F496594

General Info

Members Datasets Scaffolds Average Seq Length
2245 783 2133 130

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10003054|Ga0075368_100030542
Length 145
Sequence MKLNTIKPAEGAKHAKRRGHKGQKSRAGGFHKVGFEGGQMPLQRRLPKRGFSSLTREFVAEVRLDELERLEATDITLDVLKAAGVVPVLTIRAKVILSGKLARKVALSAGVIATKGAKSAVEAAGGSVAEVVVKPVERKLKAKAK

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
15 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
16 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
17 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
18 2519103095 Burkholderia sp. KJ006 Isolate Nodule
19 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
20 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
21 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
22 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
23 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
24 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
25 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
26 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
27 2643221556 Massilia sp. Root1485 Isolate Unclassified
28 2643221621 Achromobacter sp. Root83 Isolate Unclassified
29 2643221638 Duganella sp. Root336D2 Isolate Unclassified
30 2643221645 Massilia sp. Root351 Isolate Unclassified
31 2643221664 Massilia sp. Root418 Isolate Unclassified
32 2643221684 Massilia sp. Root133 Isolate Unclassified
33 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
34 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
35 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
36 2738541280 Massilia sp. GV090 Isolate Unclassified
37 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
38 2738541297 Duganella sp. GV083 Isolate Unclassified
39 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
40 2738541300 Massilia sp. GV016 Isolate Unclassified
41 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
42 2738541357 Duganella sp. GV053 Isolate Unclassified
43 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
44 2738543003 Duganella sp. GV066 Isolate Unclassified
45 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
46 2738543018 Massilia sp. GV045 Isolate Unclassified
47 2738543026 Duganella sp. GV089 Isolate Unclassified
48 2738543029 Duganella sp. GV039 Isolate Unclassified
49 2738543030 Massilia sp. GV097 Isolate Unclassified
50 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
51 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
52 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
53 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
54 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
55 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
56 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
57 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
58 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
59 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
60 2818991450 Burkholderia sp. 604 Isolate Unclassified
61 2818991452 Burkholderia cepacia 561 Isolate Unclassified
62 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
63 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
64 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
65 2842711865 Duganella sp. R-73148 Isolate Unclassified
66 2855730933 Achromobacter sp. HZ28 Isolate Nodule
67 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
68 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
69 2857553236 Duganella sp. R-74557 Isolate Unclassified
70 2857558681 Duganella sp. R-74565 Isolate Unclassified
71 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
72 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
73 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
74 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
75 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
76 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
77 2904424332 Duganella sp. 1411 Isolate Rhizosphere
78 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
79 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
80 2904564687 Burkholderia sp. 571 Isolate Unclassified
81 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
82 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
83 2919476304 Duganella sp. 3397 Isolate Unclassified
84 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
85 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
86 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
87 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
88 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
89 2928163908 Burkholderia sp. 567 Isolate Unclassified
90 2928170801 Burkholderia sp. 572 Isolate Unclassified
91 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
92 2928536128 Burkholderia sola 565 Isolate Unclassified
93 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
94 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
95 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
96 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
97 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
98 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
99 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
100 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
101 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
102 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
103 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
104 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
105 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
106 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
107 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
108 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
109 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
110 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
111 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
112 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
113 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
114 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
115 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
119 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
120 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
121 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
122 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
123 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
124 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
125 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
126 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
127 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
128 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
129 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
130 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
131 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
132 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
133 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
134 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
135 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
137 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
138 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
139 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
140 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
141 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
142 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
143 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
144 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
145 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
146 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
147 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
148 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
149 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
150 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
151 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
152 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
153 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
154 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
155 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
157 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
158 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
159 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
160 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
161 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
162 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
163 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
171 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
172 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
173 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
174 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
178 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
179 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
180 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
181 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
182 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
183 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
184 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
185 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
186 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
187 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
188 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
189 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
190 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
191 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
192 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
193 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
194 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
195 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
196 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
197 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
198 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
199 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
200 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
201 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
202 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
203 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
204 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
205 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
206 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
207 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
208 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
209 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
210 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
211 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
212 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
213 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
214 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
215 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
216 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
217 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
218 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
219 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
220 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
221 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
222 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
223 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
224 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
225 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
226 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
227 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
228 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
229 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
230 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
231 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
232 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
234 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
235 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
236 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
237 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
238 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
239 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
240 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
241 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
242 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
243 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
244 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
245 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
247 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
248 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
249 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
250 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
251 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
252 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
253 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
254 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
255 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
256 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
257 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
258 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
259 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
260 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
261 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
262 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
265 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
266 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
267 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
268 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
269 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
270 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
271 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
272 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
274 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
276 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
277 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
284 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
285 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
287 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
288 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
291 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
292 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
293 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
296 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
297 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
299 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
356 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
358 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
359 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
361 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
364 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
365 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
366 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
367 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
368 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
369 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
370 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
371 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
372 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
373 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
374 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
375 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
376 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
377 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
383 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
384 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
385 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
386 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
387 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
388 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
389 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
390 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
391 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
392 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
393 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
394 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
395 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
396 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
397 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
398 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
400 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
401 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
402 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
403 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
404 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
405 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
406 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
407 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
408 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
409 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
411 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
412 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
415 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
416 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
417 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
418 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
419 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
420 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
421 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
422 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
423 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
424 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
425 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
426 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
427 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
428 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
429 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
430 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
431 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
432 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
433 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
434 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
435 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
436 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
437 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
438 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
439 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
440 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
441 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
442 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
443 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
444 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
445 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
446 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
447 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
448 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
449 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
450 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
451 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
452 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
453 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
454 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
455 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
456 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
457 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
458 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
459 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
460 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
461 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
462 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
463 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
464 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
465 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
466 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
467 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
468 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
469 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
470 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
471 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
472 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
473 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
474 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
475 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
476 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
477 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
478 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
479 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
480 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
481 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
482 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
483 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
484 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
485 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
486 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
487 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
488 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
489 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
490 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
491 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
492 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
493 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
494 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
495 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
496 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
497 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
498 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
499 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
500 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
501 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
502 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
503 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
504 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
505 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
506 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
507 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
508 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
509 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
510 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
511 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
512 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
513 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
514 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
515 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
516 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
517 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
518 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
519 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
520 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
521 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
522 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
523 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
524 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
525 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
526 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
527 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
528 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
529 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
530 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
531 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
532 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
533 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
534 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
535 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
536 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
537 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
538 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
539 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
540 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
541 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
542 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
543 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
544 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
545 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
546 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
547 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
548 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
549 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
550 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
551 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
552 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
553 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
554 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
555 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
556 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
557 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
558 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
559 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
560 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
561 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
562 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
563 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
564 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
565 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
566 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
567 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
568 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
569 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
570 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
571 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
572 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
573 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
574 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
575 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
576 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
577 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
578 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
579 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
580 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
581 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
582 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
583 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
584 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
585 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
586 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
587 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
588 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
589 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
590 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
591 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
592 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
593 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
594 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
595 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
596 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
597 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
598 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
599 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
600 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
601 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
602 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
603 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
604 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
605 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
606 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
611 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
612 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
613 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
614 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
615 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
616 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
617 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
618 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
619 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
620 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
621 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
622 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
623 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
624 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
625 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
626 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
627 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
628 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
629 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
630 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
631 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
632 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
633 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
642 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
643 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
644 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
645 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
646 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
667 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
668 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
669 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
670 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
671 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
672 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
673 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
674 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
677 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
678 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
679 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
680 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
681 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
682 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
683 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
684 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
685 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
686 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
687 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
688 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
689 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
690 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
691 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
692 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
693 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
694 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
695 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
696 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
697 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
698 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
699 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
700 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
701 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
702 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
703 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
704 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
705 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
706 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
707 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
708 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
709 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
710 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
711 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
712 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
713 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
714 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
715 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
716 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
717 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
718 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
719 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
720 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
721 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
722 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
723 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
724 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
725 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
726 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
727 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
728 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
733 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
735 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
736 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
737 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
738 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
739 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
740 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
741 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
742 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
743 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
744 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
745 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
746 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
747 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
748 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
749 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
750 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
751 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
752 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
753 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
754 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
755 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
756 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
757 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
758 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
759 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
760 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
761 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
762 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
763 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
764 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
765 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
766 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
767 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
768 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
769 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
770 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
771 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
772 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
773 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
774 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
775 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
776 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
777 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
778 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
779 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
780 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
781 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
782 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
783 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.63
Metatranscriptomes 12.38
Isolates 4.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 1.2
Rhizoplane 4.14
Rhizosphere 77.15
Stem 0
Stem Tuber 0
Unclassified 8.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000961 3300001904 Bacteria 5319
2 JGI24736J21556_1014262 3300001904 Bacteria 1278
3 JGI24741J21665_1000624 3300001915 Bacteria 10681
4 JGI24741J21665_1002145 3300001915 Bacteria 5249
5 JGI24740J21852_10008508 3300001979 Bacteria 4085
6 JGI24740J21852_10010715 3300001979 Bacteria 3517
7 JGI24740J21852_10022184 3300001979 Bacteria 2190
8 JGI24739J22299_10010870 3300001989 Bacteria 3368
9 JGI24739J22299_10015549 3300001989 Bacteria 2765
10 JGI24739J22299_10028555 3300001989 Bacteria 1945
11 JGI24739J22299_10040738 3300001989 Bacteria 1549
12 JGI24737J22298_10004674 3300001990 Bacteria 4762
13 JGI24737J22298_10008370 3300001990 Bacteria 3466
14 JGI24737J22298_10022836 3300001990 Bacteria 1987
15 JGI24737J22298_10027585 3300001990 Bacteria 1790
16 JGI24735J21928_10002193 3300002067 Bacteria 6859
17 JGI24735J21928_10011144 3300002067 Bacteria 2855
18 JGI24735J21928_10014430 3300002067 Bacteria 2475
19 JGI24735J21928_10019381 3300002067 Bacteria 2091
20 JGI24738J21930_10006803 3300002075 Bacteria 2657
21 JGI25155J39150_1007058 3300002704 Bacteria 522
22 JGI25156J39149_1006223 3300002705 Bacteria 3295
23 JGI25156J39149_1012871 3300002705 Bacteria 1811
24 JGI25156J39149_1014425 3300002705 Bacteria 1629
25 JGI25156J39149_1016459 3300002705 Bacteria 1437
26 JGI25156J39149_1020451 3300002705 Bacteria 1164
27 JGI25156J39149_1033188 3300002705 Bacteria 756
28 JGI25154J39366_1000303 3300002738 Bacteria 29179
29 JGI25154J39366_1001042 3300002738 Bacteria 11063
30 JGI25158J39367_1000542 3300002739 Bacteria 7614
31 JGI25152J39213_1013037 3300002773 Bacteria 1750
32 JGI25150J39212_1001923 3300002774 Bacteria 5456
33 JGI25150J39212_1003501 3300002774 Bacteria 3664
34 Ga0006763J43179_104166 3300002870 Bacteria 5040
35 JGI25159J45721_1005729 3300002987 Bacteria 3846
36 JGI25159J45721_1006200 3300002987 Bacteria 3618
37 Ga0006765J45826_105454 3300003161 Bacteria 4839
38 Ga0006765J45826_108890 3300003161 Bacteria 1165
39 Ga0006765J45826_116549 3300003161 Bacteria 533
40 Ga0006778J45830_1013714 3300003162 Bacteria 8778
41 Ga0006778J45830_1018992 3300003162 Bacteria 2451
42 Ga0006759J45824_1009839 3300003163 Bacteria 1691
43 Ga0006759J45824_1019440 3300003163 Bacteria 3635
44 Ga0006759J45824_1019946 3300003163 Bacteria 12757
45 Ga0006759J45824_1026311 3300003163 Bacteria 2275
46 JGI25151J46595_10000457 3300003187 Bacteria 39373
47 JGI25151J46595_10071766 3300003187 Bacteria 1044
48 JGI25151J46595_10077557 3300003187 Bacteria 976
49 JGI25406J46586_10002509 3300003203 Bacteria 8686
50 JGI25406J46586_10005813 3300003203 Bacteria 5709
51 JGI25165J46597_1001391 3300003214 Bacteria 13253
52 JGI25153J46596_10002258 3300003215 Bacteria 11225
53 Ga0006758J48902_1003546 3300003300 Bacteria 6400
54 Ga0006758J48902_1008911 3300003300 Bacteria 7674
55 Ga0006758J48902_1013469 3300003300 Bacteria 2905
56 Ga0006770J48903_1023756 3300003305 Bacteria 3863
57 Ga0006777J48905_1011571 3300003308 Bacteria 3265
58 Ga0006777J48905_1023402 3300003308 Bacteria 1830
59 JGI25160J50197_1001051 3300003354 Bacteria 14224
60 JGI25160J50197_1002367 3300003354 Bacteria 8808
61 JGI25161J50226_1003265 3300003374 Bacteria 3777
62 Ga0006556J51387_1013500 3300003479 Bacteria 15419
63 Ga0006556J51387_1016929 3300003479 Bacteria 14599
64 Ga0007417J51691_1002612 3300003544 Bacteria 14201
65 Ga0007417J51691_1012996 3300003544 Bacteria 3246
66 Ga0007417J51691_1036180 3300003544 Bacteria 1373
67 Ga0006558J51389_1019156 3300003558 Bacteria 14283
68 Ga0006558J51389_1029442 3300003558 Bacteria 4339
69 Ga0007427J51700_104412 3300003559 Bacteria 1776
70 Ga0007427J51700_116762 3300003559 Bacteria 1067
71 Ga0007427J51700_120270 3300003559 Bacteria 618
72 Ga0006560J51390_1011017 3300003565 Bacteria 19884
73 Ga0006560J51390_1020307 3300003565 Bacteria 14892
74 Ga0006554J51385_1017299 3300003567 Bacteria 14985
75 Ga0007410J51695_1004597 3300003574 Bacteria 14339
76 Ga0007410J51695_1005147 3300003574 Bacteria 1659
77 Ga0007410J51695_1012689 3300003574 Bacteria 12724
78 Ga0007410J51695_1015723 3300003574 Bacteria 3888
79 Ga0007409J51694_1002712 3300003575 Bacteria 865
80 Ga0007409J51694_1007029 3300003575 Bacteria 1871
81 Ga0007409J51694_1025202 3300003575 Bacteria 1643
82 Ga0007416J51690_1009369 3300003577 Bacteria 4951
83 Ga0007429J51699_1012288 3300003579 Bacteria 4157
84 Ga0007429J51699_1013730 3300003579 Bacteria 3438
85 Ga0007411J51799_103551 3300003611 Bacteria 13349
86 Ga0007411J51799_118133 3300003611 Bacteria 750
87 Ga0007415J51800_102854 3300003613 Bacteria 5009
88 Ga0032354_1003172 3300003693 Bacteria 6308
89 Ga0032354_1006520 3300003693 Bacteria 1872
90 Ga0032354_1013175 3300003693 Bacteria 5546
91 Ga0032354_1073470 3300003693 Bacteria 3279
92 Ga0032354_1175332 3300003693 Bacteria 524
93 Ga0006780_1003512 3300003735 Bacteria 4326
94 Ga0055539_1001132 3300003752 Bacteria 5509
95 Ga0055539_1005718 3300003752 Bacteria 1607
96 Ga0055533_1003286 3300003756 Bacteria 3303
97 Ga0055533_1003606 3300003756 Bacteria 3054
98 Ga0055533_1005127 3300003756 Bacteria 2180
99 Ga0055533_1006769 3300003756 Bacteria 1642
100 Ga0055532_1000066 3300003758 Bacteria 139987
101 Ga0055532_1000261 3300003758 Bacteria 35339
102 Ga0055532_1002406 3300003758 Bacteria 3918
103 Ga0055525_1000018 3300003759 Bacteria 393974
104 Ga0055527_1000035 3300003760 Bacteria 138481
105 Ga0055527_1000602 3300003760 Bacteria 11576
106 Ga0055535_1000046 3300003761 Bacteria 139987
107 Ga0055535_1000050 3300003761 Bacteria 138481
108 Ga0055542_1000512 3300003762 Bacteria 35339
109 Ga0055542_1001443 3300003762 Bacteria 11849
110 Ga0055542_1008179 3300003762 Bacteria 2062
111 Ga0055529_1000079 3300003763 Bacteria 149370
112 Ga0055529_1000087 3300003763 Bacteria 139975
113 Ga0055529_1000089 3300003763 Bacteria 138481
114 Ga0055529_1000804 3300003763 Bacteria 19180
115 Ga0055529_1019136 3300003763 Bacteria 856
116 Ga0055526_1008246 3300003771 Bacteria 5232
117 Ga0055526_1008253 3300003771 Bacteria 5230
118 Ga0055526_1012574 3300003771 Bacteria 3674
119 Ga0055526_1017962 3300003771 Bacteria 2668
120 Ga0055537_1000038 3300003773 Bacteria 92762
121 Ga0055537_1007557 3300003773 Bacteria 2609
122 Ga0055524_1000024 3300003775 Bacteria 217953
123 Ga0055524_1003212 3300003775 Bacteria 8017
124 Ga0055524_1038927 3300003775 Bacteria 1236
125 Ga0055534_1003773 3300003784 Bacteria 4660
126 Ga0055534_1005461 3300003784 Bacteria 3395
127 Ga0055528_1000489 3300003790 Bacteria 31350
128 Ga0055528_1012285 3300003790 Bacteria 3335
129 Ga0055528_1013311 3300003790 Bacteria 3124
130 Ga0055528_1029760 3300003790 Bacteria 1468
131 Ga0055530_10007831 3300003791 Bacteria 4408
132 Ga0055531_10006076 3300003794 Bacteria 6916
133 Ga0058692_1002213 3300003856 Bacteria 6626
134 Ga0055543_1004039 3300004625 Bacteria 4114
135 Ga0058860_10029302 3300004801 Bacteria 1277
136 Ga0058862_12800340 3300004803 Bacteria 1822
137 Ga0065165_1000504 3300005262 Bacteria 60378
138 Ga0065165_1000885 3300005262 Bacteria 38659
139 Ga0065165_1006561 3300005262 Bacteria 6061
140 Ga0065165_1043988 3300005262 Bacteria 1308
141 Ga0065714_10175573 3300005288 Bacteria 985
142 Ga0065714_10264494 3300005288 Bacteria 745
143 Ga0065712_10086127 3300005290 Bacteria 2651
144 Ga0065707_10200663 3300005295 Bacteria 1308
145 Ga0070658_10012014 3300005327 Bacteria 6954
146 Ga0070658_10028760 3300005327 Bacteria 4462
147 Ga0070658_10051816 3300005327 Bacteria 3326
148 Ga0070658_10197036 3300005327 Bacteria 1698
149 Ga0070658_10210675 3300005327 Bacteria 1642
150 Ga0070658_11224510 3300005327 Bacteria 652
151 Ga0070683_100130959 3300005329 Bacteria 2373
152 Ga0070690_100665097 3300005330 Bacteria 797
153 Ga0070670_100436011 3300005331 Bacteria 1160
154 Ga0070670_100588559 3300005331 Bacteria 995
155 Ga0070670_101020706 3300005331 Bacteria 753
156 Ga0068869_100000239 3300005334 Bacteria 28911
157 Ga0068869_100792341 3300005334 Bacteria 814
158 Ga0068869_100940796 3300005334 Bacteria 750
159 Ga0070666_10064761 3300005335 Bacteria 2479
160 Ga0070666_10851489 3300005335 Bacteria 673
161 Ga0070680_100028265 3300005336 Bacteria 4496
162 Ga0070682_100104638 3300005337 Bacteria 1875
163 Ga0070682_100335096 3300005337 Bacteria 1122
164 Ga0068868_100019350 3300005338 Bacteria 5101
165 Ga0068868_100470939 3300005338 Bacteria 1096
166 Ga0068868_100985634 3300005338 Bacteria 770
167 Ga0070660_100026003 3300005339 Bacteria 4356
168 Ga0070660_100034626 3300005339 Bacteria 3817
169 Ga0070689_101355443 3300005340 Bacteria 642
170 Ga0070691_10586771 3300005341 Bacteria 656
171 Ga0070687_100449060 3300005343 Bacteria 857
172 Ga0070661_100000276 3300005344 Bacteria 41562
173 Ga0070661_100425658 3300005344 Bacteria 1053
174 Ga0070661_100577942 3300005344 Bacteria 906
175 Ga0070661_100922623 3300005344 Bacteria 722
176 Ga0070669_100615595 3300005353 Bacteria 911
177 Ga0070669_100767176 3300005353 Bacteria 818
178 Ga0070675_100789602 3300005354 Bacteria 868
179 Ga0070671_100130518 3300005355 Bacteria 2116
180 Ga0070671_101474927 3300005355 Bacteria 602
181 Ga0070673_100420566 3300005364 Bacteria 1198
182 Ga0070688_100394510 3300005365 Bacteria 1023
183 Ga0070659_100000426 3300005366 Bacteria 31940
184 Ga0070659_100235446 3300005366 Bacteria 1514
185 Ga0070659_100755623 3300005366 Bacteria 843
186 Ga0070659_100766022 3300005366 Bacteria 838
187 Ga0070667_100263553 3300005367 Bacteria 1544
188 Ga0070694_100214288 3300005444 Bacteria 1442
189 Ga0070663_100001053 3300005455 Bacteria 15091
190 Ga0070663_100021946 3300005455 Bacteria 4257
191 Ga0070663_100434756 3300005455 Bacteria 1079
192 Ga0070663_100882448 3300005455 Bacteria 771
193 Ga0070663_101124597 3300005455 Bacteria 687
194 Ga0070678_100045788 3300005456 Bacteria 3132
195 Ga0070678_100253166 3300005456 Bacteria 1477
196 Ga0070678_100667905 3300005456 Bacteria 933
197 Ga0070662_100612492 3300005457 Bacteria 916
198 Ga0070681_10376443 3300005458 Bacteria 1330
199 Ga0070681_10446735 3300005458 Bacteria 1205
200 Ga0068867_101635410 3300005459 Bacteria 603
201 Ga0070685_11308658 3300005466 Bacteria 554
202 Ga0070706_100494586 3300005467 Bacteria 1138
203 Ga0070699_100041691 3300005518 Bacteria 3973
204 Ga0070699_100043286 3300005518 Bacteria 3897
205 Ga0070699_100085640 3300005518 Bacteria 2750
206 Ga0070679_100263732 3300005530 Bacteria 1678
207 Ga0070679_100272175 3300005530 Bacteria 1647
208 Ga0070684_100277906 3300005535 Bacteria 1534
209 Ga0068853_100029320 3300005539 Bacteria 4637
210 Ga0068853_101060371 3300005539 Bacteria 781
211 Ga0068853_101493106 3300005539 Unclassified 654
212 Ga0070672_100692733 3300005543 Bacteria 892
213 Ga0070665_100065427 3300005548 Bacteria 3647
214 Ga0070665_100442535 3300005548 Bacteria 1309
215 Ga0068855_100018349 3300005563 Bacteria 8405
216 Ga0068855_100077376 3300005563 Bacteria 3860
217 Ga0068855_100131783 3300005563 Bacteria 2854
218 Ga0068855_100257086 3300005563 Bacteria 1947
219 Ga0070664_100000018 3300005564 Bacteria 125281
220 Ga0070664_100010409 3300005564 Bacteria 7543
221 Ga0070664_100068369 3300005564 Bacteria 3037
222 Ga0070664_100142127 3300005564 Bacteria 2114
223 Ga0068857_100128424 3300005577 Bacteria 2285
224 Ga0068857_100178268 3300005577 Bacteria 1933
225 Ga0068857_100409644 3300005577 Bacteria 1262
226 Ga0068854_100000225 3300005578 Bacteria 38422
227 Ga0068854_100363057 3300005578 Bacteria 1189
228 Ga0068856_100000070 3300005614 Bacteria 95320
229 Ga0068856_100117908 3300005614 Bacteria 2655
230 Ga0068856_100155750 3300005614 Bacteria 2295
231 Ga0068852_100001513 3300005616 Bacteria 15722
232 Ga0068852_100022501 3300005616 Bacteria 5056
233 Ga0068852_100840357 3300005616 Bacteria 933
234 Ga0068864_101369740 3300005618 Bacteria 709
235 Ga0068864_102390113 3300005618 Bacteria 535
236 Ga0068866_10292215 3300005718 Bacteria 1014
237 Ga0068851_10115256 3300005834 Bacteria 1439
238 Ga0068863_100046276 3300005841 Bacteria 4129
239 Ga0068863_100532459 3300005841 Bacteria 1159
240 Ga0068858_100013226 3300005842 Bacteria 7776
241 Ga0068860_100019846 3300005843 Bacteria 6518
242 Ga0068862_100708291 3300005844 Bacteria 976
243 Ga0081539_10000142 3300005985 Bacteria 165444
244 Ga0081539_10000215 3300005985 Bacteria 135054
245 Ga0081539_10003297 3300005985 Bacteria 20197
246 Ga0075368_10003054 3300006042 Bacteria 5542
247 Ga0075363_100000856 3300006048 Bacteria 10631
248 Ga0075363_100086667 3300006048 Bacteria 1719
249 Ga0075364_10015296 3300006051 Bacteria 4757
250 Ga0075364_10316984 3300006051 Bacteria 1062
251 Ga0075362_10000565 3300006177 Bacteria 10784
252 Ga0075362_10081459 3300006177 Bacteria 1492
253 Ga0075362_10527349 3300006177 Bacteria 606
254 Ga0075367_10001881 3300006178 Bacteria 9288
255 Ga0075369_10003827 3300006186 Bacteria 5518
256 Ga0075369_10490397 3300006186 Bacteria 583
257 Ga0075366_10064801 3300006195 Bacteria 2173
258 Ga0075366_10132503 3300006195 Bacteria 1504
259 Ga0075366_10267362 3300006195 Bacteria 1044
260 Ga0075366_10332276 3300006195 Bacteria 932
261 Ga0075366_10519688 3300006195 Bacteria 736
262 Ga0097621_100165035 3300006237 Bacteria 1906
263 Ga0097621_100233100 3300006237 Bacteria 1608
264 Ga0075370_10036206 3300006353 Bacteria 2772
265 Ga0075370_10136978 3300006353 Bacteria 1430
266 Ga0075370_10154017 3300006353 Bacteria 1347
267 Ga0075370_10521963 3300006353 Bacteria 717
268 Ga0068871_100003989 3300006358 Bacteria 10207
269 Ga0075433_10131861 3300006852 Bacteria 2220
270 Ga0075433_10263794 3300006852 Bacteria 1527
271 Ga0075434_100017973 3300006871 Bacteria 6823
272 Ga0068865_100052525 3300006881 Bacteria 2825
273 Ga0068865_101583434 3300006881 Bacteria 589
274 Ga0079104_1004078 3300006946 Bacteria 6424
275 Ga0099826_10000010 3300006948 Bacteria 314346
276 Ga0099826_10000024 3300006948 Bacteria 148974
277 Ga0075435_100031259 3300007076 Bacteria 4193
278 Ga0105251_10010131 3300009011 Bacteria 5495
279 Ga0105251_10027169 3300009011 Bacteria 2906
280 Ga0105251_10039647 3300009011 Bacteria 2300
281 Ga0105251_10053947 3300009011 Bacteria 1910
282 Ga0105244_10095626 3300009036 Bacteria 1457
283 Ga0105244_10129506 3300009036 Bacteria 1218
284 Ga0105250_10050101 3300009092 Bacteria 1675
285 Ga0105250_10051084 3300009092 Bacteria 1659
286 Ga0105250_10079808 3300009092 Bacteria 1326
287 Ga0105250_10493009 3300009092 Bacteria 555
288 Ga0105240_10063879 3300009093 Bacteria 4577
289 Ga0105240_10103920 3300009093 Bacteria 3450
290 Ga0105240_10108670 3300009093 Bacteria 3360
291 Ga0105240_10407148 3300009093 Bacteria 1531
292 Ga0105240_10456788 3300009093 Bacteria 1428
293 Ga0105240_10661229 3300009093 Bacteria 1144
294 Ga0111539_10009725 3300009094 Bacteria 12138
295 Ga0111539_10063652 3300009094 Bacteria 4364
296 Ga0105245_10323321 3300009098 Bacteria 1520
297 Ga0105245_11159602 3300009098 Bacteria 820
298 Ga0105247_10248107 3300009101 Bacteria 1216
299 Ga0114129_10905627 3300009147 Bacteria 1117
300 Ga0114129_11391926 3300009147 Bacteria 866
301 Ga0105243_10006860 3300009148 Bacteria 8779
302 Ga0105243_10168772 3300009148 Bacteria 1893
303 Ga0105243_10233819 3300009148 Bacteria 1632
304 Ga0105243_10413272 3300009148 Bacteria 1256
305 Ga0105241_10021276 3300009174 Bacteria 4793
306 Ga0105241_10177715 3300009174 Bacteria 1763
307 Ga0105241_10799341 3300009174 Bacteria 869
308 Ga0105241_12077056 3300009174 Bacteria 561
309 Ga0105242_10702387 3300009176 Bacteria 990
310 Ga0105248_10010314 3300009177 Bacteria 10284
311 Ga0105248_10015430 3300009177 Bacteria 8421
312 Ga0105248_10091471 3300009177 Bacteria 3427
313 Ga0105248_10393633 3300009177 Bacteria 1560
314 Ga0105248_10562764 3300009177 Bacteria 1286
315 Ga0105248_10930503 3300009177 Bacteria 982
316 Ga0105248_11153309 3300009177 Bacteria 876
317 Ga0105237_10056847 3300009545 Bacteria 3915
318 Ga0105237_10137397 3300009545 Bacteria 2438
319 Ga0105237_10145717 3300009545 Bacteria 2363
320 Ga0105237_11052499 3300009545 Bacteria 820
321 Ga0105238_10003065 3300009551 Bacteria 16659
322 Ga0105238_10478980 3300009551 Bacteria 1244
323 Ga0105238_10910308 3300009551 Bacteria 898
324 Ga0105238_11215312 3300009551 Bacteria 778
325 Ga0105239_10057421 3300010375 Bacteria 4269
326 Ga0105239_10143140 3300010375 Bacteria 2665
327 Ga0105239_10325011 3300010375 Bacteria 1735
328 Ga0105239_11049668 3300010375 Bacteria 937
329 Ga0105246_10193299 3300011119 Bacteria 1577
330 Ga0105246_10212712 3300011119 Bacteria 1510
331 Ga0105246_10681807 3300011119 Bacteria 898
332 Ga0157318_1017671 3300012482 Bacteria 604
333 Ga0157325_1002140 3300012485 Bacteria 980
334 Ga0157341_1023988 3300012494 Bacteria 620
335 Ga0157327_1046759 3300012512 Bacteria 602
336 Ga0154012_136784 3300013059 Bacteria 2113
337 Ga0157373_10015732 3300013100 Bacteria 5524
338 Ga0157371_10036577 3300013102 Bacteria 3515
339 Ga0157371_10054196 3300013102 Bacteria 2848
340 Ga0157371_10058062 3300013102 Bacteria 2745
341 Ga0157370_10062522 3300013104 Bacteria 3530
342 Ga0157370_10069903 3300013104 Bacteria 3316
343 Ga0157370_10872950 3300013104 Bacteria 817
344 Ga0157369_10078496 3300013105 Bacteria 3537
345 Ga0157369_10088073 3300013105 Bacteria 3314
346 Ga0157369_10088210 3300013105 Bacteria 3311
347 Ga0157369_10093282 3300013105 Bacteria 3214
348 Ga0157369_10188597 3300013105 Bacteria 2167
349 Ga0157369_10450338 3300013105 Bacteria 1333
350 Ga0157374_10000466 3300013296 Bacteria 36782
351 Ga0157374_10032559 3300013296 Bacteria 4748
352 Ga0157374_10069107 3300013296 Bacteria 3325
353 Ga0157374_10130817 3300013296 Bacteria 2429
354 Ga0157378_10027087 3300013297 Bacteria 5057
355 Ga0157378_10097687 3300013297 Bacteria 2677
356 Ga0157378_10140170 3300013297 Bacteria 2245
357 Ga0157378_12622117 3300013297 Bacteria 556
358 Ga0163162_10076123 3300013306 Bacteria 3417
359 Ga0163162_10086678 3300013306 Bacteria 3209
360 Ga0163162_11126646 3300013306 Bacteria 889
361 Ga0163162_11245599 3300013306 Bacteria 845
362 Ga0157372_10023322 3300013307 Bacteria 6707
363 Ga0157372_10381065 3300013307 Bacteria 1643
364 Ga0157372_11235545 3300013307 Bacteria 863
365 Ga0157375_10099540 3300013308 Bacteria 2987
366 Ga0157375_10411520 3300013308 Bacteria 1519
367 Ga0157375_10514513 3300013308 Bacteria 1360
368 Ga0157375_11027771 3300013308 Bacteria 963
369 Ga0157375_12256222 3300013308 Bacteria 649
370 Ga0163163_10694503 3300014325 Bacteria 1081
371 Ga0163163_10812622 3300014325 Bacteria 998
372 Ga0182008_10003186 3300014497 Bacteria 10028
373 Ga0182008_10079122 3300014497 Bacteria 1617
374 Ga0157376_10069893 3300014969 Bacteria 2979
375 Ga0157376_10493710 3300014969 Bacteria 1202
376 Ga0157376_11933336 3300014969 Bacteria 627
377 Ga0157376_12048211 3300014969 Bacteria 610
378 Ga0182006_1000240 3300015261 Bacteria 51334
379 Ga0182006_1009882 3300015261 Bacteria 4266
380 Ga0182006_1041809 3300015261 Bacteria 1798
381 Ga0182006_1235790 3300015261 Bacteria 602
382 Ga0182007_10012896 3300015262 Bacteria 3204
383 Ga0182007_10021036 3300015262 Bacteria 2322
384 Ga0182007_10039882 3300015262 Bacteria 1569
385 Ga0182005_1000016 3300015265 Bacteria 346889
386 Ga0183361_10015 3300016635 Bacteria 166772
387 Ga0184593_113785 3300019179 Bacteria 1316
388 Ga0184594_128061 3300019181 Bacteria 2351
389 Ga0197907_10133130 3300020069 Bacteria 3203
390 Ga0197907_11250558 3300020069 Bacteria 757
391 Ga0206356_10498037 3300020070 Bacteria 8711
392 Ga0206356_10847300 3300020070 Bacteria 1439
393 Ga0206355_1030836 3300020076 Bacteria 4092
394 Ga0206355_1157373 3300020076 Bacteria 1847
395 Ga0206355_1331117 3300020076 Bacteria 1480
396 Ga0206355_1594134 3300020076 Bacteria 852
397 Ga0206355_1647216 3300020076 Bacteria 1384
398 Ga0206351_10165518 3300020077 Bacteria 2290
399 Ga0206351_10211974 3300020077 Bacteria 1162
400 Ga0206352_11278378 3300020078 Bacteria 1040
401 Ga0206350_10425581 3300020080 Bacteria 3340
402 Ga0206350_10705675 3300020080 Bacteria 3953
403 Ga0206350_11246990 3300020080 Bacteria 2177
404 Ga0206354_10086599 3300020081 Bacteria 3665
405 Ga0206354_11361223 3300020081 Bacteria 3291
406 Ga0206354_11564442 3300020081 Bacteria 2672
407 Ga0206353_10280775 3300020082 Bacteria 2088
408 Ga0206353_10343767 3300020082 Bacteria 2679
409 Ga0206353_11104472 3300020082 Bacteria 2372
410 Ga0154015_1522148 3300020610 Bacteria 1971
411 Ga0154015_1692537 3300020610 Bacteria 4101
412 Ga0213872_10010693 3300021361 Bacteria 4359
413 Ga0213872_10047302 3300021361 Bacteria 1956
414 Ga0213872_10332396 3300021361 Bacteria 626
415 Ga0224712_10002193 3300022467 Bacteria 4763
416 Ga0224712_10060966 3300022467 Bacteria 1503
417 Ga0224712_10125668 3300022467 Bacteria 1115
418 Ga0247514_106419 3300023560 Bacteria 1381
419 Ga0209436_100401 3300025208 Bacteria 19545
420 Ga0209784_100052 3300025224 Bacteria 182783
421 Ga0209784_103737 3300025224 Bacteria 1213
422 Ga0209566_100068 3300025225 Bacteria 177484
423 Ga0209566_100801 3300025225 Bacteria 16448
424 Ga0209566_102355 3300025225 Bacteria 3595
425 Ga0209566_108979 3300025225 Bacteria 1059
426 Ga0209674_100087 3300025226 Bacteria 182783
427 Ga0209674_100153 3300025226 Bacteria 94333
428 Ga0209674_102800 3300025226 Bacteria 3515
429 Ga0209674_103913 3300025226 Bacteria 2577
430 Ga0209674_105404 3300025226 Bacteria 1893
431 Ga0209672_100073 3300025228 Bacteria 166621
432 Ga0209672_100276 3300025228 Bacteria 37317
433 Ga0209672_100383 3300025228 Bacteria 26965
434 Ga0209672_102256 3300025228 Bacteria 4964
435 Ga0209672_102285 3300025228 Bacteria 4911
436 Ga0209672_116278 3300025228 Bacteria 813
437 Ga0209147_100090 3300025229 Bacteria 176176
438 Ga0209147_100093 3300025229 Bacteria 167196
439 Ga0209147_102318 3300025229 Bacteria 4911
440 Ga0209563_100011 3300025230 Bacteria 1187808
441 Ga0209563_100373 3300025230 Bacteria 16406
442 Ga0209563_100470 3300025230 Bacteria 13814
443 Ga0209563_119837 3300025230 Bacteria 765
444 Ga0207427_100807 3300025231 Bacteria 14176
445 Ga0209437_103924 3300025233 Bacteria 2645
446 Ga0209258_100130 3300025242 Bacteria 176078
447 Ga0209258_100140 3300025242 Bacteria 167245
448 Ga0209258_102394 3300025242 Bacteria 4911
449 Ga0209258_103856 3300025242 Bacteria 3054
450 Ga0207425_1000021 3300025245 Bacteria 367537
451 Ga0207425_1000845 3300025245 Bacteria 15112
452 Ga0207425_1000932 3300025245 Bacteria 13905
453 Ga0209646_1000068 3300025246 Bacteria 233765
454 Ga0209646_1000119 3300025246 Bacteria 147427
455 Ga0209677_100043 3300025253 Bacteria 222331
456 Ga0209677_107281 3300025253 Bacteria 2389
457 Ga0209148_1000119 3300025254 Bacteria 188079
458 Ga0209148_1000140 3300025254 Bacteria 166819
459 Ga0209148_1000444 3300025254 Bacteria 45400
460 Ga0209148_1001671 3300025254 Bacteria 9966
461 Ga0209759_1001723 3300025256 Bacteria 11286
462 Ga0209759_1004738 3300025256 Bacteria 4974
463 Ga0209759_1008563 3300025256 Bacteria 3175
464 Ga0209759_1010191 3300025256 Bacteria 2773
465 Ga0209759_1012475 3300025256 Bacteria 2352
466 Ga0209759_1014574 3300025256 Bacteria 2071
467 Ga0209759_1014581 3300025256 Bacteria 2071
468 Ga0209759_1026805 3300025256 Bacteria 1201
469 Ga0209129_1000020 3300025258 Bacteria 457053
470 Ga0209233_1000173 3300025261 Bacteria 145995
471 Ga0209565_1000123 3300025263 Bacteria 111069
472 Ga0209565_1001042 3300025263 Bacteria 14043
473 Ga0209565_1003095 3300025263 Bacteria 5581
474 Ga0209455_1000070 3300025272 Bacteria 307867
475 Ga0209455_1000119 3300025272 Bacteria 174994
476 Ga0209455_1000125 3300025272 Bacteria 166819
477 Ga0209455_1000244 3300025272 Bacteria 67136
478 Ga0209455_1001216 3300025272 Bacteria 12270
479 Ga0209673_1000040 3300025273 Bacteria 312633
480 Ga0209673_1000098 3300025273 Bacteria 193352
481 Ga0209673_1004818 3300025273 Bacteria 7072
482 Ga0209673_1112596 3300025273 Bacteria 567
483 Ga0209130_1000290 3300025284 Bacteria 61271
484 Ga0209130_1002182 3300025284 Bacteria 10312
485 Ga0209675_1000117 3300025291 Bacteria 111087
486 Ga0209675_1002785 3300025291 Bacteria 8724
487 Ga0209025_1000039 3300025294 Bacteria 377396
488 Ga0209025_1011110 3300025294 Bacteria 5993
489 Ga0209564_1000027 3300025295 Bacteria 518458
490 Ga0209564_1000047 3300025295 Bacteria 368031
491 Ga0209564_1000121 3300025295 Bacteria 204081
492 Ga0209564_1002740 3300025295 Bacteria 13260
493 Ga0209564_1006738 3300025295 Bacteria 6100
494 Ga0209564_1032951 3300025295 Bacteria 1549
495 Ga0209564_1041569 3300025295 Bacteria 1231
496 Ga0209758_1000077 3300025297 Bacteria 268195
497 Ga0209758_1000322 3300025297 Bacteria 92458
498 Ga0209050_1000050 3300025298 Bacteria 362578
499 Ga0209050_1002922 3300025298 Bacteria 13390
500 Ga0209256_1000054 3300025299 Bacteria 298431
501 Ga0209256_1001933 3300025299 Bacteria 18898
502 Ga0209256_1002719 3300025299 Bacteria 13723
503 Ga0209256_1024911 3300025299 Bacteria 1753
504 Ga0209256_1058574 3300025299 Bacteria 905
505 Ga0207426_1000199 3300025302 Bacteria 145826
506 Ga0207426_1000802 3300025302 Bacteria 34010
507 Ga0207426_1010681 3300025302 Bacteria 3549
508 Ga0207426_1047907 3300025302 Bacteria 1287
509 Ga0209051_1052723 3300025303 Bacteria 1341
510 Ga0209051_1053753 3300025303 Bacteria 1320
511 Ga0209257_1000075 3300025304 Bacteria 324855
512 Ga0207656_10080640 3300025321 Bacteria 1462
513 Ga0207656_10187581 3300025321 Bacteria 995
514 Ga0207696_1020741 3300025711 Bacteria 2112
515 Ga0207696_1166247 3300025711 Bacteria 586
516 Ga0207696_1181955 3300025711 Bacteria 555
517 Ga0207655_1000499 3300025728 Bacteria 50341
518 Ga0207713_1004623 3300025735 Bacteria 8892
519 Ga0207713_1005407 3300025735 Bacteria 7998
520 Ga0207713_1023386 3300025735 Bacteria 2909
521 Ga0207710_10161546 3300025900 Bacteria 1092
522 Ga0207680_10163642 3300025903 Bacteria 1494
523 Ga0207680_10716637 3300025903 Bacteria 717
524 Ga0207647_10004870 3300025904 Bacteria 9917
525 Ga0207647_10007364 3300025904 Bacteria 7955
526 Ga0207647_10104384 3300025904 Bacteria 1680
527 Ga0207643_10273624 3300025908 Bacteria 1046
528 Ga0207705_10004265 3300025909 Bacteria 10829
529 Ga0207705_10011628 3300025909 Bacteria 6360
530 Ga0207705_10060061 3300025909 Bacteria 2745
531 Ga0207705_10103487 3300025909 Bacteria 2097
532 Ga0207705_10122104 3300025909 Bacteria 1934
533 Ga0207684_10223837 3300025910 Bacteria 1624
534 Ga0207684_10567778 3300025910 Bacteria 970
535 Ga0207654_10002111 3300025911 Bacteria 10175
536 Ga0207654_10090331 3300025911 Bacteria 1865
537 Ga0207654_10395591 3300025911 Bacteria 960
538 Ga0207654_10496717 3300025911 Bacteria 861
539 Ga0207695_10008376 3300025913 Bacteria 12952
540 Ga0207695_10027074 3300025913 Bacteria 6388
541 Ga0207695_10035527 3300025913 Bacteria 5403
542 Ga0207695_10227793 3300025913 Bacteria 1769
543 Ga0207695_10246637 3300025913 Bacteria 1686
544 Ga0207695_10269527 3300025913 Bacteria 1598
545 Ga0207695_11012665 3300025913 Bacteria 710
546 Ga0207695_11263733 3300025913 Bacteria 619
547 Ga0207671_10004456 3300025914 Bacteria 13379
548 Ga0207671_10201201 3300025914 Bacteria 1556
549 Ga0207671_10215175 3300025914 Bacteria 1504
550 Ga0207660_10011879 3300025917 Bacteria 5680
551 Ga0207662_10615472 3300025918 Bacteria 756
552 Ga0207657_10014049 3300025919 Bacteria 7833
553 Ga0207657_10030110 3300025919 Bacteria 4931
554 Ga0207657_10044711 3300025919 Bacteria 3891
555 Ga0207657_10377992 3300025919 Bacteria 1116
556 Ga0207649_10000490 3300025920 Bacteria 28067
557 Ga0207649_10023804 3300025920 Bacteria 3551
558 Ga0207652_10090095 3300025921 Bacteria 2694
559 Ga0207652_10434543 3300025921 Bacteria 1184
560 Ga0207646_10808223 3300025922 Bacteria 835
561 Ga0207694_10002733 3300025924 Bacteria 14269
562 Ga0207694_10045423 3300025924 Bacteria 3393
563 Ga0207694_10100374 3300025924 Bacteria 2293
564 Ga0207694_10108713 3300025924 Bacteria 2204
565 Ga0207650_10291854 3300025925 Bacteria 1330
566 Ga0207659_10648536 3300025926 Bacteria 902
567 Ga0207687_10187681 3300025927 Bacteria 1606
568 Ga0207687_10444164 3300025927 Bacteria 1075
569 Ga0207664_11036144 3300025929 Bacteria 735
570 Ga0207644_10095363 3300025931 Bacteria 2225
571 Ga0207644_10560838 3300025931 Bacteria 946
572 Ga0207690_10000040 3300025932 Bacteria 130300
573 Ga0207690_10048382 3300025932 Bacteria 2827
574 Ga0207690_10182111 3300025932 Bacteria 1583
575 Ga0207690_10375638 3300025932 Bacteria 1129
576 Ga0207690_10619049 3300025932 Bacteria 885
577 Ga0207690_10823820 3300025932 Bacteria 768
578 Ga0207706_10008025 3300025933 Bacteria 9741
579 Ga0207686_10724498 3300025934 Bacteria 792
580 Ga0207709_10001005 3300025935 Bacteria 20902
581 Ga0207709_10020009 3300025935 Bacteria 3772
582 Ga0207709_10115312 3300025935 Bacteria 1804
583 Ga0207704_10176248 3300025938 Bacteria 1540
584 Ga0207704_10836131 3300025938 Bacteria 771
585 Ga0207704_11259073 3300025938 Bacteria 632
586 Ga0207711_10057542 3300025941 Bacteria 3342
587 Ga0207711_10105192 3300025941 Bacteria 2502
588 Ga0207711_10582575 3300025941 Bacteria 1044
589 Ga0207711_10745958 3300025941 Bacteria 913
590 Ga0207689_10000370 3300025942 Bacteria 42422
591 Ga0207689_10056742 3300025942 Bacteria 3223
592 Ga0207689_10943752 3300025942 Bacteria 728
593 Ga0207689_10951974 3300025942 Bacteria 724
594 Ga0207679_10000032 3300025945 Bacteria 158845
595 Ga0207679_10108686 3300025945 Bacteria 2184
596 Ga0207679_10237693 3300025945 Bacteria 1542
597 Ga0207679_11677414 3300025945 Bacteria 582
598 Ga0207667_10006131 3300025949 Bacteria 14607
599 Ga0207667_10009212 3300025949 Bacteria 11656
600 Ga0207667_10015897 3300025949 Bacteria 8521
601 Ga0207667_10128204 3300025949 Bacteria 2613
602 Ga0207667_10384789 3300025949 Bacteria 1429
603 Ga0207651_10446093 3300025960 Bacteria 1109
604 Ga0207651_10469680 3300025960 Bacteria 1082
605 Ga0207651_10764166 3300025960 Bacteria 855
606 Ga0207668_11173430 3300025972 Bacteria 690
607 Ga0207640_10001991 3300025981 Bacteria 11019
608 Ga0207640_10022226 3300025981 Bacteria 3792
609 Ga0207658_10165595 3300025986 Bacteria 1816
610 Ga0207658_10257424 3300025986 Bacteria 1486
611 Ga0207658_11175935 3300025986 Bacteria 701
612 Ga0207677_10006249 3300026023 Bacteria 6514
613 Ga0207703_10041315 3300026035 Bacteria 3694
614 Ga0207678_10000024 3300026067 Bacteria 125239
615 Ga0207678_10003236 3300026067 Bacteria 14714
616 Ga0207678_10043906 3300026067 Bacteria 3867
617 Ga0207678_10238626 3300026067 Bacteria 1557
618 Ga0207678_10248922 3300026067 Bacteria 1522
619 Ga0207678_10381905 3300026067 Bacteria 1218
620 Ga0207702_10000973 3300026078 Bacteria 29351
621 Ga0207702_10185671 3300026078 Bacteria 1917
622 Ga0207641_10789388 3300026088 Bacteria 939
623 Ga0207648_10002176 3300026089 Bacteria 21281
624 Ga0207648_10873460 3300026089 Bacteria 839
625 Ga0207676_10231338 3300026095 Bacteria 1653
626 Ga0207676_10813761 3300026095 Bacteria 912
627 Ga0207676_11424445 3300026095 Bacteria 689
628 Ga0207674_10003250 3300026116 Bacteria 20001
629 Ga0207674_10033169 3300026116 Bacteria 5406
630 Ga0207674_10173522 3300026116 Bacteria 2109
631 Ga0207675_101338134 3300026118 Bacteria 737
632 Ga0207683_10065088 3300026121 Bacteria 3213
633 Ga0207683_10148309 3300026121 Bacteria 2116
634 Ga0207683_10228973 3300026121 Bacteria 1694
635 Ga0207683_10351656 3300026121 Bacteria 1352
636 Ga0207683_10505174 3300026121 Bacteria 1117
637 Ga0207698_10017410 3300026142 Bacteria 4874
638 Ga0207698_10023299 3300026142 Bacteria 4323
639 Ga0207698_10790935 3300026142 Bacteria 950
640 Ga0207698_11334281 3300026142 Bacteria 732
641 Ga0209281_1002282 3300027111 Bacteria 8082
642 Ga0209371_1000325 3300027312 Bacteria 52216
643 Ga0209371_1000766 3300027312 Bacteria 26728
644 Ga0209371_1003600 3300027312 Bacteria 7407
645 Ga0209282_1000032 3300027666 Bacteria 149218
646 Ga0209282_1000072 3300027666 Bacteria 81137
647 Ga0209813_10001024 3300027866 Bacteria 6287
648 Ga0209974_10092867 3300027876 Bacteria 1048
649 Ga0207428_10008382 3300027907 Bacteria 9335
650 Ga0268266_10117830 3300028379 Bacteria 2360
651 Ga0268265_10565558 3300028380 Bacteria 1081
652 Ga0268265_10897546 3300028380 Bacteria 870
653 Ga0265336_10000618 3300028666 Bacteria 19547
654 Ga0307515_10067022 3300028794 Bacteria 4959
655 Ga0307515_10084890 3300028794 Bacteria 4059
656 Ga0307515_10119204 3300028794 Bacteria 3004
657 Ga0307515_10276308 3300028794 Bacteria 1393
658 Ga0265338_10004608 3300028800 Bacteria 18530
659 Ga0265338_10005463 3300028800 Bacteria 16588
660 Ga0265324_10000002 3300029957 Bacteria 382754
661 Ga0265324_10000500 3300029957 Bacteria 27131
662 Ga0268256_1001275 3300030500 Bacteria 15647
663 Ga0268256_1002981 3300030500 Bacteria 8011
664 Ga0307512_10116329 3300030522 Bacteria 1738
665 Ga0316176_1210209 3300030732 Bacteria 1192
666 Ga0314311_1150818 3300030733 Bacteria 1473
667 Ga0316179_1017842 3300030734 Bacteria 1012
668 Ga0316178_1040944 3300030735 Bacteria 1141
669 Ga0316180_1026989 3300030736 Bacteria 4122
670 Ga0316183_1084783 3300030742 Bacteria 1538
671 Ga0316181_1091528 3300030744 Bacteria 717
672 Ga0316182_1108504 3300030745 Bacteria 3080
673 Ga0316182_1184435 3300030745 Bacteria 617
674 Ga0316182_1433823 3300030745 Bacteria 630
675 Ga0265767_100009 3300030836 Bacteria 6118
676 Ga0265766_1000099 3300030863 Bacteria 2843
677 Ga0265766_1000407 3300030863 Bacteria 1830
678 Ga0265766_1000435 3300030863 Bacteria 1791
679 Ga0265766_1000731 3300030863 Bacteria 1481
680 Ga0265766_1003268 3300030863 Bacteria 938
681 Ga0265769_100464 3300030888 Bacteria 1672
682 Ga0265769_100729 3300030888 Bacteria 1415
683 Ga0265769_102846 3300030888 Bacteria 932
684 Ga0265769_113786 3300030888 Bacteria 586
685 Ga0265768_100424 3300030963 Bacteria 1645
686 Ga0265773_1008002 3300031018 Bacteria 838
687 Ga0265328_10003595 3300031239 Bacteria 6839
688 Ga0265331_10000050 3300031250 Bacteria 181286
689 Ga0265331_10003466 3300031250 Bacteria 10177
690 Ga0265327_10000109 3300031251 Bacteria 181275
691 Ga0265327_10000161 3300031251 Bacteria 144768
692 Ga0265327_10000178 3300031251 Bacteria 135732
693 Ga0265327_10009306 3300031251 Bacteria 7110
694 Ga0265327_10028075 3300031251 Bacteria 3226
695 Ga0265327_10098857 3300031251 Bacteria 1411
696 Ga0265316_10067921 3300031344 Bacteria 2756
697 Ga0265316_10182264 3300031344 Bacteria 1563
698 Ga0265316_10503563 3300031344 Bacteria 865
699 Ga0307513_10011808 3300031456 Bacteria 10825
700 Ga0307513_10124367 3300031456 Bacteria 2539
701 Ga0307513_10769558 3300031456 Bacteria 668
702 Ga0307509_10109747 3300031507 Bacteria 2767
703 Ga0307509_10192810 3300031507 Bacteria 1886
704 Ga0307509_10286613 3300031507 Bacteria 1404
705 Ga0307408_100000089 3300031548 Bacteria 100712
706 Ga0307408_100001167 3300031548 Bacteria 19940
707 Ga0307408_100004683 3300031548 Bacteria 9240
708 Ga0307408_100292357 3300031548 Bacteria 1361
709 Ga0307408_100297420 3300031548 Bacteria 1350
710 Ga0307408_100477718 3300031548 Bacteria 1087
711 Ga0307408_100820655 3300031548 Bacteria 845
712 Ga0316575_10000771 3300031665 Bacteria 9685
713 Ga0316575_10038338 3300031665 Bacteria 1890
714 Ga0310111_101033 3300031667 Bacteria 2830
715 Ga0310111_122416 3300031667 Bacteria 763
716 Ga0316579_10026608 3300031691 Bacteria 2621
717 Ga0265314_10158374 3300031711 Bacteria 1381
718 Ga0316576_10029129 3300031727 Bacteria 3899
719 Ga0316578_10033675 3300031728 Bacteria 2937
720 Ga0307516_10583188 3300031730 Bacteria 772
721 Ga0307405_10052007 3300031731 Bacteria 2545
722 Ga0307405_10394290 3300031731 Bacteria 1082
723 Ga0307405_10964520 3300031731 Bacteria 725
724 Ga0316577_10146540 3300031733 Bacteria 1330
725 Ga0247548_101784 3300031814 Bacteria 896
726 Ga0247548_107337 3300031814 Bacteria 548
727 Ga0307518_10004256 3300031838 Bacteria 10276
728 Ga0307410_10632467 3300031852 Bacteria 896
729 Ga0307406_10400159 3300031901 Bacteria 1088
730 Ga0307406_10504504 3300031901 Bacteria 981
731 Ga0307407_10777831 3300031903 Bacteria 727
732 Ga0307412_10000056 3300031911 Bacteria 145861
733 Ga0307412_10011111 3300031911 Bacteria 5206
734 Ga0307412_10507816 3300031911 Bacteria 1005
735 Ga0307416_100002061 3300032002 Bacteria 11324
736 Ga0307416_100003624 3300032002 Bacteria 9121
737 Ga0307416_100006305 3300032002 Bacteria 7414
738 Ga0307416_100212411 3300032002 Bacteria 1847
739 Ga0307411_10233740 3300032005 Bacteria 1435
740 Ga0307411_10411105 3300032005 Bacteria 1121
741 Ga0307411_10487888 3300032005 Bacteria 1039
742 Ga0307411_10724848 3300032005 Bacteria 869
743 Ga0307411_10836349 3300032005 Bacteria 813
744 Ga0307411_11073839 3300032005 Bacteria 724
745 Ga0307415_101279947 3300032126 Bacteria 694
746 Ga0316583_10196422 3300032133 Bacteria 700
747 Ga0316580_10001102 3300032139 Bacteria 6814
748 Ga0316593_10000198 3300032168 Bacteria 9333
749 Ga0316593_10193303 3300032168 Bacteria 750
750 Ga0316593_10223821 3300032168 Bacteria 699
751 Ga0307507_10149043 3300033179 Bacteria 1767
752 Ga0307510_10228403 3300033180 Bacteria 1366
753 Ga0316592_1001786 3300033524 Bacteria 3582
754 Ga0316596_1000040 3300033541 Bacteria 13770
755 Ga0373950_0017579 3300034818 Bacteria 1233
756 Ga0373940_0012763 3300035088 Bacteria 2018
757 Ga0373940_0097521 3300035088 Bacteria 888
758 Ga0373932_0048427 3300035112 Bacteria 1252
759 Ga0373939_0000348 3300035114 Bacteria 11798
760 Ga0373960_0000482 3300035121 Bacteria 7922
761 Ga0373961_0059684 3300035241 Bacteria 1154
762 Ga0373962_0035579 3300035242 Bacteria 1383
763 Ga0316574_0003365 3300035398 Bacteria 8235
764 Ga0373931_0000535 3300035691 Bacteria 15604
765 Ga0373931_0008660 3300035691 Bacteria 4836
766 Ga0373931_0861160 3300035691 Bacteria 607
767 Ga0373947_0765701 3300035725 Bacteria 659
768 Ga0310112_026650 3300036458 Bacteria 799
769 Ga0310109_000061 3300036534 Bacteria 5065
770 Ga0310110_014822 3300036535 Bacteria 1120
771 Ga0395899_0000080 3300037312 Bacteria 171568
772 Ga0395899_0000218 3300037312 Bacteria 79718
773 Ga0395899_0005268 3300037312 Bacteria 10047
774 Ga0395899_0079277 3300037312 Bacteria 2391
775 Ga0395899_0462873 3300037312 Bacteria 828
776 Ga0395900_0000087 3300037418 Bacteria 171568
777 Ga0395900_0103484 3300037418 Bacteria 2924
778 Ga0395900_0104724 3300037418 Bacteria 2906
779 Ga0395900_0682800 3300037418 Bacteria 961
780 Ga0395900_0699378 3300037418 Bacteria 947
781 Ga0395900_1333168 3300037418 Bacteria 631
782 Ga0395900_1707164 3300037418 Bacteria 540
783 Ga0395898_0000448 3300037466 Bacteria 84953
784 Ga0395898_0004701 3300037466 Bacteria 14859
785 Ga0395898_0091559 3300037466 Bacteria 2925
786 Ga0395898_0139979 3300037466 Bacteria 2316
787 Ga0395898_1142440 3300037466 Bacteria 711
788 Ga0395898_1218083 3300037466 Bacteria 684
789 Ga0395905_0001371 3300037471 Bacteria 29596
790 Ga0395905_0002507 3300037471 Bacteria 20284
791 Ga0395905_0097862 3300037471 Bacteria 2755
792 Ga0395905_0173708 3300037471 Bacteria 2023
793 Ga0395905_0177460 3300037471 Bacteria 1999
794 Ga0395901_0000378 3300038443 Bacteria 53368
795 Ga0395901_0062325 3300038443 Bacteria 3880
796 Ga0395901_0207707 3300038443 Bacteria 2050
797 Ga0395901_0565724 3300038443 Bacteria 1150
798 Ga0395901_0798512 3300038443 Bacteria 933
799 Ga0395901_1105207 3300038443 Bacteria 763
800 Ga0395901_1341045 3300038443 Bacteria 676
801 Ga0400490_00437 3300038726 Bacteria 17578
802 Ga0400490_03371 3300038726 Bacteria 14955
803 Ga0400490_46672 3300038726 Bacteria 1597
804 Ga0400491_08907 3300038727 Bacteria 2331
805 Ga0400488_51157 3300038741 Bacteria 5303
806 Ga0400486_01341 3300038742 Bacteria 7086
807 Ga0400486_03874 3300038742 Bacteria 2575
808 Ga0400486_32640 3300038742 Bacteria 3848
809 Ga0400483_035353 3300039062 Bacteria 8181
810 Ga0400483_062435 3300039062 Bacteria 2108
811 Ga0400483_071897 3300039062 Bacteria 4924
812 Ga0400483_074535 3300039062 Bacteria 1920
813 Ga0400483_080413 3300039062 Bacteria 2696
814 Ga0400483_131418 3300039062 Bacteria 2090
815 Ga0400483_159229 3300039062 Bacteria 2986
816 Ga0400483_205660 3300039062 Bacteria 9867
817 Ga0400489_88546 3300039093 Bacteria 4330
818 Ga0436365_1248808 3300039437 Bacteria 996
819 Ga0436360_0476119 3300039438 Bacteria 2627
820 Ga0436361_0141197 3300039447 Bacteria 3173
821 Ga0436361_0378504 3300039447 Bacteria 3034
822 Ga0436361_0575526 3300039447 Bacteria 1312
823 Ga0436361_0830526 3300039447 Bacteria 3680
824 Ga0439436_0003093 3300041404 Bacteria 5043
825 Ga0439436_0101864 3300041404 Bacteria 801
826 Ga0439439_0027171 3300041406 Bacteria 1445
827 Ga0439439_0087288 3300041406 Bacteria 849
828 Ga0439439_0245793 3300041406 Bacteria 529
829 Ga0439447_063185 3300041407 Bacteria 868
830 Ga0439453_0009071 3300041408 Bacteria 1613
831 Ga0439466_0050203 3300041411 Bacteria 1368
832 Ga0439465_0010238 3300041413 Bacteria 2947
833 Ga0439465_0042679 3300041413 Bacteria 1470
834 Ga0439465_0098774 3300041413 Bacteria 1006
835 Ga0451791_0429238 3300041451 Bacteria 1115
836 Ga0451805_077998 3300041461 Bacteria 694
837 Ga0451805_100255 3300041461 Bacteria 1908
838 Ga0451835_1143204 3300041492 Bacteria 570
839 Ga0451841_0463776 3300041498 Bacteria 702
840 Ga0451850_01102 3300041506 Bacteria 709
841 Ga0451850_20986 3300041506 Bacteria 830
842 Ga0451853_0562209 3300041512 Bacteria 1045
843 Ga0452271_59633 3300041916 Bacteria 1191
844 Ga0439431_0002191 3300041997 Bacteria 4307
845 Ga0439433_0000255 3300041999 Bacteria 8970
846 Ga0439437_001479 3300042000 Bacteria 2468
847 Ga0439442_017115 3300042002 Bacteria 1496
848 Ga0439442_047946 3300042002 Bacteria 900
849 Ga0439445_0003892 3300042004 Bacteria 3360
850 Ga0439448_0000118 3300042005 Bacteria 14718
851 Ga0439448_0036301 3300042005 Bacteria 1581
852 Ga0439448_0044502 3300042005 Bacteria 1443
853 Ga0439448_0095964 3300042005 Bacteria 1004
854 Ga0439432_001484 3300042006 Bacteria 8802
855 Ga0439449_0008668 3300042007 Bacteria 3860
856 Ga0439449_0013168 3300042007 Bacteria 3111
857 Ga0439449_0098851 3300042007 Bacteria 1078
858 Ga0439452_030522 3300042010 Bacteria 1328
859 Ga0439452_091319 3300042010 Bacteria 658
860 Ga0439454_011850 3300042011 Bacteria 1172
861 Ga0439454_022677 3300042011 Bacteria 937
862 Ga0439455_0000425 3300042012 Bacteria 5666
863 Ga0439455_0026675 3300042012 Bacteria 1411
864 Ga0439455_0035150 3300042012 Bacteria 1263
865 Ga0439457_010422 3300042014 Bacteria 2137
866 Ga0450911_004506 3300042115 Bacteria 2277
867 Ga0450917_000001 3300042120 Bacteria 12228
868 Ga0450920_039592 3300042122 Bacteria 939
869 Ga0450923_056631 3300042125 Bacteria 850
870 Ga0450888_000936 3300042126 Bacteria 2776
871 Ga0450890_000549 3300042127 Bacteria 5493
872 Ga0450890_001085 3300042127 Bacteria 3967
873 Ga0450897_002592 3300042128 Bacteria 1373
874 Ga0450891_000655 3300042129 Bacteria 3612
875 Ga0450892_001248 3300042130 Bacteria 2585
876 Ga0450898_043606 3300042134 Bacteria 854
877 Ga0450902_024020 3300042137 Bacteria 1013
878 Ga0450904_002765 3300042139 Bacteria 2007
879 Ga0450904_008721 3300042139 Bacteria 1001
880 Ga0450889_000161 3300042144 Bacteria 6993
881 Ga0450907_011958 3300042146 Bacteria 1442
882 Ga0450910_017596 3300042147 Bacteria 1065
883 Ga0439446_0029603 3300042156 Bacteria 1580
884 Ga0439446_0048229 3300042156 Bacteria 1268
885 Ga0439446_0056828 3300042156 Bacteria 1176
886 Ga0439458_0009491 3300042157 Bacteria 2166
887 Ga0450909_012865 3300042185 Bacteria 1228
888 Ga0450916_001782 3300042530 Bacteria 2198
889 Ga0450893_0002428 3300042532 Bacteria 2901
890 Ga0450893_0016245 3300042532 Bacteria 1259
891 Ga0450901_013383 3300042533 Bacteria 859
892 Ga0451577_0000013 3300042876 Bacteria 550689
893 Ga0451577_0000191 3300042876 Bacteria 128991
894 Ga0451577_0056781 3300042876 Bacteria 3492
895 Ga0451577_0128321 3300042876 Bacteria 2274
896 Ga0451577_0218523 3300042876 Bacteria 1722
897 Ga0451577_0283539 3300042876 Bacteria 1501
898 Ga0451577_0286581 3300042876 Bacteria 1492
899 Ga0466969_0001722 3300044656 Bacteria 11695
900 Ga0466969_0004256 3300044656 Bacteria 7608
901 Ga0466969_0010770 3300044656 Bacteria 4844
902 Ga0466969_0011638 3300044656 Bacteria 4654
903 Ga0466969_0131244 3300044656 Bacteria 1161
904 Ga0466972_0060383 3300044658 Bacteria 1819
905 Ga0466972_0095863 3300044658 Bacteria 1405
906 Ga0466972_0154934 3300044658 Bacteria 1076
907 Ga0466972_0202782 3300044658 Bacteria 929
908 Ga0466973_0049331 3300044659 Bacteria 3901
909 Ga0466981_0147961 3300044669 Bacteria 1617
910 Ga0453683_0000059 3300044673 Bacteria 187158
911 Ga0466965_0001145 3300044683 Bacteria 10416
912 Ga0466965_0015818 3300044683 Bacteria 3584
913 Ga0466965_0063634 3300044683 Bacteria 1846
914 Ga0466965_0071942 3300044683 Bacteria 1740
915 Ga0466965_0221193 3300044683 Bacteria 1009
916 Ga0466965_0321709 3300044683 Bacteria 842
917 Ga0466965_0321710 3300044683 Bacteria 842
918 Ga0466966_0003725 3300044684 Bacteria 10048
919 Ga0466966_0059810 3300044684 Bacteria 2406
920 Ga0466966_0062883 3300044684 Bacteria 2339
921 Ga0466966_0062980 3300044684 Bacteria 2337
922 Ga0466966_0067908 3300044684 Bacteria 2238
923 Ga0466966_0093495 3300044684 Bacteria 1865
924 Ga0466961_0000296 3300044693 Bacteria 33082
925 Ga0466961_0000649 3300044693 Bacteria 21880
926 Ga0466961_0036745 3300044693 Bacteria 3143
927 Ga0466961_0053995 3300044693 Bacteria 2563
928 Ga0466961_0072863 3300044693 Bacteria 2178
929 Ga0466961_0117187 3300044693 Bacteria 1673
930 Ga0466961_0118072 3300044693 Bacteria 1666
931 Ga0466961_0335951 3300044693 Bacteria 920
932 Ga0466961_0391601 3300044693 Bacteria 843
933 Ga0466961_0800640 3300044693 Bacteria 562
934 Ga0466963_0047825 3300044694 Bacteria 2824
935 Ga0466963_0662781 3300044694 Bacteria 736
936 Ga0466964_0015332 3300044706 Bacteria 2915
937 Ga0466964_0020973 3300044706 Bacteria 2522
938 Ga0466964_0105381 3300044706 Bacteria 1249
939 Ga0453684_0000585 3300044712 Bacteria 135647
940 Ga0453684_0000590 3300044712 Bacteria 134718
941 Ga0453684_0000989 3300044712 Bacteria 92793
942 Ga0453684_0035225 3300044712 Bacteria 6924
943 Ga0453684_0065104 3300044712 Bacteria 4650
944 Ga0453684_0239607 3300044712 Bacteria 2089
945 Ga0453684_0317486 3300044712 Bacteria 1766
946 Ga0453684_0456100 3300044712 Bacteria 1422
947 Ga0453684_0860212 3300044712 Bacteria 974
948 Ga0453684_1755614 3300044712 Bacteria 632
949 Ga0466971_0000181 3300044719 Bacteria 23780
950 Ga0466971_0035698 3300044719 Bacteria 2229
951 Ga0466971_0136841 3300044719 Bacteria 1139
952 Ga0466968_0242976 3300044735 Bacteria 853
953 Ga0466968_0272311 3300044735 Bacteria 808
954 Ga0466968_0282713 3300044735 Bacteria 794
955 Ga0466970_0002988 3300044765 Bacteria 8198
956 Ga0466970_0015188 3300044765 Bacteria 3960
957 Ga0466970_0070556 3300044765 Bacteria 1878
958 Ga0466970_0178995 3300044765 Bacteria 1176
959 Ga0466957_0002562 3300044842 Bacteria 9780
960 Ga0466957_0014461 3300044842 Bacteria 4595
961 Ga0466957_0019611 3300044842 Bacteria 3978
962 Ga0466957_0027993 3300044842 Bacteria 3352
963 Ga0466957_0096700 3300044842 Bacteria 1856
964 Ga0466957_0197429 3300044842 Bacteria 1320
965 Ga0466957_0218243 3300044842 Bacteria 1258
966 Ga0466957_0379455 3300044842 Bacteria 964
967 Ga0466959_0000926 3300045049 Bacteria 17409
968 Ga0466959_0005512 3300045049 Bacteria 8680
969 Ga0466959_0007380 3300045049 Bacteria 7712
970 Ga0466959_0071231 3300045049 Bacteria 2517
971 Ga0466959_0265929 3300045049 Bacteria 1180
972 Ga0451576_0000013 3300045051 Bacteria 665120
973 Ga0451576_0000018 3300045051 Bacteria 550689
974 Ga0451576_0005877 3300045051 Bacteria 15243
975 Ga0451576_0010036 3300045051 Bacteria 10905
976 Ga0451576_0025038 3300045051 Bacteria 6436
977 Ga0451576_0100286 3300045051 Bacteria 3011
978 Ga0451576_0193652 3300045051 Bacteria 2123
979 Ga0451576_0280918 3300045051 Bacteria 1741
980 Ga0451576_0999273 3300045051 Bacteria 877
981 Ga0466958_0001887 3300045836 Bacteria 10239
982 Ga0466958_0019865 3300045836 Bacteria 3913
983 Ga0466958_0060303 3300045836 Bacteria 2309
984 Ga0466958_0065480 3300045836 Bacteria 2217
985 Ga0466958_0159333 3300045836 Bacteria 1425
986 Ga0466967_0187281 3300045976 Bacteria 1955
987 Ga0466967_0545245 3300045976 Bacteria 1141
988 Ga0466967_0746643 3300045976 Bacteria 970
989 Ga0495617_000397 3300046452 Bacteria 24142
990 Ga0495617_000636 3300046452 Bacteria 17611
991 Ga0495617_000830 3300046452 Bacteria 14706
992 Ga0495617_007711 3300046452 Bacteria 3722
993 Ga0495617_009077 3300046452 Bacteria 3418
994 Ga0495617_107059 3300046452 Bacteria 906
995 Ga0495627_004713 3300046453 Bacteria 5636
996 Ga0495627_008079 3300046453 Bacteria 3967
997 Ga0495592_0100631 3300046454 Bacteria 2060
998 Ga0495592_0205027 3300046454 Bacteria 1328
999 Ga0495603_0001612 3300046455 Bacteria 13252
1000 Ga0495603_0009392 3300046455 Bacteria 5909
1001 Ga0495603_0021343 3300046455 Bacteria 3921
1002 Ga0495603_0036844 3300046455 Bacteria 2935
1003 Ga0495603_0121153 3300046455 Bacteria 1524
1004 Ga0495603_0344095 3300046455 Bacteria 855
1005 Ga0495603_0365634 3300046455 Bacteria 828
1006 Ga0495590_0000020 3300046457 Bacteria 212352
1007 Ga0495590_0000632 3300046457 Bacteria 16341
1008 Ga0495590_0001551 3300046457 Bacteria 9865
1009 Ga0495590_0006208 3300046457 Bacteria 4677
1010 Ga0495590_0018240 3300046457 Bacteria 2513
1011 Ga0495590_0035656 3300046457 Bacteria 1736
1012 Ga0495590_0084356 3300046457 Bacteria 1120
1013 Ga0495590_0407092 3300046457 Bacteria 522
1014 Ga0495591_010774 3300046458 Bacteria 3514
1015 Ga0495629_0008019 3300046459 Bacteria 7771
1016 Ga0495629_0015926 3300046459 Bacteria 5401
1017 Ga0495629_0143741 3300046459 Bacteria 1659
1018 Ga0495629_0185132 3300046459 Bacteria 1442
1019 Ga0495629_0248372 3300046459 Bacteria 1224
1020 Ga0495629_0919744 3300046459 Bacteria 572
1021 Ga0495638_0000235 3300046460 Bacteria 75760
1022 Ga0495638_0010507 3300046460 Bacteria 6417
1023 Ga0495638_0016045 3300046460 Bacteria 5020
1024 Ga0495638_0058891 3300046460 Bacteria 2379
1025 Ga0495638_0066492 3300046460 Bacteria 2215
1026 Ga0495638_0127888 3300046460 Bacteria 1495
1027 Ga0495638_0138245 3300046460 Bacteria 1424
1028 Ga0495638_0143356 3300046460 Bacteria 1392
1029 Ga0495638_0175482 3300046460 Bacteria 1226
1030 Ga0495638_0192509 3300046460 Bacteria 1156
1031 Ga0495641_0049296 3300046461 Bacteria 1928
1032 Ga0495653_0000067 3300046463 Bacteria 90116
1033 Ga0495653_0004702 3300046463 Bacteria 11053
1034 Ga0495653_0030611 3300046463 Bacteria 4284
1035 Ga0495653_0071030 3300046463 Bacteria 2603
1036 Ga0495653_0091071 3300046463 Bacteria 2229
1037 Ga0495653_0300755 3300046463 Bacteria 1046
1038 Ga0495650_0000200 3300046471 Bacteria 130223
1039 Ga0495650_0000436 3300046471 Bacteria 67167
1040 Ga0495650_0001809 3300046471 Bacteria 19254
1041 Ga0495650_0007290 3300046471 Bacteria 6684
1042 Ga0495650_0017593 3300046471 Bacteria 3580
1043 Ga0495650_0020204 3300046471 Bacteria 3253
1044 Ga0495650_0023276 3300046471 Bacteria 2951
1045 Ga0495650_0025873 3300046471 Bacteria 2740
1046 Ga0495650_0028055 3300046471 Bacteria 2591
1047 Ga0495650_0046362 3300046471 Bacteria 1824
1048 Ga0495650_0086014 3300046471 Bacteria 1204
1049 Ga0495580_0006554 3300046472 Bacteria 9466
1050 Ga0495580_0016805 3300046472 Bacteria 5490
1051 Ga0495580_0020632 3300046472 Bacteria 4873
1052 Ga0495580_0130646 3300046472 Bacteria 1742
1053 Ga0495580_0295525 3300046472 Bacteria 1103
1054 Ga0495580_0716936 3300046472 Bacteria 653
1055 Ga0495582_0005108 3300046473 Bacteria 7350
1056 Ga0495582_0014415 3300046473 Bacteria 4345
1057 Ga0495582_0033837 3300046473 Bacteria 2810
1058 Ga0495582_0181417 3300046473 Bacteria 1199
1059 Ga0495582_0545605 3300046473 Bacteria 670
1060 Ga0495605_0000061 3300046474 Bacteria 145286
1061 Ga0495605_0001735 3300046474 Bacteria 13971
1062 Ga0495605_0005449 3300046474 Bacteria 7411
1063 Ga0495605_0009198 3300046474 Bacteria 5554
1064 Ga0495605_0010393 3300046474 Bacteria 5209
1065 Ga0495605_0012129 3300046474 Bacteria 4788
1066 Ga0495605_0013819 3300046474 Bacteria 4436
1067 Ga0495605_0014824 3300046474 Bacteria 4254
1068 Ga0495605_0017339 3300046474 Bacteria 3880
1069 Ga0495605_0066496 3300046474 Bacteria 1712
1070 Ga0495605_0085995 3300046474 Bacteria 1463
1071 Ga0495605_0125990 3300046474 Bacteria 1158
1072 Ga0495605_0272644 3300046474 Bacteria 720
1073 Ga0495639_0038910 3300046475 Bacteria 2137
1074 Ga0495639_0088103 3300046475 Bacteria 1453
1075 Ga0495639_0088932 3300046475 Bacteria 1446
1076 Ga0495639_0150524 3300046475 Bacteria 1122
1077 Ga0495662_0024098 3300046476 Bacteria 2936
1078 Ga0495662_0180757 3300046476 Bacteria 1039
1079 Ga0495664_0006673 3300046477 Bacteria 6381
1080 Ga0495664_0069337 3300046477 Bacteria 2105
1081 Ga0495664_0072529 3300046477 Bacteria 2057
1082 Ga0495664_0095229 3300046477 Bacteria 1792
1083 Ga0495664_0097358 3300046477 Bacteria 1771
1084 Ga0495664_0250066 3300046477 Bacteria 1072
1085 Ga0495584_0000636 3300046491 Bacteria 23364
1086 Ga0495584_0002002 3300046491 Bacteria 11717
1087 Ga0495584_0011799 3300046491 Bacteria 4468
1088 Ga0495584_0012155 3300046491 Bacteria 4399
1089 Ga0495584_0021670 3300046491 Bacteria 3262
1090 Ga0495584_0032055 3300046491 Bacteria 2660
1091 Ga0495584_0033893 3300046491 Bacteria 2583
1092 Ga0495584_0144920 3300046491 Bacteria 1206
1093 Ga0495584_0190186 3300046491 Bacteria 1043
1094 Ga0495584_0201597 3300046491 Bacteria 1011
1095 Ga0495585_0000497 3300046492 Bacteria 37109
1096 Ga0495585_0006666 3300046492 Bacteria 7134
1097 Ga0495585_0037607 3300046492 Bacteria 2725
1098 Ga0495585_0040726 3300046492 Bacteria 2607
1099 Ga0495585_0041550 3300046492 Bacteria 2578
1100 Ga0495585_0050808 3300046492 Bacteria 2298
1101 Ga0495585_0053985 3300046492 Bacteria 2222
1102 Ga0495585_0057251 3300046492 Bacteria 2151
1103 Ga0495585_0067131 3300046492 Bacteria 1962
1104 Ga0495594_0010435 3300046499 Bacteria 4818
1105 Ga0495594_0017612 3300046499 Bacteria 3776
1106 Ga0495594_0034748 3300046499 Bacteria 2743
1107 Ga0495594_0073377 3300046499 Bacteria 1904
1108 Ga0495594_0125027 3300046499 Bacteria 1455
1109 Ga0495594_0244040 3300046499 Bacteria 1023
1110 Ga0495596_0001745 3300046500 Bacteria 12192
1111 Ga0495596_0001963 3300046500 Bacteria 11349
1112 Ga0495596_0020643 3300046500 Bacteria 2694
1113 Ga0495596_0142796 3300046500 Bacteria 930
1114 Ga0495596_0165675 3300046500 Bacteria 859
1115 Ga0495596_0199960 3300046500 Bacteria 776
1116 Ga0495596_0254795 3300046500 Bacteria 681
1117 Ga0495607_0009755 3300046501 Bacteria 6481
1118 Ga0495607_0017761 3300046501 Bacteria 4554
1119 Ga0495607_0021914 3300046501 Bacteria 4018
1120 Ga0495607_0038368 3300046501 Bacteria 2869
1121 Ga0495607_0042397 3300046501 Bacteria 2697
1122 Ga0495607_0059953 3300046501 Bacteria 2167
1123 Ga0495607_0062866 3300046501 Bacteria 2102
1124 Ga0495607_0063124 3300046501 Bacteria 2097
1125 Ga0495607_0100890 3300046501 Bacteria 1546
1126 Ga0495607_0103502 3300046501 Bacteria 1521
1127 Ga0495607_0159222 3300046501 Bacteria 1148
1128 Ga0495607_0318419 3300046501 Bacteria 726
1129 Ga0495607_0319723 3300046501 Bacteria 724
1130 Ga0495583_0000317 3300046506 Bacteria 76193
1131 Ga0495583_0002046 3300046506 Bacteria 18350
1132 Ga0495583_0004594 3300046506 Bacteria 9786
1133 Ga0495583_0004815 3300046506 Bacteria 9459
1134 Ga0495583_0011949 3300046506 Bacteria 4952
1135 Ga0495583_0016574 3300046506 Bacteria 3954
1136 Ga0495583_0018545 3300046506 Bacteria 3659
1137 Ga0495583_0019465 3300046506 Bacteria 3542
1138 Ga0495583_0094359 3300046506 Bacteria 1284
1139 Ga0495606_0009877 3300046507 Bacteria 8000
1140 Ga0495606_0031882 3300046507 Bacteria 3658
1141 Ga0495606_0035311 3300046507 Bacteria 3418
1142 Ga0495606_0035595 3300046507 Bacteria 3401
1143 Ga0495606_0037967 3300046507 Bacteria 3264
1144 Ga0495606_0048233 3300046507 Bacteria 2802
1145 Ga0495606_0054164 3300046507 Bacteria 2598
1146 Ga0495606_0064595 3300046507 Bacteria 2328
1147 Ga0495606_0066613 3300046507 Bacteria 2283
1148 Ga0495606_0070973 3300046507 Bacteria 2194
1149 Ga0495606_0080050 3300046507 Bacteria 2033
1150 Ga0495606_0085615 3300046507 Bacteria 1949
1151 Ga0495606_0109571 3300046507 Bacteria 1667
1152 Ga0495606_0147485 3300046507 Bacteria 1383
1153 Ga0495608_0188850 3300046511 Bacteria 1301
1154 Ga0495608_0308495 3300046511 Bacteria 979
1155 Ga0495610_0000017 3300046512 Bacteria 365675
1156 Ga0495610_0065030 3300046512 Bacteria 1722
1157 Ga0495610_0125032 3300046512 Bacteria 1122
1158 Ga0495616_0003800 3300046513 Bacteria 9623
1159 Ga0495616_0011842 3300046513 Bacteria 4974
1160 Ga0495616_0034996 3300046513 Bacteria 2602
1161 Ga0495616_0072460 3300046513 Bacteria 1663
1162 Ga0495616_0086533 3300046513 Bacteria 1490
1163 Ga0495616_0102252 3300046513 Bacteria 1342
1164 Ga0495616_0111084 3300046513 Bacteria 1273
1165 Ga0495616_0117328 3300046513 Bacteria 1231
1166 Ga0495616_0119592 3300046513 Bacteria 1217
1167 Ga0495616_0163239 3300046513 Bacteria 1000
1168 Ga0495616_0390385 3300046513 Bacteria 573
1169 Ga0495618_0018095 3300046514 Bacteria 4325
1170 Ga0495618_0138514 3300046514 Bacteria 1556
1171 Ga0495618_0469722 3300046514 Bacteria 761
1172 Ga0495620_0001543 3300046515 Bacteria 13683
1173 Ga0495620_0014491 3300046515 Bacteria 4006
1174 Ga0495620_0053647 3300046515 Bacteria 1706
1175 Ga0495628_0006292 3300046516 Bacteria 10367
1176 Ga0495628_0069084 3300046516 Bacteria 2755
1177 Ga0495628_0075933 3300046516 Bacteria 2616
1178 Ga0495628_0079554 3300046516 Bacteria 2548
1179 Ga0495628_0109587 3300046516 Bacteria 2124
1180 Ga0495628_0205693 3300046516 Bacteria 1482
1181 Ga0495630_0038355 3300046517 Bacteria 3583
1182 Ga0495630_0100382 3300046517 Bacteria 2189
1183 Ga0495630_0109243 3300046517 Bacteria 2095
1184 Ga0495630_0134360 3300046517 Bacteria 1879
1185 Ga0495630_0207757 3300046517 Bacteria 1494
1186 Ga0495631_0011063 3300046518 Bacteria 4450
1187 Ga0495631_0011843 3300046518 Bacteria 4278
1188 Ga0495631_0019480 3300046518 Bacteria 3181
1189 Ga0495631_0030651 3300046518 Bacteria 2438
1190 Ga0495631_0161756 3300046518 Bacteria 960
1191 Ga0495632_0016465 3300046519 Bacteria 4111
1192 Ga0495632_0026864 3300046519 Bacteria 3022
1193 Ga0495632_0089406 3300046519 Bacteria 1462
1194 Ga0495632_0096913 3300046519 Bacteria 1392
1195 Ga0495632_0172654 3300046519 Bacteria 992
1196 Ga0495637_0000053 3300046520 Bacteria 99739
1197 Ga0495637_0002190 3300046520 Bacteria 10923
1198 Ga0495637_0011543 3300046520 Bacteria 4242
1199 Ga0495637_0012032 3300046520 Bacteria 4149
1200 Ga0495637_0056898 3300046520 Bacteria 1617
1201 Ga0495643_0012013 3300046522 Bacteria 5240
1202 Ga0495643_0014375 3300046522 Bacteria 4711
1203 Ga0495643_0019530 3300046522 Bacteria 3918
1204 Ga0495643_0026159 3300046522 Bacteria 3295
1205 Ga0495643_0040991 3300046522 Bacteria 2526
1206 Ga0495643_0044520 3300046522 Bacteria 2411
1207 Ga0495643_0048287 3300046522 Bacteria 2301
1208 Ga0495643_0054593 3300046522 Bacteria 2138
1209 Ga0495643_0104068 3300046522 Bacteria 1451
1210 Ga0495644_0003110 3300046523 Bacteria 6566
1211 Ga0495644_0013221 3300046523 Bacteria 3170
1212 Ga0495644_0019769 3300046523 Bacteria 2571
1213 Ga0495644_0053726 3300046523 Bacteria 1513
1214 Ga0495644_0075233 3300046523 Bacteria 1271
1215 Ga0495644_0218639 3300046523 Bacteria 736
1216 Ga0495648_0003167 3300046524 Bacteria 14648
1217 Ga0495648_0015922 3300046524 Bacteria 5434
1218 Ga0495648_0025782 3300046524 Bacteria 3971
1219 Ga0495648_0026850 3300046524 Bacteria 3867
1220 Ga0495648_0044310 3300046524 Bacteria 2778
1221 Ga0495648_0046480 3300046524 Bacteria 2690
1222 Ga0495648_0056197 3300046524 Bacteria 2368
1223 Ga0495648_0087678 3300046524 Bacteria 1751
1224 Ga0495648_0098552 3300046524 Bacteria 1618
1225 Ga0495648_0100591 3300046524 Bacteria 1596
1226 Ga0495648_0120126 3300046524 Bacteria 1414
1227 Ga0495648_0150736 3300046524 Bacteria 1213
1228 Ga0495648_0155108 3300046524 Bacteria 1190
1229 Ga0495648_0209849 3300046524 Bacteria 968
1230 Ga0495648_0320024 3300046524 Bacteria 719
1231 Ga0495663_0006063 3300046525 Bacteria 3344
1232 Ga0495663_0008461 3300046525 Bacteria 2849
1233 Ga0495663_0012604 3300046525 Bacteria 2357
1234 Ga0495663_0017530 3300046525 Bacteria 2033
1235 Ga0495663_0065824 3300046525 Bacteria 1146
1236 Ga0495663_0124763 3300046525 Bacteria 864
1237 Ga0495666_0002416 3300046526 Bacteria 9296
1238 Ga0495666_0040638 3300046526 Bacteria 2254
1239 Ga0495666_0049585 3300046526 Bacteria 2019
1240 Ga0495666_0098357 3300046526 Bacteria 1379
1241 Ga0495666_0105624 3300046526 Bacteria 1325
1242 Ga0495666_0115943 3300046526 Bacteria 1256
1243 Ga0495666_0162411 3300046526 Bacteria 1035
1244 Ga0495666_0287216 3300046526 Bacteria 745
1245 Ga0495666_0391822 3300046526 Bacteria 624
1246 Ga0495666_0446510 3300046526 Bacteria 579
1247 Ga0495642_0005824 3300046528 Bacteria 4726
1248 Ga0495642_0007577 3300046528 Bacteria 4159
1249 Ga0495642_0008349 3300046528 Bacteria 3963
1250 Ga0495642_0019574 3300046528 Bacteria 2654
1251 Ga0495642_0026738 3300046528 Bacteria 2293
1252 Ga0495642_0030583 3300046528 Bacteria 2154
1253 Ga0495642_0048741 3300046528 Bacteria 1738
1254 Ga0495642_0056434 3300046528 Bacteria 1622
1255 Ga0495642_0075423 3300046528 Bacteria 1414
1256 Ga0495642_0079432 3300046528 Bacteria 1379
1257 Ga0495642_0168073 3300046528 Bacteria 952
1258 Ga0495642_0213337 3300046528 Bacteria 842
1259 Ga0495642_0231611 3300046528 Bacteria 807
1260 Ga0495652_0035356 3300046529 Bacteria 4349
1261 Ga0495652_0115773 3300046529 Bacteria 2147
1262 Ga0495652_0146004 3300046529 Bacteria 1854
1263 Ga0495652_0151599 3300046529 Bacteria 1810
1264 Ga0495654_0000060 3300046530 Bacteria 134307
1265 Ga0495654_0030668 3300046530 Bacteria 2734
1266 Ga0495654_0109550 3300046530 Bacteria 1261
1267 Ga0495654_0176808 3300046530 Bacteria 927
1268 Ga0495654_0191212 3300046530 Bacteria 881
1269 Ga0495654_0247759 3300046530 Bacteria 743
1270 Ga0495665_0008466 3300046531 Bacteria 5581
1271 Ga0495665_0018585 3300046531 Bacteria 3734
1272 Ga0495665_0031045 3300046531 Bacteria 2859
1273 Ga0495665_0034628 3300046531 Bacteria 2700
1274 Ga0495665_0057876 3300046531 Bacteria 2046
1275 Ga0495665_0069907 3300046531 Bacteria 1850
1276 Ga0495665_0091889 3300046531 Bacteria 1595
1277 Ga0495665_0221276 3300046531 Bacteria 978
1278 Ga0495640_0041811 3300046533 Bacteria 3201
1279 Ga0495640_0475601 3300046533 Bacteria 761
1280 Ga0495586_0008133 3300046535 Bacteria 5590
1281 Ga0495586_0018161 3300046535 Bacteria 3741
1282 Ga0495586_0051587 3300046535 Bacteria 2226
1283 Ga0495586_0070537 3300046535 Bacteria 1908
1284 Ga0495586_0072077 3300046535 Bacteria 1888
1285 Ga0495586_0106892 3300046535 Bacteria 1556
1286 Ga0495587_0007790 3300046536 Bacteria 6919
1287 Ga0495587_0037993 3300046536 Bacteria 2888
1288 Ga0495587_0086906 3300046536 Bacteria 1809
1289 Ga0495587_0263774 3300046536 Bacteria 967
1290 Ga0495587_0427665 3300046536 Bacteria 735
1291 Ga0495598_0027767 3300046537 Bacteria 1564
1292 Ga0495609_0000007 3300046538 Bacteria 398812
1293 Ga0495609_0000666 3300046538 Bacteria 26632
1294 Ga0495609_0033507 3300046538 Bacteria 2332
1295 Ga0495609_0046714 3300046538 Bacteria 1938
1296 Ga0495609_0084127 3300046538 Bacteria 1388
1297 Ga0495609_0085504 3300046538 Bacteria 1375
1298 Ga0495609_0164311 3300046538 Bacteria 939
1299 Ga0495609_0211129 3300046538 Bacteria 808
1300 Ga0495621_0161107 3300046539 Bacteria 887
1301 Ga0495621_0161323 3300046539 Bacteria 887
1302 Ga0495621_0351269 3300046539 Bacteria 619
1303 Ga0495597_0007533 3300046542 Bacteria 5520
1304 Ga0495597_0007961 3300046542 Bacteria 5336
1305 Ga0495597_0014198 3300046542 Bacteria 3796
1306 Ga0495597_0022360 3300046542 Bacteria 2933
1307 Ga0495597_0023086 3300046542 Bacteria 2879
1308 Ga0495597_0073396 3300046542 Bacteria 1471
1309 Ga0495597_0073428 3300046542 Bacteria 1470
1310 Ga0495597_0079026 3300046542 Bacteria 1409
1311 Ga0495597_0125983 3300046542 Bacteria 1065
1312 Ga0495597_0185257 3300046542 Bacteria 839
1313 Ga0495597_0232401 3300046542 Bacteria 729
1314 Ga0495597_0323992 3300046542 Bacteria 594
1315 Ga0495645_0009368 3300046543 Bacteria 6846
1316 Ga0495645_0061503 3300046543 Bacteria 2720
1317 Ga0495645_0102644 3300046543 Bacteria 2032
1318 Ga0495645_0450145 3300046543 Bacteria 812
1319 Ga0495622_0002163 3300046557 Bacteria 9573
1320 Ga0495622_0012942 3300046557 Bacteria 3869
1321 Ga0495622_0014615 3300046557 Bacteria 3646
1322 Ga0495622_0031049 3300046557 Bacteria 2498
1323 Ga0495622_0031817 3300046557 Bacteria 2464
1324 Ga0495622_0035080 3300046557 Bacteria 2339
1325 Ga0495622_0041092 3300046557 Bacteria 2150
1326 Ga0495622_0110653 3300046557 Bacteria 1257
1327 Ga0495622_0192080 3300046557 Bacteria 912
1328 Ga0495622_0207613 3300046557 Bacteria 871
1329 Ga0495633_0006566 3300046558 Bacteria 6874
1330 Ga0495633_0023121 3300046558 Bacteria 3080
1331 Ga0495633_0025281 3300046558 Bacteria 2925
1332 Ga0495633_0036777 3300046558 Bacteria 2344
1333 Ga0495633_0062271 3300046558 Bacteria 1746
1334 Ga0495633_0068032 3300046558 Bacteria 1662
1335 Ga0495633_0097194 3300046558 Bacteria 1367
1336 Ga0495633_0160994 3300046558 Bacteria 1035
1337 Ga0495633_0171885 3300046558 Bacteria 998
1338 Ga0495633_0175653 3300046558 Bacteria 986
1339 Ga0495667_0043286 3300046559 Bacteria 2984
1340 Ga0495667_0151288 3300046559 Bacteria 1494
1341 Ga0495667_0555975 3300046559 Bacteria 717
1342 Ga0495656_0010416 3300046615 Bacteria 3380
1343 Ga0495656_0081304 3300046615 Bacteria 1462
1344 Ga0495656_0084934 3300046615 Bacteria 1436
1345 Ga0495656_0099696 3300046615 Bacteria 1341
1346 Ga0495656_0169174 3300046615 Bacteria 1067
1347 Ga0495656_0267756 3300046615 Bacteria 867
1348 Ga0495668_0002640 3300046616 Bacteria 14406
1349 Ga0495668_0005163 3300046616 Bacteria 8962
1350 Ga0495668_0008733 3300046616 Bacteria 6291
1351 Ga0495668_0011342 3300046616 Bacteria 5343
1352 Ga0495668_0011816 3300046616 Bacteria 5204
1353 Ga0495668_0018916 3300046616 Bacteria 3978
1354 Ga0495668_0029452 3300046616 Bacteria 3101
1355 Ga0495668_0051941 3300046616 Bacteria 2269
1356 Ga0495668_0103355 3300046616 Bacteria 1559
1357 Ga0495668_0120245 3300046616 Bacteria 1437
1358 Ga0495668_0162205 3300046616 Bacteria 1224
1359 Ga0495668_0311153 3300046616 Bacteria 864
1360 Ga0495668_0337344 3300046616 Bacteria 827
1361 Ga0495668_0395203 3300046616 Bacteria 759
1362 Ga0495634_0045859 3300046642 Bacteria 2952
1363 Ga0495634_0121713 3300046642 Bacteria 1670
1364 Ga0495634_0202784 3300046642 Bacteria 1231
1365 Ga0495634_0211208 3300046642 Bacteria 1201
1366 Ga0495611_0001662 3300046648 Bacteria 10778
1367 Ga0495611_0002069 3300046648 Bacteria 9442
1368 Ga0495611_0005909 3300046648 Bacteria 5219
1369 Ga0495611_0011874 3300046648 Bacteria 3697
1370 Ga0495611_0093136 3300046648 Bacteria 1393
1371 Ga0495611_0182449 3300046648 Bacteria 980
1372 Ga0495611_0248659 3300046648 Bacteria 824
1373 Ga0495625_0011213 3300046660 Bacteria 7328
1374 Ga0495625_0033151 3300046660 Bacteria 3822
1375 Ga0495625_0034116 3300046660 Bacteria 3757
1376 Ga0495625_0047734 3300046660 Bacteria 3086
1377 Ga0495625_0087655 3300046660 Bacteria 2157
1378 Ga0495625_0166164 3300046660 Bacteria 1475
1379 Ga0495625_0167010 3300046660 Bacteria 1471
1380 Ga0495625_0190370 3300046660 Bacteria 1359
1381 Ga0495625_0199527 3300046660 Bacteria 1321
1382 Ga0495625_0208462 3300046660 Bacteria 1285
1383 Ga0495625_0265594 3300046660 Bacteria 1109
1384 Ga0495635_0008977 3300046663 Bacteria 6978
1385 Ga0495635_0078555 3300046663 Bacteria 2259
1386 Ga0495635_0142420 3300046663 Bacteria 1632
1387 Ga0495635_0200952 3300046663 Bacteria 1352
1388 Ga0495659_0003686 3300046664 Bacteria 4871
1389 Ga0495659_0004277 3300046664 Bacteria 4502
1390 Ga0495659_0007839 3300046664 Bacteria 3385
1391 Ga0495659_0025538 3300046664 Bacteria 2023
1392 Ga0495659_0079281 3300046664 Bacteria 1244
1393 Ga0495659_0093802 3300046664 Bacteria 1155
1394 Ga0495659_0149661 3300046664 Bacteria 936
1395 Ga0495659_0558240 3300046664 Bacteria 505
1396 Ga0495661_0019060 3300046665 Bacteria 4500
1397 Ga0495661_0022315 3300046665 Bacteria 4118
1398 Ga0495661_0027641 3300046665 Bacteria 3639
1399 Ga0495661_0036532 3300046665 Bacteria 3075
1400 Ga0495661_0042541 3300046665 Bacteria 2799
1401 Ga0495661_0062587 3300046665 Bacteria 2203
1402 Ga0495661_0089042 3300046665 Bacteria 1760
1403 Ga0495661_0119891 3300046665 Bacteria 1454
1404 Ga0495661_0148229 3300046665 Bacteria 1269
1405 Ga0495661_0188840 3300046665 Bacteria 1086
1406 Ga0495661_0219532 3300046665 Bacteria 985
1407 Ga0495661_0293686 3300046665 Bacteria 815
1408 Ga0495661_0298181 3300046665 Bacteria 807
1409 Ga0495661_0421205 3300046665 Bacteria 646
1410 Ga0495588_0009027 3300046674 Bacteria 4594
1411 Ga0495588_0011149 3300046674 Bacteria 4209
1412 Ga0495588_0017870 3300046674 Bacteria 3451
1413 Ga0495588_0018679 3300046674 Bacteria 3384
1414 Ga0495588_0040525 3300046674 Bacteria 2375
1415 Ga0495588_0046528 3300046674 Bacteria 2225
1416 Ga0495588_0050054 3300046674 Bacteria 2149
1417 Ga0495588_0230874 3300046674 Bacteria 976
1418 Ga0495657_0727578 3300046675 Bacteria 569
1419 Ga0495657_0736393 3300046675 Bacteria 565
1420 Ga0495599_0052585 3300046678 Bacteria 2551
1421 Ga0495599_0060094 3300046678 Bacteria 2377
1422 Ga0495599_0204471 3300046678 Bacteria 1212
1423 Ga0495599_0222351 3300046678 Bacteria 1155
1424 Ga0495623_0031929 3300046679 Bacteria 3385
1425 Ga0495623_0100910 3300046679 Bacteria 1758
1426 Ga0495623_0118836 3300046679 Bacteria 1593
1427 Ga0495623_0154907 3300046679 Bacteria 1351
1428 Ga0495623_0164039 3300046679 Bacteria 1303
1429 Ga0495623_0164428 3300046679 Bacteria 1301
1430 Ga0495623_0175824 3300046679 Bacteria 1247
1431 Ga0495623_0178944 3300046679 Bacteria 1233
1432 Ga0495646_0038676 3300046680 Bacteria 2944
1433 Ga0495646_0043675 3300046680 Bacteria 2743
1434 Ga0495646_0054683 3300046680 Bacteria 2400
1435 Ga0495646_0076384 3300046680 Bacteria 1961
1436 Ga0495646_0154791 3300046680 Bacteria 1272
1437 Ga0495646_0158928 3300046680 Bacteria 1252
1438 Ga0495646_0405134 3300046680 Bacteria 708
1439 Ga0495658_0114704 3300046683 Bacteria 1624
1440 Ga0495658_0283936 3300046683 Bacteria 1045
1441 Ga0495658_0289894 3300046683 Bacteria 1034
1442 Ga0495658_0558190 3300046683 Bacteria 733
1443 Ga0495669_0001596 3300046684 Bacteria 9305
1444 Ga0495669_0002717 3300046684 Bacteria 7249
1445 Ga0495669_0031367 3300046684 Bacteria 2334
1446 Ga0495669_0041852 3300046684 Bacteria 2035
1447 Ga0495669_0086878 3300046684 Bacteria 1440
1448 Ga0495669_0116277 3300046684 Bacteria 1251
1449 Ga0495669_0350587 3300046684 Bacteria 713
1450 Ga0495613_0072609 3300046689 Bacteria 2508
1451 Ga0495613_0082016 3300046689 Bacteria 2342
1452 Ga0495613_0092389 3300046689 Bacteria 2191
1453 Ga0495613_0130385 3300046689 Bacteria 1800
1454 Ga0495613_0226145 3300046689 Bacteria 1312
1455 Ga0495613_0566434 3300046689 Bacteria 759
1456 Ga0495624_0020482 3300046690 Bacteria 4401
1457 Ga0495624_0039682 3300046690 Bacteria 3017
1458 Ga0495624_0053509 3300046690 Bacteria 2548
1459 Ga0495624_0069830 3300046690 Bacteria 2187
1460 Ga0495624_0097562 3300046690 Bacteria 1810
1461 Ga0495624_0149960 3300046690 Bacteria 1426
1462 Ga0495624_0499649 3300046690 Bacteria 727
1463 Ga0495624_0599869 3300046690 Bacteria 656
1464 Ga0495670_0009867 3300046691 Bacteria 4696
1465 Ga0495670_0028896 3300046691 Bacteria 2749
1466 Ga0495670_0035188 3300046691 Bacteria 2495
1467 Ga0495670_0067273 3300046691 Bacteria 1808
1468 Ga0495670_0102977 3300046691 Bacteria 1471
1469 Ga0495670_0119876 3300046691 Bacteria 1366
1470 Ga0495670_0150687 3300046691 Bacteria 1219
1471 Ga0495670_0166291 3300046691 Bacteria 1160
1472 Ga0495670_0320214 3300046691 Bacteria 832
1473 Ga0495671_0000037 3300046692 Bacteria 177605
1474 Ga0495671_0005005 3300046692 Bacteria 7807
1475 Ga0495671_0012352 3300046692 Bacteria 4668
1476 Ga0495671_0014262 3300046692 Bacteria 4282
1477 Ga0495671_0387612 3300046692 Bacteria 669
1478 Ga0495671_0457852 3300046692 Bacteria 609
1479 Ga0495649_0007567 3300046694 Bacteria 6610
1480 Ga0495649_0041099 3300046694 Bacteria 2529
1481 Ga0495649_0055982 3300046694 Bacteria 2130
1482 Ga0495649_0064779 3300046694 Bacteria 1962
1483 Ga0495649_0088148 3300046694 Bacteria 1655
1484 Ga0495649_0129516 3300046694 Bacteria 1331
1485 Ga0495649_0136805 3300046694 Bacteria 1291
1486 Ga0495649_0140298 3300046694 Bacteria 1272
1487 Ga0495649_0152737 3300046694 Bacteria 1212
1488 Ga0495649_0226406 3300046694 Bacteria 966
1489 Ga0495649_0246537 3300046694 Bacteria 918
1490 Ga0495589_0016595 3300046794 Bacteria 3783
1491 Ga0495589_0021019 3300046794 Bacteria 3335
1492 Ga0495589_0056788 3300046794 Bacteria 1926
1493 Ga0495589_0063428 3300046794 Bacteria 1812
1494 Ga0495589_0074703 3300046794 Bacteria 1653
1495 Ga0495589_0140971 3300046794 Bacteria 1154
1496 Ga0495589_0157145 3300046794 Bacteria 1084
1497 Ga0495589_0232418 3300046794 Bacteria 864
1498 Ga0495589_0312150 3300046794 Bacteria 727
1499 Ga0495600_0004009 3300046809 Bacteria 8753
1500 Ga0495600_0039828 3300046809 Bacteria 3060
1501 Ga0495600_0178346 3300046809 Bacteria 1369
1502 Ga0495600_0185571 3300046809 Bacteria 1339
1503 Ga0495600_0198806 3300046809 Bacteria 1288
1504 Ga0495600_0493571 3300046809 Bacteria 753
1505 Ga0495660_0010186 3300046810 Bacteria 5468
1506 Ga0495660_0011018 3300046810 Bacteria 5250
1507 Ga0495660_0012969 3300046810 Bacteria 4831
1508 Ga0495660_0015683 3300046810 Bacteria 4375
1509 Ga0495660_0034744 3300046810 Bacteria 2819
1510 Ga0495660_0048108 3300046810 Bacteria 2332
1511 Ga0495660_0051977 3300046810 Bacteria 2227
1512 Ga0495660_0065924 3300046810 Bacteria 1931
1513 Ga0495660_0084002 3300046810 Bacteria 1665
1514 Ga0495660_0116780 3300046810 Bacteria 1355
1515 Ga0495660_0119454 3300046810 Bacteria 1335
1516 Ga0495660_0174053 3300046810 Bacteria 1046
1517 Ga0495660_0208048 3300046810 Bacteria 930
1518 Ga0495660_0285985 3300046810 Bacteria 752
1519 Ga0495581_0003269 3300047315 Bacteria 9295
1520 Ga0495581_0011615 3300047315 Bacteria 5097
1521 Ga0495581_0027016 3300047315 Bacteria 3328
1522 Ga0495581_0040802 3300047315 Bacteria 2684
1523 Ga0495581_0078701 3300047315 Bacteria 1908
1524 Ga0495581_0157473 3300047315 Bacteria 1327
1525 Ga0495581_0176605 3300047315 Bacteria 1248
1526 Ga0495604_0003421 3300047317 Bacteria 12655
1527 Ga0495604_0010804 3300047317 Bacteria 7251
1528 Ga0495604_0048599 3300047317 Bacteria 3300
1529 Ga0495604_0096566 3300047317 Bacteria 2180
1530 Ga0495604_0126319 3300047317 Bacteria 1843
1531 Ga0495604_0290778 3300047317 Bacteria 1100
1532 Ga0495604_0433131 3300047317 Bacteria 861
1533 Ga0495636_0001434 3300047318 Bacteria 9014
1534 Ga0495636_0003890 3300047318 Bacteria 5826
1535 Ga0495636_0006133 3300047318 Bacteria 4722
1536 Ga0495636_0006316 3300047318 Bacteria 4654
1537 Ga0495636_0018170 3300047318 Bacteria 2820
1538 Ga0495636_0040864 3300047318 Bacteria 1923
1539 Ga0495636_0106143 3300047318 Bacteria 1232
1540 Ga0495636_0259312 3300047318 Bacteria 806
1541 Ga0495636_0337773 3300047318 Bacteria 709
1542 Ga0495674_0013576 3300047319 Bacteria 7652
1543 Ga0495674_0022526 3300047319 Bacteria 5810
1544 Ga0495674_0031660 3300047319 Bacteria 4803
1545 Ga0495674_0046418 3300047319 Bacteria 3855
1546 Ga0495674_0055008 3300047319 Bacteria 3491
1547 Ga0495674_0102840 3300047319 Bacteria 2429
1548 Ga0495674_0280785 3300047319 Bacteria 1364
1549 Ga0495672_0000013 3300047320 Bacteria 511827
1550 Ga0495672_0000157 3300047320 Bacteria 98544
1551 Ga0495672_0007686 3300047320 Bacteria 8079
1552 Ga0495672_0015499 3300047320 Bacteria 5172
1553 Ga0495672_0029479 3300047320 Bacteria 3455
1554 Ga0495672_0031965 3300047320 Bacteria 3280
1555 Ga0495672_0033248 3300047320 Bacteria 3196
1556 Ga0495672_0035691 3300047320 Bacteria 3060
1557 Ga0495672_0045766 3300047320 Bacteria 2615
1558 Ga0495672_0119798 3300047320 Bacteria 1400
1559 Ga0495672_0161124 3300047320 Bacteria 1153
1560 Ga0495672_0357737 3300047320 Bacteria 676
1561 Ga0495676_0010234 3300047321 Bacteria 8515
1562 Ga0495676_0024323 3300047321 Bacteria 5246
1563 Ga0495676_0026376 3300047321 Bacteria 5003
1564 Ga0495676_0067455 3300047321 Bacteria 2767
1565 Ga0495676_0077394 3300047321 Bacteria 2536
1566 Ga0495676_0098301 3300047321 Bacteria 2172
1567 Ga0495676_0113267 3300047321 Bacteria 1986
1568 Ga0495676_0120830 3300047321 Bacteria 1906
1569 Ga0495676_0275944 3300047321 Bacteria 1139
1570 Ga0495680_0007818 3300047322 Bacteria 9766
1571 Ga0495680_0074468 3300047322 Bacteria 2578
1572 Ga0495680_0100796 3300047322 Bacteria 2151
1573 Ga0495680_0134396 3300047322 Bacteria 1814
1574 Ga0495680_0186233 3300047322 Bacteria 1495
1575 Ga0495680_0232979 3300047322 Bacteria 1310
1576 Ga0495680_0250054 3300047322 Bacteria 1256
1577 Ga0495680_0404052 3300047322 Bacteria 942
1578 Ga0495680_1032052 3300047322 Bacteria 523
1579 Ga0495683_0001129 3300047323 Bacteria 18380
1580 Ga0495683_0017957 3300047323 Bacteria 3662
1581 Ga0495683_0022066 3300047323 Bacteria 3275
1582 Ga0495683_0023372 3300047323 Bacteria 3176
1583 Ga0495683_0032766 3300047323 Bacteria 2646
1584 Ga0495683_0033028 3300047323 Bacteria 2635
1585 Ga0495683_0044638 3300047323 Bacteria 2229
1586 Ga0495683_0049847 3300047323 Bacteria 2096
1587 Ga0495683_0059991 3300047323 Bacteria 1886
1588 Ga0495683_0070031 3300047323 Bacteria 1722
1589 Ga0495683_0093261 3300047323 Bacteria 1456
1590 Ga0495683_0188735 3300047323 Bacteria 936
1591 Ga0495683_0275552 3300047323 Bacteria 730
1592 Ga0495687_000216 3300047443 Bacteria 81734
1593 Ga0495687_000342 3300047443 Bacteria 59692
1594 Ga0495687_001562 3300047443 Bacteria 20787
1595 Ga0495687_002921 3300047443 Bacteria 12995
1596 Ga0495687_007470 3300047443 Bacteria 6428
1597 Ga0495687_013991 3300047443 Bacteria 4152
1598 Ga0495687_027846 3300047443 Bacteria 2638
1599 Ga0495687_062464 3300047443 Bacteria 1528
1600 Ga0495687_084824 3300047443 Bacteria 1229
1601 Ga0495687_095851 3300047443 Bacteria 1124
1602 Ga0495687_171650 3300047443 Bacteria 717
1603 Ga0495675_0013567 3300047444 Bacteria 5145
1604 Ga0495675_0021158 3300047444 Bacteria 4140
1605 Ga0495675_0053131 3300047444 Bacteria 2572
1606 Ga0495675_0072252 3300047444 Bacteria 2176
1607 Ga0495675_0098979 3300047444 Bacteria 1826
1608 Ga0495675_0191731 3300047444 Bacteria 1247
1609 Ga0495677_0001866 3300047445 Bacteria 8421
1610 Ga0495677_0005942 3300047445 Bacteria 4622
1611 Ga0495677_0008079 3300047445 Bacteria 3906
1612 Ga0495677_0009137 3300047445 Bacteria 3662
1613 Ga0495677_0015597 3300047445 Bacteria 2760
1614 Ga0495677_0044661 3300047445 Bacteria 1624
1615 Ga0495677_0109477 3300047445 Bacteria 1049
1616 Ga0495677_0176898 3300047445 Bacteria 826
1617 Ga0495677_0275635 3300047445 Bacteria 659
1618 Ga0495677_0289370 3300047445 Bacteria 643
1619 Ga0495679_008349 3300047446 Bacteria 4218
1620 Ga0495679_012257 3300047446 Bacteria 3270
1621 Ga0495679_017521 3300047446 Bacteria 2562
1622 Ga0495679_017686 3300047446 Bacteria 2546
1623 Ga0495679_023106 3300047446 Bacteria 2115
1624 Ga0495679_041737 3300047446 Bacteria 1418
1625 Ga0495685_000291 3300047447 Bacteria 16719
1626 Ga0495685_001965 3300047447 Bacteria 6380
1627 Ga0495685_014389 3300047447 Bacteria 2688
1628 Ga0495685_019727 3300047447 Bacteria 2316
1629 Ga0495685_034014 3300047447 Bacteria 1751
1630 Ga0495685_071378 3300047447 Bacteria 1162
1631 Ga0495685_079079 3300047447 Bacteria 1096
1632 Ga0495685_108989 3300047447 Bacteria 912
1633 Ga0495685_138553 3300047447 Bacteria 793
1634 Ga0495673_0000248 3300047469 Bacteria 75224
1635 Ga0495673_0019105 3300047469 Bacteria 3439
1636 Ga0495673_0030733 3300047469 Bacteria 2520
1637 Ga0495673_0067504 3300047469 Bacteria 1513
1638 Ga0495673_0078261 3300047469 Bacteria 1375
1639 Ga0495673_0132106 3300047469 Bacteria 980
1640 Ga0495673_0310455 3300047469 Bacteria 563
1641 Ga0495681_0009083 3300047470 Bacteria 6161
1642 Ga0495681_0010756 3300047470 Bacteria 5512
1643 Ga0495681_0011744 3300047470 Bacteria 5189
1644 Ga0495681_0021475 3300047470 Bacteria 3477
1645 Ga0495681_0043390 3300047470 Bacteria 2169
1646 Ga0495681_0046827 3300047470 Bacteria 2059
1647 Ga0495681_0086167 3300047470 Bacteria 1394
1648 Ga0495681_0126902 3300047470 Bacteria 1089
1649 Ga0495681_0249667 3300047470 Bacteria 701
1650 Ga0495681_0271015 3300047470 Bacteria 664
1651 Ga0495684_0068039 3300047471 Bacteria 2708
1652 Ga0495686_0000214 3300047472 Bacteria 106493
1653 Ga0495686_0000787 3300047472 Bacteria 41374
1654 Ga0495686_0001126 3300047472 Bacteria 31591
1655 Ga0495686_0007683 3300047472 Bacteria 8051
1656 Ga0495686_0010875 3300047472 Bacteria 6444
1657 Ga0495686_0057869 3300047472 Bacteria 2418
1658 Ga0495686_0189431 3300047472 Bacteria 1186
1659 Ga0495686_0290820 3300047472 Bacteria 905
1660 Ga0495686_0391768 3300047472 Bacteria 747
1661 Ga0495686_0458937 3300047472 Bacteria 676
1662 Ga0495686_0584168 3300047472 Bacteria 580
1663 Ga0495593_0002955 3300047673 Bacteria 10225
1664 Ga0495593_0015413 3300047673 Bacteria 4328
1665 Ga0495593_0018189 3300047673 Bacteria 3952
1666 Ga0495593_0036990 3300047673 Bacteria 2643
1667 Ga0495593_0185141 3300047673 Bacteria 1048
1668 Ga0495593_0466381 3300047673 Bacteria 632
1669 Ga0495602_0036361 3300048088 Bacteria 4584
1670 Ga0495602_0051607 3300048088 Bacteria 3661
1671 Ga0495602_0075551 3300048088 Bacteria 2859
1672 Ga0495602_0313649 3300048088 Bacteria 1143
1673 Ga0495602_0783218 3300048088 Bacteria 641
1674 Ga0495614_0048811 3300048089 Bacteria 1814
1675 Ga0495614_0048818 3300048089 Bacteria 1814
1676 Ga0495614_0056437 3300048089 Bacteria 1685
1677 Ga0495614_0320971 3300048089 Bacteria 718
1678 Ga0495615_0013648 3300048090 Bacteria 1701
1679 Ga0495615_0100569 3300048090 Bacteria 816
1680 Ga0495626_0000227 3300048091 Bacteria 66048
1681 Ga0495626_0010154 3300048091 Bacteria 5050
1682 Ga0495626_0021350 3300048091 Bacteria 3212
1683 Ga0495626_0022785 3300048091 Bacteria 3091
1684 Ga0495626_0040841 3300048091 Bacteria 2189
1685 Ga0495626_0044118 3300048091 Bacteria 2088
1686 Ga0495626_0055982 3300048091 Bacteria 1806
1687 Ga0495626_0060164 3300048091 Bacteria 1731
1688 Ga0495626_0073481 3300048091 Bacteria 1531
1689 Ga0495626_0073528 3300048091 Bacteria 1531
1690 Ga0495626_0083647 3300048091 Bacteria 1413
1691 Ga0495626_0084714 3300048091 Bacteria 1402
1692 Ga0495626_0096000 3300048091 Bacteria 1297
1693 Ga0495626_0097284 3300048091 Bacteria 1287
1694 Ga0495626_0126416 3300048091 Bacteria 1095
1695 Ga0495626_0202562 3300048091 Bacteria 813
1696 Ga0495626_0212790 3300048091 Bacteria 788
1697 Ga0495626_0290644 3300048091 Bacteria 647
1698 Ga0496100_0067106 3300048903 Bacteria 2381
1699 Ga0496100_0111532 3300048903 Bacteria 1901
1700 Ga0496100_0114800 3300048903 Bacteria 1876
1701 Ga0496100_0275250 3300048903 Bacteria 1253
1702 Ga0496100_0294264 3300048903 Bacteria 1213
1703 Ga0496100_0641645 3300048903 Bacteria 826
1704 Ga0496101_0009727 3300048904 Bacteria 6329
1705 Ga0496101_0046173 3300048904 Bacteria 3123
1706 Ga0496101_0211964 3300048904 Bacteria 1501
1707 Ga0496101_0560311 3300048904 Bacteria 903
1708 Ga0496101_0907796 3300048904 Bacteria 693
1709 Ga0496101_1140934 3300048904 Bacteria 611
1710 Ga0496102_0006537 3300048905 Bacteria 9950
1711 Ga0496102_0039654 3300048905 Bacteria 4256
1712 Ga0496102_0075112 3300048905 Bacteria 3106
1713 Ga0496102_0092053 3300048905 Bacteria 2807
1714 Ga0496102_0197397 3300048905 Bacteria 1896
1715 Ga0496102_0214439 3300048905 Bacteria 1814
1716 Ga0496102_0413289 3300048905 Bacteria 1267
1717 Ga0496102_1758156 3300048905 Bacteria 537
1718 Ga0496103_0003318 3300048906 Bacteria 9844
1719 Ga0496103_0017021 3300048906 Bacteria 4345
1720 Ga0496103_0032288 3300048906 Bacteria 3195
1721 Ga0496103_0038283 3300048906 Bacteria 2942
1722 Ga0496103_0155309 3300048906 Bacteria 1466
1723 Ga0496103_0210497 3300048906 Bacteria 1250
1724 Ga0496103_0343097 3300048906 Bacteria 960
1725 Ga0496103_0426401 3300048906 Bacteria 851
1726 Ga0496104_0018044 3300048907 Bacteria 6433
1727 Ga0496104_0336166 3300048907 Bacteria 1423
1728 Ga0496104_0505298 3300048907 Bacteria 1120
1729 Ga0496104_0651804 3300048907 Bacteria 962
1730 Ga0496104_0807072 3300048907 Bacteria 844
1731 Ga0496104_1163973 3300048907 Bacteria 674
1732 Ga0496105_0035800 3300048908 Bacteria 4087
1733 Ga0496105_0223701 3300048908 Bacteria 1531
1734 Ga0496105_0350800 3300048908 Bacteria 1178
1735 Ga0496106_0006711 3300048909 Bacteria 8526
1736 Ga0496106_0036102 3300048909 Bacteria 3697
1737 Ga0496106_0042023 3300048909 Bacteria 3427
1738 Ga0496106_0171980 3300048909 Bacteria 1717
1739 Ga0496106_0691124 3300048909 Bacteria 813
1740 Ga0496107_0069085 3300048910 Bacteria 2564
1741 Ga0496107_0088073 3300048910 Bacteria 2266
1742 Ga0496107_0160774 3300048910 Bacteria 1664
1743 Ga0496107_0222414 3300048910 Bacteria 1404
1744 Ga0496107_0848596 3300048910 Bacteria 667
1745 Ga0496108_0409678 3300048911 Bacteria 1184
1746 Ga0496108_1331530 3300048911 Bacteria 603
1747 Ga0496109_0042732 3300048912 Bacteria 4107
1748 Ga0496109_0548480 3300048912 Bacteria 1090
1749 Ga0496110_0032653 3300048913 Bacteria 4498
1750 Ga0496110_0294723 3300048913 Bacteria 1478
1751 Ga0496110_0456356 3300048913 Bacteria 1164
1752 Ga0496110_0457031 3300048913 Bacteria 1163
1753 Ga0496110_0794302 3300048913 Bacteria 851
1754 Ga0496110_1205357 3300048913 Bacteria 666
1755 Ga0496110_1261699 3300048913 Bacteria 648
1756 Ga0496111_0013924 3300048914 Bacteria 5484
1757 Ga0496111_0408873 3300048914 Bacteria 1003
1758 Ga0496111_0830563 3300048914 Bacteria 668
1759 Ga0496112_0014789 3300048915 Bacteria 7256
1760 Ga0496112_0196015 3300048915 Bacteria 1980
1761 Ga0496112_0529748 3300048915 Bacteria 1112
1762 Ga0496113_0023586 3300048916 Bacteria 4363
1763 Ga0496113_0027568 3300048916 Bacteria 4073
1764 Ga0496113_0173984 3300048916 Bacteria 1705
1765 Ga0496113_0274888 3300048916 Bacteria 1347
1766 Ga0496113_0476254 3300048916 Bacteria 1003
1767 Ga0496113_0757937 3300048916 Bacteria 772
1768 Ga0496114_0018505 3300048917 Bacteria 5633
1769 Ga0496114_0091484 3300048917 Bacteria 2584
1770 Ga0496114_0372797 3300048917 Bacteria 1263
1771 Ga0496114_0845291 3300048917 Bacteria 795
1772 Ga0496115_0040092 3300048918 Bacteria 3721
1773 Ga0496115_0062017 3300048918 Bacteria 3015
1774 Ga0496115_0131007 3300048918 Bacteria 2067
1775 Ga0496115_0131327 3300048918 Bacteria 2064
1776 Ga0496115_0254757 3300048918 Bacteria 1444
1777 Ga0496115_0376151 3300048918 Bacteria 1156
1778 Ga0496115_0379901 3300048918 Bacteria 1149
1779 Ga0496115_0431565 3300048918 Bacteria 1066
1780 Ga0496115_0532444 3300048918 Bacteria 941
1781 Ga0496115_0572610 3300048918 Bacteria 900
1782 Ga0496115_0608123 3300048918 Bacteria 868
1783 Ga0496116_0006663 3300048919 Bacteria 10425
1784 Ga0496116_0032654 3300048919 Bacteria 3706
1785 Ga0496116_0054709 3300048919 Bacteria 2626
1786 Ga0496116_0120515 3300048919 Bacteria 1519
1787 Ga0496116_0122217 3300048919 Bacteria 1504
1788 Ga0496116_0174618 3300048919 Bacteria 1159
1789 Ga0496116_0226636 3300048919 Bacteria 952
1790 Ga0496116_0393203 3300048919 Bacteria 617
1791 Ga0496117_0002850 3300048920 Bacteria 21031
1792 Ga0496117_0029031 3300048920 Bacteria 4270
1793 Ga0496117_0104585 3300048920 Bacteria 1781
1794 Ga0496118_0010366 3300048921 Bacteria 9235
1795 Ga0496118_0027422 3300048921 Bacteria 4820
1796 Ga0496118_0039741 3300048921 Bacteria 3750
1797 Ga0496118_0100694 3300048921 Bacteria 1953
1798 Ga0496118_0127248 3300048921 Bacteria 1644
1799 Ga0496118_0201720 3300048921 Bacteria 1177
1800 Ga0496118_0207405 3300048921 Bacteria 1153
1801 Ga0496119_0006975 3300048922 Bacteria 10299
1802 Ga0496119_0033005 3300048922 Bacteria 3441
1803 Ga0496119_0151658 3300048922 Bacteria 1241
1804 Ga0496119_0188727 3300048922 Bacteria 1075
1805 Ga0496120_0152393 3300048923 Bacteria 1160
1806 Ga0496120_0182412 3300048923 Bacteria 1029
1807 Ga0496120_0264386 3300048923 Bacteria 802
1808 Ga0496121_0002928 3300048924 Bacteria 24987
1809 Ga0496121_0015151 3300048924 Bacteria 8107
1810 Ga0496121_0023493 3300048924 Bacteria 5935
1811 Ga0496121_0031966 3300048924 Bacteria 4796
1812 Ga0496121_0040564 3300048924 Bacteria 4081
1813 Ga0496121_0060060 3300048924 Bacteria 3130
1814 Ga0496121_0064627 3300048924 Bacteria 2982
1815 Ga0496121_0233788 3300048924 Bacteria 1285
1816 Ga0496121_0672503 3300048924 Bacteria 627
1817 Ga0496122_0002652 3300048925 Bacteria 24985
1818 Ga0496122_0006384 3300048925 Bacteria 13553
1819 Ga0496122_0045238 3300048925 Bacteria 3423
1820 Ga0496122_0117785 3300048925 Bacteria 1723
1821 Ga0496122_0241896 3300048925 Bacteria 1017
1822 Ga0496123_0007601 3300048926 Bacteria 10151
1823 Ga0496123_0011446 3300048926 Bacteria 7687
1824 Ga0496123_0024316 3300048926 Bacteria 4607
1825 Ga0496123_0031548 3300048926 Bacteria 3853
1826 Ga0496123_0050572 3300048926 Bacteria 2775
1827 Ga0496124_0035888 3300048927 Bacteria 4332
1828 Ga0496124_0042938 3300048927 Bacteria 3889
1829 Ga0496124_0052609 3300048927 Bacteria 3458
1830 Ga0496124_0080875 3300048927 Bacteria 2672
1831 Ga0496124_0083920 3300048927 Bacteria 2613
1832 Ga0496124_0089738 3300048927 Bacteria 2509
1833 Ga0496124_0235447 3300048927 Bacteria 1365
1834 Ga0496124_0237303 3300048927 Bacteria 1358
1835 Ga0496124_0317340 3300048927 Bacteria 1117
1836 Ga0496124_0542713 3300048927 Bacteria 769
1837 Ga0496125_0001934 3300048928 Bacteria 28316
1838 Ga0496125_0005068 3300048928 Bacteria 14849
1839 Ga0496125_0134373 3300048928 Bacteria 1733
1840 Ga0496125_0164527 3300048928 Bacteria 1501
1841 Ga0496125_0177292 3300048928 Bacteria 1424
1842 Ga0496125_0253014 3300048928 Bacteria 1110
1843 Ga0496125_0412167 3300048928 Bacteria 786
1844 Ga0496126_0004622 3300048929 Bacteria 16312
1845 Ga0496126_0005787 3300048929 Bacteria 13974
1846 Ga0496126_0007973 3300048929 Bacteria 11505
1847 Ga0496126_0031015 3300048929 Bacteria 5056
1848 Ga0496126_0051319 3300048929 Bacteria 3755
1849 Ga0496126_0090828 3300048929 Bacteria 2686
1850 Ga0496126_0173352 3300048929 Bacteria 1836
1851 Ga0496126_0763102 3300048929 Bacteria 745
1852 Ga0501306_000005 3300049127 Bacteria 11576
1853 Ga0501306_000357 3300049127 Bacteria 3332
1854 Ga0501306_000359 3300049127 Bacteria 3323
1855 Ga0501306_002633 3300049127 Bacteria 1863
1856 Ga0501306_006022 3300049127 Bacteria 1409
1857 Ga0501306_051944 3300049127 Bacteria 659
1858 Ga0501306_104473 3300049127 Bacteria 509
1859 Ga0501308_000002 3300049128 Bacteria 13277
1860 Ga0501308_000101 3300049128 Bacteria 3987
1861 Ga0501308_001514 3300049128 Bacteria 1877
1862 Ga0501308_005869 3300049128 Bacteria 1240
1863 Ga0501309_000053 3300049129 Bacteria 5860
1864 Ga0501309_000994 3300049129 Bacteria 2589
1865 Ga0501309_008348 3300049129 Bacteria 1302
1866 Ga0501309_018310 3300049129 Bacteria 967
1867 Ga0501310_000065 3300049130 Bacteria 9861
1868 Ga0501310_000908 3300049130 Bacteria 2638
1869 Ga0501310_001119 3300049130 Bacteria 2408
1870 Ga0501310_001494 3300049130 Bacteria 2132
1871 Ga0501310_005775 3300049130 Bacteria 1278
1872 Ga0501310_006883 3300049130 Bacteria 1204
1873 Ga0501343_001045 3300049132 Bacteria 1805
1874 Ga0501343_003853 3300049132 Bacteria 1115
1875 Ga0501304_000001 3300049160 Bacteria 14569
1876 Ga0501304_000110 3300049160 Bacteria 3123
1877 Ga0501305_000138 3300049161 Bacteria 4738
1878 Ga0501305_001754 3300049161 Bacteria 2204
1879 Ga0501305_002625 3300049161 Bacteria 1958
1880 Ga0501307_000084 3300049162 Bacteria 4158
1881 Ga0501307_000295 3300049162 Bacteria 3069
1882 Ga0501307_000470 3300049162 Bacteria 2735
1883 Ga0501307_000643 3300049162 Bacteria 2526
1884 Ga0501307_008590 3300049162 Bacteria 1151
1885 Ga0501307_027472 3300049162 Bacteria 774
1886 Ga0495678_000010 3300049459 Bacteria 357896
1887 Ga0495678_006058 3300049459 Bacteria 6512
1888 Ga0495678_006909 3300049459 Bacteria 5955
1889 Ga0495678_008007 3300049459 Bacteria 5399
1890 Ga0495678_016621 3300049459 Bacteria 3359
1891 Ga0495678_016940 3300049459 Bacteria 3315
1892 Ga0495678_021632 3300049459 Bacteria 2828
1893 Ga0495678_031895 3300049459 Bacteria 2191
1894 Ga0495678_052645 3300049459 Bacteria 1566
1895 Ga0495678_058254 3300049459 Bacteria 1460
1896 Ga0495678_093588 3300049459 Bacteria 1053
1897 Ga0495678_172811 3300049459 Bacteria 682
1898 Ga0495678_187690 3300049459 Bacteria 644
1899 Ga0495682_0003087 3300049460 Bacteria 7552
1900 Ga0495682_0003914 3300049460 Bacteria 6501
1901 Ga0495682_0006686 3300049460 Bacteria 4656
1902 Ga0495682_0015613 3300049460 Bacteria 2877
1903 Ga0495682_0067593 3300049460 Bacteria 1287
1904 Ga0495682_0128104 3300049460 Bacteria 908
1905 Ga0501292_002630 3300049515 Bacteria 2332
1906 Ga0501298_064091 3300049521 Bacteria 783
1907 Ga0501303_013329 3300049526 Bacteria 802
1908 Ga0501311_000002 3300049527 Bacteria 12093
1909 Ga0501311_002478 3300049527 Bacteria 1773
1910 Ga0501311_024768 3300049527 Bacteria 837
1911 Ga0501312_000249 3300049528 Bacteria 3886
1912 Ga0501312_004300 3300049528 Bacteria 1670
1913 Ga0501312_006986 3300049528 Bacteria 1426
1914 Ga0501312_009302 3300049528 Bacteria 1293
1915 Ga0501313_000292 3300049529 Bacteria 3129
1916 Ga0501313_000495 3300049529 Bacteria 2736
1917 Ga0501313_000546 3300049529 Bacteria 2658
1918 Ga0501313_031015 3300049529 Bacteria 693
1919 Ga0501314_001218 3300049530 Bacteria 1825
1920 Ga0501314_002963 3300049530 Bacteria 1345
1921 Ga0501314_015087 3300049530 Bacteria 762
1922 Ga0501315_000004 3300049531 Bacteria 11326
1923 Ga0501315_000754 3300049531 Bacteria 2426
1924 Ga0501315_003030 3300049531 Bacteria 1647
1925 Ga0501315_005958 3300049531 Bacteria 1340
1926 Ga0501315_012600 3300049531 Bacteria 1048
1927 Ga0501315_045069 3300049531 Bacteria 678
1928 Ga0501315_051891 3300049531 Bacteria 646
1929 Ga0501316_000002 3300049532 Bacteria 13278
1930 Ga0501316_001189 3300049532 Bacteria 2134
1931 Ga0501316_001227 3300049532 Bacteria 2118
1932 Ga0501316_026469 3300049532 Bacteria 759
1933 Ga0501317_000290 3300049533 Bacteria 3266
1934 Ga0501317_002431 3300049533 Bacteria 1759
1935 Ga0501317_007694 3300049533 Bacteria 1223
1936 Ga0501318_000040 3300049534 Bacteria 5307
1937 Ga0501318_001648 3300049534 Bacteria 1802
1938 Ga0501319_000027 3300049535 Bacteria 4992
1939 Ga0501319_025246 3300049535 Bacteria 551
1940 Ga0501320_001179 3300049536 Bacteria 1838
1941 Ga0501320_001910 3300049536 Bacteria 1600
1942 Ga0501320_003292 3300049536 Bacteria 1359
1943 Ga0501320_009368 3300049536 Bacteria 979
1944 Ga0501321_001759 3300049537 Bacteria 1786
1945 Ga0501321_005466 3300049537 Bacteria 1258
1946 Ga0501321_005923 3300049537 Bacteria 1226
1947 Ga0501322_010033 3300049538 Bacteria 724
1948 Ga0501322_012491 3300049538 Bacteria 676
1949 Ga0501323_000015 3300049539 Bacteria 8085
1950 Ga0501323_000822 3300049539 Bacteria 2504
1951 Ga0501323_001128 3300049539 Bacteria 2270
1952 Ga0501323_002535 3300049539 Bacteria 1781
1953 Ga0501323_006919 3300049539 Bacteria 1280
1954 Ga0501323_012755 3300049539 Bacteria 1030
1955 Ga0501323_017279 3300049539 Bacteria 926
1956 Ga0501324_015903 3300049540 Bacteria 734
1957 Ga0501324_021834 3300049540 Bacteria 659
1958 Ga0501325_005953 3300049541 Bacteria 986
1959 Ga0501326_05772 3300049542 Bacteria 680
1960 Ga0501327_00336 3300049543 Bacteria 1781
1961 Ga0501330_000369 3300049546 Bacteria 1841
1962 Ga0501334_11546 3300049550 Bacteria 648
1963 Ga0501335_003176 3300049551 Bacteria 1380
1964 Ga0501335_022410 3300049551 Bacteria 680
1965 Ga0501336_000669 3300049552 Bacteria 1807
1966 Ga0501336_001280 3300049552 Bacteria 1472
1967 Ga0501337_000673 3300049553 Bacteria 1774
1968 Ga0501337_024160 3300049553 Bacteria 506
1969 Ga0501340_003556 3300049556 Bacteria 951
1970 Ga0501032_0051651 3300049569 Bacteria 2772
1971 Ga0501032_0244711 3300049569 Bacteria 1165
1972 Ga0501033_0032115 3300049570 Bacteria 3942
1973 Ga0501033_0187485 3300049570 Bacteria 1481
1974 Ga0501034_0944157 3300049571 Bacteria 749
1975 Ga0501034_1182171 3300049571 Bacteria 644
1976 Ga0501036_0283908 3300049572 Bacteria 1385
1977 Ga0501036_0375199 3300049572 Bacteria 1187
1978 Ga0501037_0403748 3300049573 Bacteria 937
1979 Ga0501038_0184283 3300049574 Bacteria 1683
1980 Ga0501038_0388532 3300049574 Bacteria 1081
1981 Ga0501038_0681881 3300049574 Bacteria 771
1982 Ga0501043_0311069 3300049579 Bacteria 1202
1983 Ga0501047_0017972 3300049581 Bacteria 6777
1984 Ga0501047_0408279 3300049581 Bacteria 1191
1985 Ga0501048_0110710 3300049582 Bacteria 1939
1986 Ga0501207_010936 3300049654 Bacteria 1345
1987 Ga0501210_004862 3300049657 Bacteria 941
1988 Ga0501211_006351 3300049658 Bacteria 1172
1989 Ga0501217_133450 3300049661 Bacteria 730
1990 Ga0501222_005375 3300049662 Bacteria 1730
1991 Ga0501230_002593 3300049667 Bacteria 2321
1992 Ga0501233_077131 3300049668 Bacteria 853
1993 Ga0501238_000213 3300049671 Bacteria 8393
1994 Ga0501249_002499 3300049679 Bacteria 3714
1995 Ga0501257_034882 3300049686 Bacteria 1222
1996 Ga0501221_018188 3300049704 Bacteria 1351
1997 Ga0501263_018035 3300049760 Bacteria 931
1998 Ga0501269_000003 3300049766 Bacteria 111299
1999 Ga0501279_001682 3300049775 Bacteria 2912
2000 Ga0501279_019904 3300049775 Bacteria 951
2001 Ga0501035_0010452 3300049822 Bacteria 8602
2002 Ga0501035_0010523 3300049822 Bacteria 8572
2003 Ga0501035_0011202 3300049822 Bacteria 8305
2004 Ga0501035_0314676 3300049822 Bacteria 1316
2005 Ga0501044_0000210 3300049823 Bacteria 74323
2006 Ga0501044_0024898 3300049823 Bacteria 6347
2007 Ga0501044_0078211 3300049823 Bacteria 3352
2008 Ga0501044_0358594 3300049823 Bacteria 1376
2009 Ga0501044_0853919 3300049823 Bacteria 787
2010 Ga0501226_005181 3300049853 Bacteria 1494
2011 nmdc:mga03683_216870_c1 3300050489 Bacteria 882
2012 nmdc:mga03n38_298936_c1 3300050490 Bacteria 864
2013 nmdc:mga03n38_4317_c1 3300050490 Bacteria 4691
2014 nmdc:mga00v17_12098_c1 3300050491 Bacteria 4754
2015 nmdc:mga00v17_184456_c1 3300050491 Bacteria 1347
2016 nmdc:mga0k408_139838_c1 3300050493 Bacteria 1440
2017 nmdc:mga0k408_43703_c1 3300050493 Bacteria 2583
2018 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
2019 nmdc:mga0k408_98510_c1 3300050493 Bacteria 1723
2020 nmdc:mga06z11_1936_c1 3300050494 Bacteria 7811
2021 nmdc:mga07m45_13904_c1 3300050496 Bacteria 4278
2022 nmdc:mga07m45_45273_c1 3300050496 Bacteria 2470
2023 nmdc:mga07m45_521668_c1 3300050496 Bacteria 688
2024 nmdc:mga07m45_6867_c1 3300050496 Bacteria 5791
2025 nmdc:mga05p37_434571_c1 3300050507 Bacteria 1524
2026 nmdc:mga05p37_750093_c1 3300050507 Bacteria 1076
2027 nmdc:mga08y16_79438_c1 3300050511 Bacteria 3419
2028 nmdc:mga0n895_56341_c1 3300050512 Bacteria 3872
2029 nmdc:mga08x19_336538_c1 3300050514 Bacteria 1052
2030 nmdc:mga0a205_171614_c1 3300050515 Bacteria 2065
2031 nmdc:mga0sz30_439069_c1 3300050516 Bacteria 586
2032 Ga0495655_0104305 3300053083 Bacteria 844
2033 Ga0500644_0035969 3300053088 Bacteria 1608
2034 Ga0500646_0009238 3300053090 Bacteria 2523
2035 Ga0500641_0039435 3300053096 Bacteria 1903
2036 Ga0500650_0075460 3300053098 Bacteria 1576
2037 Ga0500555_069725 3300053103 Bacteria 929
2038 Ga0500618_003056 3300053125 Bacteria 5938
2039 Ga0500628_002187 3300053129 Bacteria 3263
2040 Ga0500655_002279 3300053133 Bacteria 3523
2041 Ga0500559_0103340 3300053136 Bacteria 1315
2042 Ga0500568_0055223 3300053139 Bacteria 1551
2043 Ga0500573_0439913 3300053140 Bacteria 606
2044 Ga0500577_0289774 3300053142 Bacteria 714
2045 Ga0500586_017865 3300053145 Bacteria 2178
2046 Ga0500600_0129045 3300053149 Bacteria 1290
2047 Ga0500604_0000352 3300053151 Bacteria 12731
2048 Ga0500616_0170867 3300053153 Bacteria 987
2049 Ga0500619_138164 3300053154 Bacteria 830
2050 Ga0500622_0000002 3300053156 Bacteria 646442
2051 Ga0500622_0060471 3300053156 Bacteria 1933
2052 Ga0500622_0103807 3300053156 Bacteria 1396
2053 Ga0500645_035372 3300053730 Bacteria 1488
2054 Ga0500645_191047 3300053730 Bacteria 554
2055 Ga0500565_012675 3300053734 Bacteria 901
2056 Ga0587084_000161 3300059477 Bacteria 4157
2057 Ga0587084_001109 3300059477 Bacteria 2453
2058 Ga0587084_002020 3300059477 Bacteria 2038
2059 Ga0587084_098994 3300059477 Bacteria 589
2060 Ga0587093_081804 3300059478 Bacteria 558
2061 Ga0587066_000001 3300059490 Bacteria 11779
2062 Ga0587070_000065 3300059491 Bacteria 5371
2063 Ga0587070_075589 3300059491 Bacteria 728
2064 Ga0587070_092774 3300059491 Bacteria 682
2065 Ga0587073_0001671 3300059492 Bacteria 2662
2066 Ga0587073_0129733 3300059492 Bacteria 691
2067 Ga0587077_001151 3300059493 Bacteria 2731
2068 Ga0587077_020126 3300059493 Bacteria 1169
2069 Ga0587080_002147 3300059503 Bacteria 2280
2070 Ga0587080_077620 3300059503 Bacteria 676
2071 Ga0587082_000884 3300059504 Bacteria 2839
2072 Ga0587083_0000094 3300059505 Bacteria 5249
2073 Ga0587083_0000200 3300059505 Bacteria 4379
2074 Ga0587083_0069435 3300059505 Bacteria 814
2075 Ga0587085_021468 3300059506 Bacteria 987
2076 Ga0587086_066732 3300059507 Bacteria 610
2077 Ga0587088_000001 3300059508 Bacteria 14678
2078 Ga0587088_037690 3300059508 Bacteria 896
2079 Ga0587089_043032 3300059509 Bacteria 704
2080 Ga0587090_008198 3300059510 Bacteria 1394
2081 Ga0587091_000335 3300059511 Bacteria 3779
2082 Ga0587091_096258 3300059511 Bacteria 687
2083 Ga0587092_006055 3300059512 Bacteria 1517
2084 Ga0587098_001373 3300059604 Bacteria 1852
2085 Ga0587098_009967 3300059604 Bacteria 1043
2086 Ga0587098_038216 3300059604 Bacteria 688
2087 Ga0587106_000819 3300059605 Bacteria 2456
2088 Ga0587106_008375 3300059605 Bacteria 1284
2089 Ga0587125_003092 3300059607 Bacteria 1390
2090 Ga0587099_000096 3300059622 Bacteria 3472
2091 Ga0587101_005751 3300059623 Bacteria 1390
2092 Ga0587117_015850 3300059627 Bacteria 996
2093 Ga0587128_000098 3300059630 Bacteria 4404
2094 Ga0587128_007622 3300059630 Bacteria 1374
2095 Ga0587062_016401 3300059639 Bacteria 1001
2096 Ga0587062_038847 3300059639 Bacteria 764
2097 Ga0587067_000303 3300059640 Bacteria 4022
2098 Ga0587067_017051 3300059640 Bacteria 1201
2099 Ga0587068_000002 3300059641 Bacteria 13671
2100 Ga0587068_000145 3300059641 Bacteria 5029
2101 Ga0587068_000228 3300059641 Bacteria 4429
2102 Ga0587068_005731 3300059641 Bacteria 1708
2103 Ga0587069_001414 3300059642 Bacteria 2197
2104 Ga0587069_004834 3300059642 Bacteria 1537
2105 Ga0587072_001765 3300059643 Bacteria 2769
2106 Ga0587072_003430 3300059643 Bacteria 2226
2107 Ga0587072_005754 3300059643 Bacteria 1863
2108 Ga0587075_000434 3300059644 Bacteria 3285
2109 Ga0587076_000914 3300059645 Bacteria 2766
2110 Ga0587076_004751 3300059645 Bacteria 1717
2111 Ga0587078_000693 3300059646 Bacteria 2693
2112 Ga0587078_011692 3300059646 Bacteria 1023
2113 Ga0587078_045061 3300059646 Bacteria 633
2114 Ga0587079_000913 3300059647 Bacteria 3025
2115 Ga0587079_011093 3300059647 Bacteria 1443
2116 Ga0587079_034989 3300059647 Bacteria 986
2117 Ga0587079_037199 3300059647 Bacteria 966
2118 Ga0587100_007975 3300059648 Bacteria 848
2119 Ga0587102_019683 3300059649 Bacteria 752
2120 Ga0587107_000137 3300059652 Bacteria 3765
2121 Ga0587107_051316 3300059652 Bacteria 700
2122 Ga0587114_004063 3300059655 Bacteria 1499
2123 Ga0587071_000116 3300060344 Bacteria 5683
2124 Ga0587071_183420 3300060344 Bacteria 539
2125 Ga0587111_0000227 3300060346 Bacteria 4609
2126 Ga0587111_0000229 3300060346 Bacteria 4601
2127 Ga0587111_0002272 3300060346 Bacteria 2528
2128 Ga0587111_0017972 3300060346 Bacteria 1324
2129 Ga0466962_0001202 3300061719 Bacteria 11897
2130 Ga0466962_0016232 3300061719 Bacteria 3591
2131 Ga0466962_0029411 3300061719 Bacteria 2630
2132 Ga0466962_0147138 3300061719 Bacteria 1142
2133 Ga0466962_0464838 3300061719 Bacteria 638

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0009238 Ga0500646_0009238_595_1074 104
2 3300053098 Ga0500650_0075460 Ga0500650_0075460_724_1203 104
3 3300053103 Ga0500555_069725 Ga0500555_069725_230_709 104
4 3300053133 Ga0500655_002279 Ga0500655_002279_2466_2945 104
5 3300053151 Ga0500604_0000352 Ga0500604_0000352_2543_3022 104
6 3300053156 Ga0500622_0103807 Ga0500622_0103807_240_719 104
7 3300053730 Ga0500645_035372 Ga0500645_035372_930_1409 104
8 3300005334 Ga0068869_100000239 Ga0068869_10000023921 106
9 3300005335 Ga0070666_10851489 Ga0070666_108514891 106
10 3300005338 Ga0068868_100019350 Ga0068868_1000193502 106
11 3300005340 Ga0070689_101355443 Ga0070689_1013554432 106
12 3300005353 Ga0070669_100767176 Ga0070669_1007671762 106
13 3300005364 Ga0070673_100420566 Ga0070673_1004205663 106
14 3300005365 Ga0070688_100394510 Ga0070688_1003945103 106
15 3300005444 Ga0070694_100214288 Ga0070694_1002142882 106
16 3300005456 Ga0070678_100045788 Ga0070678_1000457882 106
17 3300005548 Ga0070665_100442535 Ga0070665_1004425352 106
18 3300005618 Ga0068864_101369740 Ga0068864_1013697402 106
19 3300005841 Ga0068863_100046276 Ga0068863_1000462768 106
20 3300005842 Ga0068858_100013226 Ga0068858_1000132269 106
21 3300005844 Ga0068862_100708291 Ga0068862_1007082912 106
22 3300006358 Ga0068871_100003989 Ga0068871_1000039899 106
23 3300009098 Ga0105245_10323321 Ga0105245_103233211 106
24 3300009177 Ga0105248_10010314 Ga0105248_100103149 106
25 3300013296 Ga0157374_10032559 Ga0157374_100325595 106
26 3300013297 Ga0157378_10097687 Ga0157378_100976872 106
27 3300014325 Ga0163163_10812622 Ga0163163_108126221 106
28 3300014969 Ga0157376_10069893 Ga0157376_100698935 106
29 3300025903 Ga0207680_10716637 Ga0207680_107166372 106
30 3300025927 Ga0207687_10187681 Ga0207687_101876814 106
31 3300025941 Ga0207711_10105192 Ga0207711_101051923 106
32 3300025942 Ga0207689_10000370 Ga0207689_1000037022 106
33 3300025960 Ga0207651_10446093 Ga0207651_104460933 106
34 3300025986 Ga0207658_11175935 Ga0207658_111759352 106
35 3300026023 Ga0207677_10006249 Ga0207677_1000624910 106
36 3300026035 Ga0207703_10041315 Ga0207703_100413153 106
37 3300026095 Ga0207676_10813761 Ga0207676_108137613 106
38 3300026121 Ga0207683_10065088 Ga0207683_100650882 106
39 3300028380 Ga0268265_10565558 Ga0268265_105655582 106
40 3300013308 Ga0157375_11027771 Ga0157375_110277713 107
41 3300005331 Ga0070670_100588559 Ga0070670_1005885591 108
42 3300005843 Ga0068860_100019846 Ga0068860_1000198462 108
43 3300014325 Ga0163163_10694503 Ga0163163_106945032 108
44 3300025925 Ga0207650_10291854 Ga0207650_102918542 108
45 3300013308 Ga0157375_10411520 Ga0157375_104115203 110
46 3300041512 Ga0451853_0562209 Ga0451853_0562209_320_790 110
47 3300025945 Ga0207679_11677414 Ga0207679_116774141 112
48 3300046683 Ga0495658_0558190 Ga0495658_0558190_121_567 112
49 3300050493 nmdc:mga0k408_712_c1 nmdc:mga0k408_712_c1_5833_6300 112
50 3300013308 Ga0157375_12256222 Ga0157375_122562222 114
51 3300026118 Ga0207675_101338134 Ga0207675_1013381342 114
52 3300026089 Ga0207648_10873460 Ga0207648_108734602 115
53 3300026095 Ga0207676_10231338 Ga0207676_102313383 115
54 3300028794 Ga0307515_10276308 Ga0307515_102763082 115
55 3300041461 Ga0451805_077998 Ga0451805_077998_247_678 115
56 3300042876 Ga0451577_0128321 Ga0451577_0128321_296_733 115
57 3300044712 Ga0453684_0456100 Ga0453684_0456100_961_1398 115
58 3300045051 Ga0451576_0280918 Ga0451576_0280918_589_1026 115
59 3300003790 Ga0055528_1029760 Ga0055528_10297603 116
60 3300005330 Ga0070690_100665097 Ga0070690_1006650972 116
61 3300005467 Ga0070706_100494586 Ga0070706_1004945861 116
62 3300005518 Ga0070699_100041691 Ga0070699_1000416913 116
63 3300005518 Ga0070699_100085640 Ga0070699_1000856403 116
64 3300009147 Ga0114129_10905627 Ga0114129_109056272 116
65 3300009147 Ga0114129_11391926 Ga0114129_113919262 116
66 3300013296 Ga0157374_10130817 Ga0157374_101308171 116
67 3300013297 Ga0157378_12622117 Ga0157378_126221171 116
68 3300013306 Ga0163162_11126646 Ga0163162_111266461 116
69 3300013308 Ga0157375_10514513 Ga0157375_105145131 116
70 3300014969 Ga0157376_10493710 Ga0157376_104937102 116
71 3300025910 Ga0207684_10567778 Ga0207684_105677783 116
72 3300025922 Ga0207646_10808223 Ga0207646_108082231 116
73 3300025938 Ga0207704_11259073 Ga0207704_112590731 116
74 3300032126 Ga0307415_101279947 Ga0307415_1012799471 116
75 3300035725 Ga0373947_0765701 Ga0373947_0765701_184_618 116
76 3300046683 Ga0495658_0289894 Ga0495658_0289894_236_703 116
77 3300050507 nmdc:mga05p37_434571_c1 nmdc:mga05p37_434571_c1_423_869 116
78 3300050507 nmdc:mga05p37_750093_c1 nmdc:mga05p37_750093_c1_156_602 116
79 3300003203 JGI25406J46586_10002509 JGI25406J46586_1000250916 117
80 3300003203 JGI25406J46586_10005813 JGI25406J46586_100058132 117
81 3300005290 Ga0065712_10086127 Ga0065712_100861272 117
82 3300005295 Ga0065707_10200663 Ga0065707_102006633 117
83 3300005618 Ga0068864_102390113 Ga0068864_1023901131 117
84 3300005985 Ga0081539_10000142 Ga0081539_1000014288 117
85 3300005985 Ga0081539_10000215 Ga0081539_10000215135 117
86 3300005985 Ga0081539_10003297 Ga0081539_100032973 117
87 3300006852 Ga0075433_10131861 Ga0075433_101318613 117
88 3300006852 Ga0075433_10263794 Ga0075433_102637942 117
89 3300006871 Ga0075434_100017973 Ga0075434_1000179733 117
90 3300007076 Ga0075435_100031259 Ga0075435_1000312592 117
91 3300009094 Ga0111539_10063652 Ga0111539_100636524 117
92 3300009177 Ga0105248_11153309 Ga0105248_111533092 117
93 3300031548 Ga0307408_100292357 Ga0307408_1002923572 117
94 3300031731 Ga0307405_10394290 Ga0307405_103942902 117
95 3300031901 Ga0307406_10400159 Ga0307406_104001592 117
96 3300032002 Ga0307416_100003624 Ga0307416_10000362414 117
97 3300032005 Ga0307411_10487888 Ga0307411_104878882 117
98 3300039437 Ga0436365_1248808 Ga0436365_1248808_42_518 117
99 3300042876 Ga0451577_0283539 Ga0451577_0283539_151_594 117
100 3300045051 Ga0451576_0100286 Ga0451576_0100286_51_494 117
101 3300048913 Ga0496110_1205357 Ga0496110_1205357_12_455 117
102 3300049521 Ga0501298_064091 Ga0501298_064091_205_657 117
103 3300050511 nmdc:mga08y16_79438_c1 nmdc:mga08y16_79438_c1_1750_2199 117
104 3300050512 nmdc:mga0n895_56341_c1 nmdc:mga0n895_56341_c1_755_1198 117
105 3300050514 nmdc:mga08x19_336538_c1 nmdc:mga08x19_336538_c1_204_647 117
106 3300050515 nmdc:mga0a205_171614_c1 nmdc:mga0a205_171614_c1_1577_2026 117
107 3300005331 Ga0070670_100436011 Ga0070670_1004360112 118
108 3300005564 Ga0070664_100010409 Ga0070664_1000104094 118
109 3300009177 Ga0105248_10562764 Ga0105248_105627643 118
110 3300013102 Ga0157371_10058062 Ga0157371_100580623 118
111 3300025932 Ga0207690_10823820 Ga0207690_108238201 118
112 3300026121 Ga0207683_10351656 Ga0207683_103516563 118
113 3300031731 Ga0307405_10964520 Ga0307405_109645202 118
114 3300053139 Ga0500568_0055223 Ga0500568_0055223_857_1330 118
115 3300005366 Ga0070659_100766022 Ga0070659_1007660222 119
116 3300025932 Ga0207690_10619049 Ga0207690_106190492 119
117 3300014969 Ga0157376_11933336 Ga0157376_119333361 120
118 3300025941 Ga0207711_10582575 Ga0207711_105825751 120
119 3300031911 Ga0307412_10011111 Ga0307412_100111118 120
120 3300037312 Ga0395899_0005268 Ga0395899_0005268_5021_5443 120
121 3300041404 Ga0439436_0003093 Ga0439436_0003093_1486_1917 120
122 3300041406 Ga0439439_0027171 Ga0439439_0027171_826_1257 120
123 3300041407 Ga0439447_063185 Ga0439447_063185_29_460 120
124 3300041411 Ga0439466_0050203 Ga0439466_0050203_10_441 120
125 3300041413 Ga0439465_0010238 Ga0439465_0010238_1563_1994 120
126 3300041997 Ga0439431_0002191 Ga0439431_0002191_2023_2454 120
127 3300041999 Ga0439433_0000255 Ga0439433_0000255_4197_4628 120
128 3300042002 Ga0439442_047946 Ga0439442_047946_177_608 120
129 3300042004 Ga0439445_0003892 Ga0439445_0003892_1089_1520 120
130 3300042006 Ga0439432_001484 Ga0439432_001484_2555_2986 120
131 3300042007 Ga0439449_0013168 Ga0439449_0013168_1983_2414 120
132 3300042010 Ga0439452_030522 Ga0439452_030522_706_1137 120
133 3300042156 Ga0439446_0056828 Ga0439446_0056828_106_537 120
134 3300042185 Ga0450909_012865 Ga0450909_012865_429_860 120
135 3300048907 Ga0496104_0651804 Ga0496104_0651804_436_876 120
136 3300048919 Ga0496116_0120515 Ga0496116_0120515_865_1305 120
137 3300048922 Ga0496119_0006975 Ga0496119_0006975_6151_6591 120
138 3300048924 Ga0496121_0002928 Ga0496121_0002928_5025_5465 120
139 3300048927 Ga0496124_0035888 Ga0496124_0035888_215_655 120
140 3300048928 Ga0496125_0001934 Ga0496125_0001934_6955_7395 120
141 3300048929 Ga0496126_0763102 Ga0496126_0763102_76_516 120
142 3300037466 Ga0395898_1218083 Ga0395898_1218083_243_674 121
143 3300047472 Ga0495686_0584168 Ga0495686_0584168_122_556 122
144 3300049823 Ga0501044_0853919 Ga0501044_0853919_47_523 122
145 3300041451 Ga0451791_0429238 Ga0451791_0429238_306_740 123
146 3300042014 Ga0439457_010422 Ga0439457_010422_1506_1937 123
147 3300049531 Ga0501315_051891 Ga0501315_051891_58_534 123
148 3300053096 Ga0500641_0039435 Ga0500641_0039435_879_1361 124
149 3300032005 Ga0307411_10233740 Ga0307411_102337401 125
150 3300038726 Ga0400490_03371 Ga0400490_03371_9150_9587 125
151 iso_pu_bacteria 2842454564 2842461299 125
152 3300005539 Ga0068853_101060371 Ga0068853_1010603711 126
153 iso_pu_bacteria 2511231002 2511245083 126
154 iso_pu_bacteria 2643221554 2643792076 126
155 iso_pu_bacteria 2643221556 2643799429 126
156 iso_pu_bacteria 2643221638 2644216443 126
157 iso_pu_bacteria 2643221645 2644254807 126
158 iso_pu_bacteria 2643221664 2644360368 126
159 iso_pu_bacteria 2643221684 2644471522 126
160 iso_pu_bacteria 2738541280 2738738116 126
161 iso_pu_bacteria 2738541297 2738826789 126
162 iso_pu_bacteria 2738541300 2738843086 126
163 iso_pu_bacteria 2738541357 2739150586 126
164 iso_pu_bacteria 2738543003 2739192505 126
165 iso_pu_bacteria 2738543018 2739273837 126
166 iso_pu_bacteria 2738543026 2739318982 126
167 iso_pu_bacteria 2738543029 2739337223 126
168 iso_pu_bacteria 2738543030 2739342881 126
169 iso_pu_bacteria 2842711865 2842712337 126
170 iso_pu_bacteria 2857553236 2857556281 126
171 iso_pu_bacteria 2857558681 2857560802 126
172 iso_pu_bacteria 2904424332 2904428883 126
173 iso_pu_bacteria 2919476304 2919476957 126
174 iso_pu_bacteria 8047673197 8047676077 126
175 3300006051 Ga0075364_10316984 Ga0075364_103169842 127
176 3300032168 Ga0316593_10193303 Ga0316593_101933032 127
177 3300033541 Ga0316596_1000040 Ga0316596_10000407 127
178 3300042127 Ga0450890_001085 Ga0450890_001085_2495_2917 127
179 3300042533 Ga0450901_013383 Ga0450901_013383_344_775 127
180 iso_pu_bacteria 2501025501 2501074046 127
181 iso_pu_bacteria 2501025502 2501084118 127
182 iso_pu_bacteria 2501025504 2501414355 127
183 iso_pu_bacteria 2508501125 2509132518 127
184 iso_pu_bacteria 2510065045 2510252583 127
185 iso_pu_bacteria 2510917013 2511093330 127
186 iso_pu_bacteria 2510917014 2511099778 127
187 iso_pu_bacteria 2510917015 2511102451 127
188 iso_pu_bacteria 2512047030 2512348441 127
189 iso_pu_bacteria 2513237082 2513556141 127
190 iso_pu_bacteria 2513237083 2513564327 127
191 iso_pu_bacteria 2513237151 2513962592 127
192 iso_pu_bacteria 2513237166 2514050901 127
193 iso_pu_bacteria 2515154122 2515684861 127
194 iso_pu_bacteria 2515154123 2515690948 127
195 iso_pu_bacteria 2515154189 2516022230 127
196 iso_pu_bacteria 2519103095 2519457515 127
197 iso_pu_bacteria 2526164713 2527080587 127
198 iso_pu_bacteria 2562617112 2563061523 127
199 iso_pu_bacteria 2582581311 2585294150 127
200 iso_pu_bacteria 2599185239 2599741043 127
201 iso_pu_bacteria 2599185240 2599748350 127
202 iso_pu_bacteria 2599185355 2600210262 127
203 iso_pu_bacteria 2600255067 2600813801 127
204 iso_pu_bacteria 2675903129 2676745814 127
205 iso_pu_bacteria 2711768613 2713478613 127
206 iso_pu_bacteria 2718217991 2719641681 127
207 iso_pu_bacteria 2738541296 2738824029 127
208 iso_pu_bacteria 2738541298 2738836420 127
209 iso_pu_bacteria 2738541306 2738877950 127
210 iso_pu_bacteria 2738543002 2739189656 127
211 iso_pu_bacteria 2738543008 2739224543 127
212 iso_pu_bacteria 2744054900 2746087224 127
213 iso_pu_bacteria 2744054901 2746093269 127
214 iso_pu_bacteria 2751185846 2753566201 127
215 iso_pu_bacteria 2791355137 2792837062 127
216 iso_pu_bacteria 2808606384 2808972857 127
217 iso_pu_bacteria 2808606390 2809007978 127
218 iso_pu_bacteria 2808606391 2809015382 127
219 iso_pu_bacteria 2816332253 2817259705 127
220 iso_pu_bacteria 2816332256 2817277374 127
221 iso_pu_bacteria 2816332286 2817453540 127
222 iso_pu_bacteria 2818991450 2819624163 127
223 iso_pu_bacteria 2818991452 2819636795 127
224 iso_pu_bacteria 2842324504 2842332188 127
225 iso_pu_bacteria 2842348783 2842356360 127
226 iso_pu_bacteria 2856287931 2856289407 127
227 iso_pu_bacteria 2857357740 2857362279 127
228 iso_pu_bacteria 2863421361 2863426496 127
229 iso_pu_bacteria 2870068957 2870069402 127
230 iso_pu_bacteria 2883087390 2883091437 127
231 iso_pu_bacteria 2885270888 2885272359 127
232 iso_pu_bacteria 2900634093 2900637068 127
233 iso_pu_bacteria 2902682994 2902686677 127
234 iso_pu_bacteria 2904434214 2904438988 127
235 iso_pu_bacteria 2904483920 2904490114 127
236 iso_pu_bacteria 2904564687 2904569340 127
237 iso_pu_bacteria 2904571731 2904576823 127
238 iso_pu_bacteria 2904615490 2904624834 127
239 iso_pu_bacteria 2919527303 2919533283 127
240 iso_pu_bacteria 2921643360 2921651507 127
241 iso_pu_bacteria 2928108538 2928114211 127
242 iso_pu_bacteria 2928135762 2928141041 127
243 iso_pu_bacteria 2928157003 2928163049 127
244 iso_pu_bacteria 2928163908 2928170201 127
245 iso_pu_bacteria 2928170801 2928176337 127
246 iso_pu_bacteria 2928503688 2928509206 127
247 iso_pu_bacteria 2928536128 2928542017 127
248 iso_pu_bacteria 2945934425 2945934568 127
249 iso_pu_bacteria 2981990288 2981996104 127
250 iso_pu_bacteria 2990703756 2990704874 127
251 iso_pu_bacteria 641736151 642426538 127
252 iso_pu_bacteria 641736154 642417676 127
253 iso_pu_bacteria 642555112 642594616 127
254 iso_pu_bacteria 642555113 642623205 127
255 iso_pu_bacteria 8003955200 8003956820 127
256 iso_pu_bacteria 8018845410 8018847929 127
257 iso_pu_bacteria 8020807995 8020813917 127
258 iso_pu_bacteria 8020938398 8020939047 127
259 iso_pu_bacteria 8020945358 8020947762 127
260 iso_pu_bacteria 8020953355 8020953406 127
261 iso_pu_bacteria 8021120328 8021127513 127
262 iso_pu_bacteria 8039098773 8039099663 127
263 iso_pu_bacteria 8040167225 8040171494 127
264 iso_pu_bacteria 8040173305 8040174108 127
265 iso_pu_bacteria 8055266321 8055269423 127
266 iso_pu_bacteria 8055301274 8055307415 127
267 3300003693 Ga0032354_1175332 Ga0032354_11753321 128
268 3300005327 Ga0070658_10210675 Ga0070658_102106752 128
269 3300005338 Ga0068868_100470939 Ga0068868_1004709391 128
270 3300005341 Ga0070691_10586771 Ga0070691_105867711 128
271 3300005458 Ga0070681_10446735 Ga0070681_104467352 128
272 3300005459 Ga0068867_101635410 Ga0068867_1016354101 128
273 3300005539 Ga0068853_101493106 Ga0068853_1014931062 128
274 3300005616 Ga0068852_100022501 Ga0068852_1000225016 128
275 3300005841 Ga0068863_100532459 Ga0068863_1005324592 128
276 3300006186 Ga0075369_10490397 Ga0075369_104903971 128
277 3300006195 Ga0075366_10332276 Ga0075366_103322763 128
278 3300006353 Ga0075370_10154017 Ga0075370_101540172 128
279 3300009036 Ga0105244_10129506 Ga0105244_101295062 128
280 3300009094 Ga0111539_10009725 Ga0111539_1000972512 128
281 3300009177 Ga0105248_10393633 Ga0105248_103936332 128
282 3300009545 Ga0105237_11052499 Ga0105237_110524992 128
283 3300009551 Ga0105238_11215312 Ga0105238_112153122 128
284 3300011119 Ga0105246_10212712 Ga0105246_102127123 128
285 3300025299 Ga0209256_1058574 Ga0209256_10585742 128
286 3300025908 Ga0207643_10273624 Ga0207643_102736241 128
287 3300025910 Ga0207684_10223837 Ga0207684_102238373 128
288 3300025932 Ga0207690_10182111 Ga0207690_101821112 128
289 3300025935 Ga0207709_10001005 Ga0207709_1000100524 128
290 3300025960 Ga0207651_10764166 Ga0207651_107641662 128
291 3300026088 Ga0207641_10789388 Ga0207641_107893882 128
292 3300026089 Ga0207648_10002176 Ga0207648_1000217615 128
293 3300026121 Ga0207683_10505174 Ga0207683_105051741 128
294 3300026142 Ga0207698_10017410 Ga0207698_100174106 128
295 3300027876 Ga0209974_10092867 Ga0209974_100928671 128
296 3300027907 Ga0207428_10008382 Ga0207428_100083822 128
297 3300028794 Ga0307515_10067022 Ga0307515_100670228 128
298 3300028794 Ga0307515_10119204 Ga0307515_101192042 128
299 3300030522 Ga0307512_10116329 Ga0307512_101163292 128
300 3300031251 Ga0265327_10028075 Ga0265327_100280755 128
301 3300031456 Ga0307513_10011808 Ga0307513_1001180812 128
302 3300031456 Ga0307513_10769558 Ga0307513_107695582 128
303 3300031507 Ga0307509_10109747 Ga0307509_101097476 128
304 3300031507 Ga0307509_10192810 Ga0307509_101928102 128
305 3300031507 Ga0307509_10286613 Ga0307509_102866132 128
306 3300031730 Ga0307516_10583188 Ga0307516_105831882 128
307 3300035088 Ga0373940_0097521 Ga0373940_0097521_91_522 128
308 3300035112 Ga0373932_0048427 Ga0373932_0048427_751_1182 128
309 3300035691 Ga0373931_0008660 Ga0373931_0008660_3504_3935 128
310 3300041506 Ga0451850_20986 Ga0451850_20986_359_790 128
311 3300042876 Ga0451577_0218523 Ga0451577_0218523_310_747 128
312 3300046511 Ga0495608_0308495 Ga0495608_0308495_270_701 128
313 3300046526 Ga0495666_0287216 Ga0495666_0287216_36_467 128
314 3300046557 Ga0495622_0207613 Ga0495622_0207613_324_755 128
315 3300046683 Ga0495658_0114704 Ga0495658_0114704_429_863 128
316 3300046683 Ga0495658_0283936 Ga0495658_0283936_438_869 128
317 3300046689 Ga0495613_0226145 Ga0495613_0226145_547_978 128
318 3300047315 Ga0495581_0078701 Ga0495581_0078701_654_1085 128
319 3300047321 Ga0495676_0010234 Ga0495676_0010234_3993_4424 128
320 3300048089 Ga0495614_0320971 Ga0495614_0320971_62_493 128
321 3300048091 Ga0495626_0126416 Ga0495626_0126416_51_482 128
322 3300048904 Ga0496101_0211964 Ga0496101_0211964_91_531 128
323 3300048916 Ga0496113_0476254 Ga0496113_0476254_489_920 128
324 3300048925 Ga0496122_0002652 Ga0496122_0002652_22689_23129 128
325 3300048926 Ga0496123_0007601 Ga0496123_0007601_215_655 128
326 3300048928 Ga0496125_0412167 Ga0496125_0412167_86_517 128
327 3300049127 Ga0501306_051944 Ga0501306_051944_199_639 128
328 3300049530 Ga0501314_015087 Ga0501314_015087_287_727 128
329 3300049535 Ga0501319_000027 Ga0501319_000027_2808_3248 128
330 3300049537 Ga0501321_005923 Ga0501321_005923_493_933 128
331 3300049539 Ga0501323_000015 Ga0501323_000015_3899_4339 128
332 3300049569 Ga0501032_0051651 Ga0501032_0051651_1938_2378 128
333 3300049570 Ga0501033_0187485 Ga0501033_0187485_290_730 128
334 3300049573 Ga0501037_0403748 Ga0501037_0403748_450_890 128
335 3300049574 Ga0501038_0388532 Ga0501038_0388532_361_801 128
336 3300049579 Ga0501043_0311069 Ga0501043_0311069_478_918 128
337 3300049581 Ga0501047_0408279 Ga0501047_0408279_734_1174 128
338 3300049657 Ga0501210_004862 Ga0501210_004862_35_466 128
339 3300049822 Ga0501035_0010523 Ga0501035_0010523_4289_4729 128
340 3300049823 Ga0501044_0078211 Ga0501044_0078211_834_1274 128
341 3300050496 nmdc:mga07m45_45273_c1 nmdc:mga07m45_45273_c1_1049_1480 128
342 3300053129 Ga0500628_002187 Ga0500628_002187_411_842 128
343 3300053142 Ga0500577_0289774 Ga0500577_0289774_116_550 128
344 3300053153 Ga0500616_0170867 Ga0500616_0170867_530_964 128
345 3300053154 Ga0500619_138164 Ga0500619_138164_76_507 128
346 3300053156 Ga0500622_0060471 Ga0500622_0060471_617_1048 128
347 3300053730 Ga0500645_191047 Ga0500645_191047_10_441 128
348 3300059512 Ga0587092_006055 Ga0587092_006055_108_539 128
349 3300001915 JGI24741J21665_1000624 JGI24741J21665_100062411 129
350 3300001979 JGI24740J21852_10022184 JGI24740J21852_100221843 129
351 3300001989 JGI24739J22299_10010870 JGI24739J22299_100108702 129
352 3300001990 JGI24737J22298_10022836 JGI24737J22298_100228363 129
353 3300002705 JGI25156J39149_1006223 JGI25156J39149_10062232 129
354 3300002705 JGI25156J39149_1016459 JGI25156J39149_10164592 129
355 3300002705 JGI25156J39149_1020451 JGI25156J39149_10204512 129
356 3300002705 JGI25156J39149_1033188 JGI25156J39149_10331881 129
357 3300002738 JGI25154J39366_1000303 JGI25154J39366_100030313 129
358 3300003187 JGI25151J46595_10000457 JGI25151J46595_1000045731 129
359 3300003479 Ga0006556J51387_1016929 Ga0006556J51387_101692920 129
360 3300003558 Ga0006558J51389_1019156 Ga0006558J51389_101915620 129
361 3300003565 Ga0006560J51390_1011017 Ga0006560J51390_101101725 129
362 3300003752 Ga0055539_1001132 Ga0055539_10011322 129
363 3300003752 Ga0055539_1005718 Ga0055539_10057182 129
364 3300003756 Ga0055533_1005127 Ga0055533_10051273 129
365 3300003756 Ga0055533_1006769 Ga0055533_10067691 129
366 3300003758 Ga0055532_1000066 Ga0055532_100006622 129
367 3300003760 Ga0055527_1000602 Ga0055527_100060210 129
368 3300003761 Ga0055535_1000046 Ga0055535_100004622 129
369 3300003762 Ga0055542_1001443 Ga0055542_100144315 129
370 3300003763 Ga0055529_1000087 Ga0055529_100008722 129
371 3300003763 Ga0055529_1000804 Ga0055529_100080411 129
372 3300005288 Ga0065714_10175573 Ga0065714_101755731 129
373 3300005344 Ga0070661_100000276 Ga0070661_10000027633 129
374 3300005455 Ga0070663_100001053 Ga0070663_10000105322 129
375 3300005535 Ga0070684_100277906 Ga0070684_1002779062 129
376 3300005564 Ga0070664_100000018 Ga0070664_100000018119 129
377 3300005578 Ga0068854_100000225 Ga0068854_10000022522 129
378 3300005614 Ga0068856_100000070 Ga0068856_10000007022 129
379 3300005616 Ga0068852_100840357 Ga0068852_1008403571 129
380 3300006042 Ga0075368_10003054 Ga0075368_100030542 129
381 3300006048 Ga0075363_100000856 Ga0075363_10000085619 129
382 3300006051 Ga0075364_10015296 Ga0075364_1001529610 129
383 3300006177 Ga0075362_10081459 Ga0075362_100814592 129
384 3300006178 Ga0075367_10001881 Ga0075367_1000188119 129
385 3300006186 Ga0075369_10003827 Ga0075369_100038272 129
386 3300006195 Ga0075366_10267362 Ga0075366_102673621 129
387 3300006948 Ga0099826_10000024 Ga0099826_1000002422 129
388 3300009011 Ga0105251_10010131 Ga0105251_1001013110 129
389 3300009011 Ga0105251_10039647 Ga0105251_100396473 129
390 3300009093 Ga0105240_10063879 Ga0105240_100638799 129
391 3300009174 Ga0105241_10799341 Ga0105241_107993411 129
392 3300013102 Ga0157371_10054196 Ga0157371_100541963 129
393 3300013307 Ga0157372_10381065 Ga0157372_103810652 129
394 3300014497 Ga0182008_10003186 Ga0182008_100031862 129
395 3300015261 Ga0182006_1009882 Ga0182006_10098826 129
396 3300015261 Ga0182006_1041809 Ga0182006_10418092 129
397 3300015262 Ga0182007_10012896 Ga0182007_100128964 129
398 3300015262 Ga0182007_10039882 Ga0182007_100398823 129
399 3300019179 Ga0184593_113785 Ga0184593_1137853 129
400 3300023560 Ga0247514_106419 Ga0247514_1064192 129
401 3300025224 Ga0209784_100052 Ga0209784_10005222 129
402 3300025224 Ga0209784_103737 Ga0209784_1037371 129
403 3300025225 Ga0209566_100068 Ga0209566_100068185 129
404 3300025225 Ga0209566_102355 Ga0209566_1023552 129
405 3300025226 Ga0209674_100087 Ga0209674_100087185 129
406 3300025226 Ga0209674_102800 Ga0209674_1028006 129
407 3300025228 Ga0209672_100276 Ga0209672_10027630 129
408 3300025228 Ga0209672_100383 Ga0209672_10038320 129
409 3300025228 Ga0209672_116278 Ga0209672_1162782 129
410 3300025229 Ga0209147_100090 Ga0209147_100090134 129
411 3300025230 Ga0209563_100470 Ga0209563_1004708 129
412 3300025230 Ga0209563_119837 Ga0209563_1198372 129
413 3300025242 Ga0209258_100130 Ga0209258_100130133 129
414 3300025242 Ga0209258_103856 Ga0209258_1038562 129
415 3300025246 Ga0209646_1000119 Ga0209646_1000119132 129
416 3300025253 Ga0209677_100043 Ga0209677_100043189 129
417 3300025253 Ga0209677_107281 Ga0209677_1072816 129
418 3300025254 Ga0209148_1001671 Ga0209148_10016719 129
419 3300025256 Ga0209759_1004738 Ga0209759_10047382 129
420 3300025256 Ga0209759_1008563 Ga0209759_10085635 129
421 3300025256 Ga0209759_1014581 Ga0209759_10145812 129
422 3300025256 Ga0209759_1026805 Ga0209759_10268052 129
423 3300025272 Ga0209455_1000119 Ga0209455_100011949 129
424 3300025272 Ga0209455_1001216 Ga0209455_100121617 129
425 3300025294 Ga0209025_1000039 Ga0209025_100003925 129
426 3300025735 Ga0207713_1005407 Ga0207713_10054073 129
427 3300025735 Ga0207713_1023386 Ga0207713_10233861 129
428 3300025911 Ga0207654_10496717 Ga0207654_104967172 129
429 3300025913 Ga0207695_10027074 Ga0207695_1002707414 129
430 3300025913 Ga0207695_11012665 Ga0207695_110126651 129
431 3300025920 Ga0207649_10000490 Ga0207649_1000049025 129
432 3300025945 Ga0207679_10000032 Ga0207679_1000003245 129
433 3300025981 Ga0207640_10001991 Ga0207640_1000199122 129
434 3300025986 Ga0207658_10257424 Ga0207658_102574243 129
435 3300026067 Ga0207678_10000024 Ga0207678_1000002422 129
436 3300026078 Ga0207702_10000973 Ga0207702_1000097322 129
437 3300026116 Ga0207674_10003250 Ga0207674_1000325022 129
438 3300027666 Ga0209282_1000032 Ga0209282_1000032143 129
439 3300027866 Ga0209813_10001024 Ga0209813_100010242 129
440 3300028666 Ga0265336_10000618 Ga0265336_1000061822 129
441 3300029957 Ga0265324_10000002 Ga0265324_1000000285 129
442 3300030836 Ga0265767_100009 Ga0265767_1000095 129
443 3300030863 Ga0265766_1000435 Ga0265766_10004352 129
444 3300030888 Ga0265769_102846 Ga0265769_1028462 129
445 3300031018 Ga0265773_1008002 Ga0265773_10080021 129
446 3300031251 Ga0265327_10000178 Ga0265327_1000017810 129
447 3300031344 Ga0265316_10067921 Ga0265316_100679215 129
448 3300031548 Ga0307408_100004683 Ga0307408_10000468311 129
449 3300031667 Ga0310111_122416 Ga0310111_1224162 129
450 3300031731 Ga0307405_10052007 Ga0307405_100520072 129
451 3300031852 Ga0307410_10632467 Ga0307410_106324671 129
452 3300031911 Ga0307412_10507816 Ga0307412_105078162 129
453 3300032002 Ga0307416_100006305 Ga0307416_10000630513 129
454 3300032005 Ga0307411_10411105 Ga0307411_104111053 129
455 3300033179 Ga0307507_10149043 Ga0307507_101490432 129
456 3300036458 Ga0310112_026650 Ga0310112_026650_167_601 129
457 3300039438 Ga0436360_0476119 Ga0436360_0476119_1632_2066 129
458 3300039447 Ga0436361_0141197 Ga0436361_0141197_1094_1525 129
459 3300041498 Ga0451841_0463776 Ga0451841_0463776_134_568 129
460 3300042876 Ga0451577_0000013 Ga0451577_0000013_424039_424473 129
461 3300042876 Ga0451577_0000191 Ga0451577_0000191_44629_45060 129
462 3300044673 Ga0453683_0000059 Ga0453683_0000059_60508_60942 129
463 3300044712 Ga0453684_0000585 Ga0453684_0000585_8997_9431 129
464 3300044712 Ga0453684_0000590 Ga0453684_0000590_50356_50787 129
465 3300044712 Ga0453684_0035225 Ga0453684_0035225_3166_3618 129
466 3300044712 Ga0453684_0065104 Ga0453684_0065104_2393_2827 129
467 3300044842 Ga0466957_0379455 Ga0466957_0379455_499_933 129
468 3300045051 Ga0451576_0000018 Ga0451576_0000018_126217_126651 129
469 3300045051 Ga0451576_0005877 Ga0451576_0005877_9178_9609 129
470 3300045051 Ga0451576_0010036 Ga0451576_0010036_7886_8320 129
471 3300045051 Ga0451576_0025038 Ga0451576_0025038_2079_2513 129
472 3300045051 Ga0451576_0193652 Ga0451576_0193652_1679_2113 129
473 3300046471 Ga0495650_0000200 Ga0495650_0000200_89378_89809 129
474 3300046471 Ga0495650_0020204 Ga0495650_0020204_1084_1518 129
475 3300046471 Ga0495650_0028055 Ga0495650_0028055_1356_1790 129
476 3300046506 Ga0495583_0094359 Ga0495583_0094359_65_496 129
477 3300046512 Ga0495610_0125032 Ga0495610_0125032_89_523 129
478 3300046513 Ga0495616_0117328 Ga0495616_0117328_609_1043 129
479 3300046517 Ga0495630_0038355 Ga0495630_0038355_3092_3526 129
480 3300046524 Ga0495648_0046480 Ga0495648_0046480_813_1244 129
481 3300046526 Ga0495666_0391822 Ga0495666_0391822_96_530 129
482 3300046528 Ga0495642_0213337 Ga0495642_0213337_79_510 129
483 3300046539 Ga0495621_0161107 Ga0495621_0161107_64_495 129
484 3300046665 Ga0495661_0421205 Ga0495661_0421205_193_627 129
485 3300046678 Ga0495599_0052585 Ga0495599_0052585_789_1223 129
486 3300046678 Ga0495599_0060094 Ga0495599_0060094_819_1253 129
487 3300046679 Ga0495623_0164428 Ga0495623_0164428_819_1253 129
488 3300046690 Ga0495624_0149960 Ga0495624_0149960_775_1209 129
489 3300046694 Ga0495649_0055982 Ga0495649_0055982_572_1006 129
490 3300046810 Ga0495660_0116780 Ga0495660_0116780_159_590 129
491 3300046810 Ga0495660_0208048 Ga0495660_0208048_206_640 129
492 3300047318 Ga0495636_0040864 Ga0495636_0040864_133_564 129
493 3300047322 Ga0495680_0232979 Ga0495680_0232979_89_523 129
494 3300047323 Ga0495683_0033028 Ga0495683_0033028_2077_2508 129
495 3300047443 Ga0495687_000216 Ga0495687_000216_9481_9915 129
496 3300047444 Ga0495675_0098979 Ga0495675_0098979_95_529 129
497 3300047447 Ga0495685_138553 Ga0495685_138553_187_618 129
498 3300047472 Ga0495686_0391768 Ga0495686_0391768_156_590 129
499 3300048091 Ga0495626_0202562 Ga0495626_0202562_352_786 129
500 3300048905 Ga0496102_0413289 Ga0496102_0413289_721_1152 129
501 3300048906 Ga0496103_0343097 Ga0496103_0343097_452_883 129
502 3300048911 Ga0496108_1331530 Ga0496108_1331530_60_488 129
503 3300048919 Ga0496116_0032654 Ga0496116_0032654_1334_1768 129
504 3300048919 Ga0496116_0393203 Ga0496116_0393203_51_485 129
505 3300048921 Ga0496118_0100694 Ga0496118_0100694_1425_1859 129
506 3300049129 Ga0501309_008348 Ga0501309_008348_535_966 129
507 3300049162 Ga0501307_027472 Ga0501307_027472_38_469 129
508 3300049459 Ga0495678_016940 Ga0495678_016940_956_1387 129
509 3300049459 Ga0495678_021632 Ga0495678_021632_2374_2805 129
510 3300049527 Ga0501311_024768 Ga0501311_024768_146_577 129
511 3300049569 Ga0501032_0244711 Ga0501032_0244711_534_974 129
512 3300049570 Ga0501033_0032115 Ga0501033_0032115_2447_2887 129
513 3300049571 Ga0501034_1182171 Ga0501034_1182171_78_518 129
514 3300049572 Ga0501036_0375199 Ga0501036_0375199_249_689 129
515 3300049574 Ga0501038_0184283 Ga0501038_0184283_456_890 129
516 3300049574 Ga0501038_0681881 Ga0501038_0681881_227_667 129
517 3300049581 Ga0501047_0017972 Ga0501047_0017972_3241_3681 129
518 3300049582 Ga0501048_0110710 Ga0501048_0110710_98_538 129
519 3300049822 Ga0501035_0011202 Ga0501035_0011202_2228_2668 129
520 3300049822 Ga0501035_0314676 Ga0501035_0314676_328_762 129
521 3300049823 Ga0501044_0000210 Ga0501044_0000210_27748_28182 129
522 3300049823 Ga0501044_0024898 Ga0501044_0024898_2465_2905 129
523 3300050490 nmdc:mga03n38_4317_c1 nmdc:mga03n38_4317_c1_3852_4334 129
524 3300050491 nmdc:mga00v17_12098_c1 nmdc:mga00v17_12098_c1_3092_3544 129
525 3300050491 nmdc:mga00v17_184456_c1 nmdc:mga00v17_184456_c1_573_1055 129
526 3300050493 nmdc:mga0k408_139838_c1 nmdc:mga0k408_139838_c1_808_1290 129
527 3300050494 nmdc:mga06z11_1936_c1 nmdc:mga06z11_1936_c1_5954_6436 129
528 3300050496 nmdc:mga07m45_6867_c1 nmdc:mga07m45_6867_c1_3789_4271 129
529 3300050516 nmdc:mga0sz30_439069_c1 nmdc:mga0sz30_439069_c1_83_565 129
530 3300053140 Ga0500573_0439913 Ga0500573_0439913_94_525 129
531 3300059510 Ga0587090_008198 Ga0587090_008198_125_556 129
532 3300059604 Ga0587098_009967 Ga0587098_009967_431_862 129
533 3300059643 Ga0587072_001765 Ga0587072_001765_722_1153 129
534 3300059645 Ga0587076_004751 Ga0587076_004751_210_641 129
535 iso_pu_bacteria 2643221621 2644123358 129
536 3300002738 JGI25154J39366_1001042 JGI25154J39366_10010429 130
537 3300002739 JGI25158J39367_1000542 JGI25158J39367_10005425 130
538 3300002773 JGI25152J39213_1013037 JGI25152J39213_10130374 130
539 3300002774 JGI25150J39212_1001923 JGI25150J39212_100192310 130
540 3300002774 JGI25150J39212_1003501 JGI25150J39212_10035012 130
541 3300002870 Ga0006763J43179_104166 Ga0006763J43179_10416611 130
542 3300002987 JGI25159J45721_1005729 JGI25159J45721_10057294 130
543 3300002987 JGI25159J45721_1006200 JGI25159J45721_10062004 130
544 3300003161 Ga0006765J45826_105454 Ga0006765J45826_10545410 130
545 3300003161 Ga0006765J45826_108890 Ga0006765J45826_1088903 130
546 3300003162 Ga0006778J45830_1013714 Ga0006778J45830_101371415 130
547 3300003163 Ga0006759J45824_1009839 Ga0006759J45824_10098394 130
548 3300003163 Ga0006759J45824_1019440 Ga0006759J45824_10194403 130
549 3300003163 Ga0006759J45824_1019946 Ga0006759J45824_101994620 130
550 3300003187 JGI25151J46595_10071766 JGI25151J46595_100717662 130
551 3300003187 JGI25151J46595_10077557 JGI25151J46595_100775572 130
552 3300003215 JGI25153J46596_10002258 JGI25153J46596_1000225810 130
553 3300003300 Ga0006758J48902_1003546 Ga0006758J48902_100354613 130
554 3300003300 Ga0006758J48902_1008911 Ga0006758J48902_100891111 130
555 3300003308 Ga0006777J48905_1023402 Ga0006777J48905_10234023 130
556 3300003354 JGI25160J50197_1001051 JGI25160J50197_100105120 130
557 3300003374 JGI25161J50226_1003265 JGI25161J50226_10032655 130
558 3300003544 Ga0007417J51691_1002612 Ga0007417J51691_100261221 130
559 3300003544 Ga0007417J51691_1036180 Ga0007417J51691_10361803 130
560 3300003559 Ga0007427J51700_104412 Ga0007427J51700_1044123 130
561 3300003559 Ga0007427J51700_116762 Ga0007427J51700_1167622 130
562 3300003574 Ga0007410J51695_1004597 Ga0007410J51695_100459721 130
563 3300003574 Ga0007410J51695_1005147 Ga0007410J51695_10051473 130
564 3300003574 Ga0007410J51695_1012689 Ga0007410J51695_101268920 130
565 3300003575 Ga0007409J51694_1002712 Ga0007409J51694_10027122 130
566 3300003579 Ga0007429J51699_1013730 Ga0007429J51699_10137306 130
567 3300003611 Ga0007411J51799_103551 Ga0007411J51799_10355120 130
568 3300003613 Ga0007415J51800_102854 Ga0007415J51800_10285411 130
569 3300003693 Ga0032354_1003172 Ga0032354_10031723 130
570 3300003693 Ga0032354_1073470 Ga0032354_10734703 130
571 3300003759 Ga0055525_1000018 Ga0055525_1000018345 130
572 3300003762 Ga0055542_1008179 Ga0055542_10081791 130
573 3300003763 Ga0055529_1000079 Ga0055529_100007926 130
574 3300003771 Ga0055526_1008246 Ga0055526_10082463 130
575 3300003771 Ga0055526_1008253 Ga0055526_10082533 130
576 3300003771 Ga0055526_1012574 Ga0055526_10125743 130
577 3300003771 Ga0055526_1017962 Ga0055526_10179622 130
578 3300003773 Ga0055537_1000038 Ga0055537_10000383 130
579 3300003773 Ga0055537_1007557 Ga0055537_10075572 130
580 3300003775 Ga0055524_1000024 Ga0055524_10000246 130
581 3300003775 Ga0055524_1003212 Ga0055524_10032125 130
582 3300003775 Ga0055524_1038927 Ga0055524_10389273 130
583 3300003784 Ga0055534_1003773 Ga0055534_10037733 130
584 3300003784 Ga0055534_1005461 Ga0055534_10054613 130
585 3300003790 Ga0055528_1012285 Ga0055528_10122855 130
586 3300003790 Ga0055528_1013311 Ga0055528_10133113 130
587 3300003791 Ga0055530_10007831 Ga0055530_100078315 130
588 3300003794 Ga0055531_10006076 Ga0055531_1000607614 130
589 3300004625 Ga0055543_1004039 Ga0055543_10040395 130
590 3300004803 Ga0058862_12800340 Ga0058862_128003405 130
591 3300005262 Ga0065165_1000504 Ga0065165_100050453 130
592 3300005262 Ga0065165_1006561 Ga0065165_10065615 130
593 3300005262 Ga0065165_1043988 Ga0065165_10439882 130
594 3300005288 Ga0065714_10264494 Ga0065714_102644942 130
595 3300005327 Ga0070658_11224510 Ga0070658_112245102 130
596 3300005329 Ga0070683_100130959 Ga0070683_1001309592 130
597 3300005331 Ga0070670_101020706 Ga0070670_1010207062 130
598 3300005334 Ga0068869_100792341 Ga0068869_1007923411 130
599 3300005334 Ga0068869_100940796 Ga0068869_1009407961 130
600 3300005336 Ga0070680_100028265 Ga0070680_1000282654 130
601 3300005337 Ga0070682_100335096 Ga0070682_1003350961 130
602 3300005343 Ga0070687_100449060 Ga0070687_1004490602 130
603 3300005344 Ga0070661_100577942 Ga0070661_1005779422 130
604 3300005344 Ga0070661_100922623 Ga0070661_1009226232 130
605 3300005353 Ga0070669_100615595 Ga0070669_1006155952 130
606 3300005354 Ga0070675_100789602 Ga0070675_1007896022 130
607 3300005355 Ga0070671_101474927 Ga0070671_1014749271 130
608 3300005366 Ga0070659_100755623 Ga0070659_1007556232 130
609 3300005455 Ga0070663_100882448 Ga0070663_1008824482 130
610 3300005456 Ga0070678_100667905 Ga0070678_1006679052 130
611 3300005457 Ga0070662_100612492 Ga0070662_1006124922 130
612 3300005458 Ga0070681_10376443 Ga0070681_103764433 130
613 3300005466 Ga0070685_11308658 Ga0070685_113086581 130
614 3300005518 Ga0070699_100043286 Ga0070699_1000432868 130
615 3300005530 Ga0070679_100263732 Ga0070679_1002637323 130
616 3300005530 Ga0070679_100272175 Ga0070679_1002721753 130
617 3300005539 Ga0068853_100029320 Ga0068853_10002932010 130
618 3300005543 Ga0070672_100692733 Ga0070672_1006927333 130
619 3300005563 Ga0068855_100257086 Ga0068855_1002570862 130
620 3300005564 Ga0070664_100068369 Ga0070664_1000683692 130
621 3300005577 Ga0068857_100178268 Ga0068857_1001782684 130
622 3300005577 Ga0068857_100409644 Ga0068857_1004096442 130
623 3300005578 Ga0068854_100363057 Ga0068854_1003630571 130
624 3300005614 Ga0068856_100117908 Ga0068856_1001179082 130
625 3300005718 Ga0068866_10292215 Ga0068866_102922152 130
626 3300006048 Ga0075363_100086667 Ga0075363_1000866674 130
627 3300006177 Ga0075362_10000565 Ga0075362_1000056518 130
628 3300006177 Ga0075362_10527349 Ga0075362_105273491 130
629 3300006195 Ga0075366_10064801 Ga0075366_100648012 130
630 3300006195 Ga0075366_10132503 Ga0075366_101325032 130
631 3300006195 Ga0075366_10519688 Ga0075366_105196882 130
632 3300006237 Ga0097621_100165035 Ga0097621_1001650354 130
633 3300006237 Ga0097621_100233100 Ga0097621_1002331002 130
634 3300006353 Ga0075370_10036206 Ga0075370_100362066 130
635 3300006353 Ga0075370_10136978 Ga0075370_101369783 130
636 3300006353 Ga0075370_10521963 Ga0075370_105219632 130
637 3300006881 Ga0068865_100052525 Ga0068865_1000525255 130
638 3300006881 Ga0068865_101583434 Ga0068865_1015834341 130
639 3300006946 Ga0079104_1004078 Ga0079104_100407810 130
640 3300006948 Ga0099826_10000010 Ga0099826_10000010256 130
641 3300009036 Ga0105244_10095626 Ga0105244_100956263 130
642 3300009092 Ga0105250_10079808 Ga0105250_100798083 130
643 3300009093 Ga0105240_10108670 Ga0105240_101086702 130
644 3300009148 Ga0105243_10006860 Ga0105243_100068602 130
645 3300009148 Ga0105243_10168772 Ga0105243_101687725 130
646 3300009148 Ga0105243_10413272 Ga0105243_104132723 130
647 3300009174 Ga0105241_10021276 Ga0105241_100212763 130
648 3300009177 Ga0105248_10930503 Ga0105248_109305032 130
649 3300009545 Ga0105237_10056847 Ga0105237_100568478 130
650 3300009551 Ga0105238_10910308 Ga0105238_109103081 130
651 3300010375 Ga0105239_11049668 Ga0105239_110496682 130
652 3300011119 Ga0105246_10193299 Ga0105246_101932992 130
653 3300012482 Ga0157318_1017671 Ga0157318_10176711 130
654 3300012485 Ga0157325_1002140 Ga0157325_10021403 130
655 3300012494 Ga0157341_1023988 Ga0157341_10239881 130
656 3300012512 Ga0157327_1046759 Ga0157327_10467591 130
657 3300013100 Ga0157373_10015732 Ga0157373_100157322 130
658 3300013104 Ga0157370_10062522 Ga0157370_100625222 130
659 3300013105 Ga0157369_10093282 Ga0157369_100932821 130
660 3300013297 Ga0157378_10027087 Ga0157378_100270872 130
661 3300013307 Ga0157372_11235545 Ga0157372_112355451 130
662 3300015261 Ga0182006_1000240 Ga0182006_100024027 130
663 3300015261 Ga0182006_1235790 Ga0182006_12357902 130
664 3300015262 Ga0182007_10021036 Ga0182007_100210362 130
665 3300015265 Ga0182005_1000016 Ga0182005_1000016283 130
666 3300020069 Ga0197907_11250558 Ga0197907_112505581 130
667 3300020070 Ga0206356_10847300 Ga0206356_108473004 130
668 3300020076 Ga0206355_1157373 Ga0206355_11573733 130
669 3300020077 Ga0206351_10211974 Ga0206351_102119743 130
670 3300020078 Ga0206352_11278378 Ga0206352_112783781 130
671 3300020080 Ga0206350_10425581 Ga0206350_104255818 130
672 3300020081 Ga0206354_10086599 Ga0206354_100865995 130
673 3300020082 Ga0206353_10343767 Ga0206353_103437672 130
674 3300020610 Ga0154015_1522148 Ga0154015_15221482 130
675 3300021361 Ga0213872_10010693 Ga0213872_100106936 130
676 3300021361 Ga0213872_10047302 Ga0213872_100473023 130
677 3300022467 Ga0224712_10125668 Ga0224712_101256683 130
678 3300025208 Ga0209436_100401 Ga0209436_10040123 130
679 3300025230 Ga0209563_100011 Ga0209563_100011746 130
680 3300025233 Ga0209437_103924 Ga0209437_1039244 130
681 3300025245 Ga0207425_1000021 Ga0207425_100002131 130
682 3300025245 Ga0207425_1000845 Ga0207425_100084512 130
683 3300025245 Ga0207425_1000932 Ga0207425_10009329 130
684 3300025246 Ga0209646_1000068 Ga0209646_100006826 130
685 3300025254 Ga0209148_1000444 Ga0209148_100044420 130
686 3300025258 Ga0209129_1000020 Ga0209129_1000020102 130
687 3300025263 Ga0209565_1000123 Ga0209565_1000123102 130
688 3300025263 Ga0209565_1001042 Ga0209565_100104216 130
689 3300025263 Ga0209565_1003095 Ga0209565_10030957 130
690 3300025272 Ga0209455_1000070 Ga0209455_1000070246 130
691 3300025273 Ga0209673_1000040 Ga0209673_1000040290 130
692 3300025273 Ga0209673_1004818 Ga0209673_100481810 130
693 3300025284 Ga0209130_1000290 Ga0209130_100029054 130
694 3300025284 Ga0209130_1002182 Ga0209130_100218213 130
695 3300025291 Ga0209675_1000117 Ga0209675_10001173 130
696 3300025291 Ga0209675_1002785 Ga0209675_10027853 130
697 3300025294 Ga0209025_1011110 Ga0209025_10111108 130
698 3300025295 Ga0209564_1000027 Ga0209564_1000027329 130
699 3300025295 Ga0209564_1000047 Ga0209564_100004731 130
700 3300025295 Ga0209564_1000121 Ga0209564_1000121185 130
701 3300025295 Ga0209564_1002740 Ga0209564_10027409 130
702 3300025295 Ga0209564_1032951 Ga0209564_10329512 130
703 3300025297 Ga0209758_1000077 Ga0209758_1000077233 130
704 3300025297 Ga0209758_1000322 Ga0209758_100032227 130
705 3300025298 Ga0209050_1000050 Ga0209050_100005031 130
706 3300025298 Ga0209050_1002922 Ga0209050_10029228 130
707 3300025299 Ga0209256_1000054 Ga0209256_1000054246 130
708 3300025299 Ga0209256_1001933 Ga0209256_100193318 130
709 3300025299 Ga0209256_1002719 Ga0209256_10027192 130
710 3300025299 Ga0209256_1024911 Ga0209256_10249113 130
711 3300025302 Ga0207426_1000802 Ga0207426_100080217 130
712 3300025302 Ga0207426_1047907 Ga0207426_10479072 130
713 3300025303 Ga0209051_1052723 Ga0209051_10527231 130
714 3300025303 Ga0209051_1053753 Ga0209051_10537532 130
715 3300025304 Ga0209257_1000075 Ga0209257_100007531 130
716 3300025728 Ga0207655_1000499 Ga0207655_100049923 130
717 3300025909 Ga0207705_10060061 Ga0207705_100600614 130
718 3300025911 Ga0207654_10002111 Ga0207654_1000211112 130
719 3300025913 Ga0207695_10246637 Ga0207695_102466372 130
720 3300025914 Ga0207671_10215175 Ga0207671_102151752 130
721 3300025917 Ga0207660_10011879 Ga0207660_100118793 130
722 3300025918 Ga0207662_10615472 Ga0207662_106154721 130
723 3300025919 Ga0207657_10030110 Ga0207657_100301102 130
724 3300025920 Ga0207649_10023804 Ga0207649_100238046 130
725 3300025921 Ga0207652_10090095 Ga0207652_100900956 130
726 3300025921 Ga0207652_10434543 Ga0207652_104345432 130
727 3300025924 Ga0207694_10045423 Ga0207694_100454232 130
728 3300025926 Ga0207659_10648536 Ga0207659_106485361 130
729 3300025927 Ga0207687_10444164 Ga0207687_104441642 130
730 3300025932 Ga0207690_10048382 Ga0207690_100483822 130
731 3300025933 Ga0207706_10008025 Ga0207706_100080259 130
732 3300025934 Ga0207686_10724498 Ga0207686_107244982 130
733 3300025935 Ga0207709_10020009 Ga0207709_100200095 130
734 3300025935 Ga0207709_10115312 Ga0207709_101153122 130
735 3300025938 Ga0207704_10176248 Ga0207704_101762482 130
736 3300025938 Ga0207704_10836131 Ga0207704_108361312 130
737 3300025941 Ga0207711_10745958 Ga0207711_107459582 130
738 3300025942 Ga0207689_10056742 Ga0207689_100567426 130
739 3300025942 Ga0207689_10943752 Ga0207689_109437521 130
740 3300025942 Ga0207689_10951974 Ga0207689_109519741 130
741 3300025945 Ga0207679_10108686 Ga0207679_101086862 130
742 3300025945 Ga0207679_10237693 Ga0207679_102376932 130
743 3300025949 Ga0207667_10128204 Ga0207667_101282042 130
744 3300025949 Ga0207667_10384789 Ga0207667_103847893 130
745 3300025972 Ga0207668_11173430 Ga0207668_111734301 130
746 3300025981 Ga0207640_10022226 Ga0207640_100222268 130
747 3300025986 Ga0207658_10165595 Ga0207658_101655951 130
748 3300026067 Ga0207678_10003236 Ga0207678_1000323623 130
749 3300026116 Ga0207674_10033169 Ga0207674_100331692 130
750 3300026121 Ga0207683_10228973 Ga0207683_102289732 130
751 3300027111 Ga0209281_1002282 Ga0209281_10022825 130
752 3300027666 Ga0209282_1000072 Ga0209282_100007239 130
753 3300028380 Ga0268265_10897546 Ga0268265_108975461 130
754 3300028794 Ga0307515_10084890 Ga0307515_100848904 130
755 3300030732 Ga0316176_1210209 Ga0316176_12102091 130
756 3300030733 Ga0314311_1150818 Ga0314311_11508183 130
757 3300030734 Ga0316179_1017842 Ga0316179_10178422 130
758 3300030735 Ga0316178_1040944 Ga0316178_10409442 130
759 3300030736 Ga0316180_1026989 Ga0316180_10269893 130
760 3300030742 Ga0316183_1084783 Ga0316183_10847832 130
761 3300030744 Ga0316181_1091528 Ga0316181_10915282 130
762 3300030745 Ga0316182_1108504 Ga0316182_11085046 130
763 3300030745 Ga0316182_1184435 Ga0316182_11844351 130
764 3300030745 Ga0316182_1433823 Ga0316182_14338231 130
765 3300031250 Ga0265331_10003466 Ga0265331_1000346613 130
766 3300031251 Ga0265327_10009306 Ga0265327_100093062 130
767 3300031251 Ga0265327_10098857 Ga0265327_100988572 130
768 3300031344 Ga0265316_10503563 Ga0265316_105035632 130
769 3300031548 Ga0307408_100000089 Ga0307408_10000008937 130
770 3300031548 Ga0307408_100001167 Ga0307408_1000011673 130
771 3300031548 Ga0307408_100297420 Ga0307408_1002974202 130
772 3300031548 Ga0307408_100477718 Ga0307408_1004777183 130
773 3300031548 Ga0307408_100820655 Ga0307408_1008206551 130
774 3300031711 Ga0265314_10158374 Ga0265314_101583744 130
775 3300031838 Ga0307518_10004256 Ga0307518_100042562 130
776 3300031901 Ga0307406_10504504 Ga0307406_105045042 130
777 3300031903 Ga0307407_10777831 Ga0307407_107778312 130
778 3300032002 Ga0307416_100002061 Ga0307416_1000020612 130
779 3300032002 Ga0307416_100212411 Ga0307416_1002124114 130
780 3300032005 Ga0307411_10724848 Ga0307411_107248482 130
781 3300032005 Ga0307411_10836349 Ga0307411_108363492 130
782 3300032005 Ga0307411_11073839 Ga0307411_110738392 130
783 3300033180 Ga0307510_10228403 Ga0307510_102284032 130
784 3300034818 Ga0373950_0017579 Ga0373950_0017579_610_1041 130
785 3300035088 Ga0373940_0012763 Ga0373940_0012763_385_816 130
786 3300035114 Ga0373939_0000348 Ga0373939_0000348_1170_1601 130
787 3300035121 Ga0373960_0000482 Ga0373960_0000482_5128_5559 130
788 3300035241 Ga0373961_0059684 Ga0373961_0059684_11_442 130
789 3300035242 Ga0373962_0035579 Ga0373962_0035579_693_1124 130
790 3300035691 Ga0373931_0000535 Ga0373931_0000535_5397_5828 130
791 3300037312 Ga0395899_0000218 Ga0395899_0000218_40724_41155 130
792 3300037418 Ga0395900_1707164 Ga0395900_1707164_12_443 130
793 3300037466 Ga0395898_0139979 Ga0395898_0139979_404_835 130
794 3300037471 Ga0395905_0002507 Ga0395905_0002507_9718_10149 130
795 3300037471 Ga0395905_0097862 Ga0395905_0097862_1184_1615 130
796 3300037471 Ga0395905_0177460 Ga0395905_0177460_1345_1776 130
797 3300038443 Ga0395901_0000378 Ga0395901_0000378_33_464 130
798 3300038443 Ga0395901_0207707 Ga0395901_0207707_33_464 130
799 3300038443 Ga0395901_0565724 Ga0395901_0565724_651_1082 130
800 3300038443 Ga0395901_0798512 Ga0395901_0798512_365_796 130
801 3300038726 Ga0400490_00437 Ga0400490_00437_8811_9242 130
802 3300038727 Ga0400491_08907 Ga0400491_08907_1302_1733 130
803 3300038741 Ga0400488_51157 Ga0400488_51157_2432_2863 130
804 3300038742 Ga0400486_01341 Ga0400486_01341_5912_6343 130
805 3300039447 Ga0436361_0378504 Ga0436361_0378504_2155_2586 130
806 3300039447 Ga0436361_0575526 Ga0436361_0575526_461_895 130
807 3300041404 Ga0439436_0101864 Ga0439436_0101864_213_644 130
808 3300041406 Ga0439439_0087288 Ga0439439_0087288_129_560 130
809 3300041406 Ga0439439_0245793 Ga0439439_0245793_64_495 130
810 3300041408 Ga0439453_0009071 Ga0439453_0009071_794_1225 130
811 3300041413 Ga0439465_0042679 Ga0439465_0042679_308_739 130
812 3300041413 Ga0439465_0098774 Ga0439465_0098774_140_571 130
813 3300041461 Ga0451805_100255 Ga0451805_100255_565_996 130
814 3300041492 Ga0451835_1143204 Ga0451835_1143204_67_498 130
815 3300041506 Ga0451850_01102 Ga0451850_01102_75_506 130
816 3300041916 Ga0452271_59633 Ga0452271_59633_537_968 130
817 3300042000 Ga0439437_001479 Ga0439437_001479_1337_1768 130
818 3300042002 Ga0439442_017115 Ga0439442_017115_740_1171 130
819 3300042005 Ga0439448_0036301 Ga0439448_0036301_296_727 130
820 3300042005 Ga0439448_0044502 Ga0439448_0044502_27_458 130
821 3300042005 Ga0439448_0095964 Ga0439448_0095964_497_928 130
822 3300042007 Ga0439449_0008668 Ga0439449_0008668_2859_3290 130
823 3300042007 Ga0439449_0098851 Ga0439449_0098851_77_508 130
824 3300042010 Ga0439452_091319 Ga0439452_091319_30_464 130
825 3300042011 Ga0439454_011850 Ga0439454_011850_603_1034 130
826 3300042011 Ga0439454_022677 Ga0439454_022677_221_652 130
827 3300042012 Ga0439455_0000425 Ga0439455_0000425_2553_2984 130
828 3300042012 Ga0439455_0026675 Ga0439455_0026675_954_1385 130
829 3300042012 Ga0439455_0035150 Ga0439455_0035150_806_1237 130
830 3300042115 Ga0450911_004506 Ga0450911_004506_1766_2197 130
831 3300042120 Ga0450917_000001 Ga0450917_000001_6213_6644 130
832 3300042122 Ga0450920_039592 Ga0450920_039592_207_638 130
833 3300042125 Ga0450923_056631 Ga0450923_056631_357_788 130
834 3300042126 Ga0450888_000936 Ga0450888_000936_2078_2509 130
835 3300042127 Ga0450890_000549 Ga0450890_000549_4394_4825 130
836 3300042128 Ga0450897_002592 Ga0450897_002592_489_920 130
837 3300042129 Ga0450891_000655 Ga0450891_000655_3143_3574 130
838 3300042130 Ga0450892_001248 Ga0450892_001248_2116_2547 130
839 3300042134 Ga0450898_043606 Ga0450898_043606_15_446 130
840 3300042137 Ga0450902_024020 Ga0450902_024020_62_493 130
841 3300042139 Ga0450904_002765 Ga0450904_002765_643_1074 130
842 3300042139 Ga0450904_008721 Ga0450904_008721_191_622 130
843 3300042144 Ga0450889_000161 Ga0450889_000161_3339_3770 130
844 3300042146 Ga0450907_011958 Ga0450907_011958_158_589 130
845 3300042147 Ga0450910_017596 Ga0450910_017596_121_552 130
846 3300042156 Ga0439446_0029603 Ga0439446_0029603_606_1037 130
847 3300042156 Ga0439446_0048229 Ga0439446_0048229_659_1090 130
848 3300042157 Ga0439458_0009491 Ga0439458_0009491_454_885 130
849 3300042530 Ga0450916_001782 Ga0450916_001782_316_747 130
850 3300042532 Ga0450893_0002428 Ga0450893_0002428_521_952 130
851 3300042532 Ga0450893_0016245 Ga0450893_0016245_269_700 130
852 3300042876 Ga0451577_0286581 Ga0451577_0286581_820_1254 130
853 3300044656 Ga0466969_0011638 Ga0466969_0011638_97_531 130
854 3300044658 Ga0466972_0095863 Ga0466972_0095863_400_831 130
855 3300044658 Ga0466972_0202782 Ga0466972_0202782_413_844 130
856 3300044669 Ga0466981_0147961 Ga0466981_0147961_538_969 130
857 3300044683 Ga0466965_0071942 Ga0466965_0071942_927_1358 130
858 3300044683 Ga0466965_0321709 Ga0466965_0321709_400_831 130
859 3300044683 Ga0466965_0321710 Ga0466965_0321710_400_831 130
860 3300044684 Ga0466966_0093495 Ga0466966_0093495_384_818 130
861 3300044693 Ga0466961_0000649 Ga0466961_0000649_19249_19683 130
862 3300044693 Ga0466961_0391601 Ga0466961_0391601_27_458 130
863 3300044693 Ga0466961_0800640 Ga0466961_0800640_27_458 130
864 3300044694 Ga0466963_0662781 Ga0466963_0662781_291_722 130
865 3300044706 Ga0466964_0020973 Ga0466964_0020973_400_831 130
866 3300044706 Ga0466964_0105381 Ga0466964_0105381_208_639 130
867 3300044712 Ga0453684_0000989 Ga0453684_0000989_83403_83837 130
868 3300044712 Ga0453684_0239607 Ga0453684_0239607_1626_2060 130
869 3300044712 Ga0453684_0317486 Ga0453684_0317486_1260_1691 130
870 3300044712 Ga0453684_1755614 Ga0453684_1755614_30_464 130
871 3300044719 Ga0466971_0136841 Ga0466971_0136841_501_932 130
872 3300044735 Ga0466968_0242976 Ga0466968_0242976_388_819 130
873 3300044765 Ga0466970_0070556 Ga0466970_0070556_294_725 130
874 3300044842 Ga0466957_0027993 Ga0466957_0027993_386_817 130
875 3300044842 Ga0466957_0096700 Ga0466957_0096700_359_790 130
876 3300045049 Ga0466959_0071231 Ga0466959_0071231_1705_2139 130
877 3300046452 Ga0495617_000397 Ga0495617_000397_22810_23241 130
878 3300046452 Ga0495617_000636 Ga0495617_000636_4278_4709 130
879 3300046452 Ga0495617_000830 Ga0495617_000830_5071_5502 130
880 3300046452 Ga0495617_007711 Ga0495617_007711_100_531 130
881 3300046452 Ga0495617_009077 Ga0495617_009077_955_1386 130
882 3300046452 Ga0495617_107059 Ga0495617_107059_334_765 130
883 3300046453 Ga0495627_004713 Ga0495627_004713_4147_4578 130
884 3300046453 Ga0495627_008079 Ga0495627_008079_1178_1609 130
885 3300046455 Ga0495603_0001612 Ga0495603_0001612_3295_3726 130
886 3300046455 Ga0495603_0009392 Ga0495603_0009392_3435_3866 130
887 3300046455 Ga0495603_0365634 Ga0495603_0365634_25_456 130
888 3300046457 Ga0495590_0000020 Ga0495590_0000020_113007_113438 130
889 3300046457 Ga0495590_0000632 Ga0495590_0000632_2901_3332 130
890 3300046457 Ga0495590_0001551 Ga0495590_0001551_7383_7814 130
891 3300046457 Ga0495590_0006208 Ga0495590_0006208_1491_1922 130
892 3300046457 Ga0495590_0035656 Ga0495590_0035656_497_928 130
893 3300046457 Ga0495590_0084356 Ga0495590_0084356_495_926 130
894 3300046459 Ga0495629_0015926 Ga0495629_0015926_3822_4253 130
895 3300046459 Ga0495629_0143741 Ga0495629_0143741_784_1215 130
896 3300046459 Ga0495629_0185132 Ga0495629_0185132_454_885 130
897 3300046460 Ga0495638_0000235 Ga0495638_0000235_54654_55085 130
898 3300046460 Ga0495638_0016045 Ga0495638_0016045_2194_2625 130
899 3300046460 Ga0495638_0066492 Ga0495638_0066492_1351_1782 130
900 3300046460 Ga0495638_0127888 Ga0495638_0127888_413_844 130
901 3300046460 Ga0495638_0138245 Ga0495638_0138245_81_512 130
902 3300046460 Ga0495638_0143356 Ga0495638_0143356_699_1130 130
903 3300046460 Ga0495638_0175482 Ga0495638_0175482_660_1091 130
904 3300046460 Ga0495638_0192509 Ga0495638_0192509_152_583 130
905 3300046463 Ga0495653_0000067 Ga0495653_0000067_70020_70451 130
906 3300046463 Ga0495653_0004702 Ga0495653_0004702_599_1030 130
907 3300046463 Ga0495653_0030611 Ga0495653_0030611_1140_1571 130
908 3300046463 Ga0495653_0091071 Ga0495653_0091071_654_1085 130
909 3300046471 Ga0495650_0000436 Ga0495650_0000436_679_1110 130
910 3300046471 Ga0495650_0001809 Ga0495650_0001809_13714_14145 130
911 3300046471 Ga0495650_0007290 Ga0495650_0007290_4211_4642 130
912 3300046471 Ga0495650_0017593 Ga0495650_0017593_2235_2666 130
913 3300046471 Ga0495650_0023276 Ga0495650_0023276_754_1185 130
914 3300046472 Ga0495580_0020632 Ga0495580_0020632_4170_4601 130
915 3300046472 Ga0495580_0295525 Ga0495580_0295525_646_1077 130
916 3300046473 Ga0495582_0005108 Ga0495582_0005108_2868_3299 130
917 3300046473 Ga0495582_0014415 Ga0495582_0014415_2415_2846 130
918 3300046473 Ga0495582_0545605 Ga0495582_0545605_129_560 130
919 3300046474 Ga0495605_0000061 Ga0495605_0000061_143114_143545 130
920 3300046474 Ga0495605_0001735 Ga0495605_0001735_10249_10680 130
921 3300046474 Ga0495605_0005449 Ga0495605_0005449_1321_1752 130
922 3300046474 Ga0495605_0009198 Ga0495605_0009198_4847_5278 130
923 3300046474 Ga0495605_0010393 Ga0495605_0010393_3554_3985 130
924 3300046474 Ga0495605_0012129 Ga0495605_0012129_3201_3632 130
925 3300046474 Ga0495605_0013819 Ga0495605_0013819_2154_2585 130
926 3300046474 Ga0495605_0085995 Ga0495605_0085995_402_833 130
927 3300046474 Ga0495605_0272644 Ga0495605_0272644_125_556 130
928 3300046475 Ga0495639_0088103 Ga0495639_0088103_512_943 130
929 3300046475 Ga0495639_0088932 Ga0495639_0088932_556_987 130
930 3300046475 Ga0495639_0150524 Ga0495639_0150524_260_691 130
931 3300046477 Ga0495664_0097358 Ga0495664_0097358_993_1424 130
932 3300046491 Ga0495584_0000636 Ga0495584_0000636_12500_12931 130
933 3300046491 Ga0495584_0002002 Ga0495584_0002002_8601_9032 130
934 3300046491 Ga0495584_0011799 Ga0495584_0011799_2285_2716 130
935 3300046491 Ga0495584_0012155 Ga0495584_0012155_1891_2322 130
936 3300046491 Ga0495584_0021670 Ga0495584_0021670_184_615 130
937 3300046491 Ga0495584_0032055 Ga0495584_0032055_1529_1960 130
938 3300046491 Ga0495584_0033893 Ga0495584_0033893_1502_1933 130
939 3300046491 Ga0495584_0144920 Ga0495584_0144920_14_445 130
940 3300046491 Ga0495584_0190186 Ga0495584_0190186_559_990 130
941 3300046491 Ga0495584_0201597 Ga0495584_0201597_350_781 130
942 3300046492 Ga0495585_0000497 Ga0495585_0000497_523_954 130
943 3300046492 Ga0495585_0006666 Ga0495585_0006666_2143_2574 130
944 3300046492 Ga0495585_0037607 Ga0495585_0037607_383_814 130
945 3300046492 Ga0495585_0040726 Ga0495585_0040726_2077_2508 130
946 3300046492 Ga0495585_0041550 Ga0495585_0041550_1760_2191 130
947 3300046492 Ga0495585_0050808 Ga0495585_0050808_810_1241 130
948 3300046492 Ga0495585_0053985 Ga0495585_0053985_1102_1533 130
949 3300046492 Ga0495585_0057251 Ga0495585_0057251_452_883 130
950 3300046492 Ga0495585_0067131 Ga0495585_0067131_745_1176 130
951 3300046499 Ga0495594_0017612 Ga0495594_0017612_401_832 130
952 3300046499 Ga0495594_0034748 Ga0495594_0034748_1823_2254 130
953 3300046499 Ga0495594_0073377 Ga0495594_0073377_1353_1784 130
954 3300046499 Ga0495594_0125027 Ga0495594_0125027_86_517 130
955 3300046499 Ga0495594_0244040 Ga0495594_0244040_450_881 130
956 3300046500 Ga0495596_0001745 Ga0495596_0001745_1164_1595 130
957 3300046500 Ga0495596_0001963 Ga0495596_0001963_4519_4950 130
958 3300046500 Ga0495596_0199960 Ga0495596_0199960_194_625 130
959 3300046500 Ga0495596_0254795 Ga0495596_0254795_56_460 130
960 3300046501 Ga0495607_0009755 Ga0495607_0009755_1988_2419 130
961 3300046501 Ga0495607_0017761 Ga0495607_0017761_3967_4398 130
962 3300046501 Ga0495607_0021914 Ga0495607_0021914_1803_2234 130
963 3300046501 Ga0495607_0038368 Ga0495607_0038368_2194_2625 130
964 3300046501 Ga0495607_0042397 Ga0495607_0042397_1088_1519 130
965 3300046501 Ga0495607_0059953 Ga0495607_0059953_1491_1922 130
966 3300046501 Ga0495607_0062866 Ga0495607_0062866_1112_1543 130
967 3300046501 Ga0495607_0063124 Ga0495607_0063124_335_766 130
968 3300046501 Ga0495607_0103502 Ga0495607_0103502_57_488 130
969 3300046501 Ga0495607_0159222 Ga0495607_0159222_396_827 130
970 3300046501 Ga0495607_0318419 Ga0495607_0318419_35_466 130
971 3300046501 Ga0495607_0319723 Ga0495607_0319723_261_692 130
972 3300046506 Ga0495583_0000317 Ga0495583_0000317_65544_65975 130
973 3300046506 Ga0495583_0002046 Ga0495583_0002046_4081_4512 130
974 3300046506 Ga0495583_0004594 Ga0495583_0004594_6816_7247 130
975 3300046506 Ga0495583_0011949 Ga0495583_0011949_739_1170 130
976 3300046506 Ga0495583_0018545 Ga0495583_0018545_2073_2504 130
977 3300046506 Ga0495583_0019465 Ga0495583_0019465_1354_1785 130
978 3300046507 Ga0495606_0031882 Ga0495606_0031882_514_945 130
979 3300046507 Ga0495606_0035311 Ga0495606_0035311_2467_2898 130
980 3300046507 Ga0495606_0035595 Ga0495606_0035595_2829_3260 130
981 3300046507 Ga0495606_0037967 Ga0495606_0037967_353_784 130
982 3300046507 Ga0495606_0048233 Ga0495606_0048233_2010_2441 130
983 3300046507 Ga0495606_0066613 Ga0495606_0066613_779_1210 130
984 3300046507 Ga0495606_0070973 Ga0495606_0070973_1634_2065 130
985 3300046507 Ga0495606_0080050 Ga0495606_0080050_719_1150 130
986 3300046507 Ga0495606_0085615 Ga0495606_0085615_1293_1724 130
987 3300046507 Ga0495606_0109571 Ga0495606_0109571_1102_1533 130
988 3300046507 Ga0495606_0147485 Ga0495606_0147485_687_1118 130
989 3300046512 Ga0495610_0000017 Ga0495610_0000017_334867_335298 130
990 3300046513 Ga0495616_0003800 Ga0495616_0003800_3780_4211 130
991 3300046513 Ga0495616_0011842 Ga0495616_0011842_4134_4565 130
992 3300046513 Ga0495616_0034996 Ga0495616_0034996_1763_2194 130
993 3300046513 Ga0495616_0072460 Ga0495616_0072460_1102_1533 130
994 3300046513 Ga0495616_0102252 Ga0495616_0102252_700_1131 130
995 3300046513 Ga0495616_0111084 Ga0495616_0111084_118_549 130
996 3300046513 Ga0495616_0119592 Ga0495616_0119592_658_1089 130
997 3300046513 Ga0495616_0163239 Ga0495616_0163239_261_692 130
998 3300046513 Ga0495616_0390385 Ga0495616_0390385_78_509 130
999 3300046515 Ga0495620_0001543 Ga0495620_0001543_9055_9486 130
1000 3300046515 Ga0495620_0053647 Ga0495620_0053647_590_1021 130
1001 3300046516 Ga0495628_0205693 Ga0495628_0205693_481_912 130
1002 3300046517 Ga0495630_0109243 Ga0495630_0109243_50_481 130
1003 3300046517 Ga0495630_0207757 Ga0495630_0207757_619_1050 130
1004 3300046518 Ga0495631_0011063 Ga0495631_0011063_1023_1454 130
1005 3300046518 Ga0495631_0011843 Ga0495631_0011843_780_1211 130
1006 3300046518 Ga0495631_0019480 Ga0495631_0019480_2492_2923 130
1007 3300046518 Ga0495631_0030651 Ga0495631_0030651_1494_1925 130
1008 3300046518 Ga0495631_0161756 Ga0495631_0161756_146_577 130
1009 3300046519 Ga0495632_0016465 Ga0495632_0016465_1162_1593 130
1010 3300046519 Ga0495632_0026864 Ga0495632_0026864_1441_1872 130
1011 3300046519 Ga0495632_0096913 Ga0495632_0096913_566_997 130
1012 3300046519 Ga0495632_0172654 Ga0495632_0172654_240_671 130
1013 3300046520 Ga0495637_0000053 Ga0495637_0000053_1955_2386 130
1014 3300046520 Ga0495637_0002190 Ga0495637_0002190_6439_6870 130
1015 3300046520 Ga0495637_0011543 Ga0495637_0011543_1981_2412 130
1016 3300046520 Ga0495637_0012032 Ga0495637_0012032_3063_3494 130
1017 3300046520 Ga0495637_0056898 Ga0495637_0056898_12_443 130
1018 3300046522 Ga0495643_0012013 Ga0495643_0012013_4163_4594 130
1019 3300046522 Ga0495643_0014375 Ga0495643_0014375_2409_2840 130
1020 3300046522 Ga0495643_0019530 Ga0495643_0019530_1151_1582 130
1021 3300046522 Ga0495643_0026159 Ga0495643_0026159_2537_2968 130
1022 3300046522 Ga0495643_0040991 Ga0495643_0040991_1682_2113 130
1023 3300046522 Ga0495643_0044520 Ga0495643_0044520_665_1096 130
1024 3300046522 Ga0495643_0048287 Ga0495643_0048287_1052_1483 130
1025 3300046522 Ga0495643_0104068 Ga0495643_0104068_584_1015 130
1026 3300046523 Ga0495644_0003110 Ga0495644_0003110_2249_2680 130
1027 3300046523 Ga0495644_0013221 Ga0495644_0013221_439_870 130
1028 3300046523 Ga0495644_0019769 Ga0495644_0019769_338_769 130
1029 3300046523 Ga0495644_0075233 Ga0495644_0075233_430_861 130
1030 3300046524 Ga0495648_0003167 Ga0495648_0003167_10190_10621 130
1031 3300046524 Ga0495648_0015922 Ga0495648_0015922_4227_4658 130
1032 3300046524 Ga0495648_0044310 Ga0495648_0044310_1349_1780 130
1033 3300046524 Ga0495648_0056197 Ga0495648_0056197_44_475 130
1034 3300046524 Ga0495648_0087678 Ga0495648_0087678_664_1095 130
1035 3300046524 Ga0495648_0098552 Ga0495648_0098552_864_1295 130
1036 3300046524 Ga0495648_0100591 Ga0495648_0100591_634_1065 130
1037 3300046524 Ga0495648_0120126 Ga0495648_0120126_431_862 130
1038 3300046524 Ga0495648_0150736 Ga0495648_0150736_142_573 130
1039 3300046524 Ga0495648_0155108 Ga0495648_0155108_15_446 130
1040 3300046524 Ga0495648_0209849 Ga0495648_0209849_52_483 130
1041 3300046524 Ga0495648_0320024 Ga0495648_0320024_56_487 130
1042 3300046525 Ga0495663_0006063 Ga0495663_0006063_2218_2649 130
1043 3300046525 Ga0495663_0008461 Ga0495663_0008461_730_1161 130
1044 3300046525 Ga0495663_0012604 Ga0495663_0012604_463_894 130
1045 3300046525 Ga0495663_0017530 Ga0495663_0017530_415_846 130
1046 3300046525 Ga0495663_0065824 Ga0495663_0065824_616_1047 130
1047 3300046525 Ga0495663_0124763 Ga0495663_0124763_395_826 130
1048 3300046526 Ga0495666_0002416 Ga0495666_0002416_8135_8566 130
1049 3300046526 Ga0495666_0040638 Ga0495666_0040638_593_1024 130
1050 3300046526 Ga0495666_0049585 Ga0495666_0049585_731_1162 130
1051 3300046526 Ga0495666_0098357 Ga0495666_0098357_814_1245 130
1052 3300046526 Ga0495666_0115943 Ga0495666_0115943_99_530 130
1053 3300046528 Ga0495642_0005824 Ga0495642_0005824_3627_4058 130
1054 3300046528 Ga0495642_0007577 Ga0495642_0007577_1891_2322 130
1055 3300046528 Ga0495642_0008349 Ga0495642_0008349_1074_1505 130
1056 3300046528 Ga0495642_0019574 Ga0495642_0019574_1524_1955 130
1057 3300046528 Ga0495642_0026738 Ga0495642_0026738_1710_2141 130
1058 3300046528 Ga0495642_0030583 Ga0495642_0030583_831_1262 130
1059 3300046528 Ga0495642_0048741 Ga0495642_0048741_79_510 130
1060 3300046528 Ga0495642_0075423 Ga0495642_0075423_62_493 130
1061 3300046528 Ga0495642_0079432 Ga0495642_0079432_609_1040 130
1062 3300046528 Ga0495642_0168073 Ga0495642_0168073_405_836 130
1063 3300046529 Ga0495652_0035356 Ga0495652_0035356_3048_3479 130
1064 3300046529 Ga0495652_0146004 Ga0495652_0146004_252_683 130
1065 3300046530 Ga0495654_0000060 Ga0495654_0000060_116617_117048 130
1066 3300046530 Ga0495654_0030668 Ga0495654_0030668_2280_2711 130
1067 3300046530 Ga0495654_0109550 Ga0495654_0109550_251_682 130
1068 3300046530 Ga0495654_0176808 Ga0495654_0176808_170_601 130
1069 3300046531 Ga0495665_0008466 Ga0495665_0008466_3084_3515 130
1070 3300046531 Ga0495665_0018585 Ga0495665_0018585_2768_3199 130
1071 3300046531 Ga0495665_0069907 Ga0495665_0069907_424_855 130
1072 3300046531 Ga0495665_0221276 Ga0495665_0221276_287_718 130
1073 3300046533 Ga0495640_0041811 Ga0495640_0041811_2030_2461 130
1074 3300046535 Ga0495586_0018161 Ga0495586_0018161_2842_3273 130
1075 3300046535 Ga0495586_0051587 Ga0495586_0051587_1101_1532 130
1076 3300046535 Ga0495586_0072077 Ga0495586_0072077_481_912 130
1077 3300046536 Ga0495587_0007790 Ga0495587_0007790_4084_4515 130
1078 3300046536 Ga0495587_0086906 Ga0495587_0086906_1106_1537 130
1079 3300046537 Ga0495598_0027767 Ga0495598_0027767_597_1028 130
1080 3300046538 Ga0495609_0000007 Ga0495609_0000007_396229_396660 130
1081 3300046538 Ga0495609_0000666 Ga0495609_0000666_24185_24616 130
1082 3300046538 Ga0495609_0033507 Ga0495609_0033507_1335_1766 130
1083 3300046538 Ga0495609_0046714 Ga0495609_0046714_699_1130 130
1084 3300046538 Ga0495609_0084127 Ga0495609_0084127_789_1220 130
1085 3300046538 Ga0495609_0085504 Ga0495609_0085504_793_1224 130
1086 3300046538 Ga0495609_0164311 Ga0495609_0164311_233_664 130
1087 3300046538 Ga0495609_0211129 Ga0495609_0211129_119_550 130
1088 3300046539 Ga0495621_0161323 Ga0495621_0161323_272_703 130
1089 3300046542 Ga0495597_0007533 Ga0495597_0007533_3737_4168 130
1090 3300046542 Ga0495597_0007961 Ga0495597_0007961_2597_3028 130
1091 3300046542 Ga0495597_0014198 Ga0495597_0014198_1055_1486 130
1092 3300046542 Ga0495597_0022360 Ga0495597_0022360_54_485 130
1093 3300046542 Ga0495597_0023086 Ga0495597_0023086_313_744 130
1094 3300046542 Ga0495597_0073396 Ga0495597_0073396_995_1426 130
1095 3300046542 Ga0495597_0079026 Ga0495597_0079026_677_1108 130
1096 3300046542 Ga0495597_0232401 Ga0495597_0232401_158_589 130
1097 3300046542 Ga0495597_0323992 Ga0495597_0323992_125_556 130
1098 3300046543 Ga0495645_0450145 Ga0495645_0450145_77_508 130
1099 3300046557 Ga0495622_0012942 Ga0495622_0012942_2211_2642 130
1100 3300046557 Ga0495622_0014615 Ga0495622_0014615_1457_1888 130
1101 3300046557 Ga0495622_0031049 Ga0495622_0031049_1113_1544 130
1102 3300046557 Ga0495622_0031817 Ga0495622_0031817_1495_1926 130
1103 3300046557 Ga0495622_0035080 Ga0495622_0035080_1496_1927 130
1104 3300046557 Ga0495622_0041092 Ga0495622_0041092_1590_2021 130
1105 3300046557 Ga0495622_0110653 Ga0495622_0110653_460_891 130
1106 3300046558 Ga0495633_0006566 Ga0495633_0006566_2455_2886 130
1107 3300046558 Ga0495633_0023121 Ga0495633_0023121_2596_3027 130
1108 3300046558 Ga0495633_0025281 Ga0495633_0025281_1707_2138 130
1109 3300046558 Ga0495633_0036777 Ga0495633_0036777_263_694 130
1110 3300046558 Ga0495633_0062271 Ga0495633_0062271_131_562 130
1111 3300046558 Ga0495633_0068032 Ga0495633_0068032_659_1090 130
1112 3300046558 Ga0495633_0097194 Ga0495633_0097194_74_505 130
1113 3300046558 Ga0495633_0160994 Ga0495633_0160994_503_934 130
1114 3300046558 Ga0495633_0171885 Ga0495633_0171885_274_705 130
1115 3300046558 Ga0495633_0175653 Ga0495633_0175653_387_818 130
1116 3300046559 Ga0495667_0151288 Ga0495667_0151288_564_995 130
1117 3300046615 Ga0495656_0010416 Ga0495656_0010416_2319_2750 130
1118 3300046615 Ga0495656_0081304 Ga0495656_0081304_218_649 130
1119 3300046615 Ga0495656_0084934 Ga0495656_0084934_169_600 130
1120 3300046615 Ga0495656_0099696 Ga0495656_0099696_581_1012 130
1121 3300046615 Ga0495656_0169174 Ga0495656_0169174_371_802 130
1122 3300046615 Ga0495656_0267756 Ga0495656_0267756_313_744 130
1123 3300046616 Ga0495668_0002640 Ga0495668_0002640_880_1311 130
1124 3300046616 Ga0495668_0005163 Ga0495668_0005163_6103_6534 130
1125 3300046616 Ga0495668_0008733 Ga0495668_0008733_2332_2763 130
1126 3300046616 Ga0495668_0011342 Ga0495668_0011342_4063_4494 130
1127 3300046616 Ga0495668_0011816 Ga0495668_0011816_1944_2375 130
1128 3300046616 Ga0495668_0018916 Ga0495668_0018916_1105_1536 130
1129 3300046616 Ga0495668_0029452 Ga0495668_0029452_1039_1470 130
1130 3300046616 Ga0495668_0051941 Ga0495668_0051941_1675_2106 130
1131 3300046616 Ga0495668_0103355 Ga0495668_0103355_158_589 130
1132 3300046616 Ga0495668_0162205 Ga0495668_0162205_665_1096 130
1133 3300046616 Ga0495668_0337344 Ga0495668_0337344_200_631 130
1134 3300046616 Ga0495668_0395203 Ga0495668_0395203_95_526 130
1135 3300046642 Ga0495634_0121713 Ga0495634_0121713_673_1104 130
1136 3300046642 Ga0495634_0202784 Ga0495634_0202784_313_744 130
1137 3300046642 Ga0495634_0211208 Ga0495634_0211208_673_1104 130
1138 3300046648 Ga0495611_0001662 Ga0495611_0001662_6687_7118 130
1139 3300046648 Ga0495611_0002069 Ga0495611_0002069_4761_5192 130
1140 3300046648 Ga0495611_0005909 Ga0495611_0005909_753_1184 130
1141 3300046648 Ga0495611_0011874 Ga0495611_0011874_2798_3229 130
1142 3300046648 Ga0495611_0093136 Ga0495611_0093136_295_726 130
1143 3300046648 Ga0495611_0182449 Ga0495611_0182449_450_881 130
1144 3300046660 Ga0495625_0011213 Ga0495625_0011213_4643_5074 130
1145 3300046660 Ga0495625_0033151 Ga0495625_0033151_1995_2426 130
1146 3300046660 Ga0495625_0034116 Ga0495625_0034116_618_1049 130
1147 3300046660 Ga0495625_0047734 Ga0495625_0047734_1819_2250 130
1148 3300046660 Ga0495625_0087655 Ga0495625_0087655_688_1119 130
1149 3300046660 Ga0495625_0166164 Ga0495625_0166164_544_975 130
1150 3300046660 Ga0495625_0167010 Ga0495625_0167010_531_962 130
1151 3300046660 Ga0495625_0190370 Ga0495625_0190370_686_1117 130
1152 3300046660 Ga0495625_0199527 Ga0495625_0199527_107_538 130
1153 3300046660 Ga0495625_0208462 Ga0495625_0208462_348_779 130
1154 3300046663 Ga0495635_0008977 Ga0495635_0008977_2364_2795 130
1155 3300046663 Ga0495635_0200952 Ga0495635_0200952_503_934 130
1156 3300046664 Ga0495659_0003686 Ga0495659_0003686_2060_2491 130
1157 3300046664 Ga0495659_0004277 Ga0495659_0004277_1642_2073 130
1158 3300046664 Ga0495659_0007839 Ga0495659_0007839_1677_2108 130
1159 3300046664 Ga0495659_0025538 Ga0495659_0025538_910_1341 130
1160 3300046664 Ga0495659_0079281 Ga0495659_0079281_427_858 130
1161 3300046664 Ga0495659_0093802 Ga0495659_0093802_527_958 130
1162 3300046664 Ga0495659_0149661 Ga0495659_0149661_189_620 130
1163 3300046664 Ga0495659_0558240 Ga0495659_0558240_54_485 130
1164 3300046665 Ga0495661_0019060 Ga0495661_0019060_2011_2442 130
1165 3300046665 Ga0495661_0022315 Ga0495661_0022315_2910_3341 130
1166 3300046665 Ga0495661_0027641 Ga0495661_0027641_1837_2268 130
1167 3300046665 Ga0495661_0036532 Ga0495661_0036532_1154_1585 130
1168 3300046665 Ga0495661_0042541 Ga0495661_0042541_611_1042 130
1169 3300046665 Ga0495661_0062587 Ga0495661_0062587_619_1050 130
1170 3300046665 Ga0495661_0089042 Ga0495661_0089042_296_727 130
1171 3300046665 Ga0495661_0119891 Ga0495661_0119891_460_891 130
1172 3300046665 Ga0495661_0188840 Ga0495661_0188840_142_573 130
1173 3300046665 Ga0495661_0219532 Ga0495661_0219532_514_945 130
1174 3300046665 Ga0495661_0293686 Ga0495661_0293686_38_469 130
1175 3300046674 Ga0495588_0009027 Ga0495588_0009027_1778_2209 130
1176 3300046674 Ga0495588_0011149 Ga0495588_0011149_3215_3646 130
1177 3300046674 Ga0495588_0017870 Ga0495588_0017870_1099_1530 130
1178 3300046674 Ga0495588_0018679 Ga0495588_0018679_2192_2623 130
1179 3300046674 Ga0495588_0040525 Ga0495588_0040525_393_824 130
1180 3300046674 Ga0495588_0046528 Ga0495588_0046528_1656_2087 130
1181 3300046674 Ga0495588_0050054 Ga0495588_0050054_744_1175 130
1182 3300046674 Ga0495588_0230874 Ga0495588_0230874_182_613 130
1183 3300046678 Ga0495599_0222351 Ga0495599_0222351_706_1137 130
1184 3300046679 Ga0495623_0118836 Ga0495623_0118836_18_449 130
1185 3300046679 Ga0495623_0154907 Ga0495623_0154907_477_908 130
1186 3300046679 Ga0495623_0175824 Ga0495623_0175824_687_1118 130
1187 3300046679 Ga0495623_0178944 Ga0495623_0178944_418_849 130
1188 3300046680 Ga0495646_0043675 Ga0495646_0043675_571_1002 130
1189 3300046680 Ga0495646_0054683 Ga0495646_0054683_448_879 130
1190 3300046680 Ga0495646_0158928 Ga0495646_0158928_515_946 130
1191 3300046684 Ga0495669_0001596 Ga0495669_0001596_5291_5722 130
1192 3300046684 Ga0495669_0002717 Ga0495669_0002717_3800_4231 130
1193 3300046684 Ga0495669_0086878 Ga0495669_0086878_344_775 130
1194 3300046684 Ga0495669_0350587 Ga0495669_0350587_151_582 130
1195 3300046689 Ga0495613_0082016 Ga0495613_0082016_803_1234 130
1196 3300046689 Ga0495613_0092389 Ga0495613_0092389_384_815 130
1197 3300046690 Ga0495624_0069830 Ga0495624_0069830_1222_1653 130
1198 3300046690 Ga0495624_0499649 Ga0495624_0499649_103_534 130
1199 3300046691 Ga0495670_0009867 Ga0495670_0009867_1262_1693 130
1200 3300046691 Ga0495670_0028896 Ga0495670_0028896_1704_2135 130
1201 3300046691 Ga0495670_0035188 Ga0495670_0035188_1459_1890 130
1202 3300046691 Ga0495670_0067273 Ga0495670_0067273_293_724 130
1203 3300046691 Ga0495670_0102977 Ga0495670_0102977_220_651 130
1204 3300046691 Ga0495670_0119876 Ga0495670_0119876_347_778 130
1205 3300046691 Ga0495670_0150687 Ga0495670_0150687_727_1158 130
1206 3300046691 Ga0495670_0166291 Ga0495670_0166291_378_809 130
1207 3300046691 Ga0495670_0320214 Ga0495670_0320214_152_583 130
1208 3300046692 Ga0495671_0000037 Ga0495671_0000037_101832_102263 130
1209 3300046692 Ga0495671_0005005 Ga0495671_0005005_4207_4638 130
1210 3300046692 Ga0495671_0014262 Ga0495671_0014262_3493_3924 130
1211 3300046692 Ga0495671_0457852 Ga0495671_0457852_58_489 130
1212 3300046694 Ga0495649_0007567 Ga0495649_0007567_2130_2561 130
1213 3300046694 Ga0495649_0041099 Ga0495649_0041099_1957_2388 130
1214 3300046694 Ga0495649_0064779 Ga0495649_0064779_1160_1591 130
1215 3300046694 Ga0495649_0129516 Ga0495649_0129516_130_561 130
1216 3300046694 Ga0495649_0136805 Ga0495649_0136805_136_567 130
1217 3300046794 Ga0495589_0016595 Ga0495589_0016595_1768_2199 130
1218 3300046794 Ga0495589_0056788 Ga0495589_0056788_340_771 130
1219 3300046794 Ga0495589_0063428 Ga0495589_0063428_1076_1507 130
1220 3300046794 Ga0495589_0074703 Ga0495589_0074703_1007_1438 130
1221 3300046794 Ga0495589_0157145 Ga0495589_0157145_225_656 130
1222 3300046809 Ga0495600_0004009 Ga0495600_0004009_1511_1942 130
1223 3300046809 Ga0495600_0178346 Ga0495600_0178346_395_826 130
1224 3300046809 Ga0495600_0198806 Ga0495600_0198806_79_510 130
1225 3300046809 Ga0495600_0493571 Ga0495600_0493571_39_470 130
1226 3300046810 Ga0495660_0010186 Ga0495660_0010186_1369_1800 130
1227 3300046810 Ga0495660_0011018 Ga0495660_0011018_2210_2641 130
1228 3300046810 Ga0495660_0012969 Ga0495660_0012969_902_1333 130
1229 3300046810 Ga0495660_0015683 Ga0495660_0015683_1490_1921 130
1230 3300046810 Ga0495660_0034744 Ga0495660_0034744_580_1011 130
1231 3300046810 Ga0495660_0048108 Ga0495660_0048108_722_1153 130
1232 3300046810 Ga0495660_0051977 Ga0495660_0051977_787_1218 130
1233 3300046810 Ga0495660_0065924 Ga0495660_0065924_1228_1659 130
1234 3300046810 Ga0495660_0084002 Ga0495660_0084002_660_1091 130
1235 3300046810 Ga0495660_0174053 Ga0495660_0174053_73_504 130
1236 3300046810 Ga0495660_0285985 Ga0495660_0285985_261_692 130
1237 3300047315 Ga0495581_0027016 Ga0495581_0027016_2596_3027 130
1238 3300047315 Ga0495581_0040802 Ga0495581_0040802_2071_2502 130
1239 3300047315 Ga0495581_0157473 Ga0495581_0157473_152_583 130
1240 3300047317 Ga0495604_0003421 Ga0495604_0003421_9382_9813 130
1241 3300047317 Ga0495604_0010804 Ga0495604_0010804_314_745 130
1242 3300047317 Ga0495604_0048599 Ga0495604_0048599_2196_2627 130
1243 3300047318 Ga0495636_0001434 Ga0495636_0001434_4538_4969 130
1244 3300047318 Ga0495636_0003890 Ga0495636_0003890_2686_3117 130
1245 3300047318 Ga0495636_0006133 Ga0495636_0006133_640_1071 130
1246 3300047318 Ga0495636_0006316 Ga0495636_0006316_1693_2124 130
1247 3300047318 Ga0495636_0018170 Ga0495636_0018170_977_1408 130
1248 3300047318 Ga0495636_0106143 Ga0495636_0106143_475_906 130
1249 3300047318 Ga0495636_0259312 Ga0495636_0259312_245_676 130
1250 3300047318 Ga0495636_0337773 Ga0495636_0337773_162_593 130
1251 3300047319 Ga0495674_0031660 Ga0495674_0031660_571_1002 130
1252 3300047319 Ga0495674_0280785 Ga0495674_0280785_476_907 130
1253 3300047320 Ga0495672_0000013 Ga0495672_0000013_15074_15505 130
1254 3300047320 Ga0495672_0000157 Ga0495672_0000157_96910_97341 130
1255 3300047320 Ga0495672_0007686 Ga0495672_0007686_3998_4429 130
1256 3300047320 Ga0495672_0015499 Ga0495672_0015499_4071_4502 130
1257 3300047320 Ga0495672_0031965 Ga0495672_0031965_277_708 130
1258 3300047320 Ga0495672_0045766 Ga0495672_0045766_1517_1948 130
1259 3300047320 Ga0495672_0161124 Ga0495672_0161124_661_1092 130
1260 3300047320 Ga0495672_0357737 Ga0495672_0357737_109_540 130
1261 3300047321 Ga0495676_0024323 Ga0495676_0024323_2700_3131 130
1262 3300047321 Ga0495676_0026376 Ga0495676_0026376_4143_4574 130
1263 3300047321 Ga0495676_0098301 Ga0495676_0098301_243_674 130
1264 3300047321 Ga0495676_0113267 Ga0495676_0113267_729_1160 130
1265 3300047321 Ga0495676_0120830 Ga0495676_0120830_229_660 130
1266 3300047321 Ga0495676_0275944 Ga0495676_0275944_521_952 130
1267 3300047322 Ga0495680_0007818 Ga0495680_0007818_8052_8483 130
1268 3300047322 Ga0495680_0186233 Ga0495680_0186233_16_447 130
1269 3300047322 Ga0495680_0404052 Ga0495680_0404052_176_607 130
1270 3300047323 Ga0495683_0001129 Ga0495683_0001129_17136_17567 130
1271 3300047323 Ga0495683_0017957 Ga0495683_0017957_223_654 130
1272 3300047323 Ga0495683_0023372 Ga0495683_0023372_608_1039 130
1273 3300047323 Ga0495683_0032766 Ga0495683_0032766_1270_1701 130
1274 3300047323 Ga0495683_0059991 Ga0495683_0059991_255_686 130
1275 3300047323 Ga0495683_0070031 Ga0495683_0070031_82_513 130
1276 3300047323 Ga0495683_0093261 Ga0495683_0093261_965_1396 130
1277 3300047323 Ga0495683_0275552 Ga0495683_0275552_215_646 130
1278 3300047443 Ga0495687_000342 Ga0495687_000342_10219_10650 130
1279 3300047443 Ga0495687_001562 Ga0495687_001562_15726_16157 130
1280 3300047443 Ga0495687_002921 Ga0495687_002921_8706_9137 130
1281 3300047443 Ga0495687_007470 Ga0495687_007470_2138_2569 130
1282 3300047443 Ga0495687_013991 Ga0495687_013991_12_443 130
1283 3300047443 Ga0495687_062464 Ga0495687_062464_1086_1517 130
1284 3300047443 Ga0495687_084824 Ga0495687_084824_188_619 130
1285 3300047443 Ga0495687_095851 Ga0495687_095851_545_976 130
1286 3300047444 Ga0495675_0013567 Ga0495675_0013567_695_1126 130
1287 3300047444 Ga0495675_0021158 Ga0495675_0021158_385_816 130
1288 3300047444 Ga0495675_0072252 Ga0495675_0072252_1070_1501 130
1289 3300047445 Ga0495677_0001866 Ga0495677_0001866_4034_4465 130
1290 3300047445 Ga0495677_0005942 Ga0495677_0005942_2596_3027 130
1291 3300047445 Ga0495677_0008079 Ga0495677_0008079_403_834 130
1292 3300047445 Ga0495677_0009137 Ga0495677_0009137_2930_3361 130
1293 3300047445 Ga0495677_0015597 Ga0495677_0015597_560_991 130
1294 3300047445 Ga0495677_0044661 Ga0495677_0044661_131_562 130
1295 3300047445 Ga0495677_0109477 Ga0495677_0109477_245_676 130
1296 3300047445 Ga0495677_0176898 Ga0495677_0176898_57_488 130
1297 3300047445 Ga0495677_0275635 Ga0495677_0275635_208_639 130
1298 3300047445 Ga0495677_0289370 Ga0495677_0289370_67_498 130
1299 3300047446 Ga0495679_008349 Ga0495679_008349_1237_1668 130
1300 3300047446 Ga0495679_023106 Ga0495679_023106_1125_1556 130
1301 3300047446 Ga0495679_041737 Ga0495679_041737_22_453 130
1302 3300047447 Ga0495685_000291 Ga0495685_000291_2690_3121 130
1303 3300047447 Ga0495685_001965 Ga0495685_001965_3259_3690 130
1304 3300047447 Ga0495685_014389 Ga0495685_014389_2139_2570 130
1305 3300047447 Ga0495685_019727 Ga0495685_019727_1473_1904 130
1306 3300047447 Ga0495685_034014 Ga0495685_034014_647_1078 130
1307 3300047447 Ga0495685_071378 Ga0495685_071378_337_768 130
1308 3300047447 Ga0495685_108989 Ga0495685_108989_252_683 130
1309 3300047469 Ga0495673_0000248 Ga0495673_0000248_22145_22576 130
1310 3300047469 Ga0495673_0019105 Ga0495673_0019105_2449_2880 130
1311 3300047469 Ga0495673_0132106 Ga0495673_0132106_204_635 130
1312 3300047469 Ga0495673_0310455 Ga0495673_0310455_99_530 130
1313 3300047470 Ga0495681_0009083 Ga0495681_0009083_86_517 130
1314 3300047470 Ga0495681_0010756 Ga0495681_0010756_1090_1521 130
1315 3300047470 Ga0495681_0011744 Ga0495681_0011744_2993_3424 130
1316 3300047470 Ga0495681_0021475 Ga0495681_0021475_2044_2475 130
1317 3300047470 Ga0495681_0043390 Ga0495681_0043390_731_1162 130
1318 3300047470 Ga0495681_0046827 Ga0495681_0046827_1074_1505 130
1319 3300047470 Ga0495681_0126902 Ga0495681_0126902_564_995 130
1320 3300047470 Ga0495681_0271015 Ga0495681_0271015_149_580 130
1321 3300047472 Ga0495686_0000787 Ga0495686_0000787_39479_39910 130
1322 3300047472 Ga0495686_0001126 Ga0495686_0001126_30897_31328 130
1323 3300047472 Ga0495686_0007683 Ga0495686_0007683_1342_1773 130
1324 3300047472 Ga0495686_0010875 Ga0495686_0010875_3898_4329 130
1325 3300047472 Ga0495686_0057869 Ga0495686_0057869_1624_2055 130
1326 3300047472 Ga0495686_0189431 Ga0495686_0189431_37_468 130
1327 3300047673 Ga0495593_0002955 Ga0495593_0002955_3261_3692 130
1328 3300047673 Ga0495593_0018189 Ga0495593_0018189_421_852 130
1329 3300047673 Ga0495593_0036990 Ga0495593_0036990_1635_2066 130
1330 3300048088 Ga0495602_0036361 Ga0495602_0036361_3138_3569 130
1331 3300048088 Ga0495602_0051607 Ga0495602_0051607_668_1099 130
1332 3300048089 Ga0495614_0056437 Ga0495614_0056437_147_578 130
1333 3300048090 Ga0495615_0013648 Ga0495615_0013648_839_1270 130
1334 3300048090 Ga0495615_0100569 Ga0495615_0100569_375_806 130
1335 3300048091 Ga0495626_0000227 Ga0495626_0000227_2125_2556 130
1336 3300048091 Ga0495626_0010154 Ga0495626_0010154_1152_1583 130
1337 3300048091 Ga0495626_0021350 Ga0495626_0021350_2138_2569 130
1338 3300048091 Ga0495626_0040841 Ga0495626_0040841_1067_1498 130
1339 3300048091 Ga0495626_0055982 Ga0495626_0055982_912_1343 130
1340 3300048091 Ga0495626_0060164 Ga0495626_0060164_533_964 130
1341 3300048091 Ga0495626_0073481 Ga0495626_0073481_142_573 130
1342 3300048091 Ga0495626_0073528 Ga0495626_0073528_307_738 130
1343 3300048091 Ga0495626_0083647 Ga0495626_0083647_557_988 130
1344 3300048091 Ga0495626_0084714 Ga0495626_0084714_678_1109 130
1345 3300048091 Ga0495626_0096000 Ga0495626_0096000_396_827 130
1346 3300048091 Ga0495626_0290644 Ga0495626_0290644_159_590 130
1347 3300048903 Ga0496100_0111532 Ga0496100_0111532_887_1318 130
1348 3300048903 Ga0496100_0294264 Ga0496100_0294264_157_588 130
1349 3300048903 Ga0496100_0641645 Ga0496100_0641645_175_606 130
1350 3300048904 Ga0496101_0009727 Ga0496101_0009727_2016_2447 130
1351 3300048904 Ga0496101_1140934 Ga0496101_1140934_39_470 130
1352 3300048905 Ga0496102_0075112 Ga0496102_0075112_904_1335 130
1353 3300048905 Ga0496102_0092053 Ga0496102_0092053_2049_2480 130
1354 3300048905 Ga0496102_0214439 Ga0496102_0214439_1357_1788 130
1355 3300048905 Ga0496102_1758156 Ga0496102_1758156_12_443 130
1356 3300048906 Ga0496103_0017021 Ga0496103_0017021_1719_2150 130
1357 3300048906 Ga0496103_0038283 Ga0496103_0038283_1762_2193 130
1358 3300048906 Ga0496103_0155309 Ga0496103_0155309_192_623 130
1359 3300048906 Ga0496103_0426401 Ga0496103_0426401_372_803 130
1360 3300048907 Ga0496104_0505298 Ga0496104_0505298_659_1090 130
1361 3300048907 Ga0496104_0807072 Ga0496104_0807072_160_591 130
1362 3300048909 Ga0496106_0036102 Ga0496106_0036102_939_1370 130
1363 3300048909 Ga0496106_0171980 Ga0496106_0171980_478_909 130
1364 3300048910 Ga0496107_0160774 Ga0496107_0160774_1105_1536 130
1365 3300048910 Ga0496107_0222414 Ga0496107_0222414_532_963 130
1366 3300048912 Ga0496109_0548480 Ga0496109_0548480_129_560 130
1367 3300048913 Ga0496110_0456356 Ga0496110_0456356_130_561 130
1368 3300048913 Ga0496110_0457031 Ga0496110_0457031_604_1035 130
1369 3300048913 Ga0496110_0794302 Ga0496110_0794302_225_656 130
1370 3300048913 Ga0496110_1261699 Ga0496110_1261699_93_524 130
1371 3300048914 Ga0496111_0408873 Ga0496111_0408873_55_486 130
1372 3300048915 Ga0496112_0529748 Ga0496112_0529748_481_912 130
1373 3300048916 Ga0496113_0173984 Ga0496113_0173984_1151_1582 130
1374 3300048916 Ga0496113_0757937 Ga0496113_0757937_189_620 130
1375 3300048917 Ga0496114_0372797 Ga0496114_0372797_559_990 130
1376 3300048918 Ga0496115_0040092 Ga0496115_0040092_2126_2557 130
1377 3300048918 Ga0496115_0062017 Ga0496115_0062017_418_849 130
1378 3300048918 Ga0496115_0131327 Ga0496115_0131327_751_1182 130
1379 3300048918 Ga0496115_0254757 Ga0496115_0254757_403_834 130
1380 3300048918 Ga0496115_0379901 Ga0496115_0379901_521_952 130
1381 3300048918 Ga0496115_0572610 Ga0496115_0572610_128_559 130
1382 3300048918 Ga0496115_0608123 Ga0496115_0608123_19_450 130
1383 3300048919 Ga0496116_0054709 Ga0496116_0054709_1585_2016 130
1384 3300048919 Ga0496116_0122217 Ga0496116_0122217_362_793 130
1385 3300048919 Ga0496116_0226636 Ga0496116_0226636_403_834 130
1386 3300048922 Ga0496119_0188727 Ga0496119_0188727_319_750 130
1387 3300048923 Ga0496120_0152393 Ga0496120_0152393_439_870 130
1388 3300048924 Ga0496121_0233788 Ga0496121_0233788_543_974 130
1389 3300048924 Ga0496121_0672503 Ga0496121_0672503_186_617 130
1390 3300048925 Ga0496122_0045238 Ga0496122_0045238_2909_3340 130
1391 3300048925 Ga0496122_0117785 Ga0496122_0117785_879_1310 130
1392 3300048926 Ga0496123_0024316 Ga0496123_0024316_142_573 130
1393 3300048926 Ga0496123_0031548 Ga0496123_0031548_2288_2719 130
1394 3300048926 Ga0496123_0050572 Ga0496123_0050572_142_573 130
1395 3300048927 Ga0496124_0052609 Ga0496124_0052609_2719_3150 130
1396 3300048927 Ga0496124_0080875 Ga0496124_0080875_1457_1888 130
1397 3300048927 Ga0496124_0083920 Ga0496124_0083920_1555_1986 130
1398 3300048927 Ga0496124_0235447 Ga0496124_0235447_122_553 130
1399 3300048927 Ga0496124_0237303 Ga0496124_0237303_663_1094 130
1400 3300048927 Ga0496124_0317340 Ga0496124_0317340_545_976 130
1401 3300048927 Ga0496124_0542713 Ga0496124_0542713_77_508 130
1402 3300048928 Ga0496125_0134373 Ga0496125_0134373_785_1216 130
1403 3300048928 Ga0496125_0164527 Ga0496125_0164527_681_1112 130
1404 3300048928 Ga0496125_0177292 Ga0496125_0177292_876_1307 130
1405 3300048929 Ga0496126_0004622 Ga0496126_0004622_13599_14030 130
1406 3300049127 Ga0501306_000005 Ga0501306_000005_2453_2884 130
1407 3300049127 Ga0501306_000357 Ga0501306_000357_1955_2386 130
1408 3300049127 Ga0501306_000359 Ga0501306_000359_541_972 130
1409 3300049127 Ga0501306_002633 Ga0501306_002633_1419_1850 130
1410 3300049127 Ga0501306_006022 Ga0501306_006022_83_514 130
1411 3300049127 Ga0501306_104473 Ga0501306_104473_65_496 130
1412 3300049128 Ga0501308_000002 Ga0501308_000002_8053_8484 130
1413 3300049128 Ga0501308_000101 Ga0501308_000101_1175_1606 130
1414 3300049128 Ga0501308_001514 Ga0501308_001514_883_1314 130
1415 3300049128 Ga0501308_005869 Ga0501308_005869_11_442 130
1416 3300049129 Ga0501309_000053 Ga0501309_000053_2405_2836 130
1417 3300049129 Ga0501309_000994 Ga0501309_000994_542_973 130
1418 3300049129 Ga0501309_018310 Ga0501309_018310_420_851 130
1419 3300049130 Ga0501310_000065 Ga0501310_000065_733_1164 130
1420 3300049130 Ga0501310_000908 Ga0501310_000908_1230_1661 130
1421 3300049130 Ga0501310_001119 Ga0501310_001119_216_647 130
1422 3300049130 Ga0501310_001494 Ga0501310_001494_978_1409 130
1423 3300049130 Ga0501310_005775 Ga0501310_005775_494_964 130
1424 3300049130 Ga0501310_006883 Ga0501310_006883_588_1019 130
1425 3300049132 Ga0501343_001045 Ga0501343_001045_506_937 130
1426 3300049132 Ga0501343_003853 Ga0501343_003853_309_740 130
1427 3300049160 Ga0501304_000001 Ga0501304_000001_5013_5444 130
1428 3300049160 Ga0501304_000110 Ga0501304_000110_386_817 130
1429 3300049161 Ga0501305_000138 Ga0501305_000138_1152_1583 130
1430 3300049161 Ga0501305_001754 Ga0501305_001754_919_1350 130
1431 3300049161 Ga0501305_002625 Ga0501305_002625_581_1012 130
1432 3300049162 Ga0501307_000084 Ga0501307_000084_3123_3554 130
1433 3300049162 Ga0501307_000295 Ga0501307_000295_2049_2480 130
1434 3300049162 Ga0501307_000470 Ga0501307_000470_1762_2193 130
1435 3300049162 Ga0501307_000643 Ga0501307_000643_1221_1652 130
1436 3300049162 Ga0501307_008590 Ga0501307_008590_65_496 130
1437 3300049459 Ga0495678_000010 Ga0495678_000010_345842_346273 130
1438 3300049459 Ga0495678_006058 Ga0495678_006058_2010_2441 130
1439 3300049459 Ga0495678_006909 Ga0495678_006909_4034_4465 130
1440 3300049459 Ga0495678_016621 Ga0495678_016621_1203_1634 130
1441 3300049459 Ga0495678_052645 Ga0495678_052645_780_1211 130
1442 3300049459 Ga0495678_058254 Ga0495678_058254_620_1051 130
1443 3300049459 Ga0495678_093588 Ga0495678_093588_42_473 130
1444 3300049459 Ga0495678_172811 Ga0495678_172811_219_650 130
1445 3300049460 Ga0495682_0003087 Ga0495682_0003087_2103_2534 130
1446 3300049460 Ga0495682_0006686 Ga0495682_0006686_3047_3478 130
1447 3300049460 Ga0495682_0067593 Ga0495682_0067593_77_508 130
1448 3300049460 Ga0495682_0128104 Ga0495682_0128104_169_600 130
1449 3300049515 Ga0501292_002630 Ga0501292_002630_1278_1709 130
1450 3300049526 Ga0501303_013329 Ga0501303_013329_137_568 130
1451 3300049527 Ga0501311_000002 Ga0501311_000002_7886_8317 130
1452 3300049527 Ga0501311_002478 Ga0501311_002478_308_739 130
1453 3300049528 Ga0501312_000249 Ga0501312_000249_1152_1583 130
1454 3300049528 Ga0501312_004300 Ga0501312_004300_1126_1557 130
1455 3300049528 Ga0501312_006986 Ga0501312_006986_379_810 130
1456 3300049528 Ga0501312_009302 Ga0501312_009302_312_743 130
1457 3300049529 Ga0501313_000292 Ga0501313_000292_813_1244 130
1458 3300049529 Ga0501313_000495 Ga0501313_000495_89_520 130
1459 3300049529 Ga0501313_000546 Ga0501313_000546_2011_2442 130
1460 3300049529 Ga0501313_031015 Ga0501313_031015_171_602 130
1461 3300049530 Ga0501314_001218 Ga0501314_001218_579_1010 130
1462 3300049530 Ga0501314_002963 Ga0501314_002963_181_612 130
1463 3300049531 Ga0501315_000004 Ga0501315_000004_9129_9560 130
1464 3300049531 Ga0501315_000754 Ga0501315_000754_1183_1614 130
1465 3300049531 Ga0501315_003030 Ga0501315_003030_1121_1552 130
1466 3300049531 Ga0501315_005958 Ga0501315_005958_65_496 130
1467 3300049531 Ga0501315_012600 Ga0501315_012600_452_883 130
1468 3300049531 Ga0501315_045069 Ga0501315_045069_208_639 130
1469 3300049532 Ga0501316_000002 Ga0501316_000002_8702_9133 130
1470 3300049532 Ga0501316_001189 Ga0501316_001189_783_1214 130
1471 3300049532 Ga0501316_001227 Ga0501316_001227_377_808 130
1472 3300049532 Ga0501316_026469 Ga0501316_026469_22_453 130
1473 3300049533 Ga0501317_002431 Ga0501317_002431_317_748 130
1474 3300049533 Ga0501317_007694 Ga0501317_007694_749_1180 130
1475 3300049534 Ga0501318_000040 Ga0501318_000040_2303_2734 130
1476 3300049534 Ga0501318_001648 Ga0501318_001648_824_1255 130
1477 3300049535 Ga0501319_025246 Ga0501319_025246_94_525 130
1478 3300049536 Ga0501320_001179 Ga0501320_001179_609_1040 130
1479 3300049536 Ga0501320_001910 Ga0501320_001910_684_1115 130
1480 3300049536 Ga0501320_003292 Ga0501320_003292_13_444 130
1481 3300049536 Ga0501320_009368 Ga0501320_009368_133_564 130
1482 3300049537 Ga0501321_001759 Ga0501321_001759_214_645 130
1483 3300049537 Ga0501321_005466 Ga0501321_005466_414_845 130
1484 3300049538 Ga0501322_010033 Ga0501322_010033_117_548 130
1485 3300049538 Ga0501322_012491 Ga0501322_012491_130_561 130
1486 3300049539 Ga0501323_000822 Ga0501323_000822_1985_2416 130
1487 3300049539 Ga0501323_001128 Ga0501323_001128_813_1244 130
1488 3300049539 Ga0501323_002535 Ga0501323_002535_1136_1567 130
1489 3300049539 Ga0501323_006919 Ga0501323_006919_267_698 130
1490 3300049539 Ga0501323_012755 Ga0501323_012755_23_454 130
1491 3300049539 Ga0501323_017279 Ga0501323_017279_214_645 130
1492 3300049540 Ga0501324_015903 Ga0501324_015903_89_520 130
1493 3300049540 Ga0501324_021834 Ga0501324_021834_49_480 130
1494 3300049541 Ga0501325_005953 Ga0501325_005953_349_780 130
1495 3300049542 Ga0501326_05772 Ga0501326_05772_215_646 130
1496 3300049543 Ga0501327_00336 Ga0501327_00336_803_1234 130
1497 3300049546 Ga0501330_000369 Ga0501330_000369_885_1316 130
1498 3300049550 Ga0501334_11546 Ga0501334_11546_126_557 130
1499 3300049551 Ga0501335_003176 Ga0501335_003176_549_980 130
1500 3300049551 Ga0501335_022410 Ga0501335_022410_46_477 130
1501 3300049552 Ga0501336_000669 Ga0501336_000669_838_1269 130
1502 3300049552 Ga0501336_001280 Ga0501336_001280_215_646 130
1503 3300049553 Ga0501337_000673 Ga0501337_000673_799_1230 130
1504 3300049553 Ga0501337_024160 Ga0501337_024160_29_460 130
1505 3300049556 Ga0501340_003556 Ga0501340_003556_171_602 130
1506 3300049571 Ga0501034_0944157 Ga0501034_0944157_208_639 130
1507 3300049572 Ga0501036_0283908 Ga0501036_0283908_498_929 130
1508 3300049654 Ga0501207_010936 Ga0501207_010936_718_1149 130
1509 3300049658 Ga0501211_006351 Ga0501211_006351_602_1033 130
1510 3300049661 Ga0501217_133450 Ga0501217_133450_41_472 130
1511 3300049662 Ga0501222_005375 Ga0501222_005375_209_640 130
1512 3300049667 Ga0501230_002593 Ga0501230_002593_1773_2204 130
1513 3300049668 Ga0501233_077131 Ga0501233_077131_187_618 130
1514 3300049671 Ga0501238_000213 Ga0501238_000213_2757_3188 130
1515 3300049679 Ga0501249_002499 Ga0501249_002499_1024_1455 130
1516 3300049686 Ga0501257_034882 Ga0501257_034882_205_636 130
1517 3300049704 Ga0501221_018188 Ga0501221_018188_910_1341 130
1518 3300049760 Ga0501263_018035 Ga0501263_018035_38_469 130
1519 3300049766 Ga0501269_000003 Ga0501269_000003_84949_85380 130
1520 3300049775 Ga0501279_001682 Ga0501279_001682_1765_2196 130
1521 3300049775 Ga0501279_019904 Ga0501279_019904_150_581 130
1522 3300049822 Ga0501035_0010452 Ga0501035_0010452_6980_7411 130
1523 3300049823 Ga0501044_0358594 Ga0501044_0358594_260_691 130
1524 3300049853 Ga0501226_005181 Ga0501226_005181_819_1250 130
1525 3300050489 nmdc:mga03683_216870_c1 nmdc:mga03683_216870_c1_150_581 130
1526 3300050490 nmdc:mga03n38_298936_c1 nmdc:mga03n38_298936_c1_377_808 130
1527 3300050493 nmdc:mga0k408_43703_c1 nmdc:mga0k408_43703_c1_74_505 130
1528 3300050493 nmdc:mga0k408_98510_c1 nmdc:mga0k408_98510_c1_639_1070 130
1529 3300050496 nmdc:mga07m45_13904_c1 nmdc:mga07m45_13904_c1_1389_1820 130
1530 3300050496 nmdc:mga07m45_521668_c1 nmdc:mga07m45_521668_c1_36_467 130
1531 3300053083 Ga0495655_0104305 Ga0495655_0104305_44_475 130
1532 3300053088 Ga0500644_0035969 Ga0500644_0035969_264_695 130
1533 3300053125 Ga0500618_003056 Ga0500618_003056_4713_5144 130
1534 3300053136 Ga0500559_0103340 Ga0500559_0103340_505_936 130
1535 3300053145 Ga0500586_017865 Ga0500586_017865_1662_2093 130
1536 3300053149 Ga0500600_0129045 Ga0500600_0129045_445_891 130
1537 3300053156 Ga0500622_0000002 Ga0500622_0000002_9103_9537 130
1538 3300053734 Ga0500565_012675 Ga0500565_012675_40_471 130
1539 3300059477 Ga0587084_001109 Ga0587084_001109_1063_1494 130
1540 3300059477 Ga0587084_002020 Ga0587084_002020_962_1393 130
1541 3300059478 Ga0587093_081804 Ga0587093_081804_50_481 130
1542 3300059490 Ga0587066_000001 Ga0587066_000001_4443_4874 130
1543 3300059491 Ga0587070_000065 Ga0587070_000065_3819_4250 130
1544 3300059492 Ga0587073_0001671 Ga0587073_0001671_978_1409 130
1545 3300059493 Ga0587077_001151 Ga0587077_001151_1179_1610 130
1546 3300059503 Ga0587080_002147 Ga0587080_002147_1248_1679 130
1547 3300059503 Ga0587080_077620 Ga0587080_077620_131_562 130
1548 3300059504 Ga0587082_000884 Ga0587082_000884_1248_1679 130
1549 3300059505 Ga0587083_0000094 Ga0587083_0000094_3079_3510 130
1550 3300059505 Ga0587083_0000200 Ga0587083_0000200_3832_4263 130
1551 3300059506 Ga0587085_021468 Ga0587085_021468_171_602 130
1552 3300059508 Ga0587088_000001 Ga0587088_000001_5110_5541 130
1553 3300059509 Ga0587089_043032 Ga0587089_043032_206_637 130
1554 3300059511 Ga0587091_000335 Ga0587091_000335_2568_2999 130
1555 3300059604 Ga0587098_001373 Ga0587098_001373_396_827 130
1556 3300059605 Ga0587106_000819 Ga0587106_000819_1241_1672 130
1557 3300059607 Ga0587125_003092 Ga0587125_003092_710_1141 130
1558 3300059622 Ga0587099_000096 Ga0587099_000096_953_1384 130
1559 3300059623 Ga0587101_005751 Ga0587101_005751_275_706 130
1560 3300059627 Ga0587117_015850 Ga0587117_015850_497_928 130
1561 3300059630 Ga0587128_000098 Ga0587128_000098_1987_2418 130
1562 3300059639 Ga0587062_016401 Ga0587062_016401_56_487 130
1563 3300059639 Ga0587062_038847 Ga0587062_038847_190_621 130
1564 3300059640 Ga0587067_000303 Ga0587067_000303_2568_2999 130
1565 3300059641 Ga0587068_000002 Ga0587068_000002_3676_4107 130
1566 3300059641 Ga0587068_000145 Ga0587068_000145_3673_4104 130
1567 3300059641 Ga0587068_000228 Ga0587068_000228_129_560 130
1568 3300059642 Ga0587069_001414 Ga0587069_001414_645_1076 130
1569 3300059643 Ga0587072_003430 Ga0587072_003430_130_561 130
1570 3300059644 Ga0587075_000434 Ga0587075_000434_1178_1609 130
1571 3300059645 Ga0587076_000914 Ga0587076_000914_670_1101 130
1572 3300059646 Ga0587078_000693 Ga0587078_000693_1254_1685 130
1573 3300059647 Ga0587079_000913 Ga0587079_000913_1353_1784 130
1574 3300059647 Ga0587079_011093 Ga0587079_011093_617_1048 130
1575 3300059648 Ga0587100_007975 Ga0587100_007975_195_626 130
1576 3300059652 Ga0587107_000137 Ga0587107_000137_976_1407 130
1577 3300059655 Ga0587114_004063 Ga0587114_004063_287_718 130
1578 3300060344 Ga0587071_000116 Ga0587071_000116_1642_2073 130
1579 3300060346 Ga0587111_0000227 Ga0587111_0000227_383_814 130
1580 3300060346 Ga0587111_0000229 Ga0587111_0000229_3579_4010 130
1581 3300060346 Ga0587111_0002272 Ga0587111_0002272_1128_1559 130
1582 3300060346 Ga0587111_0017972 Ga0587111_0017972_685_1134 130
1583 3300001904 JGI24736J21556_1000961 JGI24736J21556_10009616 131
1584 3300001904 JGI24736J21556_1014262 JGI24736J21556_10142623 131
1585 3300001915 JGI24741J21665_1002145 JGI24741J21665_10021456 131
1586 3300001979 JGI24740J21852_10008508 JGI24740J21852_100085087 131
1587 3300001979 JGI24740J21852_10010715 JGI24740J21852_100107155 131
1588 3300001989 JGI24739J22299_10015549 JGI24739J22299_100155493 131
1589 3300001989 JGI24739J22299_10028555 JGI24739J22299_100285553 131
1590 3300001989 JGI24739J22299_10040738 JGI24739J22299_100407383 131
1591 3300001990 JGI24737J22298_10004674 JGI24737J22298_100046748 131
1592 3300001990 JGI24737J22298_10008370 JGI24737J22298_100083704 131
1593 3300001990 JGI24737J22298_10027585 JGI24737J22298_100275853 131
1594 3300002067 JGI24735J21928_10002193 JGI24735J21928_1000219311 131
1595 3300002067 JGI24735J21928_10011144 JGI24735J21928_100111443 131
1596 3300002067 JGI24735J21928_10014430 JGI24735J21928_100144302 131
1597 3300002067 JGI24735J21928_10019381 JGI24735J21928_100193812 131
1598 3300002075 JGI24738J21930_10006803 JGI24738J21930_100068033 131
1599 3300002704 JGI25155J39150_1007058 JGI25155J39150_10070581 131
1600 3300002705 JGI25156J39149_1012871 JGI25156J39149_10128712 131
1601 3300002705 JGI25156J39149_1014425 JGI25156J39149_10144252 131
1602 3300003161 Ga0006765J45826_116549 Ga0006765J45826_1165491 131
1603 3300003162 Ga0006778J45830_1018992 Ga0006778J45830_10189925 131
1604 3300003163 Ga0006759J45824_1026311 Ga0006759J45824_10263114 131
1605 3300003214 JGI25165J46597_1001391 JGI25165J46597_100139122 131
1606 3300003300 Ga0006758J48902_1013469 Ga0006758J48902_10134693 131
1607 3300003305 Ga0006770J48903_1023756 Ga0006770J48903_10237565 131
1608 3300003308 Ga0006777J48905_1011571 Ga0006777J48905_10115716 131
1609 3300003354 JGI25160J50197_1002367 JGI25160J50197_100236717 131
1610 3300003479 Ga0006556J51387_1013500 Ga0006556J51387_101350023 131
1611 3300003544 Ga0007417J51691_1012996 Ga0007417J51691_10129968 131
1612 3300003558 Ga0006558J51389_1029442 Ga0006558J51389_102944211 131
1613 3300003559 Ga0007427J51700_120270 Ga0007427J51700_1202701 131
1614 3300003565 Ga0006560J51390_1020307 Ga0006560J51390_102030722 131
1615 3300003567 Ga0006554J51385_1017299 Ga0006554J51385_101729922 131
1616 3300003574 Ga0007410J51695_1015723 Ga0007410J51695_10157238 131
1617 3300003575 Ga0007409J51694_1007029 Ga0007409J51694_10070295 131
1618 3300003575 Ga0007409J51694_1025202 Ga0007409J51694_10252022 131
1619 3300003577 Ga0007416J51690_1009369 Ga0007416J51690_100936911 131
1620 3300003579 Ga0007429J51699_1012288 Ga0007429J51699_10122888 131
1621 3300003611 Ga0007411J51799_118133 Ga0007411J51799_1181332 131
1622 3300003693 Ga0032354_1006520 Ga0032354_10065205 131
1623 3300003693 Ga0032354_1013175 Ga0032354_10131751 131
1624 3300003735 Ga0006780_1003512 Ga0006780_100351211 131
1625 3300003756 Ga0055533_1003286 Ga0055533_10032865 131
1626 3300003756 Ga0055533_1003606 Ga0055533_10036063 131
1627 3300003758 Ga0055532_1000261 Ga0055532_100026133 131
1628 3300003758 Ga0055532_1002406 Ga0055532_10024068 131
1629 3300003760 Ga0055527_1000035 Ga0055527_10000357 131
1630 3300003761 Ga0055535_1000050 Ga0055535_10000507 131
1631 3300003762 Ga0055542_1000512 Ga0055542_100051233 131
1632 3300003763 Ga0055529_1000089 Ga0055529_10000897 131
1633 3300003763 Ga0055529_1019136 Ga0055529_10191361 131
1634 3300003790 Ga0055528_1000489 Ga0055528_100048924 131
1635 3300003856 Ga0058692_1002213 Ga0058692_100221313 131
1636 3300004801 Ga0058860_10029302 Ga0058860_100293021 131
1637 3300005262 Ga0065165_1000885 Ga0065165_100088533 131
1638 3300005327 Ga0070658_10012014 Ga0070658_1001201414 131
1639 3300005327 Ga0070658_10028760 Ga0070658_100287603 131
1640 3300005327 Ga0070658_10051816 Ga0070658_100518162 131
1641 3300005327 Ga0070658_10197036 Ga0070658_101970362 131
1642 3300005335 Ga0070666_10064761 Ga0070666_100647615 131
1643 3300005337 Ga0070682_100104638 Ga0070682_1001046382 131
1644 3300005338 Ga0068868_100985634 Ga0068868_1009856341 131
1645 3300005339 Ga0070660_100026003 Ga0070660_1000260032 131
1646 3300005339 Ga0070660_100034626 Ga0070660_1000346262 131
1647 3300005344 Ga0070661_100425658 Ga0070661_1004256582 131
1648 3300005355 Ga0070671_100130518 Ga0070671_1001305185 131
1649 3300005366 Ga0070659_100000426 Ga0070659_10000042628 131
1650 3300005366 Ga0070659_100235446 Ga0070659_1002354462 131
1651 3300005367 Ga0070667_100263553 Ga0070667_1002635532 131
1652 3300005455 Ga0070663_100021946 Ga0070663_1000219467 131
1653 3300005455 Ga0070663_100434756 Ga0070663_1004347562 131
1654 3300005455 Ga0070663_101124597 Ga0070663_1011245972 131
1655 3300005456 Ga0070678_100253166 Ga0070678_1002531662 131
1656 3300005548 Ga0070665_100065427 Ga0070665_1000654278 131
1657 3300005563 Ga0068855_100018349 Ga0068855_1000183496 131
1658 3300005563 Ga0068855_100077376 Ga0068855_1000773766 131
1659 3300005563 Ga0068855_100131783 Ga0068855_1001317834 131
1660 3300005564 Ga0070664_100142127 Ga0070664_1001421273 131
1661 3300005577 Ga0068857_100128424 Ga0068857_1001284243 131
1662 3300005614 Ga0068856_100155750 Ga0068856_1001557503 131
1663 3300005616 Ga0068852_100001513 Ga0068852_1000015132 131
1664 3300005834 Ga0068851_10115256 Ga0068851_101152563 131
1665 3300009011 Ga0105251_10027169 Ga0105251_100271693 131
1666 3300009011 Ga0105251_10053947 Ga0105251_100539472 131
1667 3300009092 Ga0105250_10050101 Ga0105250_100501012 131
1668 3300009092 Ga0105250_10051084 Ga0105250_100510842 131
1669 3300009092 Ga0105250_10493009 Ga0105250_104930091 131
1670 3300009093 Ga0105240_10103920 Ga0105240_101039205 131
1671 3300009093 Ga0105240_10407148 Ga0105240_104071482 131
1672 3300009093 Ga0105240_10456788 Ga0105240_104567882 131
1673 3300009093 Ga0105240_10661229 Ga0105240_106612292 131
1674 3300009098 Ga0105245_11159602 Ga0105245_111596023 131
1675 3300009101 Ga0105247_10248107 Ga0105247_102481072 131
1676 3300009148 Ga0105243_10233819 Ga0105243_102338192 131
1677 3300009174 Ga0105241_10177715 Ga0105241_101777152 131
1678 3300009174 Ga0105241_12077056 Ga0105241_120770561 131
1679 3300009176 Ga0105242_10702387 Ga0105242_107023873 131
1680 3300009177 Ga0105248_10015430 Ga0105248_100154308 131
1681 3300009177 Ga0105248_10091471 Ga0105248_100914712 131
1682 3300009545 Ga0105237_10137397 Ga0105237_101373972 131
1683 3300009545 Ga0105237_10145717 Ga0105237_101457172 131
1684 3300009551 Ga0105238_10003065 Ga0105238_100030658 131
1685 3300009551 Ga0105238_10478980 Ga0105238_104789803 131
1686 3300010375 Ga0105239_10057421 Ga0105239_100574212 131
1687 3300010375 Ga0105239_10143140 Ga0105239_101431403 131
1688 3300010375 Ga0105239_10325011 Ga0105239_103250113 131
1689 3300011119 Ga0105246_10681807 Ga0105246_106818073 131
1690 3300013059 Ga0154012_136784 Ga0154012_1367841 131
1691 3300013102 Ga0157371_10036577 Ga0157371_100365772 131
1692 3300013104 Ga0157370_10069903 Ga0157370_100699034 131
1693 3300013104 Ga0157370_10872950 Ga0157370_108729502 131
1694 3300013105 Ga0157369_10078496 Ga0157369_100784968 131
1695 3300013105 Ga0157369_10088073 Ga0157369_100880733 131
1696 3300013105 Ga0157369_10088210 Ga0157369_100882103 131
1697 3300013105 Ga0157369_10188597 Ga0157369_101885973 131
1698 3300013105 Ga0157369_10450338 Ga0157369_104503383 131
1699 3300013296 Ga0157374_10000466 Ga0157374_1000046625 131
1700 3300013296 Ga0157374_10069107 Ga0157374_100691074 131
1701 3300013297 Ga0157378_10140170 Ga0157378_101401703 131
1702 3300013306 Ga0163162_10076123 Ga0163162_100761235 131
1703 3300013306 Ga0163162_10086678 Ga0163162_100866784 131
1704 3300013306 Ga0163162_11245599 Ga0163162_112455992 131
1705 3300013307 Ga0157372_10023322 Ga0157372_1002332215 131
1706 3300013308 Ga0157375_10099540 Ga0157375_100995404 131
1707 3300014497 Ga0182008_10079122 Ga0182008_100791223 131
1708 3300014969 Ga0157376_12048211 Ga0157376_120482111 131
1709 3300016635 Ga0183361_10015 Ga0183361_1001540 131
1710 3300019181 Ga0184594_128061 Ga0184594_1280611 131
1711 3300020069 Ga0197907_10133130 Ga0197907_101331304 131
1712 3300020070 Ga0206356_10498037 Ga0206356_104980376 131
1713 3300020076 Ga0206355_1030836 Ga0206355_10308363 131
1714 3300020076 Ga0206355_1331117 Ga0206355_13311172 131
1715 3300020076 Ga0206355_1594134 Ga0206355_15941343 131
1716 3300020076 Ga0206355_1647216 Ga0206355_16472163 131
1717 3300020077 Ga0206351_10165518 Ga0206351_101655184 131
1718 3300020080 Ga0206350_10705675 Ga0206350_107056754 131
1719 3300020080 Ga0206350_11246990 Ga0206350_112469902 131
1720 3300020081 Ga0206354_11361223 Ga0206354_113612233 131
1721 3300020081 Ga0206354_11564442 Ga0206354_115644426 131
1722 3300020082 Ga0206353_10280775 Ga0206353_102807752 131
1723 3300020082 Ga0206353_11104472 Ga0206353_111044722 131
1724 3300020610 Ga0154015_1692537 Ga0154015_16925376 131
1725 3300021361 Ga0213872_10332396 Ga0213872_103323961 131
1726 3300022467 Ga0224712_10002193 Ga0224712_100021937 131
1727 3300022467 Ga0224712_10060966 Ga0224712_100609663 131
1728 3300025225 Ga0209566_100801 Ga0209566_10080122 131
1729 3300025225 Ga0209566_108979 Ga0209566_1089792 131
1730 3300025226 Ga0209674_100153 Ga0209674_100153100 131
1731 3300025226 Ga0209674_103913 Ga0209674_1039133 131
1732 3300025226 Ga0209674_105404 Ga0209674_1054045 131
1733 3300025228 Ga0209672_100073 Ga0209672_100073141 131
1734 3300025228 Ga0209672_102256 Ga0209672_1022567 131
1735 3300025228 Ga0209672_102285 Ga0209672_1022851 131
1736 3300025229 Ga0209147_100093 Ga0209147_100093141 131
1737 3300025229 Ga0209147_102318 Ga0209147_1023181 131
1738 3300025230 Ga0209563_100373 Ga0209563_10037316 131
1739 3300025231 Ga0207427_100807 Ga0207427_1008078 131
1740 3300025242 Ga0209258_100140 Ga0209258_100140141 131
1741 3300025242 Ga0209258_102394 Ga0209258_1023941 131
1742 3300025254 Ga0209148_1000119 Ga0209148_100011922 131
1743 3300025254 Ga0209148_1000140 Ga0209148_1000140142 131
1744 3300025256 Ga0209759_1001723 Ga0209759_100172312 131
1745 3300025256 Ga0209759_1010191 Ga0209759_10101916 131
1746 3300025256 Ga0209759_1012475 Ga0209759_10124753 131
1747 3300025256 Ga0209759_1014574 Ga0209759_10145742 131
1748 3300025261 Ga0209233_1000173 Ga0209233_1000173141 131
1749 3300025272 Ga0209455_1000125 Ga0209455_1000125142 131
1750 3300025272 Ga0209455_1000244 Ga0209455_100024422 131
1751 3300025273 Ga0209673_1000098 Ga0209673_1000098180 131
1752 3300025273 Ga0209673_1112596 Ga0209673_11125961 131
1753 3300025295 Ga0209564_1006738 Ga0209564_100673810 131
1754 3300025295 Ga0209564_1041569 Ga0209564_10415692 131
1755 3300025302 Ga0207426_1000199 Ga0207426_100019914 131
1756 3300025302 Ga0207426_1010681 Ga0207426_10106813 131
1757 3300025321 Ga0207656_10080640 Ga0207656_100806403 131
1758 3300025321 Ga0207656_10187581 Ga0207656_101875811 131
1759 3300025711 Ga0207696_1020741 Ga0207696_10207412 131
1760 3300025711 Ga0207696_1166247 Ga0207696_11662471 131
1761 3300025711 Ga0207696_1181955 Ga0207696_11819551 131
1762 3300025735 Ga0207713_1004623 Ga0207713_10046234 131
1763 3300025900 Ga0207710_10161546 Ga0207710_101615462 131
1764 3300025903 Ga0207680_10163642 Ga0207680_101636423 131
1765 3300025904 Ga0207647_10004870 Ga0207647_100048706 131
1766 3300025904 Ga0207647_10007364 Ga0207647_1000736414 131
1767 3300025904 Ga0207647_10104384 Ga0207647_101043844 131
1768 3300025909 Ga0207705_10004265 Ga0207705_100042652 131
1769 3300025909 Ga0207705_10011628 Ga0207705_100116288 131
1770 3300025909 Ga0207705_10103487 Ga0207705_101034875 131
1771 3300025909 Ga0207705_10122104 Ga0207705_101221042 131
1772 3300025911 Ga0207654_10090331 Ga0207654_100903312 131
1773 3300025911 Ga0207654_10395591 Ga0207654_103955911 131
1774 3300025913 Ga0207695_10008376 Ga0207695_1000837622 131
1775 3300025913 Ga0207695_10035527 Ga0207695_100355273 131
1776 3300025913 Ga0207695_10227793 Ga0207695_102277932 131
1777 3300025913 Ga0207695_10269527 Ga0207695_102695272 131
1778 3300025913 Ga0207695_11263733 Ga0207695_112637331 131
1779 3300025914 Ga0207671_10004456 Ga0207671_1000445616 131
1780 3300025914 Ga0207671_10201201 Ga0207671_102012013 131
1781 3300025919 Ga0207657_10014049 Ga0207657_100140492 131
1782 3300025919 Ga0207657_10044711 Ga0207657_100447116 131
1783 3300025919 Ga0207657_10377992 Ga0207657_103779921 131
1784 3300025924 Ga0207694_10002733 Ga0207694_1000273322 131
1785 3300025924 Ga0207694_10100374 Ga0207694_101003743 131
1786 3300025924 Ga0207694_10108713 Ga0207694_101087134 131
1787 3300025929 Ga0207664_11036144 Ga0207664_110361441 131
1788 3300025931 Ga0207644_10095363 Ga0207644_100953636 131
1789 3300025931 Ga0207644_10560838 Ga0207644_105608383 131
1790 3300025932 Ga0207690_10000040 Ga0207690_1000004092 131
1791 3300025932 Ga0207690_10375638 Ga0207690_103756382 131
1792 3300025941 Ga0207711_10057542 Ga0207711_100575422 131
1793 3300025949 Ga0207667_10006131 Ga0207667_1000613120 131
1794 3300025949 Ga0207667_10009212 Ga0207667_1000921215 131
1795 3300025949 Ga0207667_10015897 Ga0207667_1001589714 131
1796 3300025960 Ga0207651_10469680 Ga0207651_104696802 131
1797 3300026067 Ga0207678_10043906 Ga0207678_100439062 131
1798 3300026067 Ga0207678_10238626 Ga0207678_102386262 131
1799 3300026067 Ga0207678_10248922 Ga0207678_102489223 131
1800 3300026067 Ga0207678_10381905 Ga0207678_103819051 131
1801 3300026078 Ga0207702_10185671 Ga0207702_101856713 131
1802 3300026095 Ga0207676_11424445 Ga0207676_114244451 131
1803 3300026116 Ga0207674_10173522 Ga0207674_101735222 131
1804 3300026121 Ga0207683_10148309 Ga0207683_101483092 131
1805 3300026142 Ga0207698_10023299 Ga0207698_100232998 131
1806 3300026142 Ga0207698_10790935 Ga0207698_107909352 131
1807 3300026142 Ga0207698_11334281 Ga0207698_113342812 131
1808 3300027312 Ga0209371_1000325 Ga0209371_100032544 131
1809 3300027312 Ga0209371_1000766 Ga0209371_100076621 131
1810 3300027312 Ga0209371_1003600 Ga0209371_10036007 131
1811 3300028379 Ga0268266_10117830 Ga0268266_101178302 131
1812 3300028800 Ga0265338_10004608 Ga0265338_1000460813 131
1813 3300028800 Ga0265338_10005463 Ga0265338_1000546323 131
1814 3300029957 Ga0265324_10000500 Ga0265324_1000050024 131
1815 3300030500 Ga0268256_1001275 Ga0268256_100127515 131
1816 3300030500 Ga0268256_1002981 Ga0268256_10029819 131
1817 3300030863 Ga0265766_1000099 Ga0265766_10000993 131
1818 3300030863 Ga0265766_1000407 Ga0265766_10004072 131
1819 3300030863 Ga0265766_1000731 Ga0265766_10007313 131
1820 3300030863 Ga0265766_1003268 Ga0265766_10032683 131
1821 3300030888 Ga0265769_100464 Ga0265769_1004642 131
1822 3300030888 Ga0265769_100729 Ga0265769_1007292 131
1823 3300030888 Ga0265769_113786 Ga0265769_1137861 131
1824 3300030963 Ga0265768_100424 Ga0265768_1004244 131
1825 3300031239 Ga0265328_10003595 Ga0265328_100035957 131
1826 3300031250 Ga0265331_10000050 Ga0265331_10000050121 131
1827 3300031251 Ga0265327_10000109 Ga0265327_10000109104 131
1828 3300031251 Ga0265327_10000161 Ga0265327_1000016146 131
1829 3300031344 Ga0265316_10182264 Ga0265316_101822642 131
1830 3300031456 Ga0307513_10124367 Ga0307513_101243671 131
1831 3300031665 Ga0316575_10000771 Ga0316575_1000077111 131
1832 3300031665 Ga0316575_10038338 Ga0316575_100383382 131
1833 3300031667 Ga0310111_101033 Ga0310111_1010336 131
1834 3300031691 Ga0316579_10026608 Ga0316579_100266082 131
1835 3300031727 Ga0316576_10029129 Ga0316576_100291291 131
1836 3300031728 Ga0316578_10033675 Ga0316578_100336752 131
1837 3300031733 Ga0316577_10146540 Ga0316577_101465402 131
1838 3300031814 Ga0247548_101784 Ga0247548_1017841 131
1839 3300031814 Ga0247548_107337 Ga0247548_1073371 131
1840 3300031911 Ga0307412_10000056 Ga0307412_1000005622 131
1841 3300032133 Ga0316583_10196422 Ga0316583_101964222 131
1842 3300032139 Ga0316580_10001102 Ga0316580_100011026 131
1843 3300032168 Ga0316593_10000198 Ga0316593_100001981 131
1844 3300032168 Ga0316593_10223821 Ga0316593_102238212 131
1845 3300033524 Ga0316592_1001786 Ga0316592_10017862 131
1846 3300035398 Ga0316574_0003365 Ga0316574_0003365_4749_5183 131
1847 3300035691 Ga0373931_0861160 Ga0373931_0861160_104_550 131
1848 3300036534 Ga0310109_000061 Ga0310109_000061_76_528 131
1849 3300036535 Ga0310110_014822 Ga0310110_014822_467_901 131
1850 3300037312 Ga0395899_0000080 Ga0395899_0000080_136342_136776 131
1851 3300037312 Ga0395899_0079277 Ga0395899_0079277_704_1138 131
1852 3300037312 Ga0395899_0462873 Ga0395899_0462873_370_804 131
1853 3300037418 Ga0395900_0000087 Ga0395900_0000087_34793_35227 131
1854 3300037418 Ga0395900_0103484 Ga0395900_0103484_800_1234 131
1855 3300037418 Ga0395900_0104724 Ga0395900_0104724_785_1219 131
1856 3300037418 Ga0395900_0682800 Ga0395900_0682800_161_595 131
1857 3300037418 Ga0395900_0699378 Ga0395900_0699378_351_785 131
1858 3300037418 Ga0395900_1333168 Ga0395900_1333168_49_483 131
1859 3300037466 Ga0395898_0000448 Ga0395898_0000448_9555_9989 131
1860 3300037466 Ga0395898_0004701 Ga0395898_0004701_9638_10072 131
1861 3300037466 Ga0395898_0091559 Ga0395898_0091559_1691_2125 131
1862 3300037466 Ga0395898_1142440 Ga0395898_1142440_105_539 131
1863 3300037471 Ga0395905_0001371 Ga0395905_0001371_4267_4701 131
1864 3300037471 Ga0395905_0173708 Ga0395905_0173708_1220_1654 131
1865 3300038443 Ga0395901_0062325 Ga0395901_0062325_2261_2695 131
1866 3300038443 Ga0395901_1105207 Ga0395901_1105207_81_515 131
1867 3300038443 Ga0395901_1341045 Ga0395901_1341045_23_457 131
1868 3300038726 Ga0400490_46672 Ga0400490_46672_1013_1447 131
1869 3300038742 Ga0400486_03874 Ga0400486_03874_649_1083 131
1870 3300038742 Ga0400486_32640 Ga0400486_32640_3123_3557 131
1871 3300039062 Ga0400483_035353 Ga0400483_035353_6149_6583 131
1872 3300039062 Ga0400483_062435 Ga0400483_062435_1016_1450 131
1873 3300039062 Ga0400483_071897 Ga0400483_071897_3023_3457 131
1874 3300039062 Ga0400483_074535 Ga0400483_074535_50_484 131
1875 3300039062 Ga0400483_080413 Ga0400483_080413_1492_1926 131
1876 3300039062 Ga0400483_131418 Ga0400483_131418_1504_1938 131
1877 3300039062 Ga0400483_159229 Ga0400483_159229_2463_2897 131
1878 3300039062 Ga0400483_205660 Ga0400483_205660_8983_9417 131
1879 3300039093 Ga0400489_88546 Ga0400489_88546_2602_3036 131
1880 3300039447 Ga0436361_0830526 Ga0436361_0830526_1887_2321 131
1881 3300042005 Ga0439448_0000118 Ga0439448_0000118_12108_12542 131
1882 3300042876 Ga0451577_0056781 Ga0451577_0056781_2562_2999 131
1883 3300044656 Ga0466969_0001722 Ga0466969_0001722_6404_6838 131
1884 3300044656 Ga0466969_0004256 Ga0466969_0004256_3600_4034 131
1885 3300044656 Ga0466969_0010770 Ga0466969_0010770_2663_3097 131
1886 3300044656 Ga0466969_0131244 Ga0466969_0131244_163_597 131
1887 3300044658 Ga0466972_0060383 Ga0466972_0060383_232_666 131
1888 3300044658 Ga0466972_0154934 Ga0466972_0154934_383_817 131
1889 3300044659 Ga0466973_0049331 Ga0466973_0049331_845_1279 131
1890 3300044683 Ga0466965_0001145 Ga0466965_0001145_9157_9591 131
1891 3300044683 Ga0466965_0015818 Ga0466965_0015818_373_807 131
1892 3300044683 Ga0466965_0063634 Ga0466965_0063634_866_1300 131
1893 3300044683 Ga0466965_0221193 Ga0466965_0221193_334_768 131
1894 3300044684 Ga0466966_0003725 Ga0466966_0003725_2478_2912 131
1895 3300044684 Ga0466966_0059810 Ga0466966_0059810_430_864 131
1896 3300044684 Ga0466966_0062883 Ga0466966_0062883_1694_2128 131
1897 3300044684 Ga0466966_0062980 Ga0466966_0062980_1694_2128 131
1898 3300044684 Ga0466966_0067908 Ga0466966_0067908_1651_2085 131
1899 3300044693 Ga0466961_0000296 Ga0466961_0000296_10753_11187 131
1900 3300044693 Ga0466961_0036745 Ga0466961_0036745_2463_2897 131
1901 3300044693 Ga0466961_0053995 Ga0466961_0053995_364_798 131
1902 3300044693 Ga0466961_0072863 Ga0466961_0072863_1258_1692 131
1903 3300044693 Ga0466961_0117187 Ga0466961_0117187_735_1169 131
1904 3300044693 Ga0466961_0118072 Ga0466961_0118072_303_737 131
1905 3300044693 Ga0466961_0335951 Ga0466961_0335951_271_705 131
1906 3300044694 Ga0466963_0047825 Ga0466963_0047825_1237_1671 131
1907 3300044706 Ga0466964_0015332 Ga0466964_0015332_988_1422 131
1908 3300044712 Ga0453684_0860212 Ga0453684_0860212_470_904 131
1909 3300044719 Ga0466971_0000181 Ga0466971_0000181_8920_9354 131
1910 3300044719 Ga0466971_0035698 Ga0466971_0035698_506_940 131
1911 3300044735 Ga0466968_0272311 Ga0466968_0272311_38_472 131
1912 3300044735 Ga0466968_0282713 Ga0466968_0282713_128_562 131
1913 3300044765 Ga0466970_0002988 Ga0466970_0002988_3671_4105 131
1914 3300044765 Ga0466970_0015188 Ga0466970_0015188_2476_2910 131
1915 3300044765 Ga0466970_0178995 Ga0466970_0178995_471_905 131
1916 3300044842 Ga0466957_0002562 Ga0466957_0002562_3622_4056 131
1917 3300044842 Ga0466957_0014461 Ga0466957_0014461_1938_2372 131
1918 3300044842 Ga0466957_0019611 Ga0466957_0019611_1285_1719 131
1919 3300044842 Ga0466957_0197429 Ga0466957_0197429_611_1045 131
1920 3300044842 Ga0466957_0218243 Ga0466957_0218243_707_1141 131
1921 3300045049 Ga0466959_0000926 Ga0466959_0000926_12114_12548 131
1922 3300045049 Ga0466959_0005512 Ga0466959_0005512_3322_3756 131
1923 3300045049 Ga0466959_0007380 Ga0466959_0007380_2762_3196 131
1924 3300045049 Ga0466959_0265929 Ga0466959_0265929_475_909 131
1925 3300045051 Ga0451576_0000013 Ga0451576_0000013_539881_540315 131
1926 3300045051 Ga0451576_0999273 Ga0451576_0999273_334_768 131
1927 3300045836 Ga0466958_0001887 Ga0466958_0001887_9704_10138 131
1928 3300045836 Ga0466958_0019865 Ga0466958_0019865_1361_1795 131
1929 3300045836 Ga0466958_0060303 Ga0466958_0060303_493_927 131
1930 3300045836 Ga0466958_0065480 Ga0466958_0065480_1603_2037 131
1931 3300045836 Ga0466958_0159333 Ga0466958_0159333_231_665 131
1932 3300045976 Ga0466967_0187281 Ga0466967_0187281_1062_1496 131
1933 3300045976 Ga0466967_0545245 Ga0466967_0545245_444_878 131
1934 3300045976 Ga0466967_0746643 Ga0466967_0746643_233_667 131
1935 3300046454 Ga0495592_0100631 Ga0495592_0100631_1338_1772 131
1936 3300046454 Ga0495592_0205027 Ga0495592_0205027_433_867 131
1937 3300046455 Ga0495603_0021343 Ga0495603_0021343_1347_1781 131
1938 3300046455 Ga0495603_0036844 Ga0495603_0036844_1493_1927 131
1939 3300046455 Ga0495603_0121153 Ga0495603_0121153_800_1234 131
1940 3300046455 Ga0495603_0344095 Ga0495603_0344095_298_732 131
1941 3300046457 Ga0495590_0018240 Ga0495590_0018240_254_688 131
1942 3300046457 Ga0495590_0407092 Ga0495590_0407092_19_453 131
1943 3300046458 Ga0495591_010774 Ga0495591_010774_876_1310 131
1944 3300046459 Ga0495629_0008019 Ga0495629_0008019_3929_4363 131
1945 3300046459 Ga0495629_0248372 Ga0495629_0248372_749_1183 131
1946 3300046459 Ga0495629_0919744 Ga0495629_0919744_97_531 131
1947 3300046460 Ga0495638_0010507 Ga0495638_0010507_1772_2206 131
1948 3300046460 Ga0495638_0058891 Ga0495638_0058891_519_953 131
1949 3300046461 Ga0495641_0049296 Ga0495641_0049296_1061_1495 131
1950 3300046463 Ga0495653_0071030 Ga0495653_0071030_819_1253 131
1951 3300046463 Ga0495653_0300755 Ga0495653_0300755_583_1017 131
1952 3300046471 Ga0495650_0025873 Ga0495650_0025873_1849_2283 131
1953 3300046471 Ga0495650_0046362 Ga0495650_0046362_1356_1790 131
1954 3300046471 Ga0495650_0086014 Ga0495650_0086014_592_1026 131
1955 3300046472 Ga0495580_0006554 Ga0495580_0006554_3415_3849 131
1956 3300046472 Ga0495580_0016805 Ga0495580_0016805_1673_2107 131
1957 3300046472 Ga0495580_0130646 Ga0495580_0130646_912_1346 131
1958 3300046472 Ga0495580_0716936 Ga0495580_0716936_30_464 131
1959 3300046473 Ga0495582_0033837 Ga0495582_0033837_1112_1546 131
1960 3300046473 Ga0495582_0181417 Ga0495582_0181417_507_941 131
1961 3300046474 Ga0495605_0014824 Ga0495605_0014824_1695_2129 131
1962 3300046474 Ga0495605_0017339 Ga0495605_0017339_2485_2919 131
1963 3300046474 Ga0495605_0066496 Ga0495605_0066496_115_549 131
1964 3300046474 Ga0495605_0125990 Ga0495605_0125990_451_885 131
1965 3300046475 Ga0495639_0038910 Ga0495639_0038910_1147_1581 131
1966 3300046476 Ga0495662_0024098 Ga0495662_0024098_778_1212 131
1967 3300046476 Ga0495662_0180757 Ga0495662_0180757_215_649 131
1968 3300046477 Ga0495664_0006673 Ga0495664_0006673_4816_5250 131
1969 3300046477 Ga0495664_0069337 Ga0495664_0069337_1337_1771 131
1970 3300046477 Ga0495664_0072529 Ga0495664_0072529_1195_1629 131
1971 3300046477 Ga0495664_0095229 Ga0495664_0095229_89_523 131
1972 3300046477 Ga0495664_0250066 Ga0495664_0250066_495_929 131
1973 3300046499 Ga0495594_0010435 Ga0495594_0010435_314_748 131
1974 3300046500 Ga0495596_0020643 Ga0495596_0020643_433_867 131
1975 3300046500 Ga0495596_0142796 Ga0495596_0142796_101_535 131
1976 3300046500 Ga0495596_0165675 Ga0495596_0165675_335_769 131
1977 3300046501 Ga0495607_0100890 Ga0495607_0100890_423_857 131
1978 3300046506 Ga0495583_0004815 Ga0495583_0004815_6527_6961 131
1979 3300046506 Ga0495583_0016574 Ga0495583_0016574_785_1219 131
1980 3300046507 Ga0495606_0009877 Ga0495606_0009877_1941_2375 131
1981 3300046507 Ga0495606_0054164 Ga0495606_0054164_819_1253 131
1982 3300046507 Ga0495606_0064595 Ga0495606_0064595_260_694 131
1983 3300046511 Ga0495608_0188850 Ga0495608_0188850_818_1252 131
1984 3300046512 Ga0495610_0065030 Ga0495610_0065030_957_1391 131
1985 3300046513 Ga0495616_0086533 Ga0495616_0086533_241_675 131
1986 3300046514 Ga0495618_0018095 Ga0495618_0018095_1999_2433 131
1987 3300046514 Ga0495618_0138514 Ga0495618_0138514_1072_1506 131
1988 3300046514 Ga0495618_0469722 Ga0495618_0469722_299_733 131
1989 3300046515 Ga0495620_0014491 Ga0495620_0014491_1692_2126 131
1990 3300046516 Ga0495628_0006292 Ga0495628_0006292_768_1202 131
1991 3300046516 Ga0495628_0069084 Ga0495628_0069084_1404_1838 131
1992 3300046516 Ga0495628_0075933 Ga0495628_0075933_649_1083 131
1993 3300046516 Ga0495628_0079554 Ga0495628_0079554_1347_1781 131
1994 3300046516 Ga0495628_0109587 Ga0495628_0109587_872_1306 131
1995 3300046517 Ga0495630_0100382 Ga0495630_0100382_405_839 131
1996 3300046517 Ga0495630_0134360 Ga0495630_0134360_1351_1785 131
1997 3300046519 Ga0495632_0089406 Ga0495632_0089406_269_703 131
1998 3300046522 Ga0495643_0054593 Ga0495643_0054593_1210_1644 131
1999 3300046523 Ga0495644_0053726 Ga0495644_0053726_392_826 131
2000 3300046523 Ga0495644_0218639 Ga0495644_0218639_278_712 131
2001 3300046524 Ga0495648_0025782 Ga0495648_0025782_1482_1916 131
2002 3300046524 Ga0495648_0026850 Ga0495648_0026850_1347_1781 131
2003 3300046526 Ga0495666_0105624 Ga0495666_0105624_16_450 131
2004 3300046526 Ga0495666_0162411 Ga0495666_0162411_551_985 131
2005 3300046526 Ga0495666_0446510 Ga0495666_0446510_51_485 131
2006 3300046528 Ga0495642_0056434 Ga0495642_0056434_885_1319 131
2007 3300046528 Ga0495642_0231611 Ga0495642_0231611_64_498 131
2008 3300046529 Ga0495652_0115773 Ga0495652_0115773_841_1275 131
2009 3300046529 Ga0495652_0151599 Ga0495652_0151599_30_464 131
2010 3300046530 Ga0495654_0191212 Ga0495654_0191212_92_526 131
2011 3300046530 Ga0495654_0247759 Ga0495654_0247759_195_629 131
2012 3300046531 Ga0495665_0031045 Ga0495665_0031045_1999_2433 131
2013 3300046531 Ga0495665_0034628 Ga0495665_0034628_444_878 131
2014 3300046531 Ga0495665_0057876 Ga0495665_0057876_1326_1760 131
2015 3300046531 Ga0495665_0091889 Ga0495665_0091889_820_1254 131
2016 3300046533 Ga0495640_0475601 Ga0495640_0475601_277_711 131
2017 3300046535 Ga0495586_0008133 Ga0495586_0008133_1688_2122 131
2018 3300046535 Ga0495586_0070537 Ga0495586_0070537_151_585 131
2019 3300046535 Ga0495586_0106892 Ga0495586_0106892_153_587 131
2020 3300046536 Ga0495587_0037993 Ga0495587_0037993_1094_1528 131
2021 3300046536 Ga0495587_0263774 Ga0495587_0263774_391_825 131
2022 3300046536 Ga0495587_0427665 Ga0495587_0427665_272_706 131
2023 3300046539 Ga0495621_0351269 Ga0495621_0351269_155_589 131
2024 3300046542 Ga0495597_0073428 Ga0495597_0073428_843_1277 131
2025 3300046542 Ga0495597_0125983 Ga0495597_0125983_155_589 131
2026 3300046542 Ga0495597_0185257 Ga0495597_0185257_41_475 131
2027 3300046543 Ga0495645_0009368 Ga0495645_0009368_1166_1600 131
2028 3300046543 Ga0495645_0061503 Ga0495645_0061503_1249_1683 131
2029 3300046543 Ga0495645_0102644 Ga0495645_0102644_421_855 131
2030 3300046557 Ga0495622_0002163 Ga0495622_0002163_2815_3249 131
2031 3300046557 Ga0495622_0192080 Ga0495622_0192080_378_812 131
2032 3300046559 Ga0495667_0043286 Ga0495667_0043286_1351_1785 131
2033 3300046559 Ga0495667_0555975 Ga0495667_0555975_25_459 131
2034 3300046616 Ga0495668_0120245 Ga0495668_0120245_559_993 131
2035 3300046616 Ga0495668_0311153 Ga0495668_0311153_53_487 131
2036 3300046642 Ga0495634_0045859 Ga0495634_0045859_1643_2077 131
2037 3300046648 Ga0495611_0248659 Ga0495611_0248659_41_475 131
2038 3300046660 Ga0495625_0265594 Ga0495625_0265594_444_878 131
2039 3300046663 Ga0495635_0078555 Ga0495635_0078555_342_776 131
2040 3300046663 Ga0495635_0142420 Ga0495635_0142420_30_464 131
2041 3300046665 Ga0495661_0148229 Ga0495661_0148229_735_1169 131
2042 3300046665 Ga0495661_0298181 Ga0495661_0298181_22_456 131
2043 3300046675 Ga0495657_0727578 Ga0495657_0727578_51_485 131
2044 3300046675 Ga0495657_0736393 Ga0495657_0736393_51_485 131
2045 3300046678 Ga0495599_0204471 Ga0495599_0204471_25_459 131
2046 3300046679 Ga0495623_0031929 Ga0495623_0031929_1155_1589 131
2047 3300046679 Ga0495623_0100910 Ga0495623_0100910_1263_1697 131
2048 3300046679 Ga0495623_0164039 Ga0495623_0164039_51_485 131
2049 3300046680 Ga0495646_0038676 Ga0495646_0038676_1164_1598 131
2050 3300046680 Ga0495646_0076384 Ga0495646_0076384_821_1255 131
2051 3300046680 Ga0495646_0154791 Ga0495646_0154791_51_485 131
2052 3300046680 Ga0495646_0405134 Ga0495646_0405134_51_485 131
2053 3300046684 Ga0495669_0031367 Ga0495669_0031367_1842_2276 131
2054 3300046684 Ga0495669_0041852 Ga0495669_0041852_311_745 131
2055 3300046684 Ga0495669_0116277 Ga0495669_0116277_431_865 131
2056 3300046689 Ga0495613_0072609 Ga0495613_0072609_1351_1785 131
2057 3300046689 Ga0495613_0130385 Ga0495613_0130385_1337_1771 131
2058 3300046689 Ga0495613_0566434 Ga0495613_0566434_79_513 131
2059 3300046690 Ga0495624_0020482 Ga0495624_0020482_3835_4269 131
2060 3300046690 Ga0495624_0039682 Ga0495624_0039682_1233_1667 131
2061 3300046690 Ga0495624_0053509 Ga0495624_0053509_768_1202 131
2062 3300046690 Ga0495624_0097562 Ga0495624_0097562_1347_1781 131
2063 3300046690 Ga0495624_0599869 Ga0495624_0599869_176_610 131
2064 3300046692 Ga0495671_0012352 Ga0495671_0012352_2238_2672 131
2065 3300046692 Ga0495671_0387612 Ga0495671_0387612_109_543 131
2066 3300046694 Ga0495649_0088148 Ga0495649_0088148_337_771 131
2067 3300046694 Ga0495649_0140298 Ga0495649_0140298_251_685 131
2068 3300046694 Ga0495649_0152737 Ga0495649_0152737_721_1155 131
2069 3300046694 Ga0495649_0226406 Ga0495649_0226406_352_786 131
2070 3300046694 Ga0495649_0246537 Ga0495649_0246537_440_874 131
2071 3300046794 Ga0495589_0021019 Ga0495589_0021019_362_796 131
2072 3300046794 Ga0495589_0140971 Ga0495589_0140971_255_689 131
2073 3300046794 Ga0495589_0232418 Ga0495589_0232418_250_684 131
2074 3300046794 Ga0495589_0312150 Ga0495589_0312150_241_675 131
2075 3300046809 Ga0495600_0039828 Ga0495600_0039828_1112_1546 131
2076 3300046809 Ga0495600_0185571 Ga0495600_0185571_374_808 131
2077 3300046810 Ga0495660_0119454 Ga0495660_0119454_582_1016 131
2078 3300047315 Ga0495581_0003269 Ga0495581_0003269_147_581 131
2079 3300047315 Ga0495581_0011615 Ga0495581_0011615_463_897 131
2080 3300047315 Ga0495581_0176605 Ga0495581_0176605_294_728 131
2081 3300047317 Ga0495604_0096566 Ga0495604_0096566_819_1253 131
2082 3300047317 Ga0495604_0126319 Ga0495604_0126319_287_721 131
2083 3300047317 Ga0495604_0290778 Ga0495604_0290778_380_814 131
2084 3300047317 Ga0495604_0433131 Ga0495604_0433131_86_520 131
2085 3300047319 Ga0495674_0013576 Ga0495674_0013576_3472_3906 131
2086 3300047319 Ga0495674_0022526 Ga0495674_0022526_4373_4807 131
2087 3300047319 Ga0495674_0046418 Ga0495674_0046418_2087_2521 131
2088 3300047319 Ga0495674_0055008 Ga0495674_0055008_1711_2145 131
2089 3300047319 Ga0495674_0102840 Ga0495674_0102840_1564_1998 131
2090 3300047320 Ga0495672_0029479 Ga0495672_0029479_1381_1815 131
2091 3300047320 Ga0495672_0033248 Ga0495672_0033248_2659_3093 131
2092 3300047320 Ga0495672_0035691 Ga0495672_0035691_853_1287 131
2093 3300047320 Ga0495672_0119798 Ga0495672_0119798_82_516 131
2094 3300047321 Ga0495676_0067455 Ga0495676_0067455_1515_1949 131
2095 3300047321 Ga0495676_0077394 Ga0495676_0077394_1335_1769 131
2096 3300047322 Ga0495680_0074468 Ga0495680_0074468_1351_1785 131
2097 3300047322 Ga0495680_0100796 Ga0495680_0100796_30_464 131
2098 3300047322 Ga0495680_0134396 Ga0495680_0134396_1351_1785 131
2099 3300047322 Ga0495680_0250054 Ga0495680_0250054_270_704 131
2100 3300047322 Ga0495680_1032052 Ga0495680_1032052_53_487 131
2101 3300047323 Ga0495683_0022066 Ga0495683_0022066_1658_2092 131
2102 3300047323 Ga0495683_0044638 Ga0495683_0044638_561_995 131
2103 3300047323 Ga0495683_0049847 Ga0495683_0049847_1331_1765 131
2104 3300047323 Ga0495683_0188735 Ga0495683_0188735_129_563 131
2105 3300047443 Ga0495687_027846 Ga0495687_027846_1032_1466 131
2106 3300047443 Ga0495687_171650 Ga0495687_171650_201_635 131
2107 3300047444 Ga0495675_0053131 Ga0495675_0053131_883_1317 131
2108 3300047444 Ga0495675_0191731 Ga0495675_0191731_555_989 131
2109 3300047446 Ga0495679_012257 Ga0495679_012257_750_1184 131
2110 3300047446 Ga0495679_017521 Ga0495679_017521_790_1224 131
2111 3300047446 Ga0495679_017686 Ga0495679_017686_2087_2521 131
2112 3300047447 Ga0495685_079079 Ga0495685_079079_378_812 131
2113 3300047469 Ga0495673_0030733 Ga0495673_0030733_1337_1771 131
2114 3300047469 Ga0495673_0067504 Ga0495673_0067504_67_501 131
2115 3300047469 Ga0495673_0078261 Ga0495673_0078261_437_871 131
2116 3300047470 Ga0495681_0086167 Ga0495681_0086167_513_947 131
2117 3300047470 Ga0495681_0249667 Ga0495681_0249667_224_658 131
2118 3300047471 Ga0495684_0068039 Ga0495684_0068039_276_710 131
2119 3300047472 Ga0495686_0000214 Ga0495686_0000214_28656_29090 131
2120 3300047472 Ga0495686_0290820 Ga0495686_0290820_346_780 131
2121 3300047472 Ga0495686_0458937 Ga0495686_0458937_219_653 131
2122 3300047673 Ga0495593_0015413 Ga0495593_0015413_1335_1769 131
2123 3300047673 Ga0495593_0185141 Ga0495593_0185141_270_704 131
2124 3300047673 Ga0495593_0466381 Ga0495593_0466381_46_480 131
2125 3300048088 Ga0495602_0075551 Ga0495602_0075551_719_1153 131
2126 3300048088 Ga0495602_0313649 Ga0495602_0313649_21_455 131
2127 3300048088 Ga0495602_0783218 Ga0495602_0783218_150_584 131
2128 3300048089 Ga0495614_0048811 Ga0495614_0048811_30_464 131
2129 3300048089 Ga0495614_0048818 Ga0495614_0048818_30_464 131
2130 3300048091 Ga0495626_0022785 Ga0495626_0022785_38_472 131
2131 3300048091 Ga0495626_0044118 Ga0495626_0044118_1323_1757 131
2132 3300048091 Ga0495626_0097284 Ga0495626_0097284_408_842 131
2133 3300048091 Ga0495626_0212790 Ga0495626_0212790_169_603 131
2134 3300048903 Ga0496100_0067106 Ga0496100_0067106_567_1001 131
2135 3300048903 Ga0496100_0114800 Ga0496100_0114800_1139_1573 131
2136 3300048903 Ga0496100_0275250 Ga0496100_0275250_369_803 131
2137 3300048904 Ga0496101_0046173 Ga0496101_0046173_1827_2261 131
2138 3300048904 Ga0496101_0560311 Ga0496101_0560311_225_659 131
2139 3300048904 Ga0496101_0907796 Ga0496101_0907796_35_469 131
2140 3300048905 Ga0496102_0006537 Ga0496102_0006537_7748_8182 131
2141 3300048905 Ga0496102_0039654 Ga0496102_0039654_2161_2595 131
2142 3300048905 Ga0496102_0197397 Ga0496102_0197397_869_1303 131
2143 3300048906 Ga0496103_0003318 Ga0496103_0003318_3717_4151 131
2144 3300048906 Ga0496103_0032288 Ga0496103_0032288_313_747 131
2145 3300048906 Ga0496103_0210497 Ga0496103_0210497_469_903 131
2146 3300048907 Ga0496104_0018044 Ga0496104_0018044_4795_5229 131
2147 3300048907 Ga0496104_0336166 Ga0496104_0336166_93_527 131
2148 3300048907 Ga0496104_1163973 Ga0496104_1163973_17_451 131
2149 3300048908 Ga0496105_0035800 Ga0496105_0035800_2133_2567 131
2150 3300048908 Ga0496105_0223701 Ga0496105_0223701_817_1251 131
2151 3300048908 Ga0496105_0350800 Ga0496105_0350800_658_1092 131
2152 3300048909 Ga0496106_0006711 Ga0496106_0006711_4432_4866 131
2153 3300048909 Ga0496106_0042023 Ga0496106_0042023_1705_2139 131
2154 3300048909 Ga0496106_0691124 Ga0496106_0691124_230_664 131
2155 3300048910 Ga0496107_0069085 Ga0496107_0069085_106_540 131
2156 3300048910 Ga0496107_0088073 Ga0496107_0088073_452_886 131
2157 3300048910 Ga0496107_0848596 Ga0496107_0848596_181_615 131
2158 3300048911 Ga0496108_0409678 Ga0496108_0409678_457_891 131
2159 3300048912 Ga0496109_0042732 Ga0496109_0042732_160_594 131
2160 3300048913 Ga0496110_0032653 Ga0496110_0032653_249_683 131
2161 3300048913 Ga0496110_0294723 Ga0496110_0294723_496_930 131
2162 3300048914 Ga0496111_0013924 Ga0496111_0013924_3620_4054 131
2163 3300048914 Ga0496111_0830563 Ga0496111_0830563_165_599 131
2164 3300048915 Ga0496112_0014789 Ga0496112_0014789_814_1248 131
2165 3300048915 Ga0496112_0196015 Ga0496112_0196015_360_794 131
2166 3300048916 Ga0496113_0023586 Ga0496113_0023586_3495_3929 131
2167 3300048916 Ga0496113_0027568 Ga0496113_0027568_2133_2567 131
2168 3300048916 Ga0496113_0274888 Ga0496113_0274888_616_1050 131
2169 3300048917 Ga0496114_0018505 Ga0496114_0018505_277_711 131
2170 3300048917 Ga0496114_0091484 Ga0496114_0091484_90_524 131
2171 3300048917 Ga0496114_0845291 Ga0496114_0845291_17_451 131
2172 3300048918 Ga0496115_0131007 Ga0496115_0131007_1343_1777 131
2173 3300048918 Ga0496115_0376151 Ga0496115_0376151_50_484 131
2174 3300048918 Ga0496115_0431565 Ga0496115_0431565_324_758 131
2175 3300048918 Ga0496115_0532444 Ga0496115_0532444_377_811 131
2176 3300048919 Ga0496116_0006663 Ga0496116_0006663_575_1009 131
2177 3300048919 Ga0496116_0174618 Ga0496116_0174618_72_506 131
2178 3300048920 Ga0496117_0002850 Ga0496117_0002850_9402_9836 131
2179 3300048920 Ga0496117_0029031 Ga0496117_0029031_2149_2583 131
2180 3300048920 Ga0496117_0104585 Ga0496117_0104585_609_1043 131
2181 3300048921 Ga0496118_0010366 Ga0496118_0010366_1255_1689 131
2182 3300048921 Ga0496118_0027422 Ga0496118_0027422_1688_2122 131
2183 3300048921 Ga0496118_0039741 Ga0496118_0039741_1347_1781 131
2184 3300048921 Ga0496118_0127248 Ga0496118_0127248_522_956 131
2185 3300048921 Ga0496118_0201720 Ga0496118_0201720_321_755 131
2186 3300048921 Ga0496118_0207405 Ga0496118_0207405_511_945 131
2187 3300048922 Ga0496119_0033005 Ga0496119_0033005_1010_1444 131
2188 3300048922 Ga0496119_0151658 Ga0496119_0151658_589_1023 131
2189 3300048923 Ga0496120_0182412 Ga0496120_0182412_224_658 131
2190 3300048923 Ga0496120_0264386 Ga0496120_0264386_239_673 131
2191 3300048924 Ga0496121_0015151 Ga0496121_0015151_2136_2570 131
2192 3300048924 Ga0496121_0023493 Ga0496121_0023493_5434_5868 131
2193 3300048924 Ga0496121_0031966 Ga0496121_0031966_1794_2228 131
2194 3300048924 Ga0496121_0040564 Ga0496121_0040564_2990_3424 131
2195 3300048924 Ga0496121_0060060 Ga0496121_0060060_343_777 131
2196 3300048924 Ga0496121_0064627 Ga0496121_0064627_1356_1790 131
2197 3300048925 Ga0496122_0006384 Ga0496122_0006384_9492_9926 131
2198 3300048925 Ga0496122_0241896 Ga0496122_0241896_286_720 131
2199 3300048926 Ga0496123_0011446 Ga0496123_0011446_5431_5865 131
2200 3300048927 Ga0496124_0042938 Ga0496124_0042938_831_1265 131
2201 3300048927 Ga0496124_0089738 Ga0496124_0089738_283_717 131
2202 3300048928 Ga0496125_0005068 Ga0496125_0005068_4821_5255 131
2203 3300048928 Ga0496125_0253014 Ga0496125_0253014_284_718 131
2204 3300048929 Ga0496126_0005787 Ga0496126_0005787_9556_9990 131
2205 3300048929 Ga0496126_0007973 Ga0496126_0007973_9337_9771 131
2206 3300048929 Ga0496126_0031015 Ga0496126_0031015_1728_2162 131
2207 3300048929 Ga0496126_0051319 Ga0496126_0051319_354_794 131
2208 3300048929 Ga0496126_0090828 Ga0496126_0090828_903_1337 131
2209 3300048929 Ga0496126_0173352 Ga0496126_0173352_97_537 131
2210 3300049459 Ga0495678_008007 Ga0495678_008007_4916_5350 131
2211 3300049459 Ga0495678_031895 Ga0495678_031895_418_852 131
2212 3300049459 Ga0495678_187690 Ga0495678_187690_111_545 131
2213 3300049460 Ga0495682_0003914 Ga0495682_0003914_1673_2107 131
2214 3300049460 Ga0495682_0015613 Ga0495682_0015613_1175_1609 131
2215 3300049533 Ga0501317_000290 Ga0501317_000290_20_454 131
2216 3300059477 Ga0587084_000161 Ga0587084_000161_959_1396 131
2217 3300059477 Ga0587084_098994 Ga0587084_098994_88_522 131
2218 3300059491 Ga0587070_075589 Ga0587070_075589_274_708 131
2219 3300059491 Ga0587070_092774 Ga0587070_092774_231_665 131
2220 3300059492 Ga0587073_0129733 Ga0587073_0129733_176_610 131
2221 3300059493 Ga0587077_020126 Ga0587077_020126_717_1151 131
2222 3300059505 Ga0587083_0069435 Ga0587083_0069435_24_458 131
2223 3300059507 Ga0587086_066732 Ga0587086_066732_16_450 131
2224 3300059508 Ga0587088_037690 Ga0587088_037690_208_642 131
2225 3300059511 Ga0587091_096258 Ga0587091_096258_186_620 131
2226 3300059604 Ga0587098_038216 Ga0587098_038216_32_466 131
2227 3300059605 Ga0587106_008375 Ga0587106_008375_240_674 131
2228 3300059630 Ga0587128_007622 Ga0587128_007622_574_1008 131
2229 3300059640 Ga0587067_017051 Ga0587067_017051_651_1085 131
2230 3300059641 Ga0587068_005731 Ga0587068_005731_1030_1464 131
2231 3300059642 Ga0587069_004834 Ga0587069_004834_327_761 131
2232 3300059643 Ga0587072_005754 Ga0587072_005754_208_642 131
2233 3300059646 Ga0587078_011692 Ga0587078_011692_28_462 131
2234 3300059646 Ga0587078_045061 Ga0587078_045061_28_462 131
2235 3300059647 Ga0587079_034989 Ga0587079_034989_370_804 131
2236 3300059647 Ga0587079_037199 Ga0587079_037199_427_861 131
2237 3300059649 Ga0587102_019683 Ga0587102_019683_249_683 131
2238 3300059652 Ga0587107_051316 Ga0587107_051316_45_479 131
2239 3300060344 Ga0587071_183420 Ga0587071_183420_47_481 131
2240 3300061719 Ga0466962_0001202 Ga0466962_0001202_1760_2194 131
2241 3300061719 Ga0466962_0016232 Ga0466962_0016232_2258_2692 131
2242 3300061719 Ga0466962_0029411 Ga0466962_0029411_636_1070 131
2243 3300061719 Ga0466962_0147138 Ga0466962_0147138_540_974 131
2244 3300061719 Ga0466962_0464838 Ga0466962_0464838_61_495 131
2245 iso_pu_bacteria 2855730933 2855735567 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

12

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Bo structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.8349 95 129
6hix-assembly1.cif.gz_AP cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.7791 61 129
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.7716 62 129
8c95-assembly1.cif.gz_L cryo-em captures early ribosome assembly in action 0.7482 40 131
4v48-assembly1.cif.gz_AJ real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.7312 62 130
ID Description Score Start End Superfamily
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.968 62 131 3.100.10.10
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9548 62 131 3.100.10.10
af_Q6UUH5_140_226_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8914 63 130 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8856 63 131 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8841 63 129 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A661D962-F1-model_v4 50S ribosomal protein L15 0.9846 60 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q3ZTU2-F1-model_v4 deleted 0.9813 60 130
AF-A0A080LUN8-F1-model_v4 50S ribosomal protein L15 0.9711 56 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1B5EQ26-F1-model_v4 deleted 0.9696 61 131
AF-A7MPG9-F1-model_v4 50S ribosomal protein L15 0.9684 61 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.25 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map