F496516

General Info

Members Datasets Scaffolds Average Seq Length
2181 1026 1736 100

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_11656380|Ga0207639_116563802
Length 118
Sequence LENGWASPVCSGGKEDRMAKTSQVNRNKMRERMAGRDKGKRKALKDIVMDRTLPVEDRFNASLKLAQLPRNGAKVRVRLRCELTGRARGNYRKFKLCRIALRDLASAGQIPGMVKASW

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
14 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
15 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
16 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
17 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
18 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
19 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
20 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
21 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
29 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
30 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
31 2516143018 Ensifer sp. BR816 Isolate Nodule
32 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
33 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
34 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
35 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
36 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
37 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
38 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
39 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
40 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
41 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
42 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
43 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
44 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
45 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
46 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
47 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
48 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
49 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
50 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
51 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
52 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
53 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
54 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
55 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
56 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
57 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
58 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
59 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
60 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
61 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
62 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
63 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
64 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
65 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
66 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
67 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
68 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
69 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
70 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
71 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
72 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
73 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
74 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
75 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
76 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
77 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
78 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
79 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
80 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
81 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
82 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
83 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
84 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
85 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
86 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
87 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
88 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
89 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
90 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
91 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
92 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
93 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
94 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
95 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
96 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
97 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
98 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
99 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
100 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
101 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
102 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
103 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
104 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
105 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
106 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
107 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
108 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
109 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
110 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
111 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
112 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
113 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
114 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
115 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
116 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
117 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
118 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
119 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
120 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
121 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
122 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
123 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
124 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
125 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
126 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
127 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
128 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
129 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
130 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
131 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
132 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
133 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
134 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
135 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
136 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
137 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
138 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
139 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
140 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
141 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
142 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
143 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
144 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
145 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
146 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
147 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
148 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
149 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
150 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
151 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
152 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
153 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
154 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
155 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
156 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
157 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
158 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
159 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
160 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
161 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
162 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
163 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
164 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
165 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
166 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
167 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
168 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
169 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
170 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
171 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
172 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
173 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
174 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
175 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
176 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
177 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
178 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
179 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
180 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
181 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
182 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
183 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
184 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
185 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
186 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
187 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
188 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
189 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
190 2922368715
191 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
192 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
193 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
194 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
195 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
196 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
197 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
198 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
199 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
200 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
201 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
202 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
203 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
204 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
205 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
206 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
207 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
208 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
209 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
210 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
211 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
212 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
213 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
214 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
215 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
216 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
217 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
218 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
219 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
220 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
221 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
222 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
223 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
224 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
225 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
226 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
227 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
228 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
229 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
230 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
231 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
232 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
233 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
234 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
235 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
236 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
237 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
238 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
239 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
240 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
241 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
242 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
243 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
244 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
245 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
246 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
247 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
248 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
249 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
250 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
251 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
252 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
253 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
254 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
255 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
256 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
257 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
258 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
259 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
260 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
261 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
262 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
263 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
264 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
265 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
266 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
267 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
268 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
269 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
270 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
271 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
272 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
273 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
274 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
275 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
276 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
277 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
278 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
279 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
280 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
281 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
282 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
283 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
284 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
285 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
286 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
287 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
288 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
289 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
290 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
291 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
292 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
293 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
294 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
295 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
296 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
297 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
298 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
299 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
300 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
301 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
302 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
303 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
304 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
305 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
306 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
307 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
308 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
309 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
310 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
311 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
312 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
313 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
314 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
315 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
316 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
317 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
318 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
319 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
320 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
321 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
322 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
323 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
324 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
325 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
326 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
327 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
328 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
329 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
330 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
331 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
332 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
333 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
334 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
335 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
336 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
337 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
338 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
339 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
340 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
341 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
342 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
343 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
344 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
345 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
346 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
347 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
348 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
349 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
350 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
351 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
352 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
353 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
354 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
355 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
356 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
357 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
358 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
359 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
360 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
361 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
362 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
363 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
364 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
365 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
366 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
367 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
368 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
369 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
370 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
371 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
372 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
373 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
374 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
375 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
376 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
377 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
378 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
379 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
380 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
381 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
382 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
383 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
384 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
385 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
386 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
387 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
388 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
389 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
390 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
391 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
392 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
393 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
394 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
395 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
396 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
397 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
398 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
399 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
400 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
401 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
402 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
403 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
404 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
405 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
406 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
407 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
408 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
409 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
410 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
411 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
414 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
415 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
416 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
417 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
418 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
419 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
420 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
421 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
422 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
423 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
424 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
425 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
426 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
427 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
428 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
429 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
430 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
431 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
432 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
433 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
434 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
435 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
436 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
437 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
438 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
439 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
440 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
441 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
442 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
443 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
444 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
445 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
446 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
447 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
448 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
449 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
450 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
451 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
452 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
453 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
454 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
455 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
456 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
457 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
458 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
459 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
460 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
461 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
462 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
463 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
464 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
465 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
466 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
467 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
468 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
469 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
470 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
471 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
472 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
473 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
474 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
475 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
476 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
477 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
478 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
479 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
480 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
481 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
482 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
483 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
484 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
485 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
486 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
487 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
488 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
489 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
490 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
491 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
492 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
493 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
494 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
495 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
496 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
497 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
498 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
499 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
500 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
501 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
502 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
503 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
504 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
505 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
506 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
507 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
508 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
509 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
510 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
511 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
512 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
513 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
514 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
515 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
516 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
517 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
518 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
519 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
520 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
521 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
522 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
523 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
524 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
525 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
526 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
527 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
528 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
529 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
530 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
531 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
532 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
533 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
534 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
535 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
536 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
537 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
538 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
539 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
540 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
541 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
542 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
543 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
544 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
545 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
546 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
547 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
548 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
549 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
550 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
551 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
552 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
553 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
554 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
555 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
556 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
557 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
558 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
559 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
560 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
561 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
562 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
563 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
564 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
565 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
566 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
567 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
568 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
569 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
570 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
571 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
572 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
573 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
574 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
575 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
576 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
577 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
578 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
579 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
582 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
583 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
584 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
644 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
646 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
647 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
648 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
649 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
650 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
651 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
654 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
655 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
656 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
657 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
658 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
659 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
665 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
666 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
667 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
668 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
669 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
670 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
671 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
672 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
673 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
674 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
675 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
676 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
677 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
678 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
679 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
680 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
681 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
682 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
683 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
684 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
685 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
686 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
687 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
689 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
691 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
692 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
693 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
694 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
695 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
696 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
697 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
698 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
699 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
700 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
701 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
702 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
703 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
704 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
705 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
706 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
707 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
708 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
709 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
710 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
711 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
712 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
713 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
714 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
715 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
716 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
717 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
718 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
719 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
720 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
721 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
722 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
723 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
724 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
725 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
726 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
728 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
729 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
730 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
731 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
732 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
733 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
734 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
735 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
736 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
737 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
738 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
739 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
740 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
741 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
742 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
743 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
744 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
745 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
746 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
747 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
748 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
749 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
750 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
751 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
752 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
753 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
754 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
755 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
756 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
757 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
758 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
759 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
760 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
761 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
762 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
763 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
764 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
765 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
766 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
767 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
768 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
769 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
770 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
771 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
772 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
773 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
774 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
775 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
776 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
777 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
778 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
779 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
780 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
781 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
782 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
783 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
784 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
785 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
786 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
787 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
788 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
789 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
790 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
791 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
792 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
793 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
794 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
795 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
796 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
797 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
798 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
799 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
800 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
801 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
802 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
803 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
804 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
805 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
806 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
807 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
808 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
809 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
810 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
811 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
812 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
813 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
814 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
815 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
816 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
817 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
818 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
819 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
820 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
821 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
822 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
823 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
824 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
825 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
826 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
827 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
828 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
829 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
830 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
831 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
832 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
833 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
834 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
835 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
836 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
837 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
838 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
839 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
840 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
841 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
842 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
843 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
844 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
845 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
846 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
847 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
848 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
849 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
850 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
851 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
852 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
853 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
854 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
855 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
856 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
857 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
858 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
859 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
860 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
861 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
862 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
863 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
864 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
865 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
866 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
867 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
868 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
869 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
870 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
871 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
872 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
873 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
874 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
875 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
876 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
877 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
878 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
879 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
880 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
881 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
882 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
883 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
884 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
885 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
886 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
887 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
888 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
889 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
890 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
891 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
892 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
893 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
894 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
895 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
896 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
897 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
898 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
899 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
900 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
901 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
902 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
903 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
904 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
905 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
906 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
907 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
908 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
909 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
910 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
911 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
912 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
913 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
914 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
915 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
916 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
917 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
918 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
919 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
920 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
921 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
922 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
923 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
924 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
925 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
926 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
927 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
928 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
929 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
930 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
931 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
932 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
933 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
934 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
935 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
936 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
937 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
938 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
939 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
940 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
941 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
942 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
943 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
944 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
945 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
946 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
947 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
948 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
949 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
950 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
951 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
952 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
953 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
954 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
955 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
956 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
957 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
958 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
959 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
960 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
961 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
962 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
963 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
964 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
965 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
966 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
967 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
968 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
969 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
970 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
971 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
972 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
973 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
974 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
975 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
976 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
977 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
978 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
979 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
980 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
981 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
982 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
983 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
984 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
985 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
986 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
987 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
988 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
989 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
990 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
991 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
992 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
993 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
994 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
995 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
996 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
997 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
998 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
999 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1000 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1001 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1002 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1003 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1004 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1005 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1006 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1007 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1008 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1009 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1010 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1011 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1012 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1013 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1014 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1015 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1016 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1017 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1018 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1019 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1020 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1021 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1022 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1023 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1024 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1025 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1026 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.33
Metatranscriptomes 3.3
Isolates 20.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.77
Nodule 16.6
Rhizoplane 1.74
Rhizosphere 70.75
Stem 0
Stem Tuber 0
Unclassified 6.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000035 3300000041 Bacteria 26838
2 ARSoilYngRDRAFT_c00061 3300000042 Bacteria 17682
3 ARcpr5yngRDRAFT_c000075 3300000043 Bacteria 16570
4 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
5 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
6 JGI24737J22298_10005496 3300001990 Bacteria 4373
7 JGI25165J46597_1034619 3300003214 Bacteria 650
8 JGI26129J50193_1002889 3300003349 Bacteria 1209
9 Ga0058863_11612769 3300004799 Bacteria 1005
10 Ga0058861_11519652 3300004800 Bacteria 574
11 Ga0065717_1003757 3300005276 Bacteria 1179
12 Ga0065716_1001741 3300005277 Bacteria 3669
13 Ga0065714_10430914 3300005288 Bacteria 554
14 Ga0065712_10099639 3300005290 Bacteria 2084
15 Ga0065712_10725715 3300005290 Bacteria 526
16 Ga0065715_10002477 3300005293 Bacteria 7875
17 Ga0065707_10107090 3300005295 Bacteria 2569
18 Ga0070658_10137105 3300005327 Bacteria 2042
19 Ga0070658_10322637 3300005327 Bacteria 1319
20 Ga0070658_11200369 3300005327 Bacteria 659
21 Ga0070676_10287217 3300005328 Bacteria 1110
22 Ga0070676_10477116 3300005328 Bacteria 881
23 Ga0070676_10747768 3300005328 Bacteria 717
24 Ga0070683_100088671 3300005329 Bacteria 2902
25 Ga0070683_100455703 3300005329 Bacteria 1220
26 Ga0070683_100525775 3300005329 Bacteria 1130
27 Ga0070683_100772090 3300005329 Bacteria 921
28 Ga0070690_100020637 3300005330 Bacteria 4015
29 Ga0070670_100162525 3300005331 Bacteria 1935
30 Ga0070670_100687280 3300005331 Bacteria 919
31 Ga0070670_100768266 3300005331 Bacteria 869
32 Ga0070677_10816915 3300005333 Bacteria 533
33 Ga0068869_100070091 3300005334 Bacteria 2593
34 Ga0068869_100104915 3300005334 Bacteria 2143
35 Ga0068869_100544126 3300005334 Bacteria 974
36 Ga0068869_100673877 3300005334 Bacteria 880
37 Ga0070666_10023127 3300005335 Bacteria 4042
38 Ga0070666_10329282 3300005335 Bacteria 1090
39 Ga0070680_100019894 3300005336 Bacteria 5323
40 Ga0070680_100045978 3300005336 Bacteria 3550
41 Ga0070680_100072787 3300005336 Bacteria 2825
42 Ga0070680_100248532 3300005336 Bacteria 1504
43 Ga0070680_100739003 3300005336 Bacteria 847
44 Ga0070680_100851267 3300005336 Bacteria 786
45 Ga0070680_101201131 3300005336 Bacteria 656
46 Ga0070682_100023836 3300005337 Bacteria 3637
47 Ga0070682_100716296 3300005337 Bacteria 804
48 Ga0070682_100938223 3300005337 Bacteria 714
49 Ga0070682_101349580 3300005337 Bacteria 608
50 Ga0068868_100199244 3300005338 Bacteria 1668
51 Ga0068868_100291153 3300005338 Bacteria 1384
52 Ga0068868_100405385 3300005338 Bacteria 1177
53 Ga0068868_101440077 3300005338 Bacteria 643
54 Ga0070660_100018276 3300005339 Bacteria 5121
55 Ga0070660_100040143 3300005339 Bacteria 3560
56 Ga0070660_100052268 3300005339 Bacteria 3150
57 Ga0070660_100379564 3300005339 Bacteria 1167
58 Ga0070660_100907907 3300005339 Bacteria 743
59 Ga0070689_100053325 3300005340 Bacteria 3129
60 Ga0070689_100810262 3300005340 Bacteria 824
61 Ga0070689_101509819 3300005340 Bacteria 609
62 Ga0070691_10024352 3300005341 Bacteria 2813
63 Ga0070691_10226777 3300005341 Bacteria 992
64 Ga0070691_10306108 3300005341 Bacteria 870
65 Ga0070661_100158458 3300005344 Bacteria 1713
66 Ga0070661_100582676 3300005344 Bacteria 903
67 Ga0070668_100038563 3300005347 Bacteria 3652
68 Ga0070668_100452846 3300005347 Bacteria 1104
69 Ga0070668_100850994 3300005347 Bacteria 813
70 Ga0070668_101028917 3300005347 Bacteria 741
71 Ga0070669_100023313 3300005353 Bacteria 4432
72 Ga0070669_100023914 3300005353 Bacteria 4377
73 Ga0070675_100055612 3300005354 Bacteria 3258
74 Ga0070675_100226391 3300005354 Bacteria 1630
75 Ga0070675_100350669 3300005354 Bacteria 1309
76 Ga0070675_100534805 3300005354 Bacteria 1059
77 Ga0070675_100597549 3300005354 Bacteria 1001
78 Ga0070671_100309895 3300005355 Bacteria 1344
79 Ga0070671_101577543 3300005355 Bacteria 582
80 Ga0070671_101584924 3300005355 Bacteria 580
81 Ga0070674_100001266 3300005356 Bacteria 13294
82 Ga0070674_100041872 3300005356 Bacteria 3107
83 Ga0070674_100063433 3300005356 Bacteria 2586
84 Ga0070673_100592233 3300005364 Bacteria 1011
85 Ga0070673_101623517 3300005364 Bacteria 611
86 Ga0070688_100013675 3300005365 Bacteria 4583
87 Ga0070688_101442699 3300005365 Bacteria 559
88 Ga0070659_100311578 3300005366 Bacteria 1314
89 Ga0070659_101218788 3300005366 Bacteria 666
90 Ga0070659_101253243 3300005366 Bacteria 657
91 Ga0070659_101337529 3300005366 Bacteria 636
92 Ga0070667_100061525 3300005367 Bacteria 3179
93 Ga0070667_100067572 3300005367 Bacteria 3039
94 Ga0070667_100342781 3300005367 Bacteria 1352
95 Ga0070667_100354428 3300005367 Bacteria 1329
96 Ga0070667_101874074 3300005367 Bacteria 564
97 Ga0070703_10006226 3300005406 Bacteria 3340
98 Ga0070709_10078673 3300005434 Bacteria 2146
99 Ga0070709_10504056 3300005434 Bacteria 920
100 Ga0070709_10614722 3300005434 Bacteria 838
101 Ga0070709_10883751 3300005434 Bacteria 706
102 Ga0070714_100011267 3300005435 Bacteria 7088
103 Ga0070714_101439883 3300005435 Bacteria 673
104 Ga0070713_100001675 3300005436 Bacteria 14235
105 Ga0070713_100443886 3300005436 Bacteria 1218
106 Ga0070713_100909268 3300005436 Bacteria 847
107 Ga0070713_100995054 3300005436 Bacteria 809
108 Ga0070713_101050050 3300005436 Bacteria 787
109 Ga0070713_101275263 3300005436 Bacteria 712
110 Ga0070713_101285700 3300005436 Bacteria 709
111 Ga0070713_102099842 3300005436 Bacteria 548
112 Ga0070713_102174607 3300005436 Bacteria 538
113 Ga0070710_10049219 3300005437 Bacteria 2357
114 Ga0070710_10412417 3300005437 Bacteria 908
115 Ga0070710_11060605 3300005437 Bacteria 593
116 Ga0070701_10041914 3300005438 Bacteria 2334
117 Ga0070711_100071215 3300005439 Bacteria 2449
118 Ga0070711_100389457 3300005439 Bacteria 1129
119 Ga0070711_100727388 3300005439 Bacteria 837
120 Ga0070705_100053071 3300005440 Bacteria 2371
121 Ga0070705_100054595 3300005440 Bacteria 2344
122 Ga0070705_100811235 3300005440 Bacteria 745
123 Ga0070700_100474427 3300005441 Bacteria 957
124 Ga0070700_100708498 3300005441 Bacteria 801
125 Ga0070694_100020300 3300005444 Bacteria 4234
126 Ga0070694_100056701 3300005444 Bacteria 2661
127 Ga0070694_101318053 3300005444 Bacteria 608
128 Ga0070708_100551887 3300005445 Bacteria 1087
129 Ga0070663_100034462 3300005455 Bacteria 3506
130 Ga0070663_101907264 3300005455 Bacteria 534
131 Ga0070678_100021125 3300005456 Bacteria 4286
132 Ga0070678_100021594 3300005456 Bacteria 4249
133 Ga0070678_100122832 3300005456 Bacteria 2050
134 Ga0070678_100323616 3300005456 Bacteria 1317
135 Ga0070678_100568500 3300005456 Bacteria 1008
136 Ga0070678_100760487 3300005456 Bacteria 877
137 Ga0070678_101059090 3300005456 Bacteria 747
138 Ga0070662_100021397 3300005457 Bacteria 4415
139 Ga0070662_101093878 3300005457 Bacteria 684
140 Ga0070681_10007102 3300005458 Bacteria 10905
141 Ga0070681_10263987 3300005458 Bacteria 1633
142 Ga0070681_10354805 3300005458 Bacteria 1377
143 Ga0070681_10479877 3300005458 Bacteria 1156
144 Ga0070681_10697971 3300005458 Bacteria 930
145 Ga0070681_10890099 3300005458 Bacteria 808
146 Ga0070681_11741244 3300005458 Bacteria 550
147 Ga0068867_100100755 3300005459 Bacteria 2205
148 Ga0068867_100106725 3300005459 Bacteria 2146
149 Ga0068867_100241062 3300005459 Bacteria 1466
150 Ga0068867_100513407 3300005459 Bacteria 1032
151 Ga0068867_100798158 3300005459 Bacteria 842
152 Ga0070685_10012732 3300005466 Bacteria 4425
153 Ga0070685_10190747 3300005466 Bacteria 1326
154 Ga0070706_100045185 3300005467 Bacteria 4069
155 Ga0070706_100343409 3300005467 Bacteria 1392
156 Ga0070707_100307016 3300005468 Bacteria 1542
157 Ga0070707_100471842 3300005468 Bacteria 1216
158 Ga0070698_100327715 3300005471 Bacteria 1462
159 Ga0070699_100120889 3300005518 Bacteria 2303
160 Ga0070699_100188037 3300005518 Bacteria 1834
161 Ga0070679_100039101 3300005530 Bacteria 4715
162 Ga0070679_100082939 3300005530 Bacteria 3195
163 Ga0070679_100092871 3300005530 Bacteria 3005
164 Ga0070679_100235905 3300005530 Bacteria 1788
165 Ga0070679_100356169 3300005530 Bacteria 1411
166 Ga0070679_100373412 3300005530 Bacteria 1373
167 Ga0070679_100398817 3300005530 Bacteria 1322
168 Ga0070679_100629447 3300005530 Bacteria 1016
169 Ga0070679_100931182 3300005530 Bacteria 812
170 Ga0070679_100939174 3300005530 Bacteria 809
171 Ga0070679_101484904 3300005530 Bacteria 625
172 Ga0070679_101517440 3300005530 Bacteria 617
173 Ga0070679_101644542 3300005530 Bacteria 590
174 Ga0070684_100073460 3300005535 Bacteria 3013
175 Ga0070684_100444811 3300005535 Bacteria 1197
176 Ga0070684_100819267 3300005535 Bacteria 870
177 Ga0070684_101199306 3300005535 Bacteria 714
178 Ga0070684_101913630 3300005535 Bacteria 560
179 Ga0070697_100715234 3300005536 Bacteria 884
180 Ga0068853_100006917 3300005539 Bacteria 9054
181 Ga0068853_100173535 3300005539 Bacteria 1952
182 Ga0068853_100295709 3300005539 Bacteria 1495
183 Ga0068853_100308432 3300005539 Bacteria 1464
184 Ga0068853_100402370 3300005539 Bacteria 1281
185 Ga0068853_100896521 3300005539 Bacteria 852
186 Ga0068853_102080199 3300005539 Bacteria 551
187 Ga0070672_100075788 3300005543 Bacteria 2686
188 Ga0070686_100026380 3300005544 Bacteria 3507
189 Ga0070686_100568573 3300005544 Bacteria 889
190 Ga0070686_101396448 3300005544 Bacteria 587
191 Ga0070686_101508823 3300005544 Bacteria 566
192 Ga0070695_100037771 3300005545 Bacteria 3045
193 Ga0070695_100040449 3300005545 Bacteria 2951
194 Ga0070696_100006293 3300005546 Bacteria 7950
195 Ga0070696_100010439 3300005546 Bacteria 6223
196 Ga0070696_100074654 3300005546 Bacteria 2391
197 Ga0070696_100464160 3300005546 Bacteria 1001
198 Ga0070696_100716140 3300005546 Bacteria 817
199 Ga0070693_100011024 3300005547 Bacteria 4545
200 Ga0070693_100167752 3300005547 Bacteria 1403
201 Ga0070693_100804690 3300005547 Bacteria 697
202 Ga0070693_101375393 3300005547 Bacteria 548
203 Ga0070665_100014624 3300005548 Bacteria 7876
204 Ga0070665_100074982 3300005548 Bacteria 3389
205 Ga0070665_100087868 3300005548 Bacteria 3114
206 Ga0070665_100157888 3300005548 Bacteria 2270
207 Ga0070665_100182589 3300005548 Bacteria 2099
208 Ga0070665_100331108 3300005548 Bacteria 1527
209 Ga0070665_100340969 3300005548 Bacteria 1503
210 Ga0070665_100414332 3300005548 Bacteria 1356
211 Ga0070665_100612837 3300005548 Bacteria 1102
212 Ga0070665_101381074 3300005548 Bacteria 714
213 Ga0070665_101480620 3300005548 Bacteria 687
214 Ga0070665_101900889 3300005548 Bacteria 601
215 Ga0070665_102367133 3300005548 Bacteria 534
216 Ga0070704_100930546 3300005549 Bacteria 783
217 Ga0068855_100107936 3300005563 Bacteria 3198
218 Ga0068855_100218784 3300005563 Bacteria 2137
219 Ga0068855_100377233 3300005563 Bacteria 1558
220 Ga0068855_100551499 3300005563 Bacteria 1247
221 Ga0068855_100856090 3300005563 Bacteria 963
222 Ga0068855_101168688 3300005563 Bacteria 801
223 Ga0068855_101411038 3300005563 Bacteria 717
224 Ga0068855_101569489 3300005563 Bacteria 674
225 Ga0068855_102108968 3300005563 Bacteria 567
226 Ga0070664_100068199 3300005564 Bacteria 3041
227 Ga0070664_101714597 3300005564 Bacteria 595
228 Ga0070664_101989152 3300005564 Bacteria 551
229 Ga0068857_100096862 3300005577 Bacteria 2644
230 Ga0068857_100128196 3300005577 Bacteria 2287
231 Ga0068857_100828304 3300005577 Bacteria 885
232 Ga0068857_101058490 3300005577 Bacteria 782
233 Ga0068857_101572916 3300005577 Bacteria 641
234 Ga0068854_100683089 3300005578 Bacteria 885
235 Ga0068854_101116855 3300005578 Bacteria 703
236 Ga0068856_100191608 3300005614 Bacteria 2058
237 Ga0068856_100277013 3300005614 Bacteria 1694
238 Ga0068856_100781455 3300005614 Bacteria 975
239 Ga0068856_101292082 3300005614 Bacteria 745
240 Ga0068856_101970962 3300005614 Bacteria 594
241 Ga0070702_100186251 3300005615 Bacteria 1362
242 Ga0068852_100130647 3300005616 Bacteria 2312
243 Ga0068852_102407536 3300005616 Bacteria 547
244 Ga0068859_100225122 3300005617 Bacteria 1964
245 Ga0068859_100416049 3300005617 Bacteria 1440
246 Ga0068859_100653974 3300005617 Bacteria 1143
247 Ga0068859_101091707 3300005617 Bacteria 878
248 Ga0068859_102701731 3300005617 Bacteria 545
249 Ga0068864_100170784 3300005618 Bacteria 1982
250 Ga0068864_100695509 3300005618 Bacteria 993
251 Ga0068864_101390974 3300005618 Bacteria 703
252 Ga0068864_101798307 3300005618 Bacteria 618
253 Ga0068864_102438990 3300005618 Bacteria 529
254 Ga0068866_10155481 3300005718 Bacteria 1328
255 Ga0068866_10320624 3300005718 Bacteria 975
256 Ga0068866_10583336 3300005718 Bacteria 752
257 Ga0068861_100084477 3300005719 Bacteria 2492
258 Ga0068861_100275129 3300005719 Bacteria 1447
259 Ga0068861_101018226 3300005719 Bacteria 791
260 Ga0068851_10074549 3300005834 Bacteria 1762
261 Ga0068870_10209043 3300005840 Bacteria 1188
262 Ga0068870_11056359 3300005840 Bacteria 582
263 Ga0068863_100043883 3300005841 Bacteria 4244
264 Ga0068863_100350018 3300005841 Bacteria 1438
265 Ga0068863_101024711 3300005841 Bacteria 829
266 Ga0068863_102507882 3300005841 Bacteria 525
267 Ga0068858_100049282 3300005842 Bacteria 3900
268 Ga0068858_100112898 3300005842 Bacteria 2538
269 Ga0068858_100163902 3300005842 Bacteria 2094
270 Ga0068858_100425301 3300005842 Bacteria 1277
271 Ga0068860_100092223 3300005843 Bacteria 2886
272 Ga0068860_100440964 3300005843 Bacteria 1293
273 Ga0068860_100463463 3300005843 Bacteria 1261
274 Ga0068860_101054688 3300005843 Bacteria 831
275 Ga0068860_101067238 3300005843 Bacteria 827
276 Ga0068860_102839372 3300005843 Bacteria 502
277 Ga0068862_100011381 3300005844 Bacteria 7344
278 Ga0068862_100191186 3300005844 Bacteria 1842
279 Ga0068862_100432931 3300005844 Bacteria 1237
280 Ga0068862_101350880 3300005844 Bacteria 715
281 Ga0081455_10000048 3300005937 Bacteria 126551
282 Ga0081455_10013116 3300005937 Bacteria 8213
283 Ga0081455_10017489 3300005937 Bacteria 6870
284 Ga0081455_10099126 3300005937 Bacteria 2344
285 Ga0081455_10137446 3300005937 Bacteria 1902
286 Ga0081538_10001852 3300005981 Bacteria 21341
287 Ga0081540_1095245 3300005983 Bacteria 1298
288 Ga0081540_1191416 3300005983 Bacteria 754
289 Ga0081539_10000072 3300005985 Bacteria 232726
290 Ga0081539_10009089 3300005985 Bacteria 8416
291 Ga0070717_10074954 3300006028 Bacteria 2829
292 Ga0070717_10477158 3300006028 Bacteria 1126
293 Ga0070717_10724336 3300006028 Bacteria 904
294 Ga0070717_10845026 3300006028 Bacteria 833
295 Ga0075368_10193637 3300006042 Bacteria 859
296 Ga0075363_100273731 3300006048 Bacteria 976
297 Ga0075363_100421375 3300006048 Bacteria 786
298 Ga0075363_100712037 3300006048 Bacteria 607
299 Ga0075364_10249794 3300006051 Bacteria 1205
300 Ga0070715_10011442 3300006163 Bacteria 3196
301 Ga0070716_100180003 3300006173 Bacteria 1387
302 Ga0070716_100317300 3300006173 Bacteria 1091
303 Ga0070712_100004619 3300006175 Bacteria 8513
304 Ga0070712_100314311 3300006175 Bacteria 1272
305 Ga0075362_10096734 3300006177 Bacteria 1376
306 Ga0075362_10277492 3300006177 Bacteria 828
307 Ga0075367_10319705 3300006178 Bacteria 978
308 Ga0075367_10462486 3300006178 Bacteria 804
309 Ga0075367_10488672 3300006178 Bacteria 781
310 Ga0075367_10558546 3300006178 Bacteria 727
311 Ga0075366_10042037 3300006195 Bacteria 2706
312 Ga0075366_10335185 3300006195 Bacteria 927
313 Ga0075366_10467034 3300006195 Bacteria 779
314 Ga0075366_10774579 3300006195 Bacteria 596
315 Ga0097621_100106219 3300006237 Bacteria 2368
316 Ga0097621_100141731 3300006237 Bacteria 2054
317 Ga0097621_100318759 3300006237 Bacteria 1376
318 Ga0097621_100778144 3300006237 Bacteria 885
319 Ga0097621_101172310 3300006237 Bacteria 723
320 Ga0075370_10025728 3300006353 Bacteria 3256
321 Ga0075370_10243018 3300006353 Bacteria 1066
322 Ga0068871_100071528 3300006358 Bacteria 2853
323 Ga0068871_100392603 3300006358 Bacteria 1234
324 Ga0068871_101195952 3300006358 Bacteria 713
325 Ga0075428_102272651 3300006844 Bacteria 558
326 Ga0075430_100113569 3300006846 Bacteria 2257
327 Ga0075430_100275397 3300006846 Bacteria 1392
328 Ga0075431_101210725 3300006847 Bacteria 718
329 Ga0075431_102202149 3300006847 Bacteria 506
330 Ga0075433_10227783 3300006852 Bacteria 1655
331 Ga0075433_10486718 3300006852 Bacteria 1087
332 Ga0075433_11139175 3300006852 Bacteria 678
333 Ga0075434_100127605 3300006871 Bacteria 2561
334 Ga0075434_100342016 3300006871 Bacteria 1517
335 Ga0075434_100939960 3300006871 Bacteria 879
336 Ga0068865_100002505 3300006881 Bacteria 10873
337 Ga0068865_100204889 3300006881 Bacteria 1533
338 Ga0068865_100875544 3300006881 Bacteria 779
339 Ga0068865_100934570 3300006881 Bacteria 756
340 Ga0068865_101556208 3300006881 Bacteria 593
341 Ga0075436_100053121 3300006914 Bacteria 2797
342 Ga0075436_100243577 3300006914 Bacteria 1279
343 Ga0075436_101311785 3300006914 Bacteria 548
344 Ga0097620_100225140 3300006931 Bacteria 1964
345 Ga0097620_100416056 3300006931 Bacteria 1440
346 Ga0097620_100653863 3300006931 Bacteria 1143
347 Ga0097620_101091665 3300006931 Bacteria 878
348 Ga0097620_102701815 3300006931 Bacteria 545
349 Ga0099795_10002056 3300007788 Bacteria 4620
350 Ga0099795_10357496 3300007788 Bacteria 655
351 Ga0105250_10202203 3300009092 Bacteria 838
352 Ga0105240_10118855 3300009093 Bacteria 3185
353 Ga0105240_10261448 3300009093 Bacteria 1996
354 Ga0105240_10313482 3300009093 Bacteria 1790
355 Ga0105240_10455243 3300009093 Bacteria 1431
356 Ga0105240_10546606 3300009093 Bacteria 1282
357 Ga0105240_10644980 3300009093 Bacteria 1161
358 Ga0105240_10775048 3300009093 Bacteria 1041
359 Ga0105240_10950412 3300009093 Bacteria 922
360 Ga0105240_11671845 3300009093 Bacteria 665
361 Ga0105240_12026371 3300009093 Bacteria 598
362 Ga0105240_12217837 3300009093 Bacteria 569
363 Ga0105240_12584970 3300009093 Bacteria 525
364 Ga0111539_10065259 3300009094 Bacteria 4303
365 Ga0111539_10872514 3300009094 Bacteria 1047
366 Ga0111539_12489409 3300009094 Bacteria 600
367 Ga0111539_13375196 3300009094 Bacteria 514
368 Ga0105245_10289754 3300009098 Bacteria 1603
369 Ga0105245_11142459 3300009098 Bacteria 826
370 Ga0105245_11300387 3300009098 Bacteria 776
371 Ga0105245_12283177 3300009098 Bacteria 595
372 Ga0105247_10189096 3300009101 Bacteria 1378
373 Ga0105247_10574377 3300009101 Bacteria 832
374 Ga0105247_10618604 3300009101 Bacteria 805
375 Ga0105247_11454536 3300009101 Bacteria 557
376 Ga0114129_10210172 3300009147 Bacteria 2631
377 Ga0114129_10227354 3300009147 Bacteria 2514
378 Ga0114129_11135926 3300009147 Bacteria 976
379 Ga0114129_12150191 3300009147 Bacteria 672
380 Ga0105243_10014127 3300009148 Bacteria 6039
381 Ga0105243_10014172 3300009148 Bacteria 6032
382 Ga0105243_10865852 3300009148 Bacteria 896
383 Ga0105243_11173214 3300009148 Bacteria 780
384 Ga0105241_10113021 3300009174 Bacteria 2176
385 Ga0105241_10253442 3300009174 Bacteria 1493
386 Ga0105241_10267822 3300009174 Bacteria 1454
387 Ga0105241_10349871 3300009174 Bacteria 1283
388 Ga0105241_10773262 3300009174 Bacteria 882
389 Ga0105241_10836780 3300009174 Bacteria 850
390 Ga0105241_10926408 3300009174 Bacteria 811
391 Ga0105241_11541385 3300009174 Bacteria 641
392 Ga0105241_11924604 3300009174 Bacteria 580
393 Ga0105242_10123893 3300009176 Bacteria 2222
394 Ga0105242_10256228 3300009176 Bacteria 1579
395 Ga0105242_10362506 3300009176 Bacteria 1342
396 Ga0105248_10063706 3300009177 Bacteria 4138
397 Ga0105248_10289075 3300009177 Bacteria 1846
398 Ga0105248_10451887 3300009177 Bacteria 1448
399 Ga0105248_10775680 3300009177 Bacteria 1082
400 Ga0105248_10787840 3300009177 Bacteria 1073
401 Ga0105248_12462277 3300009177 Bacteria 593
402 Ga0105237_10016531 3300009545 Bacteria 7666
403 Ga0105237_10080860 3300009545 Bacteria 3240
404 Ga0105237_10155476 3300009545 Bacteria 2283
405 Ga0105237_10373062 3300009545 Bacteria 1431
406 Ga0105237_10526050 3300009545 Bacteria 1189
407 Ga0105238_10012597 3300009551 Bacteria 8537
408 Ga0105238_10179895 3300009551 Bacteria 2092
409 Ga0105238_10215115 3300009551 Bacteria 1898
410 Ga0105238_10244606 3300009551 Bacteria 1772
411 Ga0105238_10315021 3300009551 Bacteria 1550
412 Ga0105238_10343086 3300009551 Bacteria 1482
413 Ga0105238_10561589 3300009551 Bacteria 1146
414 Ga0105238_10764574 3300009551 Bacteria 981
415 Ga0105238_10806031 3300009551 Bacteria 955
416 Ga0105238_11168422 3300009551 Bacteria 793
417 Ga0105238_11204016 3300009551 Bacteria 782
418 Ga0105238_11512957 3300009551 Bacteria 700
419 Ga0105238_13063038 3300009551 Bacteria 502
420 Ga0105249_10048120 3300009553 Bacteria 3888
421 Ga0105249_10064902 3300009553 Bacteria 3357
422 Ga0105249_10141467 3300009553 Bacteria 2308
423 Ga0105249_11396288 3300009553 Bacteria 772
424 Ga0105249_12281628 3300009553 Bacteria 614
425 Ga0099796_10124832 3300010159 Bacteria 993
426 Ga0105239_10066260 3300010375 Bacteria 3967
427 Ga0105239_10138338 3300010375 Bacteria 2712
428 Ga0105239_10327892 3300010375 Bacteria 1727
429 Ga0105239_10592553 3300010375 Bacteria 1264
430 Ga0105239_10691783 3300010375 Bacteria 1166
431 Ga0105239_10759035 3300010375 Bacteria 1110
432 Ga0105239_11628158 3300010375 Bacteria 747
433 Ga0105239_11904501 3300010375 Bacteria 690
434 Ga0105246_10004854 3300011119 Bacteria 8191
435 Ga0105246_10062954 3300011119 Bacteria 2586
436 Ga0105246_10753088 3300011119 Bacteria 859
437 Ga0105246_10854873 3300011119 Bacteria 812
438 Ga0105246_11590571 3300011119 Bacteria 617
439 Ga0105246_11914791 3300011119 Bacteria 570
440 Ga0105246_12405411 3300011119 Bacteria 517
441 Ga0157344_1004729 3300012476 Bacteria 821
442 Ga0157346_1012317 3300012480 Bacteria 646
443 Ga0157337_1010414 3300012483 Bacteria 719
444 Ga0157325_1035635 3300012485 Bacteria 520
445 Ga0157345_1022859 3300012498 Bacteria 650
446 Ga0157314_1002718 3300012500 Bacteria 1228
447 Ga0157347_1010178 3300012502 Bacteria 983
448 Ga0157313_1022476 3300012503 Bacteria 655
449 Ga0157339_1025151 3300012505 Bacteria 661
450 Ga0157324_1005414 3300012506 Bacteria 923
451 Ga0157342_1002329 3300012507 Bacteria 1532
452 Ga0157315_1003570 3300012508 Bacteria 1057
453 Ga0157316_1002477 3300012510 Bacteria 1254
454 Ga0157338_1046649 3300012515 Bacteria 608
455 Ga0157373_10204225 3300013100 Bacteria 1393
456 Ga0157373_10361875 3300013100 Bacteria 1036
457 Ga0157373_10435233 3300013100 Bacteria 942
458 Ga0157373_10523795 3300013100 Bacteria 858
459 Ga0157373_11371771 3300013100 Bacteria 537
460 Ga0157371_10360525 3300013102 Bacteria 1059
461 Ga0157371_10634665 3300013102 Bacteria 796
462 Ga0157371_10954468 3300013102 Bacteria 652
463 Ga0157371_11054853 3300013102 Bacteria 622
464 Ga0157370_10083851 3300013104 Bacteria 2996
465 Ga0157370_10324532 3300013104 Bacteria 1420
466 Ga0157370_10620972 3300013104 Bacteria 989
467 Ga0157370_11162771 3300013104 Bacteria 697
468 Ga0157370_11398251 3300013104 Bacteria 630
469 Ga0157369_10087882 3300013105 Bacteria 3319
470 Ga0157369_10135701 3300013105 Bacteria 2605
471 Ga0157369_10578454 3300013105 Bacteria 1160
472 Ga0157369_10707966 3300013105 Bacteria 1037
473 Ga0157369_10828958 3300013105 Bacteria 950
474 Ga0157369_11315190 3300013105 Bacteria 737
475 Ga0157369_11368116 3300013105 Bacteria 721
476 Ga0157369_12306567 3300013105 Bacteria 545
477 Ga0157374_10133488 3300013296 Bacteria 2404
478 Ga0157374_10332353 3300013296 Bacteria 1508
479 Ga0157374_10382101 3300013296 Bacteria 1403
480 Ga0157374_10956313 3300013296 Bacteria 875
481 Ga0157378_10115850 3300013297 Bacteria 2464
482 Ga0157378_10537404 3300013297 Bacteria 1173
483 Ga0157378_10775844 3300013297 Bacteria 983
484 Ga0157378_13021990 3300013297 Bacteria 522
485 Ga0163162_10632920 3300013306 Bacteria 1194
486 Ga0163162_10780723 3300013306 Bacteria 1073
487 Ga0163162_12249586 3300013306 Bacteria 626
488 Ga0163162_13124403 3300013306 Bacteria 532
489 Ga0157372_10327295 3300013307 Bacteria 1784
490 Ga0157372_10583662 3300013307 Bacteria 1303
491 Ga0157372_10622267 3300013307 Bacteria 1258
492 Ga0157372_11198800 3300013307 Bacteria 877
493 Ga0157372_12846566 3300013307 Bacteria 554
494 Ga0157375_10476831 3300013308 Bacteria 1413
495 Ga0157375_10952587 3300013308 Bacteria 1000
496 Ga0157375_11360480 3300013308 Bacteria 836
497 Ga0157375_11760277 3300013308 Bacteria 734
498 Ga0163163_10008003 3300014325 Bacteria 9355
499 Ga0163163_10050622 3300014325 Bacteria 4091
500 Ga0163163_10155427 3300014325 Bacteria 2332
501 Ga0163163_10483398 3300014325 Bacteria 1299
502 Ga0163163_10640651 3300014325 Bacteria 1126
503 Ga0163163_10893135 3300014325 Bacteria 952
504 Ga0163163_11109392 3300014325 Bacteria 854
505 Ga0163163_11666641 3300014325 Bacteria 698
506 Ga0163163_12335132 3300014325 Bacteria 593
507 Ga0163163_12874742 3300014325 Bacteria 537
508 Ga0157380_10069944 3300014326 Bacteria 2834
509 Ga0157380_10450958 3300014326 Bacteria 1235
510 Ga0157380_10545240 3300014326 Bacteria 1136
511 Ga0157380_10806218 3300014326 Bacteria 956
512 Ga0157380_10916393 3300014326 Bacteria 904
513 Ga0182008_10126397 3300014497 Bacteria 1273
514 Ga0182008_10213644 3300014497 Bacteria 985
515 Ga0182008_10247911 3300014497 Bacteria 918
516 Ga0157377_10476575 3300014745 Bacteria 867
517 Ga0157379_10052289 3300014968 Bacteria 3649
518 Ga0157379_10181186 3300014968 Bacteria 1903
519 Ga0157379_10232957 3300014968 Bacteria 1670
520 Ga0157379_10384430 3300014968 Bacteria 1288
521 Ga0157379_10761071 3300014968 Bacteria 912
522 Ga0157379_11349508 3300014968 Bacteria 690
523 Ga0157376_10040837 3300014969 Bacteria 3794
524 Ga0157376_10239568 3300014969 Bacteria 1690
525 Ga0157376_10303079 3300014969 Bacteria 1513
526 Ga0157376_10559227 3300014969 Bacteria 1133
527 Ga0157376_10864631 3300014969 Bacteria 920
528 Ga0157376_11078476 3300014969 Bacteria 828
529 Ga0157376_11552520 3300014969 Bacteria 696
530 Ga0157376_12145208 3300014969 Bacteria 597
531 Ga0182007_10214516 3300015262 Bacteria 678
532 Ga0163161_10260428 3300017792 Bacteria 1354
533 Ga0163161_12061192 3300017792 Bacteria 507
534 Ga0197907_10834854 3300020069 Bacteria 1122
535 Ga0197907_10879882 3300020069 Bacteria 1094
536 Ga0197907_11284989 3300020069 Bacteria 850
537 Ga0206352_10592541 3300020078 Bacteria 559
538 Ga0206352_10990522 3300020078 Bacteria 4035
539 Ga0206350_11455779 3300020080 Bacteria 775
540 Ga0206353_10563244 3300020082 Bacteria 4006
541 Ga0213873_10005735 3300021358 Bacteria 2402
542 Ga0213873_10019508 3300021358 Bacteria 1574
543 Ga0213873_10038734 3300021358 Bacteria 1219
544 Ga0213872_10012804 3300021361 Bacteria 3938
545 Ga0213872_10021018 3300021361 Bacteria 3005
546 Ga0213872_10093098 3300021361 Bacteria 1347
547 Ga0213872_10112292 3300021361 Bacteria 1210
548 Ga0213872_10201651 3300021361 Bacteria 852
549 Ga0213874_10005081 3300021377 Bacteria 3046
550 Ga0213874_10186857 3300021377 Bacteria 739
551 Ga0213876_10026215 3300021384 Bacteria 3074
552 Ga0213876_10027585 3300021384 Bacteria 2996
553 Ga0213876_10207718 3300021384 Bacteria 1041
554 Ga0213875_10007338 3300021388 Bacteria 5700
555 Ga0213875_10017153 3300021388 Bacteria 3503
556 Ga0213875_10023977 3300021388 Bacteria 2911
557 Ga0213875_10042663 3300021388 Bacteria 2130
558 Ga0213875_10042775 3300021388 Bacteria 2127
559 Ga0213875_10120516 3300021388 Bacteria 1226
560 Ga0213875_10163627 3300021388 Bacteria 1044
561 Ga0213871_10003980 3300021441 Bacteria 2912
562 Ga0213871_10012935 3300021441 Bacteria 1949
563 Ga0213871_10312436 3300021441 Bacteria 509
564 Ga0224712_10039629 3300022467 Bacteria 1767
565 Ga0224712_10064921 3300022467 Bacteria 1465
566 Ga0224712_10119230 3300022467 Bacteria 1141
567 Ga0207427_108978 3300025231 Bacteria 1091
568 Ga0209233_1000013 3300025261 Bacteria 1013785
569 Ga0209233_1003903 3300025261 Bacteria 5177
570 Ga0209233_1011776 3300025261 Bacteria 2566
571 Ga0209675_1020773 3300025291 Bacteria 1769
572 Ga0209676_1000092 3300025292 Bacteria 250453
573 Ga0209676_1004347 3300025292 Bacteria 7943
574 Ga0209050_1007859 3300025298 Bacteria 5857
575 Ga0209050_1010525 3300025298 Bacteria 4545
576 Ga0209050_1041263 3300025298 Bacteria 1274
577 Ga0209256_1018456 3300025299 Bacteria 2265
578 Ga0209256_1057678 3300025299 Bacteria 915
579 Ga0209051_1021790 3300025303 Bacteria 2715
580 Ga0209257_1005546 3300025304 Bacteria 8787
581 Ga0209257_1044807 3300025304 Bacteria 1289
582 Ga0207656_10084736 3300025321 Bacteria 1430
583 Ga0207682_10050681 3300025893 Bacteria 1717
584 Ga0207682_10279036 3300025893 Bacteria 781
585 Ga0207692_10010942 3300025898 Bacteria 3841
586 Ga0207692_10182677 3300025898 Bacteria 1223
587 Ga0207692_10385626 3300025898 Bacteria 871
588 Ga0207642_10017630 3300025899 Bacteria 2721
589 Ga0207642_10088287 3300025899 Bacteria 1525
590 Ga0207642_10242080 3300025899 Bacteria 1019
591 Ga0207710_10052978 3300025900 Bacteria 1825
592 Ga0207710_10303804 3300025900 Bacteria 807
593 Ga0207688_10166712 3300025901 Bacteria 1308
594 Ga0207680_10002564 3300025903 Bacteria 8470
595 Ga0207680_10136372 3300025903 Bacteria 1622
596 Ga0207647_10038225 3300025904 Bacteria 3036
597 Ga0207647_10310841 3300025904 Bacteria 896
598 Ga0207699_10008830 3300025906 Bacteria 4992
599 Ga0207699_10425897 3300025906 Bacteria 949
600 Ga0207699_10885593 3300025906 Bacteria 658
601 Ga0207699_11013020 3300025906 Bacteria 614
602 Ga0207699_11075577 3300025906 Bacteria 595
603 Ga0207645_10011392 3300025907 Bacteria 6075
604 Ga0207645_10279815 3300025907 Bacteria 1108
605 Ga0207645_10602094 3300025907 Bacteria 746
606 Ga0207645_10630619 3300025907 Bacteria 728
607 Ga0207643_10030805 3300025908 Bacteria 2989
608 Ga0207643_10032595 3300025908 Bacteria 2911
609 Ga0207643_10974748 3300025908 Bacteria 549
610 Ga0207705_10004720 3300025909 Bacteria 10265
611 Ga0207705_10101468 3300025909 Bacteria 2117
612 Ga0207705_10462889 3300025909 Bacteria 984
613 Ga0207705_10837392 3300025909 Bacteria 713
614 Ga0207684_10122169 3300025910 Bacteria 2233
615 Ga0207684_10354217 3300025910 Bacteria 1263
616 Ga0207684_11107359 3300025910 Bacteria 659
617 Ga0207654_10063489 3300025911 Bacteria 2168
618 Ga0207654_10065182 3300025911 Bacteria 2144
619 Ga0207654_10199940 3300025911 Bacteria 1315
620 Ga0207654_10278345 3300025911 Bacteria 1131
621 Ga0207654_11447529 3300025911 Bacteria 501
622 Ga0207707_10017730 3300025912 Bacteria 6211
623 Ga0207707_10156792 3300025912 Bacteria 1991
624 Ga0207707_10358526 3300025912 Bacteria 1256
625 Ga0207707_10391698 3300025912 Bacteria 1193
626 Ga0207707_10445172 3300025912 Bacteria 1109
627 Ga0207707_10539056 3300025912 Bacteria 992
628 Ga0207707_10574219 3300025912 Bacteria 956
629 Ga0207707_10630210 3300025912 Bacteria 905
630 Ga0207695_10163712 3300025913 Bacteria 2154
631 Ga0207695_10178743 3300025913 Bacteria 2044
632 Ga0207695_10284139 3300025913 Bacteria 1548
633 Ga0207695_10384742 3300025913 Bacteria 1288
634 Ga0207695_10396467 3300025913 Bacteria 1265
635 Ga0207695_10808022 3300025913 Bacteria 818
636 Ga0207695_11259296 3300025913 Bacteria 620
637 Ga0207695_11442632 3300025913 Bacteria 569
638 Ga0207671_10066436 3300025914 Bacteria 2684
639 Ga0207671_10158422 3300025914 Bacteria 1752
640 Ga0207671_10354632 3300025914 Bacteria 1163
641 Ga0207671_10480940 3300025914 Bacteria 990
642 Ga0207671_10621689 3300025914 Bacteria 861
643 Ga0207693_10024385 3300025915 Bacteria 4800
644 Ga0207693_10216375 3300025915 Bacteria 1505
645 Ga0207693_10312398 3300025915 Bacteria 1231
646 Ga0207693_11474147 3300025915 Bacteria 503
647 Ga0207663_10350984 3300025916 Bacteria 1117
648 Ga0207663_10573058 3300025916 Bacteria 884
649 Ga0207663_10914653 3300025916 Bacteria 702
650 Ga0207663_11278020 3300025916 Bacteria 591
651 Ga0207660_10003004 3300025917 Bacteria 11039
652 Ga0207660_10043689 3300025917 Bacteria 3149
653 Ga0207660_10153020 3300025917 Bacteria 1774
654 Ga0207660_10243075 3300025917 Bacteria 1418
655 Ga0207660_10371451 3300025917 Bacteria 1148
656 Ga0207660_10700122 3300025917 Bacteria 826
657 Ga0207660_11152826 3300025917 Bacteria 631
658 Ga0207657_10037137 3300025919 Bacteria 4355
659 Ga0207657_10063406 3300025919 Bacteria 3160
660 Ga0207657_10423466 3300025919 Bacteria 1046
661 Ga0207649_10000194 3300025920 Bacteria 50112
662 Ga0207649_10176862 3300025920 Bacteria 1491
663 Ga0207649_10251578 3300025920 Bacteria 1273
664 Ga0207649_10255186 3300025920 Bacteria 1265
665 Ga0207649_10476632 3300025920 Bacteria 946
666 Ga0207649_10568649 3300025920 Bacteria 869
667 Ga0207652_10108322 3300025921 Bacteria 2462
668 Ga0207652_10150019 3300025921 Bacteria 2087
669 Ga0207652_10206951 3300025921 Bacteria 1766
670 Ga0207652_10454365 3300025921 Bacteria 1155
671 Ga0207652_10708442 3300025921 Bacteria 898
672 Ga0207652_10716193 3300025921 Bacteria 892
673 Ga0207652_11243291 3300025921 Bacteria 647
674 Ga0207652_11545672 3300025921 Bacteria 568
675 Ga0207646_10680554 3300025922 Bacteria 921
676 Ga0207681_10026657 3300025923 Bacteria 3730
677 Ga0207681_10142714 3300025923 Bacteria 1785
678 Ga0207681_10284058 3300025923 Bacteria 1304
679 Ga0207694_10022428 3300025924 Bacteria 4789
680 Ga0207694_10042706 3300025924 Bacteria 3498
681 Ga0207694_10221393 3300025924 Bacteria 1544
682 Ga0207694_10592428 3300025924 Bacteria 932
683 Ga0207694_11360236 3300025924 Bacteria 600
684 Ga0207694_11390346 3300025924 Bacteria 593
685 Ga0207694_11424682 3300025924 Bacteria 585
686 Ga0207694_11523464 3300025924 Bacteria 564
687 Ga0207694_11894025 3300025924 Bacteria 500
688 Ga0207650_10171098 3300025925 Bacteria 1726
689 Ga0207650_10425877 3300025925 Bacteria 1102
690 Ga0207650_10540337 3300025925 Bacteria 977
691 Ga0207650_10781595 3300025925 Bacteria 809
692 Ga0207650_11071988 3300025925 Bacteria 686
693 Ga0207659_10166081 3300025926 Bacteria 1737
694 Ga0207659_10367555 3300025926 Bacteria 1197
695 Ga0207687_10085895 3300025927 Bacteria 2284
696 Ga0207687_10215504 3300025927 Bacteria 1508
697 Ga0207687_10311953 3300025927 Bacteria 1270
698 Ga0207687_10402010 3300025927 Bacteria 1127
699 Ga0207687_11544316 3300025927 Bacteria 570
700 Ga0207700_10020136 3300025928 Bacteria 4523
701 Ga0207700_10121231 3300025928 Bacteria 2121
702 Ga0207700_10145860 3300025928 Bacteria 1950
703 Ga0207700_10322910 3300025928 Bacteria 1338
704 Ga0207700_11114427 3300025928 Bacteria 705
705 Ga0207664_10015881 3300025929 Bacteria 5482
706 Ga0207664_11000656 3300025929 Bacteria 749
707 Ga0207664_11926278 3300025929 Bacteria 514
708 Ga0207644_10400322 3300025931 Bacteria 1122
709 Ga0207644_11071391 3300025931 Bacteria 677
710 Ga0207690_10029346 3300025932 Bacteria 3496
711 Ga0207690_10332331 3300025932 Bacteria 1197
712 Ga0207690_11299527 3300025932 Bacteria 608
713 Ga0207686_10137320 3300025934 Bacteria 1685
714 Ga0207686_10380969 3300025934 Bacteria 1070
715 Ga0207686_10602867 3300025934 Bacteria 864
716 Ga0207686_10807746 3300025934 Bacteria 752
717 Ga0207709_10018685 3300025935 Bacteria 3887
718 Ga0207709_10125051 3300025935 Bacteria 1743
719 Ga0207670_10028318 3300025936 Bacteria 3555
720 Ga0207670_10566270 3300025936 Bacteria 930
721 Ga0207670_10850450 3300025936 Bacteria 762
722 Ga0207669_10093454 3300025937 Bacteria 1965
723 Ga0207669_10171086 3300025937 Bacteria 1546
724 Ga0207669_10438509 3300025937 Bacteria 1032
725 Ga0207669_10621926 3300025937 Bacteria 880
726 Ga0207669_10955462 3300025937 Bacteria 718
727 Ga0207704_10068198 3300025938 Bacteria 2241
728 Ga0207704_10600811 3300025938 Bacteria 901
729 Ga0207704_10647320 3300025938 Bacteria 870
730 Ga0207665_10096951 3300025939 Bacteria 2052
731 Ga0207665_10159215 3300025939 Bacteria 1623
732 Ga0207665_10473408 3300025939 Bacteria 964
733 Ga0207711_10145656 3300025941 Bacteria 2134
734 Ga0207711_10316184 3300025941 Bacteria 1442
735 Ga0207711_10349566 3300025941 Bacteria 1369
736 Ga0207711_10807876 3300025941 Bacteria 873
737 Ga0207711_11629537 3300025941 Bacteria 589
738 Ga0207711_11655553 3300025941 Bacteria 583
739 Ga0207689_10101680 3300025942 Bacteria 2361
740 Ga0207689_10362866 3300025942 Bacteria 1205
741 Ga0207689_11736626 3300025942 Bacteria 516
742 Ga0207661_10144696 3300025944 Bacteria 2049
743 Ga0207661_10219381 3300025944 Bacteria 1680
744 Ga0207661_10344571 3300025944 Bacteria 1343
745 Ga0207661_10367957 3300025944 Bacteria 1299
746 Ga0207661_10475832 3300025944 Bacteria 1140
747 Ga0207661_11323273 3300025944 Bacteria 662
748 Ga0207679_10316118 3300025945 Bacteria 1351
749 Ga0207679_10328620 3300025945 Bacteria 1326
750 Ga0207679_11781860 3300025945 Bacteria 563
751 Ga0207679_11808868 3300025945 Bacteria 558
752 Ga0207667_10032409 3300025949 Bacteria 5632
753 Ga0207667_10128005 3300025949 Bacteria 2615
754 Ga0207667_10190159 3300025949 Bacteria 2106
755 Ga0207667_10769303 3300025949 Bacteria 961
756 Ga0207667_10776395 3300025949 Bacteria 956
757 Ga0207667_10884612 3300025949 Bacteria 886
758 Ga0207667_10988496 3300025949 Bacteria 829
759 Ga0207667_11353364 3300025949 Bacteria 687
760 Ga0207651_10169073 3300025960 Bacteria 1722
761 Ga0207651_10532437 3300025960 Bacteria 1019
762 Ga0207651_10865417 3300025960 Bacteria 804
763 Ga0207651_10968028 3300025960 Bacteria 760
764 Ga0207712_10027952 3300025961 Bacteria 3769
765 Ga0207712_10029987 3300025961 Bacteria 3654
766 Ga0207712_10392655 3300025961 Bacteria 1164
767 Ga0207712_10409159 3300025961 Bacteria 1142
768 Ga0207712_11434537 3300025961 Bacteria 618
769 Ga0207668_10076092 3300025972 Bacteria 2415
770 Ga0207668_10753316 3300025972 Bacteria 859
771 Ga0207668_10860902 3300025972 Bacteria 805
772 Ga0207668_11101471 3300025972 Bacteria 712
773 Ga0207640_10274539 3300025981 Bacteria 1321
774 Ga0207640_10778413 3300025981 Bacteria 827
775 Ga0207658_10058513 3300025986 Bacteria 2868
776 Ga0207658_10167494 3300025986 Bacteria 1806
777 Ga0207658_10708259 3300025986 Bacteria 910
778 Ga0207658_11350037 3300025986 Bacteria 652
779 Ga0207658_11552969 3300025986 Bacteria 605
780 Ga0207658_11823000 3300025986 Bacteria 555
781 Ga0207677_10368238 3300026023 Bacteria 1209
782 Ga0207677_10731759 3300026023 Bacteria 880
783 Ga0207677_10809695 3300026023 Bacteria 839
784 Ga0207703_10027678 3300026035 Bacteria 4464
785 Ga0207703_10097052 3300026035 Bacteria 2489
786 Ga0207703_10761871 3300026035 Bacteria 923
787 Ga0207703_11793975 3300026035 Bacteria 590
788 Ga0207639_10060119 3300026041 Bacteria 2931
789 Ga0207639_10114112 3300026041 Bacteria 2207
790 Ga0207639_10147933 3300026041 Bacteria 1964
791 Ga0207639_10369626 3300026041 Bacteria 1285
792 Ga0207639_10752376 3300026041 Bacteria 906
793 Ga0207639_10846791 3300026041 Bacteria 853
794 Ga0207639_11656380 3300026041 Bacteria 600
795 Ga0207678_10000118 3300026067 Bacteria 65608
796 Ga0207708_10346128 3300026075 Bacteria 1218
797 Ga0207708_10770664 3300026075 Bacteria 827
798 Ga0207702_10226977 3300026078 Bacteria 1743
799 Ga0207702_10897278 3300026078 Bacteria 878
800 Ga0207702_10950716 3300026078 Bacteria 852
801 Ga0207702_11129747 3300026078 Bacteria 777
802 Ga0207702_11445335 3300026078 Bacteria 681
803 Ga0207641_10035109 3300026088 Bacteria 4175
804 Ga0207641_10215049 3300026088 Bacteria 1779
805 Ga0207641_10636383 3300026088 Bacteria 1047
806 Ga0207641_10792941 3300026088 Bacteria 937
807 Ga0207641_11176651 3300026088 Bacteria 766
808 Ga0207648_10154508 3300026089 Bacteria 2025
809 Ga0207648_10238236 3300026089 Bacteria 1619
810 Ga0207648_10421221 3300026089 Bacteria 1212
811 Ga0207648_11260003 3300026089 Bacteria 695
812 Ga0207676_10275805 3300026095 Bacteria 1525
813 Ga0207676_10405870 3300026095 Bacteria 1274
814 Ga0207676_10530481 3300026095 Bacteria 1122
815 Ga0207676_10996869 3300026095 Bacteria 825
816 Ga0207676_11190143 3300026095 Bacteria 755
817 Ga0207674_10135964 3300026116 Bacteria 2420
818 Ga0207674_10345588 3300026116 Bacteria 1438
819 Ga0207674_10511916 3300026116 Bacteria 1159
820 Ga0207674_10772138 3300026116 Bacteria 928
821 Ga0207675_100163578 3300026118 Bacteria 2124
822 Ga0207675_100486730 3300026118 Bacteria 1227
823 Ga0207675_100615881 3300026118 Bacteria 1090
824 Ga0207683_10018489 3300026121 Bacteria 5947
825 Ga0207683_10026403 3300026121 Bacteria 5012
826 Ga0207683_10103171 3300026121 Bacteria 2547
827 Ga0207683_10237421 3300026121 Bacteria 1663
828 Ga0207683_10263843 3300026121 Bacteria 1573
829 Ga0207683_10380731 3300026121 Bacteria 1297
830 Ga0207698_10074815 3300026142 Bacteria 2703
831 Ga0207698_10127754 3300026142 Bacteria 2166
832 Ga0207698_10144541 3300026142 Bacteria 2055
833 Ga0207698_10668335 3300026142 Bacteria 1031
834 Ga0209995_1004561 3300027471 Bacteria 2216
835 Ga0209179_1000116 3300027512 Bacteria 9269
836 Ga0209983_1006615 3300027665 Bacteria 2378
837 Ga0209966_1000641 3300027695 Bacteria 7848
838 Ga0207428_10000169 3300027907 Bacteria 90667
839 Ga0207428_10030716 3300027907 Bacteria 4439
840 Ga0207428_10885962 3300027907 Bacteria 631
841 Ga0268266_10000557 3300028379 Bacteria 51935
842 Ga0268266_10005613 3300028379 Bacteria 11650
843 Ga0268266_10055515 3300028379 Bacteria 3405
844 Ga0268266_10076582 3300028379 Bacteria 2907
845 Ga0268266_10092509 3300028379 Bacteria 2653
846 Ga0268266_10095842 3300028379 Bacteria 2606
847 Ga0268266_10155348 3300028379 Bacteria 2066
848 Ga0268266_10166733 3300028379 Bacteria 1996
849 Ga0268266_10439319 3300028379 Bacteria 1239
850 Ga0268266_10854206 3300028379 Bacteria 880
851 Ga0268266_11351711 3300028379 Bacteria 688
852 Ga0268266_11571301 3300028379 Bacteria 633
853 Ga0268266_11720622 3300028379 Bacteria 602
854 Ga0268266_12070157 3300028379 Bacteria 542
855 Ga0268265_10010282 3300028380 Bacteria 6319
856 Ga0268265_10035295 3300028380 Bacteria 3652
857 Ga0268265_10272456 3300028380 Bacteria 1510
858 Ga0268265_11170634 3300028380 Bacteria 765
859 Ga0268265_11214200 3300028380 Bacteria 752
860 Ga0268265_11592757 3300028380 Bacteria 658
861 Ga0268264_10525570 3300028381 Bacteria 1157
862 Ga0268264_11786672 3300028381 Bacteria 625
863 Ga0265337_1029032 3300028556 Bacteria 1656
864 Ga0307515_10072629 3300028794 Bacteria 4638
865 Ga0265338_10002896 3300028800 Bacteria 24981
866 Ga0265338_10008853 3300028800 Bacteria 12137
867 Ga0265338_10252984 3300028800 Bacteria 1299
868 Ga0265324_10010483 3300029957 Bacteria 3571
869 Ga0265324_10067274 3300029957 Bacteria 1222
870 Ga0307512_10143919 3300030522 Bacteria 1449
871 Ga0265767_105512 3300030836 Bacteria 769
872 Ga0265766_1006157 3300030863 Bacteria 779
873 Ga0265764_109258 3300030882 Bacteria 606
874 Ga0265761_109076 3300030889 Bacteria 565
875 Ga0265760_10212807 3300031090 Bacteria 657
876 Ga0265320_10022900 3300031240 Bacteria 3335
877 Ga0265329_10324821 3300031242 Bacteria 523
878 Ga0265340_10042240 3300031247 Bacteria 2239
879 Ga0265339_10078316 3300031249 Bacteria 1750
880 Ga0265331_10000543 3300031250 Bacteria 34421
881 Ga0265331_10003502 3300031250 Bacteria 10110
882 Ga0265331_10013838 3300031250 Bacteria 4322
883 Ga0265331_10016732 3300031250 Bacteria 3843
884 Ga0265331_10171878 3300031250 Bacteria 980
885 Ga0265331_10249395 3300031250 Bacteria 796
886 Ga0265327_10000392 3300031251 Bacteria 82296
887 Ga0265327_10001257 3300031251 Bacteria 33614
888 Ga0265327_10082992 3300031251 Bacteria 1578
889 Ga0265327_10188601 3300031251 Bacteria 939
890 Ga0265327_10357150 3300031251 Bacteria 638
891 Ga0265316_10023098 3300031344 Bacteria 5229
892 Ga0265316_10228372 3300031344 Bacteria 1371
893 Ga0307513_10545964 3300031456 Bacteria 872
894 Ga0307408_100343964 3300031548 Bacteria 1263
895 Ga0307408_100857199 3300031548 Bacteria 829
896 Ga0265313_10004521 3300031595 Bacteria 10621
897 Ga0307508_10130442 3300031616 Bacteria 2117
898 Ga0307508_10851291 3300031616 Bacteria 533
899 Ga0265314_10016595 3300031711 Bacteria 5808
900 Ga0265314_10023749 3300031711 Bacteria 4666
901 Ga0265314_10056619 3300031711 Bacteria 2697
902 Ga0265314_10107669 3300031711 Bacteria 1778
903 Ga0265314_10179813 3300031711 Bacteria 1269
904 Ga0265314_10648649 3300031711 Bacteria 539
905 Ga0307516_10069198 3300031730 Bacteria 3396
906 Ga0307516_10128092 3300031730 Bacteria 2321
907 Ga0307516_10239808 3300031730 Bacteria 1512
908 Ga0307516_10646932 3300031730 Bacteria 712
909 Ga0307405_10794865 3300031731 Bacteria 792
910 Ga0307405_11447559 3300031731 Bacteria 602
911 Ga0307413_10024003 3300031824 Bacteria 3315
912 Ga0307410_10015925 3300031852 Bacteria 4470
913 Ga0307410_11938915 3300031852 Bacteria 525
914 Ga0307406_10576971 3300031901 Bacteria 924
915 Ga0307406_10863544 3300031901 Bacteria 768
916 Ga0307407_10020831 3300031903 Bacteria 3368
917 Ga0307407_10154073 3300031903 Bacteria 1497
918 Ga0307407_11490343 3300031903 Bacteria 535
919 Ga0307407_11593366 3300031903 Bacteria 518
920 Ga0307412_10319743 3300031911 Bacteria 1234
921 Ga0307412_11991834 3300031911 Bacteria 537
922 Ga0307409_100305410 3300031995 Bacteria 1482
923 Ga0307409_100803285 3300031995 Bacteria 948
924 Ga0307416_100088575 3300032002 Bacteria 2647
925 Ga0307416_101046865 3300032002 Bacteria 920
926 Ga0307416_102437823 3300032002 Bacteria 622
927 Ga0307411_10038579 3300032005 Bacteria 3014
928 Ga0307411_10758494 3300032005 Bacteria 851
929 Ga0307411_11477840 3300032005 Bacteria 624
930 Ga0307411_11740186 3300032005 Bacteria 578
931 Ga0307415_100734163 3300032126 Bacteria 895
932 Ga0307415_100893816 3300032126 Bacteria 818
933 Ga0316593_10011301 3300032168 Bacteria 2590
934 Ga0316593_10039890 3300032168 Bacteria 1559
935 Ga0316593_10039922 3300032168 Bacteria 1559
936 Ga0307510_10135648 3300033180 Bacteria 2120
937 Ga0307510_10628395 3300033180 Bacteria 529
938 Ga0316588_1031798 3300033528 Bacteria 1240
939 Ga0373930_0000191 3300034816 Bacteria 7407
940 Ga0373930_0013501 3300034816 Bacteria 1507
941 Ga0373948_0002325 3300034817 Bacteria 2793
942 Ga0373950_0000155 3300034818 Bacteria 10219
943 Ga0373958_0002981 3300034819 Bacteria 2419
944 Ga0373959_0001384 3300034820 Bacteria 3879
945 Ga0373938_0000013 3300034957 Bacteria 24269
946 Ga0373928_0000255 3300035084 Bacteria 10564
947 Ga0373929_0003185 3300035085 Bacteria 2974
948 Ga0373934_0275744 3300035086 Bacteria 696
949 Ga0373940_0001317 3300035088 Bacteria 4421
950 Ga0373949_0001716 3300035090 Bacteria 6065
951 Ga0373951_0000552 3300035091 Bacteria 10501
952 Ga0373951_0144568 3300035091 Bacteria 663
953 Ga0373952_0000182 3300035092 Bacteria 9790
954 Ga0373923_0002759 3300035111 Bacteria 5485
955 Ga0373923_0040828 3300035111 Bacteria 1911
956 Ga0373923_0096666 3300035111 Bacteria 1298
957 Ga0373932_0000252 3300035112 Bacteria 16339
958 Ga0373932_0230488 3300035112 Bacteria 669
959 Ga0373936_0033903 3300035113 Bacteria 2026
960 Ga0373936_0276834 3300035113 Bacteria 754
961 Ga0373936_0277884 3300035113 Bacteria 752
962 Ga0373936_0447114 3300035113 Bacteria 597
963 Ga0373939_0006119 3300035114 Bacteria 2892
964 Ga0373941_0036248 3300035115 Bacteria 1499
965 Ga0373941_0101183 3300035115 Bacteria 1003
966 Ga0373941_0322843 3300035115 Bacteria 621
967 Ga0373945_0018664 3300035116 Bacteria 2361
968 Ga0373945_0459882 3300035116 Bacteria 564
969 Ga0373953_0269230 3300035117 Bacteria 742
970 Ga0373953_0573873 3300035117 Bacteria 502
971 Ga0373954_0022106 3300035118 Bacteria 2884
972 Ga0373954_0340621 3300035118 Bacteria 740
973 Ga0373954_0386414 3300035118 Bacteria 692
974 Ga0373956_0053480 3300035119 Bacteria 1818
975 Ga0373957_0013550 3300035120 Bacteria 2769
976 Ga0373960_0000068 3300035121 Bacteria 14664
977 Ga0373960_0074297 3300035121 Bacteria 1058
978 Ga0373960_0091460 3300035121 Bacteria 973
979 Ga0373943_0058840 3300035170 Bacteria 1914
980 Ga0373943_0063345 3300035170 Bacteria 1853
981 Ga0373943_0263265 3300035170 Bacteria 971
982 Ga0373943_0292669 3300035170 Bacteria 923
983 Ga0373946_0194612 3300035171 Bacteria 968
984 Ga0373946_0370831 3300035171 Bacteria 719
985 Ga0373955_0028306 3300035172 Bacteria 2904
986 Ga0373955_0125577 3300035172 Bacteria 1495
987 Ga0373955_0163547 3300035172 Bacteria 1315
988 Ga0373942_0001815 3300035207 Bacteria 5399
989 Ga0373961_0003115 3300035241 Bacteria 4156
990 Ga0373962_0000112 3300035242 Bacteria 16939
991 Ga0373962_0409820 3300035242 Bacteria 500
992 Ga0373931_0001634 3300035691 Bacteria 9691
993 Ga0373931_0121321 3300035691 Bacteria 1494
994 Ga0373931_0508275 3300035691 Bacteria 778
995 Ga0373931_0545513 3300035691 Bacteria 753
996 Ga0373931_0573337 3300035691 Bacteria 735
997 Ga0373935_0004282 3300035692 Bacteria 8374
998 Ga0373935_0027495 3300035692 Bacteria 3515
999 Ga0373935_0069246 3300035692 Bacteria 2272
1000 Ga0373935_0133269 3300035692 Bacteria 1672
1001 Ga0373935_0360337 3300035692 Bacteria 1038
1002 Ga0373935_1295526 3300035692 Bacteria 544
1003 Ga0373927_0148977 3300035695 Bacteria 1532
1004 Ga0373927_0174637 3300035695 Bacteria 1409
1005 Ga0373927_0196004 3300035695 Bacteria 1325
1006 Ga0373927_0238366 3300035695 Bacteria 1195
1007 Ga0373927_0248463 3300035695 Bacteria 1169
1008 Ga0373927_0382694 3300035695 Bacteria 928
1009 Ga0373933_0013505 3300035724 Bacteria 4528
1010 Ga0373933_0117754 3300035724 Bacteria 1661
1011 Ga0373933_0288470 3300035724 Bacteria 1061
1012 Ga0373933_0855275 3300035724 Bacteria 599
1013 Ga0373947_0064868 3300035725 Bacteria 2227
1014 Ga0373947_0065025 3300035725 Bacteria 2224
1015 Ga0373947_0076251 3300035725 Bacteria 2066
1016 Ga0373947_0084575 3300035725 Bacteria 1969
1017 Ga0373947_0185690 3300035725 Bacteria 1355
1018 Ga0373947_0531279 3300035725 Bacteria 800
1019 Ga0373937_0000922 3300036401 Bacteria 24939
1020 Ga0373937_0008630 3300036401 Bacteria 8853
1021 Ga0373937_0032792 3300036401 Bacteria 4713
1022 Ga0373937_0062577 3300036401 Bacteria 3421
1023 Ga0373937_0083755 3300036401 Bacteria 2950
1024 Ga0373937_0178272 3300036401 Bacteria 1995
1025 Ga0373937_1094240 3300036401 Bacteria 746
1026 Ga0265778_001977 3300036457 Bacteria 1929
1027 Ga0265778_031317 3300036457 Bacteria 688
1028 Ga0373925_0008231 3300037068 Bacteria 7590
1029 Ga0373925_0040367 3300037068 Bacteria 3455
1030 Ga0373925_0041086 3300037068 Bacteria 3426
1031 Ga0373925_0194637 3300037068 Bacteria 1610
1032 Ga0395899_0066694 3300037312 Bacteria 2642
1033 Ga0395899_0081254 3300037312 Bacteria 2358
1034 Ga0395899_0105847 3300037312 Bacteria 2026
1035 Ga0395899_0439057 3300037312 Bacteria 857
1036 Ga0395900_0021199 3300037418 Bacteria 6643
1037 Ga0395900_0451558 3300037418 Bacteria 1242
1038 Ga0395900_0452931 3300037418 Bacteria 1239
1039 Ga0395900_0597435 3300037418 Bacteria 1044
1040 Ga0395900_0803481 3300037418 Bacteria 868
1041 Ga0395900_1408335 3300037418 Bacteria 610
1042 Ga0395898_0007760 3300037466 Bacteria 11394
1043 Ga0395898_0079037 3300037466 Bacteria 3173
1044 Ga0395898_0126504 3300037466 Bacteria 2448
1045 Ga0395898_0371181 3300037466 Bacteria 1364
1046 Ga0395898_0490950 3300037466 Bacteria 1168
1047 Ga0395898_1107123 3300037466 Bacteria 725
1048 Ga0395898_1190711 3300037466 Bacteria 693
1049 Ga0395898_1637903 3300037466 Bacteria 567
1050 Ga0395905_0500202 3300037471 Bacteria 1116
1051 Ga0395905_1284528 3300037471 Bacteria 636
1052 Ga0436364_0043783 3300037853 Bacteria 1539
1053 Ga0436364_0229979 3300037853 Bacteria 599
1054 Ga0436364_0268578 3300037853 Bacteria 6831
1055 Ga0436364_0333490 3300037853 Bacteria 1361
1056 Ga0436364_0460289 3300037853 Bacteria 662
1057 Ga0436364_0539801 3300037853 Bacteria 6263
1058 Ga0436364_0554982 3300037853 Bacteria 6536
1059 Ga0436364_0586291 3300037853 Bacteria 97560
1060 Ga0436364_0764338 3300037853 Bacteria 31107
1061 Ga0436364_1062354 3300037853 Bacteria 22499
1062 Ga0436364_1442444 3300037853 Bacteria 2695
1063 Ga0436364_1552061 3300037853 Bacteria 1475
1064 Ga0395901_0097542 3300038443 Bacteria 3081
1065 Ga0395901_0148983 3300038443 Bacteria 2459
1066 Ga0395901_0177540 3300038443 Bacteria 2233
1067 Ga0395901_0213059 3300038443 Bacteria 2021
1068 Ga0395901_0865522 3300038443 Bacteria 888
1069 Ga0395901_0910439 3300038443 Bacteria 861
1070 Ga0395901_1229977 3300038443 Bacteria 713
1071 Ga0395901_2014754 3300038443 Bacteria 523
1072 Ga0242419_011998 3300038698 Bacteria 673
1073 Ga0242420_001271 3300038996 Bacteria 3314
1074 Ga0436365_0507021 3300039437 Bacteria 1157
1075 Ga0436365_0678411 3300039437 Bacteria 1162
1076 Ga0436365_1050783 3300039437 Bacteria 5796
1077 Ga0436365_1075680 3300039437 Bacteria 1065
1078 Ga0436365_1215018 3300039437 Bacteria 3685
1079 Ga0436365_1302455 3300039437 Bacteria 561
1080 Ga0436365_1623855 3300039437 Bacteria 823
1081 Ga0436365_1790914 3300039437 Bacteria 1254
1082 Ga0436365_1902383 3300039437 Bacteria 639
1083 Ga0436360_0155823 3300039438 Bacteria 3366
1084 Ga0436360_0232519 3300039438 Bacteria 567
1085 Ga0436360_0248409 3300039438 Bacteria 1628
1086 Ga0436360_0259420 3300039438 Bacteria 1483
1087 Ga0436360_0272188 3300039438 Bacteria 1079
1088 Ga0436360_0360048 3300039438 Bacteria 2053
1089 Ga0436360_0493064 3300039438 Bacteria 663
1090 Ga0436360_0527459 3300039438 Bacteria 565
1091 Ga0436360_0663233 3300039438 Bacteria 1764
1092 Ga0436360_0765106 3300039438 Bacteria 766
1093 Ga0436360_0846287 3300039438 Bacteria 1406
1094 Ga0436360_1065206 3300039438 Bacteria 2112
1095 Ga0436360_1169610 3300039438 Bacteria 1664
1096 Ga0436360_1205890 3300039438 Bacteria 570
1097 Ga0436360_1229176 3300039438 Bacteria 14016
1098 Ga0436360_1302627 3300039438 Bacteria 833
1099 Ga0436361_0016113 3300039447 Bacteria 2363
1100 Ga0436361_0045826 3300039447 Bacteria 575
1101 Ga0436361_0057420 3300039447 Bacteria 546
1102 Ga0436361_0291526 3300039447 Bacteria 1090
1103 Ga0436361_0299606 3300039447 Bacteria 1108
1104 Ga0436361_0518587 3300039447 Bacteria 518
1105 Ga0436361_0585521 3300039447 Bacteria 1258
1106 Ga0436361_0598899 3300039447 Bacteria 866
1107 Ga0436361_0627073 3300039447 Bacteria 1475
1108 Ga0436361_0663751 3300039447 Bacteria 690
1109 Ga0436361_0765661 3300039447 Bacteria 1143
1110 Ga0436361_0783925 3300039447 Bacteria 1300
1111 Ga0436361_0878406 3300039447 Bacteria 2465
1112 Ga0436361_1000576 3300039447 Bacteria 708
1113 Ga0436361_1164878 3300039447 Bacteria 6643
1114 Ga0436361_1167977 3300039447 Bacteria 1546
1115 Ga0436363_0247885 3300039450 Bacteria 1179
1116 Ga0436363_0315020 3300039450 Bacteria 4092
1117 Ga0436363_0548499 3300039450 Bacteria 501
1118 Ga0436363_0687461 3300039450 Bacteria 593
1119 Ga0436363_0799449 3300039450 Bacteria 820
1120 Ga0436363_0819400 3300039450 Bacteria 598
1121 Ga0436363_1206715 3300039450 Bacteria 584
1122 Ga0436363_1250759 3300039450 Bacteria 1287
1123 Ga0436363_1566193 3300039450 Bacteria 582
1124 Ga0436362_0830432 3300039453 Bacteria 773
1125 Ga0436362_0967331 3300039453 Bacteria 6970
1126 Ga0436362_1063337 3300039453 Bacteria 1225
1127 Ga0436362_1174560 3300039453 Bacteria 587
1128 Ga0436362_1218939 3300039453 Bacteria 646
1129 Ga0439439_0146717 3300041406 Bacteria 668
1130 Ga0439466_0098324 3300041411 Bacteria 914
1131 Ga0451791_0161050 3300041451 Bacteria 895
1132 Ga0451793_0993829 3300041452 Bacteria 1169
1133 Ga0451795_1275112 3300041456 Bacteria 716
1134 Ga0451807_0922472 3300041486 Bacteria 1171
1135 Ga0451855_1875439 3300041511 Bacteria 724
1136 Ga0451853_1497689 3300041512 Bacteria 880
1137 Ga0451853_2532658 3300041512 Bacteria 762
1138 Ga0439441_019729 3300042001 Bacteria 1229
1139 Ga0439442_044068 3300042002 Bacteria 940
1140 Ga0439445_0048451 3300042004 Bacteria 1143
1141 Ga0439432_195556 3300042006 Bacteria 587
1142 Ga0439450_057268 3300042008 Bacteria 936
1143 Ga0439450_169890 3300042008 Unclassified 577
1144 Ga0439452_043594 3300042010 Bacteria 1049
1145 Ga0439457_106639 3300042014 Bacteria 656
1146 Ga0439435_0180555 3300042436 Bacteria 689
1147 Ga0439460_0270366 3300042461 Bacteria 590
1148 Ga0451577_0018151 3300042876 Bacteria 6483
1149 Ga0451577_0112731 3300042876 Bacteria 2434
1150 Ga0451577_1517393 3300042876 Bacteria 592
1151 Ga0439440_0209909 3300042993 Bacteria 580
1152 Ga0453683_0555259 3300044673 Bacteria 747
1153 Ga0453683_1185856 3300044673 Bacteria 511
1154 Ga0466966_0064041 3300044684 Bacteria 2316
1155 Ga0466966_0717170 3300044684 Bacteria 603
1156 Ga0466961_0078638 3300044693 Bacteria 2089
1157 Ga0466961_0245939 3300044693 Bacteria 1099
1158 Ga0466961_0499899 3300044693 Bacteria 734
1159 Ga0466961_0696513 3300044693 Bacteria 609
1160 Ga0466963_0129768 3300044694 Bacteria 1740
1161 Ga0466963_0346764 3300044694 Bacteria 1046
1162 Ga0466963_0349140 3300044694 Bacteria 1042
1163 Ga0466963_0984772 3300044694 Bacteria 594
1164 Ga0453684_0000204 3300044712 Bacteria 258105
1165 Ga0453684_0001066 3300044712 Bacteria 87216
1166 Ga0453684_0005256 3300044712 Bacteria 25882
1167 Ga0453684_0157702 3300044712 Bacteria 2689
1168 Ga0453684_0890768 3300044712 Bacteria 954
1169 Ga0466971_0166418 3300044719 Bacteria 1033
1170 Ga0466971_0497659 3300044719 Bacteria 601
1171 Ga0466968_0184221 3300044735 Bacteria 972
1172 Ga0466968_0299516 3300044735 Bacteria 773
1173 Ga0466970_0432624 3300044765 Bacteria 753
1174 Ga0466970_0466093 3300044765 Bacteria 725
1175 Ga0466957_0059645 3300044842 Bacteria 2339
1176 Ga0466957_0082727 3300044842 Bacteria 2001
1177 Ga0466957_0496615 3300044842 Bacteria 845
1178 Ga0466960_0498635 3300044901 Bacteria 713
1179 Ga0466959_0646070 3300045049 Bacteria 710
1180 Ga0451576_0003979 3300045051 Bacteria 19673
1181 Ga0451576_0110602 3300045051 Bacteria 2859
1182 Ga0451576_0205880 3300045051 Bacteria 2054
1183 Ga0451576_0646454 3300045051 Bacteria 1111
1184 Ga0451576_0878951 3300045051 Bacteria 941
1185 Ga0451576_1158947 3300045051 Bacteria 808
1186 Ga0451576_2048742 3300045051 Bacteria 589
1187 Ga0466958_0191476 3300045836 Bacteria 1300
1188 Ga0466958_0816289 3300045836 Bacteria 608
1189 Ga0466958_0977573 3300045836 Bacteria 552
1190 Ga0466958_1153413 3300045836 Bacteria 506
1191 Ga0466967_0126564 3300045976 Bacteria 2367
1192 Ga0466967_0448230 3300045976 Bacteria 1261
1193 Ga0466967_0465705 3300045976 Bacteria 1237
1194 Ga0466967_0506163 3300045976 Bacteria 1186
1195 Ga0466967_1106467 3300045976 Bacteria 789
1196 Ga0466967_1112442 3300045976 Bacteria 787
1197 Ga0466967_2598278 3300045976 Bacteria 501
1198 Ga0495617_131390 3300046452 Bacteria 803
1199 Ga0495617_220206 3300046452 Bacteria 590
1200 Ga0495592_0016148 3300046454 Bacteria 5665
1201 Ga0495603_0175103 3300046455 Bacteria 1242
1202 Ga0495629_0099980 3300046459 Bacteria 2024
1203 Ga0495629_0120625 3300046459 Bacteria 1827
1204 Ga0495629_0216828 3300046459 Bacteria 1321
1205 Ga0495629_0442119 3300046459 Bacteria 881
1206 Ga0495638_0108205 3300046460 Bacteria 1654
1207 Ga0495638_0392608 3300046460 Bacteria 722
1208 Ga0495641_0559236 3300046461 Bacteria 522
1209 Ga0495651_0013876 3300046462 Bacteria 6233
1210 Ga0495651_0070762 3300046462 Bacteria 2654
1211 Ga0495653_0133128 3300046463 Bacteria 1757
1212 Ga0495580_0875620 3300046472 Bacteria 578
1213 Ga0495582_0409812 3300046473 Bacteria 782
1214 Ga0495639_0518269 3300046475 Bacteria 609
1215 Ga0495662_0338972 3300046476 Bacteria 739
1216 Ga0495664_0014347 3300046477 Bacteria 4490
1217 Ga0495664_0272048 3300046477 Bacteria 1024
1218 Ga0495664_0454051 3300046477 Bacteria 767
1219 Ga0495585_0180347 3300046492 Bacteria 1086
1220 Ga0495594_0085650 3300046499 Bacteria 1763
1221 Ga0495594_0127254 3300046499 Bacteria 1442
1222 Ga0495594_0751173 3300046499 Bacteria 551
1223 Ga0495583_0274926 3300046506 Bacteria 672
1224 Ga0495606_0055740 3300046507 Bacteria 2555
1225 Ga0495606_0248930 3300046507 Bacteria 987
1226 Ga0495606_0467327 3300046507 Bacteria 643
1227 Ga0495608_0005788 3300046511 Bacteria 8807
1228 Ga0495608_0312524 3300046511 Bacteria 972
1229 Ga0495618_0352959 3300046514 Bacteria 906
1230 Ga0495620_0178792 3300046515 Bacteria 821
1231 Ga0495628_0110696 3300046516 Bacteria 2112
1232 Ga0495628_0518092 3300046516 Bacteria 859
1233 Ga0495628_1168676 3300046516 Bacteria 523
1234 Ga0495630_0444399 3300046517 Bacteria 994
1235 Ga0495630_0556229 3300046517 Bacteria 880
1236 Ga0495631_0083702 3300046518 Bacteria 1375
1237 Ga0495632_0088938 3300046519 Bacteria 1467
1238 Ga0495632_0223197 3300046519 Bacteria 852
1239 Ga0495642_0031203 3300046528 Bacteria 2136
1240 Ga0495642_0111550 3300046528 Bacteria 1170
1241 Ga0495652_0104031 3300046529 Bacteria 2297
1242 Ga0495652_0361215 3300046529 Bacteria 1038
1243 Ga0495654_0052557 3300046530 Bacteria 1983
1244 Ga0495665_0328206 3300046531 Bacteria 781
1245 Ga0495640_0170914 3300046533 Bacteria 1389
1246 Ga0495640_0361145 3300046533 Bacteria 895
1247 Ga0495587_0006550 3300046536 Bacteria 7580
1248 Ga0495609_0084812 3300046538 Bacteria 1382
1249 Ga0495621_0007305 3300046539 Bacteria 3267
1250 Ga0495645_0006077 3300046543 Bacteria 8353
1251 Ga0495645_0496277 3300046543 Bacteria 764
1252 Ga0495622_0005205 3300046557 Bacteria 6029
1253 Ga0495667_0013738 3300046559 Bacteria 5471
1254 Ga0495667_0192168 3300046559 Bacteria 1308
1255 Ga0495656_0058964 3300046615 Bacteria 1668
1256 Ga0495668_0112847 3300046616 Bacteria 1487
1257 Ga0495634_0245950 3300046642 Bacteria 1096
1258 Ga0495634_0650807 3300046642 Bacteria 609
1259 Ga0495611_0118236 3300046648 Bacteria 1235
1260 Ga0495625_0674147 3300046660 Bacteria 613
1261 Ga0495635_0081895 3300046663 Bacteria 2208
1262 Ga0495635_0159637 3300046663 Bacteria 1534
1263 Ga0495635_0318696 3300046663 Bacteria 1041
1264 Ga0495635_0377371 3300046663 Bacteria 944
1265 Ga0495661_0193074 3300046665 Bacteria 1071
1266 Ga0495588_0565181 3300046674 Bacteria 596
1267 Ga0495657_0089597 3300046675 Bacteria 1976
1268 Ga0495657_0195618 3300046675 Bacteria 1234
1269 Ga0495599_0090673 3300046678 Bacteria 1907
1270 Ga0495599_0282643 3300046678 Bacteria 1005
1271 Ga0495623_0261596 3300046679 Bacteria 969
1272 Ga0495646_0013300 3300046680 Bacteria 5230
1273 Ga0495646_0476338 3300046680 Bacteria 643
1274 Ga0495647_0230568 3300046681 Bacteria 820
1275 Ga0495647_0347880 3300046681 Bacteria 674
1276 Ga0495658_0077899 3300046683 Bacteria 1939
1277 Ga0495658_0105408 3300046683 Bacteria 1689
1278 Ga0495669_0056516 3300046684 Bacteria 1769
1279 Ga0495613_0288951 3300046689 Bacteria 1137
1280 Ga0495613_0609588 3300046689 Bacteria 726
1281 Ga0495624_0254893 3300046690 Bacteria 1061
1282 Ga0495671_0322087 3300046692 Bacteria 742
1283 Ga0495671_0630277 3300046692 Bacteria 510
1284 Ga0495649_0200501 3300046694 Bacteria 1036
1285 Ga0495649_0484305 3300046694 Bacteria 616
1286 Ga0495649_0521266 3300046694 Bacteria 590
1287 Ga0495649_0648876 3300046694 Bacteria 519
1288 Ga0495589_0252897 3300046794 Bacteria 823
1289 Ga0495589_0345895 3300046794 Bacteria 685
1290 Ga0495600_0171410 3300046809 Bacteria 1401
1291 Ga0495581_0222805 3300047315 Bacteria 1103
1292 Ga0495604_0064902 3300047317 Bacteria 2781
1293 Ga0495604_0599186 3300047317 Bacteria 707
1294 Ga0495636_0145114 3300047318 Bacteria 1062
1295 Ga0495674_0022196 3300047319 Bacteria 5855
1296 Ga0495674_0152655 3300047319 Bacteria 1936
1297 Ga0495674_0317586 3300047319 Bacteria 1270
1298 Ga0495674_0484119 3300047319 Bacteria 991
1299 Ga0495674_0486149 3300047319 Bacteria 989
1300 Ga0495672_0010923 3300047320 Bacteria 6440
1301 Ga0495672_0097960 3300047320 Bacteria 1596
1302 Ga0495672_0241498 3300047320 Bacteria 882
1303 Ga0495672_0382104 3300047320 Bacteria 647
1304 Ga0495676_0701455 3300047321 Bacteria 655
1305 Ga0495676_0863456 3300047321 Bacteria 581
1306 Ga0495680_0079504 3300047322 Bacteria 2479
1307 Ga0495683_0023644 3300047323 Bacteria 3158
1308 Ga0495675_0034301 3300047444 Bacteria 3240
1309 Ga0495675_0125394 3300047444 Bacteria 1598
1310 Ga0495675_0300096 3300047444 Bacteria 954
1311 Ga0495675_0465897 3300047444 Bacteria 729
1312 Ga0495684_0122366 3300047471 Bacteria 1959
1313 Ga0495684_0228897 3300047471 Bacteria 1360
1314 Ga0495684_0393069 3300047471 Bacteria 975
1315 Ga0495684_0394642 3300047471 Bacteria 973
1316 Ga0495684_0549839 3300047471 Bacteria 786
1317 Ga0495686_0173970 3300047472 Bacteria 1251
1318 Ga0495686_0389719 3300047472 Bacteria 750
1319 Ga0495593_0711071 3300047673 Bacteria 505
1320 Ga0495602_0000485 3300048088 Bacteria 36933
1321 Ga0495602_0331316 3300048088 Bacteria 1104
1322 Ga0495602_0496778 3300048088 Bacteria 853
1323 Ga0495615_0123520 3300048090 Bacteria 751
1324 Ga0495626_0026549 3300048091 Bacteria 2822
1325 Ga0495626_0394216 3300048091 Bacteria 536
1326 Ga0496100_0028163 3300048903 Bacteria 3463
1327 Ga0496100_0531081 3300048903 Bacteria 909
1328 Ga0496101_0187660 3300048904 Bacteria 1594
1329 Ga0496101_0385578 3300048904 Bacteria 1103
1330 Ga0496102_0021900 3300048905 Bacteria 5658
1331 Ga0496102_0089827 3300048905 Bacteria 2842
1332 Ga0496103_0005971 3300048906 Bacteria 7283
1333 Ga0496104_0017664 3300048907 Bacteria 6502
1334 Ga0496104_0156871 3300048907 Bacteria 2184
1335 Ga0496104_1095783 3300048907 Bacteria 700
1336 Ga0496105_0294096 3300048908 Bacteria 1307
1337 Ga0496106_0004608 3300048909 Bacteria 10225
1338 Ga0496106_0127126 3300048909 Bacteria 1996
1339 Ga0496106_0617607 3300048909 Bacteria 868
1340 Ga0496107_0008725 3300048910 Bacteria 7023
1341 Ga0496107_0041203 3300048910 Bacteria 3316
1342 Ga0496108_0266859 3300048911 Bacteria 1490
1343 Ga0496108_0731634 3300048911 Bacteria 857
1344 Ga0496108_1099120 3300048911 Bacteria 676
1345 Ga0496109_0334424 3300048912 Bacteria 1430
1346 Ga0496110_0508118 3300048913 Bacteria 1097
1347 Ga0496110_0610112 3300048913 Bacteria 989
1348 Ga0496111_0603211 3300048914 Bacteria 804
1349 Ga0496111_0725350 3300048914 Bacteria 722
1350 Ga0496112_0415216 3300048915 Bacteria 1285
1351 Ga0496113_0642497 3300048916 Bacteria 849
1352 Ga0496113_0784735 3300048916 Bacteria 757
1353 Ga0496114_0024865 3300048917 Bacteria 4890
1354 Ga0496115_0001671 3300048918 Bacteria 15949
1355 Ga0496115_0552779 3300048918 Bacteria 920
1356 Ga0496115_1197618 3300048918 Bacteria 571
1357 Ga0496120_0132303 3300048923 Bacteria 1276
1358 Ga0496120_0283637 3300048923 Bacteria 764
1359 Ga0496121_0386560 3300048924 Bacteria 921
1360 Ga0496126_0123506 3300048929 Bacteria 2243
1361 Ga0496126_0403954 3300048929 Bacteria 1107
1362 Ga0501306_011195 3300049127 Bacteria 1141
1363 Ga0501306_011303 3300049127 Bacteria 1137
1364 Ga0501308_004474 3300049128 Bacteria 1349
1365 Ga0501308_088930 3300049128 Bacteria 500
1366 Ga0501310_022382 3300049130 Bacteria 797
1367 Ga0501304_027739 3300049160 Bacteria 590
1368 Ga0501305_012393 3300049161 Bacteria 1166
1369 Ga0501307_007377 3300049162 Bacteria 1211
1370 Ga0501307_033780 3300049162 Bacteria 720
1371 Ga0501311_017110 3300049527 Bacteria 951
1372 Ga0501311_027428 3300049527 Bacteria 808
1373 Ga0501311_051585 3300049527 Bacteria 646
1374 Ga0501312_012174 3300049528 Bacteria 1180
1375 Ga0501312_013150 3300049528 Bacteria 1148
1376 Ga0501312_046864 3300049528 Bacteria 720
1377 Ga0501313_013109 3300049529 Bacteria 971
1378 Ga0501313_051720 3300049529 Bacteria 569
1379 Ga0501315_002668 3300049531 Bacteria 1707
1380 Ga0501315_079589 3300049531 Bacteria 555
1381 Ga0501316_003868 3300049532 Bacteria 1479
1382 Ga0501317_001666 3300049533 Bacteria 1965
1383 Ga0501317_009684 3300049533 Bacteria 1137
1384 Ga0501317_015990 3300049533 Bacteria 968
1385 Ga0501317_023822 3300049533 Bacteria 847
1386 Ga0501317_029983 3300049533 Bacteria 785
1387 Ga0501318_002881 3300049534 Bacteria 1531
1388 Ga0501318_003003 3300049534 Bacteria 1513
1389 Ga0501318_005635 3300049534 Bacteria 1250
1390 Ga0501318_016453 3300049534 Bacteria 894
1391 Ga0501318_024801 3300049534 Bacteria 783
1392 Ga0501318_045469 3300049534 Bacteria 639
1393 Ga0501318_073419 3300049534 Bacteria 544
1394 Ga0501320_055674 3300049536 Bacteria 547
1395 Ga0501321_006571 3300049537 Bacteria 1186
1396 Ga0501324_002934 3300049540 Bacteria 1276
1397 Ga0501324_025654 3300049540 Bacteria 623
1398 Ga0501031_0131538 3300049568 Bacteria 1635
1399 Ga0501031_0304347 3300049568 Bacteria 1033
1400 Ga0501031_0318414 3300049568 Bacteria 1008
1401 Ga0501032_0019862 3300049569 Bacteria 4691
1402 Ga0501032_0076360 3300049569 Bacteria 2231
1403 Ga0501032_0104516 3300049569 Bacteria 1876
1404 Ga0501032_0893540 3300049569 Bacteria 559
1405 Ga0501033_0005260 3300049570 Bacteria 10269
1406 Ga0501033_0012240 3300049570 Bacteria 6548
1407 Ga0501033_0020706 3300049570 Bacteria 4970
1408 Ga0501033_0106944 3300049570 Bacteria 2038
1409 Ga0501033_0206968 3300049570 Bacteria 1400
1410 Ga0501033_0975686 3300049570 Bacteria 567
1411 Ga0501034_0000208 3300049571 Bacteria 111739
1412 Ga0501034_0009460 3300049571 Bacteria 10201
1413 Ga0501034_0056638 3300049571 Bacteria 3943
1414 Ga0501034_0171459 3300049571 Bacteria 2137
1415 Ga0501034_0188771 3300049571 Bacteria 2024
1416 Ga0501034_0198693 3300049571 Bacteria 1964
1417 Ga0501034_0331645 3300049571 Bacteria 1453
1418 Ga0501034_0347968 3300049571 Bacteria 1411
1419 Ga0501034_0479868 3300049571 Bacteria 1159
1420 Ga0501034_0493116 3300049571 Bacteria 1139
1421 Ga0501034_0640364 3300049571 Bacteria 965
1422 Ga0501034_0876666 3300049571 Bacteria 786
1423 Ga0501034_0948957 3300049571 Bacteria 746
1424 Ga0501036_0050702 3300049572 Bacteria 3515
1425 Ga0501036_0075956 3300049572 Bacteria 2842
1426 Ga0501036_0249878 3300049572 Bacteria 1486
1427 Ga0501036_0308062 3300049572 Bacteria 1324
1428 Ga0501036_0380494 3300049572 Bacteria 1178
1429 Ga0501036_0415122 3300049572 Bacteria 1122
1430 Ga0501036_0565163 3300049572 Bacteria 945
1431 Ga0501036_0629985 3300049572 Bacteria 888
1432 Ga0501036_0741396 3300049572 Bacteria 811
1433 Ga0501036_1169245 3300049572 Bacteria 627
1434 Ga0501037_0007990 3300049573 Bacteria 7753
1435 Ga0501037_0013050 3300049573 Bacteria 6127
1436 Ga0501037_0098875 3300049573 Bacteria 2107
1437 Ga0501037_0108796 3300049573 Bacteria 1997
1438 Ga0501037_0123771 3300049573 Bacteria 1858
1439 Ga0501037_0259993 3300049573 Bacteria 1213
1440 Ga0501037_0502501 3300049573 Bacteria 822
1441 Ga0501037_0958892 3300049573 Bacteria 558
1442 Ga0501038_0009962 3300049574 Bacteria 8704
1443 Ga0501038_0096205 3300049574 Bacteria 2472
1444 Ga0501038_0408010 3300049574 Bacteria 1050
1445 Ga0501038_0933239 3300049574 Bacteria 639
1446 Ga0501038_1381271 3300049574 Bacteria 506
1447 Ga0501039_0000072 3300049575 Bacteria 76673
1448 Ga0501039_0098169 3300049575 Bacteria 2285
1449 Ga0501039_0133948 3300049575 Bacteria 1945
1450 Ga0501039_0309306 3300049575 Unclassified 1242
1451 Ga0501039_0582557 3300049575 Bacteria 877
1452 Ga0501039_0759757 3300049575 Bacteria 757
1453 Ga0501039_1006196 3300049575 Bacteria 647
1454 Ga0501040_0065678 3300049576 Bacteria 2499
1455 Ga0501041_0383436 3300049577 Bacteria 889
1456 Ga0501042_0135548 3300049578 Bacteria 1775
1457 Ga0501042_1363722 3300049578 Bacteria 517
1458 Ga0501043_0014584 3300049579 Bacteria 6152
1459 Ga0501043_0045694 3300049579 Bacteria 3444
1460 Ga0501043_0147562 3300049579 Bacteria 1841
1461 Ga0501043_0179217 3300049579 Bacteria 1651
1462 Ga0501043_0372880 3300049579 Bacteria 1081
1463 Ga0501043_0611113 3300049579 Bacteria 804
1464 Ga0501043_0983070 3300049579 Bacteria 601
1465 Ga0501046_0004977 3300049580 Bacteria 11926
1466 Ga0501046_0011762 3300049580 Bacteria 7472
1467 Ga0501046_0083492 3300049580 Bacteria 2466
1468 Ga0501046_0099104 3300049580 Bacteria 2237
1469 Ga0501046_0239452 3300049580 Bacteria 1338
1470 Ga0501046_0432622 3300049580 Bacteria 948
1471 Ga0501047_0001212 3300049581 Bacteria 25586
1472 Ga0501047_0002319 3300049581 Bacteria 18206
1473 Ga0501047_0042378 3300049581 Bacteria 4399
1474 Ga0501047_0059259 3300049581 Bacteria 3696
1475 Ga0501047_0138742 3300049581 Bacteria 2310
1476 Ga0501047_0154693 3300049581 Bacteria 2167
1477 Ga0501047_0154945 3300049581 Bacteria 2165
1478 Ga0501047_0180149 3300049581 Bacteria 1980
1479 Ga0501047_0267505 3300049581 Bacteria 1556
1480 Ga0501047_0285627 3300049581 Bacteria 1494
1481 Ga0501047_0415754 3300049581 Bacteria 1176
1482 Ga0501047_0757844 3300049581 Bacteria 786
1483 Ga0501048_0051367 3300049582 Bacteria 2935
1484 Ga0501048_0088154 3300049582 Bacteria 2189
1485 Ga0501048_0101952 3300049582 Bacteria 2025
1486 Ga0501048_0155341 3300049582 Bacteria 1618
1487 Ga0501048_0239734 3300049582 Unclassified 1287
1488 Ga0501048_0556179 3300049582 Bacteria 823
1489 Ga0501048_0627839 3300049582 Bacteria 771
1490 Ga0501067_0001590 3300049583 Bacteria 12434
1491 Ga0501067_0108900 3300049583 Bacteria 1540
1492 Ga0501067_0162644 3300049583 Bacteria 1243
1493 Ga0501067_0179124 3300049583 Bacteria 1181
1494 Ga0501068_0036227 3300049584 Bacteria 2949
1495 Ga0501068_0243618 3300049584 Bacteria 1145
1496 Ga0501068_0337764 3300049584 Bacteria 967
1497 Ga0501068_0435800 3300049584 Bacteria 847
1498 Ga0501068_0803807 3300049584 Bacteria 617
1499 Ga0501068_0905982 3300049584 Bacteria 580
1500 Ga0501068_0923954 3300049584 Bacteria 574
1501 Ga0501069_0058742 3300049585 Bacteria 2146
1502 Ga0501069_0079151 3300049585 Bacteria 1849
1503 Ga0501069_0459450 3300049585 Bacteria 757
1504 Ga0501069_0640660 3300049585 Bacteria 639
1505 Ga0501070_0068712 3300049586 Bacteria 2933
1506 Ga0501070_0199363 3300049586 Bacteria 1644
1507 Ga0501070_0348364 3300049586 Bacteria 1202
1508 Ga0501070_0517666 3300049586 Bacteria 957
1509 Ga0501070_0859167 3300049586 Bacteria 709
1510 Ga0501071_0057831 3300049587 Bacteria 2803
1511 Ga0501071_0252161 3300049587 Bacteria 1332
1512 Ga0501071_0296191 3300049587 Bacteria 1226
1513 Ga0501071_0303954 3300049587 Bacteria 1209
1514 Ga0501071_0577330 3300049587 Bacteria 864
1515 Ga0501071_0651782 3300049587 Bacteria 810
1516 Ga0501071_0817517 3300049587 Bacteria 719
1517 Ga0501071_1128412 3300049587 Bacteria 606
1518 Ga0501072_0052932 3300049588 Bacteria 3196
1519 Ga0501072_0131259 3300049588 Bacteria 1997
1520 Ga0501072_0770225 3300049588 Bacteria 754
1521 Ga0501072_0846029 3300049588 Bacteria 715
1522 Ga0501073_0021555 3300049589 Bacteria 4644
1523 Ga0501073_0025762 3300049589 Bacteria 4214
1524 Ga0501073_0061078 3300049589 Bacteria 2630
1525 Ga0501073_0168051 3300049589 Bacteria 1518
1526 Ga0501073_0229610 3300049589 Bacteria 1282
1527 Ga0501073_0313950 3300049589 Bacteria 1081
1528 Ga0501073_0432746 3300049589 Bacteria 909
1529 Ga0501073_0489000 3300049589 Bacteria 851
1530 Ga0501073_0529454 3300049589 Bacteria 814
1531 Ga0501073_0918746 3300049589 Bacteria 602
1532 Ga0501073_1204701 3300049589 Bacteria 520
1533 Ga0501074_0079197 3300049590 Bacteria 2358
1534 Ga0501074_0565600 3300049590 Bacteria 805
1535 Ga0501075_0063131 3300049591 Bacteria 2793
1536 Ga0501075_0173674 3300049591 Bacteria 1645
1537 Ga0501076_0013544 3300049592 Bacteria 6114
1538 Ga0501076_0247028 3300049592 Bacteria 1460
1539 Ga0501077_0165265 3300049593 Bacteria 1406
1540 Ga0501077_0196471 3300049593 Bacteria 1281
1541 Ga0501077_0389959 3300049593 Bacteria 890
1542 Ga0501077_0978032 3300049593 Bacteria 545
1543 Ga0501079_0108926 3300049741 Bacteria 2151
1544 Ga0501079_0721469 3300049741 Bacteria 785
1545 Ga0501080_0000005 3300049742 Bacteria 176271
1546 Ga0501080_0071546 3300049742 Bacteria 3226
1547 Ga0501080_0098262 3300049742 Bacteria 2717
1548 Ga0501080_0113812 3300049742 Bacteria 2508
1549 Ga0501080_0170095 3300049742 Bacteria 2010
1550 Ga0501080_0313821 3300049742 Bacteria 1421
1551 Ga0501080_0329025 3300049742 Bacteria 1382
1552 Ga0501080_0332884 3300049742 Bacteria 1373
1553 Ga0501080_0799651 3300049742 Bacteria 827
1554 Ga0501080_0870879 3300049742 Bacteria 786
1555 Ga0501080_1120692 3300049742 Bacteria 679
1556 Ga0501080_1134541 3300049742 Bacteria 674
1557 Ga0501080_1221465 3300049742 Bacteria 646
1558 Ga0501080_1305695 3300049742 Bacteria 621
1559 Ga0501080_1457080 3300049742 Bacteria 583
1560 Ga0501080_1787282 3300049742 Bacteria 517
1561 Ga0501081_0009109 3300049743 Bacteria 6458
1562 Ga0501081_0018650 3300049743 Bacteria 4611
1563 Ga0501081_0771951 3300049743 Bacteria 723
1564 Ga0501083_0082701 3300049744 Bacteria 2127
1565 Ga0501083_0109534 3300049744 Bacteria 1816
1566 Ga0501083_0154246 3300049744 Bacteria 1504
1567 Ga0501083_0190488 3300049744 Bacteria 1338
1568 Ga0501083_0232547 3300049744 Bacteria 1200
1569 Ga0501035_0000049 3300049822 Bacteria 145684
1570 Ga0501035_0048543 3300049822 Bacteria 3807
1571 Ga0501035_0084852 3300049822 Bacteria 2793
1572 Ga0501035_0438103 3300049822 Bacteria 1083
1573 Ga0501035_0510636 3300049822 Bacteria 988
1574 Ga0501035_0555601 3300049822 Bacteria 940
1575 Ga0501035_0622580 3300049822 Bacteria 877
1576 Ga0501035_0754471 3300049822 Bacteria 781
1577 Ga0501035_0880720 3300049822 Bacteria 710
1578 Ga0501035_0896113 3300049822 Bacteria 703
1579 Ga0501044_0000030 3300049823 Bacteria 173442
1580 Ga0501044_0015755 3300049823 Bacteria 8141
1581 Ga0501044_0032628 3300049823 Bacteria 5473
1582 Ga0501044_0044540 3300049823 Bacteria 4604
1583 Ga0501044_0050289 3300049823 Bacteria 4302
1584 Ga0501044_0081352 3300049823 Bacteria 3279
1585 Ga0501044_0099821 3300049823 Bacteria 2921
1586 Ga0501044_0112831 3300049823 Bacteria 2725
1587 Ga0501044_0150030 3300049823 Bacteria 2314
1588 Ga0501044_0337074 3300049823 Bacteria 1429
1589 Ga0501044_0381983 3300049823 Bacteria 1323
1590 Ga0501044_0411454 3300049823 Bacteria 1263
1591 Ga0501044_0531262 3300049823 Bacteria 1075
1592 Ga0501044_0584065 3300049823 Bacteria 1011
1593 Ga0501044_1291788 3300049823 Bacteria 596
1594 Ga0501045_0037773 3300049824 Bacteria 3511
1595 Ga0501045_0038945 3300049824 Bacteria 3459
1596 Ga0501045_0216057 3300049824 Bacteria 1428
1597 Ga0501045_0373205 3300049824 Bacteria 1062
1598 nmdc:mga03683_214353_c1 3300050489 Bacteria 887
1599 nmdc:mga03683_436293_c1 3300050489 Bacteria 629
1600 nmdc:mga03683_81488_c1 3300050489 Bacteria 1398
1601 nmdc:mga03683_94213_c1 3300050489 Bacteria 1309
1602 nmdc:mga03n38_522045_c1 3300050490 Bacteria 669
1603 nmdc:mga03n38_593050_c1 3300050490 Bacteria 630
1604 nmdc:mga00v17_250152_c1 3300050491 Bacteria 1149
1605 nmdc:mga00v17_720986_c1 3300050491 Bacteria 638
1606 nmdc:mga0yw44_553277_c1 3300050492 Bacteria 781
1607 nmdc:mga0yw44_752128_c1 3300050492 Bacteria 662
1608 nmdc:mga0k408_14041_c1 3300050493 Bacteria 4404
1609 nmdc:mga0k408_148475_c1 3300050493 Bacteria 1396
1610 nmdc:mga0k408_240476_c1 3300050493 Bacteria 1081
1611 nmdc:mga0k408_408156_c1 3300050493 Bacteria 808
1612 nmdc:mga0k408_775120_c1 3300050493 Bacteria 560
1613 nmdc:mga06z11_395022_c1 3300050494 Bacteria 832
1614 nmdc:mga06z11_631274_c1 3300050494 Bacteria 652
1615 nmdc:mga04h51_531736_c1 3300050495 Bacteria 505
1616 nmdc:mga07m45_247664_c1 3300050496 Bacteria 1037
1617 nmdc:mga05p37_1877201_c1 3300050507 Bacteria 574
1618 nmdc:mga05p37_208661_c1 3300050507 Bacteria 2362
1619 nmdc:mga05p37_703200_c1 3300050507 Bacteria 1122
1620 nmdc:mga09592_1445486_c1 3300050508 Bacteria 561
1621 nmdc:mga09592_274466_c1 3300050508 Bacteria 1462
1622 nmdc:mga06r32_1721329_c1 3300050510 Bacteria 564
1623 nmdc:mga08y16_1093548_c1 3300050511 Bacteria 773
1624 nmdc:mga08y16_205_c1 3300050511 Bacteria 53058
1625 nmdc:mga08y16_3117_c1 3300050511 Bacteria 17166
1626 nmdc:mga0n895_287400_c1 3300050512 Bacteria 1667
1627 nmdc:mga0n895_445621_c1 3300050512 Bacteria 1307
1628 nmdc:mga0n895_455742_c1 3300050512 Bacteria 1291
1629 nmdc:mga0n895_611333_c1 3300050512 Bacteria 1091
1630 nmdc:mga0rr50_1624502_c1 3300050513 Bacteria 545
1631 nmdc:mga08x19_309104_c1 3300050514 Bacteria 1099
1632 nmdc:mga08x19_437170_c1 3300050514 Bacteria 920
1633 nmdc:mga08x19_541883_c1 3300050514 Bacteria 823
1634 nmdc:mga08x19_691923_c1 3300050514 Bacteria 723
1635 nmdc:mga0a205_206624_c1 3300050515 Bacteria 1555
1636 nmdc:mga0a205_399680_c1 3300050515 Bacteria 1238
1637 nmdc:mga0a205_858010_c1 3300050515 Bacteria 755
1638 nmdc:mga0sz30_5573_c1 3300050516 Bacteria 4138
1639 Ga0495601_0057176 3300053077 Bacteria 2471
1640 Ga0495601_0613037 3300053077 Bacteria 698
1641 Ga0495601_0833131 3300053077 Bacteria 585
1642 Ga0495601_0977994 3300053077 Bacteria 533
1643 Ga0495612_0001954 3300053078 Bacteria 8488
1644 Ga0500635_0079760 3300053080 Bacteria 1174
1645 Ga0500635_0089208 3300053080 Bacteria 1119
1646 Ga0495619_0075345 3300053085 Bacteria 2264
1647 Ga0500578_0149619 3300053086 Bacteria 1455
1648 Ga0500643_022828 3300053087 Bacteria 2008
1649 Ga0500643_132082 3300053087 Bacteria 671
1650 Ga0500643_135613 3300053087 Bacteria 662
1651 Ga0500644_0009620 3300053088 Bacteria 2592
1652 Ga0500644_0034020 3300053088 Bacteria 1641
1653 Ga0500644_0168401 3300053088 Bacteria 890
1654 Ga0500644_0336959 3300053088 Bacteria 651
1655 Ga0500646_0036995 3300053090 Bacteria 1362
1656 Ga0500646_0042165 3300053090 Bacteria 1288
1657 Ga0500646_0351149 3300053090 Bacteria 537
1658 Ga0500651_0353068 3300053093 Bacteria 834
1659 Ga0500641_0000684 3300053096 Bacteria 12231
1660 Ga0500650_0068634 3300053098 Bacteria 1657
1661 Ga0500650_0080533 3300053098 Bacteria 1523
1662 Ga0500654_077292 3300053099 Bacteria 1578
1663 Ga0500555_041782 3300053103 Bacteria 1275
1664 Ga0500556_0288197 3300053104 Bacteria 643
1665 Ga0500557_157332 3300053105 Bacteria 746
1666 Ga0500592_053054 3300053116 Bacteria 660
1667 Ga0500594_0019853 3300053118 Bacteria 1669
1668 Ga0500595_001661 3300053119 Bacteria 11694
1669 Ga0500595_089684 3300053119 Bacteria 891
1670 Ga0500595_101232 3300053119 Bacteria 825
1671 Ga0500597_212073 3300053120 Bacteria 809
1672 Ga0500621_124217 3300053126 Bacteria 996
1673 Ga0500642_0001424 3300053130 Bacteria 6858
1674 Ga0500642_0230453 3300053130 Bacteria 856
1675 Ga0500658_0046521 3300053134 Bacteria 1757
1676 Ga0500559_0164356 3300053136 Bacteria 1043
1677 Ga0500559_0370957 3300053136 Bacteria 668
1678 Ga0500568_0029142 3300053139 Bacteria 2293
1679 Ga0500577_0059353 3300053142 Bacteria 1466
1680 Ga0500577_0216954 3300053142 Bacteria 828
1681 Ga0500588_0003321 3300053146 Bacteria 3381
1682 Ga0500588_0133973 3300053146 Bacteria 884
1683 Ga0500588_0202995 3300053146 Bacteria 735
1684 Ga0500604_0016509 3300053151 Bacteria 2034
1685 Ga0500604_0033041 3300053151 Bacteria 1528
1686 Ga0500616_0002871 3300053153 Bacteria 13824
1687 Ga0500619_222275 3300053154 Bacteria 629
1688 Ga0500622_0047353 3300053156 Bacteria 2221
1689 Ga0500622_0129144 3300053156 Bacteria 1217
1690 Ga0500633_0148704 3300053160 Bacteria 878
1691 Ga0500636_0445628 3300053177 Bacteria 587
1692 Ga0500609_001079 3300053731 Bacteria 4070
1693 Ga0500609_002556 3300053731 Bacteria 2592
1694 Ga0500656_006057 3300053732 Bacteria 1215
1695 Ga0500587_026309 3300053739 Bacteria 780
1696 Ga0501084_0062068 3300054114 Bacteria 3129
1697 Ga0501084_0066631 3300054114 Bacteria 3013
1698 Ga0501084_0208090 3300054114 Bacteria 1650
1699 Ga0501084_0230662 3300054114 Bacteria 1563
1700 Ga0501084_0464415 3300054114 Bacteria 1070
1701 Ga0501084_0804493 3300054114 Bacteria 792
1702 Ga0501084_1121746 3300054114 Bacteria 660
1703 Ga0501084_1130221 3300054114 Bacteria 657
1704 Ga0501084_1360722 3300054114 Bacteria 595
1705 Ga0590071_006547 3300059421 Bacteria 2769
1706 Ga0590074_078193 3300059423 Bacteria 629
1707 Ga0590075_010263 3300059424 Bacteria 2253
1708 Ga0590077_016365 3300059426 Bacteria 1555
1709 Ga0587084_059576 3300059477 Bacteria 697
1710 Ga0587070_072652 3300059491 Bacteria 737
1711 Ga0587073_0087772 3300059492 Bacteria 785
1712 Ga0587080_052290 3300059503 Bacteria 775
1713 Ga0587082_008975 3300059504 Bacteria 1408
1714 Ga0587083_0072825 3300059505 Bacteria 801
1715 Ga0587098_052953 3300059604 Bacteria 620
1716 Ga0587076_084925 3300059645 Bacteria 682
1717 Ga0587079_127439 3300059647 Bacteria 636
1718 Ga0587114_026899 3300059655 Bacteria 854
1719 Ga0587096_07987 3300060247 Bacteria 503
1720 Ga0587111_0001675 3300060346 Bacteria 2755
1721 Ga0587111_0074243 3300060346 Bacteria 800
1722 Ga0501082_0016308 3300060353 Bacteria 6395
1723 Ga0501082_0021073 3300060353 Bacteria 5621
1724 Ga0501082_0069701 3300060353 Bacteria 3028
1725 Ga0501082_0091200 3300060353 Bacteria 2631
1726 Ga0501082_0119945 3300060353 Bacteria 2279
1727 Ga0501082_0120716 3300060353 Bacteria 2272
1728 Ga0501082_0208204 3300060353 Bacteria 1701
1729 Ga0501082_0214341 3300060353 Bacteria 1675
1730 Ga0501082_0356957 3300060353 Bacteria 1275
1731 Ga0501082_0522514 3300060353 Bacteria 1038
1732 Ga0501082_1161788 3300060353 Bacteria 675
1733 Ga0466962_0043530 3300061719 Bacteria 2148
1734 Ga0530510_0015198 3300061734 Bacteria 5436
1735 Ga0530510_0480852 3300061734 Bacteria 941
1736 Ga0530510_1071595 3300061734 Unclassified 617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0155823 Ga0436360_0155823_2312_2599 90
2 3300039453 Ga0436362_1063337 Ga0436362_1063337_29_316 90
3 3300049823 Ga0501044_1291788 Ga0501044_1291788_16_303 90
4 3300049528 Ga0501312_046864 Ga0501312_046864_176_466 91
5 3300048929 Ga0496126_0403954 Ga0496126_0403954_763_1056 92
6 iso_pu_bacteria 2507262055 2507509769 92
7 iso_pu_bacteria 2508501009 2508543785 92
8 iso_pu_bacteria 2508501042 2508698427 92
9 iso_pu_bacteria 2508501122 2509112685 92
10 iso_pu_bacteria 2509276019 2509380425 92
11 iso_pu_bacteria 2510065057 2510308399 92
12 iso_pu_bacteria 2511231028 2511396969 92
13 iso_pu_bacteria 2511231052 2511501270 92
14 iso_pu_bacteria 2512875026 2512971976 92
15 iso_pu_bacteria 2513237086 2513587132 92
16 iso_pu_bacteria 2513237089 2513607079 92
17 iso_pu_bacteria 2513237091 2513620839 92
18 iso_pu_bacteria 2513237092 2513625281 92
19 iso_pu_bacteria 2513237094 2513644598 92
20 iso_pu_bacteria 2513237095 2513646165 92
21 iso_pu_bacteria 2513237096 2513658401 92
22 iso_pu_bacteria 2513237101 2513695928 92
23 iso_pu_bacteria 2513237102 2513701044 92
24 iso_pu_bacteria 2513237104 2513715007 92
25 iso_pu_bacteria 2513237137 2513857523 92
26 iso_pu_bacteria 2513237139 2513875847 92
27 iso_pu_bacteria 2513237140 2513886842 92
28 iso_pu_bacteria 2513237141 2513894240 92
29 iso_pu_bacteria 2513237143 2513906983 92
30 iso_pu_bacteria 2513237145 2513920107 92
31 iso_pu_bacteria 2513237156 2513987840 92
32 iso_pu_bacteria 2513237160 2514008881 92
33 iso_pu_bacteria 2513237161 2514011486 92
34 iso_pu_bacteria 2515154107 2515613330 92
35 iso_pu_bacteria 2515154112 2515630019 92
36 iso_pu_bacteria 2516143018 2516209148 92
37 iso_pu_bacteria 2516653046 2516892552 92
38 iso_pu_bacteria 2517093001 2517103531 92
39 iso_pu_bacteria 2517487022 2517569364 92
40 iso_pu_bacteria 2517572143 2517893476 92
41 iso_pu_bacteria 2524023205 2524441040 92
42 iso_pu_bacteria 2524023207 2524454327 92
43 iso_pu_bacteria 2524023250 2524609946 92
44 iso_pu_bacteria 2528768022 2528856452 92
45 iso_pu_bacteria 2551306084 2551678256 92
46 iso_pu_bacteria 2551306085 2551687647 92
47 iso_pu_bacteria 2551306086 2551695271 92
48 iso_pu_bacteria 2551306087 2551699383 92
49 iso_pu_bacteria 2551306089 2551711311 92
50 iso_pu_bacteria 2551306090 2551723058 92
51 iso_pu_bacteria 2551306091 2551728466 92
52 iso_pu_bacteria 2551306091 2551730897 92
53 iso_pu_bacteria 2551306092 2551733993 92
54 iso_pu_bacteria 2551306093 2551742265 92
55 iso_pu_bacteria 2558860100 2558863229 92
56 iso_pu_bacteria 2558860983 2561468204 92
57 iso_pu_bacteria 2602042107 2603859858 92
58 iso_pu_bacteria 2617270735 2617349293 92
59 iso_pu_bacteria 2617270741 2617378184 92
60 iso_pu_bacteria 2643221547 2643755792 92
61 iso_pu_bacteria 2657244999 2657686415 92
62 iso_pu_bacteria 2667528175 2671118114 92
63 iso_pu_bacteria 2690316117 2692316535 92
64 iso_pu_bacteria 2713897090 2715499428 92
65 iso_pu_bacteria 2744054633 2745082437 92
66 iso_pu_bacteria 2751185821 2753460136 92
67 iso_pu_bacteria 2791355082 2792581299 92
68 iso_pu_bacteria 2791355091 2792624835 92
69 iso_pu_bacteria 2791355092 2792630869 92
70 iso_pu_bacteria 2791355094 2792642399 92
71 iso_pu_bacteria 2791355196 2793060257 92
72 iso_pu_bacteria 2802428858 2802719377 92
73 iso_pu_bacteria 2802428859 2802723062 92
74 iso_pu_bacteria 2802428860 2802734753 92
75 iso_pu_bacteria 2802428861 2802741299 92
76 iso_pu_bacteria 2802428862 2802745048 92
77 iso_pu_bacteria 2802428863 2802751483 92
78 iso_pu_bacteria 2802429268 2804751745 92
79 iso_pu_bacteria 2802429603 2805917623 92
80 iso_pu_bacteria 2816332527 2818241496 92
81 iso_pu_bacteria 2824600985 2824602126 92
82 iso_pu_bacteria 2824609381 2824610114 92
83 iso_pu_bacteria 2824617872 2824620078 92
84 iso_pu_bacteria 2824626560 2824627711 92
85 iso_pu_bacteria 2824635225 2824636720 92
86 iso_pu_bacteria 2824644064 2824645013 92
87 iso_pu_bacteria 2824653114 2824654970 92
88 iso_pu_bacteria 2824661429 2824662368 92
89 iso_pu_bacteria 2824671348 2824672617 92
90 iso_pu_bacteria 2824679649 2824680833 92
91 iso_pu_bacteria 2824687955 2824689050 92
92 iso_pu_bacteria 2824696289 2824697417 92
93 iso_pu_bacteria 2824704595 2824706685 92
94 iso_pu_bacteria 2824714736 2824715425 92
95 iso_pu_bacteria 2824723954 2824724720 92
96 iso_pu_bacteria 2824732956 2824733548 92
97 iso_pu_bacteria 2824746037 2824746923 92
98 iso_pu_bacteria 2824753945 2824759427 92
99 iso_pu_bacteria 2824763712 2824769663 92
100 iso_pu_bacteria 2824773399 2824774026 92
101 iso_pu_bacteria 2834578030 2834579300 92
102 iso_pu_bacteria 2838074704 2838079219 92
103 iso_pu_bacteria 2838122688 2838130075 92
104 iso_pu_bacteria 2841941048 2841941232 92
105 iso_pu_bacteria 2841949485 2841952741 92
106 iso_pu_bacteria 2841957949 2841962254 92
107 iso_pu_bacteria 2841966195 2841967387 92
108 iso_pu_bacteria 2841974524 2841979215 92
109 iso_pu_bacteria 2841983080 2841990791 92
110 iso_pu_bacteria 2842038055 2842038631 92
111 iso_pu_bacteria 2842045827 2842048424 92
112 iso_pu_bacteria 2842775625 2842778826 92
113 iso_pu_bacteria 2844315083 2844318029 92
114 iso_pu_bacteria 2847417321 2847418399 92
115 iso_pu_bacteria 2847930680 2847934840 92
116 iso_pu_bacteria 2847939898 2847945405 92
117 iso_pu_bacteria 2848992105 2848993378 92
118 iso_pu_bacteria 2849076700 2849080407 92
119 iso_pu_bacteria 2850079185 2850081036 92
120 iso_pu_bacteria 2855825444 2855831622 92
121 iso_pu_bacteria 2855839649 2855840740 92
122 iso_pu_bacteria 2855872281 2855873436 92
123 iso_pu_bacteria 2857509624 2857510240 92
124 iso_pu_bacteria 2857524615 2857528506 92
125 iso_pu_bacteria 2858800743 2858801267 92
126 iso_pu_bacteria 2874590934 2874595122 92
127 iso_pu_bacteria 2874604998 2874610930 92
128 iso_pu_bacteria 2874612657 2874615645 92
129 iso_pu_bacteria 2874620515 2874621668 92
130 iso_pu_bacteria 2874645413 2874650983 92
131 iso_pu_bacteria 2876761206 2876765737 92
132 iso_pu_bacteria 2876771140 2876775058 92
133 iso_pu_bacteria 2876808645 2876810444 92
134 iso_pu_bacteria 2876818435 2876823873 92
135 iso_pu_bacteria 2879074833 2879080501 92
136 iso_pu_bacteria 2879083081 2879089287 92
137 iso_pu_bacteria 2879099564 2879109349 92
138 iso_pu_bacteria 2879110137 2879110543 92
139 iso_pu_bacteria 2879127579 2879134893 92
140 iso_pu_bacteria 2879142872 2879149204 92
141 iso_pu_bacteria 2881364244 2881366234 92
142 iso_pu_bacteria 2881665667 2881671575 92
143 iso_pu_bacteria 2883291878 2883294824 92
144 iso_pu_bacteria 2883354860 2883356690 92
145 iso_pu_bacteria 2883577096 2883581689 92
146 iso_pu_bacteria 2885366525 2885372827 92
147 iso_pu_bacteria 2885374607 2885380937 92
148 iso_pu_bacteria 2885409591 2885413050 92
149 iso_pu_bacteria 2888378607 2888382826 92
150 iso_pu_bacteria 2888388044 2888394974 92
151 iso_pu_bacteria 2888419890 2888423305 92
152 iso_pu_bacteria 2896384573 2896386890 92
153 iso_pu_bacteria 2898795034 2898796980 92
154 iso_pu_bacteria 2899275550 2899277167 92
155 iso_pu_bacteria 2903727486 2903729662 92
156 iso_pu_bacteria 2904666416 2904668615 92
157 iso_pu_bacteria 2904690495 2904696904 92
158 iso_pu_bacteria 2904711408 2904716663 92
159 iso_pu_bacteria 2906602504 2906605810 92
160 iso_pu_bacteria 2906635258 2906642776 92
161 iso_pu_bacteria 2906643746 2906644207 92
162 iso_pu_bacteria 2906660503 2906665911 92
163 iso_pu_bacteria 2908739725 2908743882 92
164 iso_pu_bacteria 2908756301 2908761480 92
165 iso_pu_bacteria 2908775508 2908778948 92
166 iso_pu_bacteria 2909399089 2909399547 92
167 iso_pu_bacteria 2913295892 2913301779 92
168 iso_pu_bacteria 2915980308 2915985670 92
169 iso_pu_bacteria 2915986958 2915991799 92
170 iso_pu_bacteria 2915993759 2916000602 92
171 iso_pu_bacteria 2916000859 2916007566 92
172 iso_pu_bacteria 2916007675 2916008884 92
173 iso_pu_bacteria 2916014648 2916018777 92
174 iso_pu_bacteria 2916021584 2916026385 92
175 iso_pu_bacteria 2916028427 2916034648 92
176 iso_pu_bacteria 2916035215 2916040629 92
177 iso_pu_bacteria 2916041962 2916048203 92
178 iso_pu_bacteria 2916048683 2916054392 92
179 iso_pu_bacteria 2916055098 2916060801 92
180 iso_pu_bacteria 2916061851 2916068165 92
181 iso_pu_bacteria 2916068649 2916075019 92
182 iso_pu_bacteria 2916076590 2916078671 92
183 iso_pu_bacteria 2919073203 2919076129 92
184 iso_pu_bacteria 2919679072 2919682198 92
185 iso_pu_bacteria 2920760137 2920765477 92
186 iso_pu_bacteria 2921201388 2921208180 92
187 iso_pu_bacteria 2921208531 2921209427 92
188 iso_pu_bacteria 2921237296 2921242269 92
189 iso_pu_bacteria 2921244191 2921248070 92
190 iso_pu_bacteria 2921250672 2921256120 92
191 iso_pu_bacteria 2921257292 2921263456 92
192 iso_pu_bacteria 2921263974 2921270093 92
193 iso_pu_bacteria 2921282425 2921285911 92
194 iso_pu_bacteria 2921289301 2921296760 92
195 iso_pu_bacteria 2921296804 2921299129 92
196 iso_pu_bacteria 2922368715 2922375214 92
197 iso_pu_bacteria 2922393267 2922395234 92
198 iso_pu_bacteria 2924144063 2924147665 92
199 iso_pu_bacteria 2924150972 2924157722 92
200 iso_pu_bacteria 2924158325 2924165047 92
201 iso_pu_bacteria 2924165586 2924172867 92
202 iso_pu_bacteria 2924172951 2924179192 92
203 iso_pu_bacteria 2924179722 2924184587 92
204 iso_pu_bacteria 2924186466 2924192971 92
205 iso_pu_bacteria 2924193448 2924199581 92
206 iso_pu_bacteria 2924200457 2924204257 92
207 iso_pu_bacteria 2924207177 2924213331 92
208 iso_pu_bacteria 2924214083 2924214803 92
209 iso_pu_bacteria 2924221636 2924221988 92
210 iso_pu_bacteria 2924228884 2924233680 92
211 iso_pu_bacteria 2929615660 2929615902 92
212 iso_pu_bacteria 2929624759 2929630515 92
213 iso_pu_bacteria 2932784394 2932792460 92
214 iso_pu_bacteria 2932794094 2932800394 92
215 iso_pu_bacteria 2932801729 2932804567 92
216 iso_pu_bacteria 2932809354 2932813959 92
217 iso_pu_bacteria 2932818245 2932819529 92
218 iso_pu_bacteria 2932828146 2932833765 92
219 iso_pu_bacteria 2933577622 2933578812 92
220 iso_pu_bacteria 2935608549 2935611372 92
221 iso_pu_bacteria 2935616580 2935618731 92
222 iso_pu_bacteria 2935630451 2935637737 92
223 iso_pu_bacteria 2935638405 2935644429 92
224 iso_pu_bacteria 2935648319 2935648756 92
225 iso_pu_bacteria 2935656913 2935657161 92
226 iso_pu_bacteria 2935665750 2935674167 92
227 iso_pu_bacteria 2935675223 2935678551 92
228 iso_pu_bacteria 2935684952 2935687952 92
229 iso_pu_bacteria 2935694250 2935701436 92
230 iso_pu_bacteria 2935703347 2935708286 92
231 iso_pu_bacteria 2935713505 2935714972 92
232 iso_pu_bacteria 2935722832 2935726463 92
233 iso_pu_bacteria 2935732158 2935733790 92
234 iso_pu_bacteria 2935741537 2935743169 92
235 iso_pu_bacteria 2935750917 2935754792 92
236 iso_pu_bacteria 2935760218 2935765500 92
237 iso_pu_bacteria 2935769743 2935775253 92
238 iso_pu_bacteria 2935777560 2935779547 92
239 iso_pu_bacteria 2935785616 2935791549 92
240 iso_pu_bacteria 2935793552 2935799861 92
241 iso_pu_bacteria 2935801545 2935805453 92
242 iso_pu_bacteria 2935810662 2935816747 92
243 iso_pu_bacteria 2935819856 2935820849 92
244 iso_pu_bacteria 2935827899 2935833822 92
245 iso_pu_bacteria 2935837841 2935839493 92
246 iso_pu_bacteria 2935847175 2935850891 92
247 iso_pu_bacteria 2935855204 2935857096 92
248 iso_pu_bacteria 2935864058 2935864640 92
249 iso_pu_bacteria 2935873716 2935876418 92
250 iso_pu_bacteria 2935883170 2935889761 92
251 iso_pu_bacteria 2935908558 2935913742 92
252 iso_pu_bacteria 2935916978 2935920268 92
253 iso_pu_bacteria 2935926038 2935930607 92
254 iso_pu_bacteria 2935934488 2935939420 92
255 iso_pu_bacteria 2935942939 2935946369 92
256 iso_pu_bacteria 2935951376 2935955792 92
257 iso_pu_bacteria 2935959822 2935966948 92
258 iso_pu_bacteria 2935967501 2935972498 92
259 iso_pu_bacteria 2935975950 2935981671 92
260 iso_pu_bacteria 2935984226 2935991046 92
261 iso_pu_bacteria 2935992306 2935997613 92
262 iso_pu_bacteria 2936002035 2936007131 92
263 iso_pu_bacteria 2936011229 2936011666 92
264 iso_pu_bacteria 2936019824 2936020261 92
265 iso_pu_bacteria 2936028420 2936028956 92
266 iso_pu_bacteria 2936037263 2936042991 92
267 iso_pu_bacteria 2936046547 2936046984 92
268 iso_pu_bacteria 2936055302 2936058136 92
269 iso_pu_bacteria 2936996657 2937001415 92
270 iso_pu_bacteria 2937002841 2937008149 92
271 iso_pu_bacteria 2937009748 2937015643 92
272 iso_pu_bacteria 2937016420 2937019597 92
273 iso_pu_bacteria 2937023124 2937028372 92
274 iso_pu_bacteria 2937029754 2937034846 92
275 iso_pu_bacteria 2937036028 2937040788 92
276 iso_pu_bacteria 2937042894 2937049361 92
277 iso_pu_bacteria 2937049772 2937056387 92
278 iso_pu_bacteria 2937056579 2937060866 92
279 iso_pu_bacteria 2937063883 2937069360 92
280 iso_pu_bacteria 2937071275 2937076550 92
281 iso_pu_bacteria 2937078374 2937079347 92
282 iso_pu_bacteria 2937084907 2937088452 92
283 iso_pu_bacteria 2937091812 2937096834 92
284 iso_pu_bacteria 2937098957 2937105917 92
285 iso_pu_bacteria 2937106411 2937113067 92
286 iso_pu_bacteria 2937113482 2937118553 92
287 iso_pu_bacteria 2937119839 2937125241 92
288 iso_pu_bacteria 2937126314 2937129966 92
289 iso_pu_bacteria 2940556831 2940559831 92
290 iso_pu_bacteria 2941507105 2941514410 92
291 iso_pu_bacteria 2941515067 2941522306 92
292 iso_pu_bacteria 2941523033 2941530175 92
293 iso_pu_bacteria 2941531003 2941536079 92
294 iso_pu_bacteria 2941538514 2941540182 92
295 iso_pu_bacteria 2957375807 2957377134 92
296 iso_pu_bacteria 2957382221 2957385714 92
297 iso_pu_bacteria 2957388812 2957388837 92
298 iso_pu_bacteria 2957395598 2957401727 92
299 iso_pu_bacteria 2957402308 2957406443 92
300 iso_pu_bacteria 2957408893 2957414196 92
301 iso_pu_bacteria 2957415311 2957418170 92
302 iso_pu_bacteria 2957422303 2957429135 92
303 iso_pu_bacteria 2957430029 2957435564 92
304 iso_pu_bacteria 2957437181 2957443032 92
305 iso_pu_bacteria 2957443900 2957449777 92
306 iso_pu_bacteria 2957450854 2957453200 92
307 iso_pu_bacteria 2957457609 2957464200 92
308 iso_pu_bacteria 2957464669 2957468118 92
309 iso_pu_bacteria 2957471148 2957477677 92
310 iso_pu_bacteria 2957478035 2957483696 92
311 iso_pu_bacteria 2957484790 2957491287 92
312 iso_pu_bacteria 2957491536 2957496676 92
313 iso_pu_bacteria 2957498199 2957504894 92
314 iso_pu_bacteria 2957505466 2957512928 92
315 iso_pu_bacteria 2960584000 2960586006 92
316 iso_pu_bacteria 2960591022 2960593521 92
317 iso_pu_bacteria 2960597568 2960602384 92
318 iso_pu_bacteria 2960603979 2960608997 92
319 iso_pu_bacteria 2960610863 2960616766 92
320 iso_pu_bacteria 2960617483 2960623099 92
321 iso_pu_bacteria 2960624210 2960630978 92
322 iso_pu_bacteria 2960631154 2960636894 92
323 iso_pu_bacteria 2960637947 2960639644 92
324 iso_pu_bacteria 2960645483 2960652509 92
325 iso_pu_bacteria 2960652885 2960655269 92
326 iso_pu_bacteria 2960660292 2960666654 92
327 iso_pu_bacteria 2960667422 2960673105 92
328 iso_pu_bacteria 2960674078 2960677297 92
329 iso_pu_bacteria 2960680706 2960686303 92
330 iso_pu_bacteria 2960687367 2960693518 92
331 iso_pu_bacteria 2960693952 2960700505 92
332 iso_pu_bacteria 2964607997 2964611281 92
333 iso_pu_bacteria 2964615318 2964621256 92
334 iso_pu_bacteria 2964621998 2964626446 92
335 iso_pu_bacteria 2964628898 2964635552 92
336 iso_pu_bacteria 2964636051 2964641215 92
337 iso_pu_bacteria 2964643177 2964647062 92
338 iso_pu_bacteria 2964649959 2964655515 92
339 iso_pu_bacteria 2964656573 2964661950 92
340 iso_pu_bacteria 2964663802 2964670119 92
341 iso_pu_bacteria 2964670856 2964677222 92
342 iso_pu_bacteria 2964678106 2964684934 92
343 iso_pu_bacteria 2964685014 2964691768 92
344 iso_pu_bacteria 2964691889 2964698505 92
345 iso_pu_bacteria 2964698721 2964703423 92
346 iso_pu_bacteria 2964705432 2964710558 92
347 iso_pu_bacteria 2964712639 2964713689 92
348 iso_pu_bacteria 2964719344 2964721089 92
349 iso_pu_bacteria 2967664464 2967671051 92
350 iso_pu_bacteria 2967671571 2967672375 92
351 iso_pu_bacteria 2967678726 2967683411 92
352 iso_pu_bacteria 2967686174 2967692231 92
353 iso_pu_bacteria 2967693043 2967694499 92
354 iso_pu_bacteria 2967699805 2967702493 92
355 iso_pu_bacteria 2967706974 2967714197 92
356 iso_pu_bacteria 2967714385 2967718840 92
357 iso_pu_bacteria 2967721400 2967726174 92
358 iso_pu_bacteria 2967728569 2967729654 92
359 iso_pu_bacteria 2967735183 2967739546 92
360 iso_pu_bacteria 2967742019 2967745162 92
361 iso_pu_bacteria 2967748971 2967754767 92
362 iso_pu_bacteria 2967755722 2967762224 92
363 iso_pu_bacteria 2967762386 2967766742 92
364 iso_pu_bacteria 2967769361 2967775202 92
365 iso_pu_bacteria 2967775926 2967782611 92
366 iso_pu_bacteria 2970019648 2970026359 92
367 iso_pu_bacteria 2970026789 2970033118 92
368 iso_pu_bacteria 2970033650 2970034151 92
369 iso_pu_bacteria 2970040964 2970046973 92
370 iso_pu_bacteria 2970047711 2970051792 92
371 iso_pu_bacteria 2970054988 2970060503 92
372 iso_pu_bacteria 2970061556 2970062284 92
373 iso_pu_bacteria 2970068827 2970069234 92
374 iso_pu_bacteria 2970076120 2970079544 92
375 iso_pu_bacteria 2970082768 2970086674 92
376 iso_pu_bacteria 2970088815 2970091741 92
377 iso_pu_bacteria 2970095765 2970102542 92
378 iso_pu_bacteria 2970102677 2970107854 92
379 iso_pu_bacteria 2970109326 2970115553 92
380 iso_pu_bacteria 2970116247 2970120779 92
381 iso_pu_bacteria 2970122695 2970128522 92
382 iso_pu_bacteria 2970129317 2970129811 92
383 iso_pu_bacteria 2970136068 2970143454 92
384 iso_pu_bacteria 2970143518 2970149808 92
385 iso_pu_bacteria 2970149975 2970156339 92
386 iso_pu_bacteria 2970156795 2970158344 92
387 iso_pu_bacteria 2970164137 2970167604 92
388 iso_pu_bacteria 2970170962 2970173591 92
389 iso_pu_bacteria 2970177841 2970178670 92
390 iso_pu_bacteria 2970184632 2970190744 92
391 iso_pu_bacteria 2970191845 2970198219 92
392 iso_pu_bacteria 2977516862 2977520505 92
393 iso_pu_bacteria 2977523885 2977530228 92
394 iso_pu_bacteria 2977530762 2977532342 92
395 iso_pu_bacteria 2977537788 2977541444 92
396 iso_pu_bacteria 2977544691 2977551375 92
397 iso_pu_bacteria 2977551784 2977557502 92
398 iso_pu_bacteria 2977558990 2977559961 92
399 iso_pu_bacteria 2977565890 2977569826 92
400 iso_pu_bacteria 2977572785 2977578822 92
401 iso_pu_bacteria 2977579622 2977583940 92
402 iso_pu_bacteria 2996310559 2996310962 92
403 iso_pu_bacteria 3005474847 3005479145 92
404 iso_pu_bacteria 3005483717 3005488154 92
405 iso_pu_bacteria 3005506211 3005512698 92
406 iso_pu_bacteria 3005587118 3005590464 92
407 iso_pu_bacteria 3005594810 3005598079 92
408 iso_pu_bacteria 3005718088 3005721269 92
409 iso_pu_bacteria 643348555 643392487 92
410 iso_pu_bacteria 643692032 643825409 92
411 iso_pu_bacteria 648276728 648741351 92
412 iso_pu_bacteria 8003992118 8003993238 92
413 iso_pu_bacteria 8003999396 8004000495 92
414 iso_pu_bacteria 8006926726 8006930386 92
415 iso_pu_bacteria 8006984368 8006986867 92
416 iso_pu_bacteria 8006994254 8006996086 92
417 iso_pu_bacteria 8016511872 8016514672 92
418 iso_pu_bacteria 8016522445 8016530771 92
419 iso_pu_bacteria 8016530956 8016536062 92
420 iso_pu_bacteria 8016539877 8016540341 92
421 iso_pu_bacteria 8016548790 8016552889 92
422 iso_pu_bacteria 8016557553 8016561268 92
423 iso_pu_bacteria 8016566248 8016574408 92
424 iso_pu_bacteria 8016575299 8016578506 92
425 iso_pu_bacteria 8016595262 8016599125 92
426 iso_pu_bacteria 8016603502 8016611923 92
427 iso_pu_bacteria 8016613128 8016621881 92
428 iso_pu_bacteria 8016622563 8016627973 92
429 iso_pu_bacteria 8016630954 8016632296 92
430 iso_pu_bacteria 8017057580 8017061762 92
431 iso_pu_bacteria 8019530166 8019535788 92
432 iso_pu_bacteria 8019538911 8019543691 92
433 iso_pu_bacteria 8019547302 8019555081 92
434 iso_pu_bacteria 8019576017 8019581262 92
435 iso_pu_bacteria 8019586578 8019588889 92
436 iso_pu_bacteria 8019597564 8019602345 92
437 iso_pu_bacteria 8019608314 8019616216 92
438 iso_pu_bacteria 8019619141 8019626836 92
439 iso_pu_bacteria 8019629233 8019635676 92
440 iso_pu_bacteria 8019638758 8019644009 92
441 iso_pu_bacteria 8019648815 8019657006 92
442 iso_pu_bacteria 8019659431 8019663473 92
443 iso_pu_bacteria 8019668869 8019673086 92
444 iso_pu_bacteria 8019687851 8019688751 92
445 iso_pu_bacteria 8049293176 8049294290 92
446 iso_pu_bacteria 8055742211 8055747549 92
447 iso_pu_bacteria 8056689827 8056691241 92
448 iso_pu_bacteria 8056967851 8056972375 92
449 iso_pu_bacteria 8057132660 8057134780 92
450 3300005327 Ga0070658_10322637 Ga0070658_103226373 93
451 3300005455 Ga0070663_101907264 Ga0070663_1019072642 93
452 3300005458 Ga0070681_11741244 Ga0070681_117412442 93
453 3300005530 Ga0070679_100373412 Ga0070679_1003734122 93
454 3300005539 Ga0068853_102080199 Ga0068853_1020801991 93
455 3300013104 Ga0157370_10620972 Ga0157370_106209722 93
456 3300013105 Ga0157369_12306567 Ga0157369_123065672 93
457 3300025909 Ga0207705_10462889 Ga0207705_104628892 93
458 3300031249 Ga0265339_10078316 Ga0265339_100783162 93
459 3300037312 Ga0395899_0439057 Ga0395899_0439057_512_817 93
460 3300037418 Ga0395900_0803481 Ga0395900_0803481_157_462 93
461 3300037466 Ga0395898_0007760 Ga0395898_0007760_8680_8985 93
462 3300049568 Ga0501031_0304347 Ga0501031_0304347_66_371 93
463 3300049570 Ga0501033_0206968 Ga0501033_0206968_475_780 93
464 3300049571 Ga0501034_0000208 Ga0501034_0000208_35378_35683 93
465 3300049571 Ga0501034_0009460 Ga0501034_0009460_2480_2785 93
466 3300049571 Ga0501034_0331645 Ga0501034_0331645_194_499 93
467 3300049572 Ga0501036_0050702 Ga0501036_0050702_676_981 93
468 3300049573 Ga0501037_0007990 Ga0501037_0007990_1654_1959 93
469 3300049574 Ga0501038_0009962 Ga0501038_0009962_1706_2011 93
470 3300049575 Ga0501039_0000072 Ga0501039_0000072_66545_66850 93
471 3300049579 Ga0501043_0983070 Ga0501043_0983070_156_461 93
472 3300049580 Ga0501046_0004977 Ga0501046_0004977_4445_4750 93
473 3300049580 Ga0501046_0083492 Ga0501046_0083492_1637_1942 93
474 3300049581 Ga0501047_0001212 Ga0501047_0001212_15370_15675 93
475 3300049581 Ga0501047_0154693 Ga0501047_0154693_890_1195 93
476 3300049581 Ga0501047_0415754 Ga0501047_0415754_74_379 93
477 3300049583 Ga0501067_0001590 Ga0501067_0001590_583_888 93
478 3300049586 Ga0501070_0068712 Ga0501070_0068712_774_1079 93
479 3300049586 Ga0501070_0348364 Ga0501070_0348364_780_1085 93
480 3300049589 Ga0501073_0025762 Ga0501073_0025762_25_330 93
481 3300049589 Ga0501073_0229610 Ga0501073_0229610_505_810 93
482 3300049589 Ga0501073_0529454 Ga0501073_0529454_255_560 93
483 3300049742 Ga0501080_0000005 Ga0501080_0000005_159702_160007 93
484 3300049822 Ga0501035_0000049 Ga0501035_0000049_38846_39151 93
485 3300049822 Ga0501035_0084852 Ga0501035_0084852_955_1260 93
486 3300049823 Ga0501044_0000030 Ga0501044_0000030_66606_66911 93
487 3300049823 Ga0501044_0099821 Ga0501044_0099821_536_841 93
488 3300049824 Ga0501045_0037773 Ga0501045_0037773_1089_1394 93
489 3300053090 Ga0500646_0351149 Ga0500646_0351149_210_506 93
490 3300060353 Ga0501082_0021073 Ga0501082_0021073_3499_3804 93
491 3300006847 Ga0075431_101210725 Ga0075431_1012107252 95
492 3300035091 Ga0373951_0144568 Ga0373951_0144568_210_515 95
493 3300035691 Ga0373931_0545513 Ga0373931_0545513_205_510 95
494 3300039437 Ga0436365_1302455 Ga0436365_1302455_124_429 95
495 3300048907 Ga0496104_0156871 Ga0496104_0156871_1537_1842 95
496 3300048908 Ga0496105_0294096 Ga0496105_0294096_550_855 95
497 3300048911 Ga0496108_0266859 Ga0496108_0266859_486_791 95
498 3300000041 ARcpr5oldR_c000035 ARcpr5oldR_00003523 96
499 3300000042 ARSoilYngRDRAFT_c00061 ARSoilYngRDRAFT_0006116 96
500 3300000043 ARcpr5yngRDRAFT_c000075 ARcpr5yngRDRAFT_00007511 96
501 3300000044 ARSoilOldRDRAFT_c000053 ARSoilOldRDRAFT_00005311 96
502 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_100002515 96
503 3300001990 JGI24737J22298_10005496 JGI24737J22298_100054967 96
504 3300003214 JGI25165J46597_1034619 JGI25165J46597_10346191 96
505 3300003349 JGI26129J50193_1002889 JGI26129J50193_10028892 96
506 3300004799 Ga0058863_11612769 Ga0058863_116127692 96
507 3300004800 Ga0058861_11519652 Ga0058861_115196521 96
508 3300005276 Ga0065717_1003757 Ga0065717_10037572 96
509 3300005277 Ga0065716_1001741 Ga0065716_10017413 96
510 3300005288 Ga0065714_10430914 Ga0065714_104309142 96
511 3300005290 Ga0065712_10099639 Ga0065712_100996395 96
512 3300005290 Ga0065712_10725715 Ga0065712_107257151 96
513 3300005293 Ga0065715_10002477 Ga0065715_1000247711 96
514 3300005295 Ga0065707_10107090 Ga0065707_101070903 96
515 3300005327 Ga0070658_10137105 Ga0070658_101371052 96
516 3300005327 Ga0070658_11200369 Ga0070658_112003692 96
517 3300005328 Ga0070676_10287217 Ga0070676_102872172 96
518 3300005328 Ga0070676_10477116 Ga0070676_104771162 96
519 3300005328 Ga0070676_10747768 Ga0070676_107477681 96
520 3300005329 Ga0070683_100088671 Ga0070683_1000886712 96
521 3300005329 Ga0070683_100455703 Ga0070683_1004557032 96
522 3300005329 Ga0070683_100525775 Ga0070683_1005257752 96
523 3300005329 Ga0070683_100772090 Ga0070683_1007720902 96
524 3300005330 Ga0070690_100020637 Ga0070690_1000206374 96
525 3300005331 Ga0070670_100162525 Ga0070670_1001625253 96
526 3300005331 Ga0070670_100687280 Ga0070670_1006872802 96
527 3300005331 Ga0070670_100768266 Ga0070670_1007682662 96
528 3300005333 Ga0070677_10816915 Ga0070677_108169151 96
529 3300005334 Ga0068869_100070091 Ga0068869_1000700916 96
530 3300005334 Ga0068869_100104915 Ga0068869_1001049151 96
531 3300005334 Ga0068869_100544126 Ga0068869_1005441262 96
532 3300005334 Ga0068869_100673877 Ga0068869_1006738772 96
533 3300005335 Ga0070666_10023127 Ga0070666_100231277 96
534 3300005335 Ga0070666_10329282 Ga0070666_103292823 96
535 3300005336 Ga0070680_100019894 Ga0070680_1000198948 96
536 3300005336 Ga0070680_100045978 Ga0070680_1000459785 96
537 3300005336 Ga0070680_100072787 Ga0070680_1000727874 96
538 3300005336 Ga0070680_100248532 Ga0070680_1002485322 96
539 3300005336 Ga0070680_100739003 Ga0070680_1007390032 96
540 3300005336 Ga0070680_100851267 Ga0070680_1008512672 96
541 3300005336 Ga0070680_101201131 Ga0070680_1012011312 96
542 3300005337 Ga0070682_100023836 Ga0070682_1000238363 96
543 3300005337 Ga0070682_100716296 Ga0070682_1007162962 96
544 3300005337 Ga0070682_100938223 Ga0070682_1009382232 96
545 3300005337 Ga0070682_101349580 Ga0070682_1013495801 96
546 3300005338 Ga0068868_100199244 Ga0068868_1001992443 96
547 3300005338 Ga0068868_100291153 Ga0068868_1002911531 96
548 3300005338 Ga0068868_100405385 Ga0068868_1004053852 96
549 3300005338 Ga0068868_101440077 Ga0068868_1014400772 96
550 3300005339 Ga0070660_100018276 Ga0070660_1000182768 96
551 3300005339 Ga0070660_100040143 Ga0070660_1000401437 96
552 3300005339 Ga0070660_100052268 Ga0070660_1000522683 96
553 3300005339 Ga0070660_100379564 Ga0070660_1003795642 96
554 3300005339 Ga0070660_100907907 Ga0070660_1009079072 96
555 3300005340 Ga0070689_100053325 Ga0070689_1000533253 96
556 3300005340 Ga0070689_100810262 Ga0070689_1008102622 96
557 3300005340 Ga0070689_101509819 Ga0070689_1015098192 96
558 3300005341 Ga0070691_10024352 Ga0070691_100243524 96
559 3300005341 Ga0070691_10226777 Ga0070691_102267772 96
560 3300005341 Ga0070691_10306108 Ga0070691_103061081 96
561 3300005344 Ga0070661_100158458 Ga0070661_1001584584 96
562 3300005344 Ga0070661_100582676 Ga0070661_1005826762 96
563 3300005347 Ga0070668_100038563 Ga0070668_1000385632 96
564 3300005347 Ga0070668_100452846 Ga0070668_1004528462 96
565 3300005347 Ga0070668_100850994 Ga0070668_1008509942 96
566 3300005347 Ga0070668_101028917 Ga0070668_1010289172 96
567 3300005353 Ga0070669_100023313 Ga0070669_1000233133 96
568 3300005353 Ga0070669_100023914 Ga0070669_1000239143 96
569 3300005354 Ga0070675_100055612 Ga0070675_1000556123 96
570 3300005354 Ga0070675_100226391 Ga0070675_1002263913 96
571 3300005354 Ga0070675_100350669 Ga0070675_1003506692 96
572 3300005354 Ga0070675_100534805 Ga0070675_1005348053 96
573 3300005354 Ga0070675_100597549 Ga0070675_1005975492 96
574 3300005355 Ga0070671_100309895 Ga0070671_1003098951 96
575 3300005355 Ga0070671_101577543 Ga0070671_1015775432 96
576 3300005355 Ga0070671_101584924 Ga0070671_1015849242 96
577 3300005356 Ga0070674_100001266 Ga0070674_10000126612 96
578 3300005356 Ga0070674_100041872 Ga0070674_1000418724 96
579 3300005356 Ga0070674_100063433 Ga0070674_1000634332 96
580 3300005364 Ga0070673_100592233 Ga0070673_1005922332 96
581 3300005364 Ga0070673_101623517 Ga0070673_1016235172 96
582 3300005365 Ga0070688_100013675 Ga0070688_1000136757 96
583 3300005365 Ga0070688_101442699 Ga0070688_1014426992 96
584 3300005366 Ga0070659_100311578 Ga0070659_1003115782 96
585 3300005366 Ga0070659_101218788 Ga0070659_1012187882 96
586 3300005366 Ga0070659_101253243 Ga0070659_1012532432 96
587 3300005366 Ga0070659_101337529 Ga0070659_1013375292 96
588 3300005367 Ga0070667_100061525 Ga0070667_1000615257 96
589 3300005367 Ga0070667_100067572 Ga0070667_1000675728 96
590 3300005367 Ga0070667_100342781 Ga0070667_1003427811 96
591 3300005367 Ga0070667_100354428 Ga0070667_1003544283 96
592 3300005367 Ga0070667_101874074 Ga0070667_1018740742 96
593 3300005406 Ga0070703_10006226 Ga0070703_100062263 96
594 3300005434 Ga0070709_10078673 Ga0070709_100786733 96
595 3300005434 Ga0070709_10504056 Ga0070709_105040562 96
596 3300005434 Ga0070709_10614722 Ga0070709_106147222 96
597 3300005434 Ga0070709_10883751 Ga0070709_108837511 96
598 3300005435 Ga0070714_100011267 Ga0070714_1000112679 96
599 3300005435 Ga0070714_101439883 Ga0070714_1014398832 96
600 3300005436 Ga0070713_100001675 Ga0070713_10000167512 96
601 3300005436 Ga0070713_100443886 Ga0070713_1004438863 96
602 3300005436 Ga0070713_100909268 Ga0070713_1009092682 96
603 3300005436 Ga0070713_100995054 Ga0070713_1009950542 96
604 3300005436 Ga0070713_101050050 Ga0070713_1010500501 96
605 3300005436 Ga0070713_101275263 Ga0070713_1012752632 96
606 3300005436 Ga0070713_101285700 Ga0070713_1012857001 96
607 3300005436 Ga0070713_102099842 Ga0070713_1020998421 96
608 3300005436 Ga0070713_102174607 Ga0070713_1021746071 96
609 3300005437 Ga0070710_10049219 Ga0070710_100492193 96
610 3300005437 Ga0070710_10412417 Ga0070710_104124172 96
611 3300005437 Ga0070710_11060605 Ga0070710_110606051 96
612 3300005438 Ga0070701_10041914 Ga0070701_100419144 96
613 3300005439 Ga0070711_100071215 Ga0070711_1000712155 96
614 3300005439 Ga0070711_100389457 Ga0070711_1003894572 96
615 3300005439 Ga0070711_100727388 Ga0070711_1007273882 96
616 3300005440 Ga0070705_100053071 Ga0070705_1000530714 96
617 3300005440 Ga0070705_100054595 Ga0070705_1000545955 96
618 3300005440 Ga0070705_100811235 Ga0070705_1008112352 96
619 3300005441 Ga0070700_100474427 Ga0070700_1004744272 96
620 3300005441 Ga0070700_100708498 Ga0070700_1007084982 96
621 3300005444 Ga0070694_100020300 Ga0070694_1000203007 96
622 3300005444 Ga0070694_100056701 Ga0070694_1000567016 96
623 3300005444 Ga0070694_101318053 Ga0070694_1013180532 96
624 3300005445 Ga0070708_100551887 Ga0070708_1005518872 96
625 3300005455 Ga0070663_100034462 Ga0070663_1000344628 96
626 3300005456 Ga0070678_100021125 Ga0070678_1000211254 96
627 3300005456 Ga0070678_100021594 Ga0070678_1000215945 96
628 3300005456 Ga0070678_100122832 Ga0070678_1001228325 96
629 3300005456 Ga0070678_100323616 Ga0070678_1003236162 96
630 3300005456 Ga0070678_100568500 Ga0070678_1005685002 96
631 3300005456 Ga0070678_100760487 Ga0070678_1007604872 96
632 3300005456 Ga0070678_101059090 Ga0070678_1010590901 96
633 3300005457 Ga0070662_100021397 Ga0070662_1000213973 96
634 3300005457 Ga0070662_101093878 Ga0070662_1010938782 96
635 3300005458 Ga0070681_10007102 Ga0070681_100071029 96
636 3300005458 Ga0070681_10263987 Ga0070681_102639871 96
637 3300005458 Ga0070681_10354805 Ga0070681_103548053 96
638 3300005458 Ga0070681_10479877 Ga0070681_104798772 96
639 3300005458 Ga0070681_10697971 Ga0070681_106979712 96
640 3300005458 Ga0070681_10890099 Ga0070681_108900992 96
641 3300005459 Ga0068867_100100755 Ga0068867_1001007554 96
642 3300005459 Ga0068867_100106725 Ga0068867_1001067253 96
643 3300005459 Ga0068867_100241062 Ga0068867_1002410623 96
644 3300005459 Ga0068867_100513407 Ga0068867_1005134072 96
645 3300005459 Ga0068867_100798158 Ga0068867_1007981582 96
646 3300005466 Ga0070685_10012732 Ga0070685_100127327 96
647 3300005466 Ga0070685_10190747 Ga0070685_101907473 96
648 3300005467 Ga0070706_100045185 Ga0070706_1000451855 96
649 3300005467 Ga0070706_100343409 Ga0070706_1003434093 96
650 3300005468 Ga0070707_100307016 Ga0070707_1003070162 96
651 3300005468 Ga0070707_100471842 Ga0070707_1004718421 96
652 3300005471 Ga0070698_100327715 Ga0070698_1003277151 96
653 3300005518 Ga0070699_100120889 Ga0070699_1001208892 96
654 3300005518 Ga0070699_100188037 Ga0070699_1001880373 96
655 3300005530 Ga0070679_100039101 Ga0070679_1000391017 96
656 3300005530 Ga0070679_100082939 Ga0070679_1000829395 96
657 3300005530 Ga0070679_100092871 Ga0070679_1000928712 96
658 3300005530 Ga0070679_100235905 Ga0070679_1002359052 96
659 3300005530 Ga0070679_100356169 Ga0070679_1003561692 96
660 3300005530 Ga0070679_100398817 Ga0070679_1003988172 96
661 3300005530 Ga0070679_100629447 Ga0070679_1006294472 96
662 3300005530 Ga0070679_100931182 Ga0070679_1009311822 96
663 3300005530 Ga0070679_100939174 Ga0070679_1009391742 96
664 3300005530 Ga0070679_101484904 Ga0070679_1014849041 96
665 3300005530 Ga0070679_101517440 Ga0070679_1015174402 96
666 3300005530 Ga0070679_101644542 Ga0070679_1016445422 96
667 3300005535 Ga0070684_100073460 Ga0070684_1000734604 96
668 3300005535 Ga0070684_100444811 Ga0070684_1004448112 96
669 3300005535 Ga0070684_100819267 Ga0070684_1008192672 96
670 3300005535 Ga0070684_101199306 Ga0070684_1011993061 96
671 3300005535 Ga0070684_101913630 Ga0070684_1019136301 96
672 3300005536 Ga0070697_100715234 Ga0070697_1007152342 96
673 3300005539 Ga0068853_100006917 Ga0068853_10000691715 96
674 3300005539 Ga0068853_100173535 Ga0068853_1001735354 96
675 3300005539 Ga0068853_100295709 Ga0068853_1002957092 96
676 3300005539 Ga0068853_100308432 Ga0068853_1003084323 96
677 3300005539 Ga0068853_100402370 Ga0068853_1004023701 96
678 3300005539 Ga0068853_100896521 Ga0068853_1008965212 96
679 3300005543 Ga0070672_100075788 Ga0070672_1000757883 96
680 3300005544 Ga0070686_100026380 Ga0070686_1000263803 96
681 3300005544 Ga0070686_100568573 Ga0070686_1005685732 96
682 3300005544 Ga0070686_101396448 Ga0070686_1013964481 96
683 3300005544 Ga0070686_101508823 Ga0070686_1015088232 96
684 3300005545 Ga0070695_100037771 Ga0070695_1000377717 96
685 3300005545 Ga0070695_100040449 Ga0070695_1000404494 96
686 3300005546 Ga0070696_100006293 Ga0070696_1000062938 96
687 3300005546 Ga0070696_100010439 Ga0070696_1000104397 96
688 3300005546 Ga0070696_100074654 Ga0070696_1000746543 96
689 3300005546 Ga0070696_100464160 Ga0070696_1004641602 96
690 3300005546 Ga0070696_100716140 Ga0070696_1007161402 96
691 3300005547 Ga0070693_100011024 Ga0070693_1000110246 96
692 3300005547 Ga0070693_100167752 Ga0070693_1001677522 96
693 3300005547 Ga0070693_100804690 Ga0070693_1008046901 96
694 3300005547 Ga0070693_101375393 Ga0070693_1013753932 96
695 3300005548 Ga0070665_100014624 Ga0070665_10001462416 96
696 3300005548 Ga0070665_100074982 Ga0070665_1000749828 96
697 3300005548 Ga0070665_100087868 Ga0070665_1000878685 96
698 3300005548 Ga0070665_100157888 Ga0070665_1001578884 96
699 3300005548 Ga0070665_100182589 Ga0070665_1001825895 96
700 3300005548 Ga0070665_100331108 Ga0070665_1003311083 96
701 3300005548 Ga0070665_100340969 Ga0070665_1003409694 96
702 3300005548 Ga0070665_100414332 Ga0070665_1004143322 96
703 3300005548 Ga0070665_100612837 Ga0070665_1006128372 96
704 3300005548 Ga0070665_101381074 Ga0070665_1013810741 96
705 3300005548 Ga0070665_101480620 Ga0070665_1014806202 96
706 3300005548 Ga0070665_101900889 Ga0070665_1019008892 96
707 3300005548 Ga0070665_102367133 Ga0070665_1023671331 96
708 3300005549 Ga0070704_100930546 Ga0070704_1009305461 96
709 3300005563 Ga0068855_100107936 Ga0068855_1001079368 96
710 3300005563 Ga0068855_100218784 Ga0068855_1002187842 96
711 3300005563 Ga0068855_100377233 Ga0068855_1003772332 96
712 3300005563 Ga0068855_100551499 Ga0068855_1005514993 96
713 3300005563 Ga0068855_100856090 Ga0068855_1008560902 96
714 3300005563 Ga0068855_101168688 Ga0068855_1011686881 96
715 3300005563 Ga0068855_101411038 Ga0068855_1014110382 96
716 3300005563 Ga0068855_101569489 Ga0068855_1015694892 96
717 3300005563 Ga0068855_102108968 Ga0068855_1021089681 96
718 3300005564 Ga0070664_100068199 Ga0070664_1000681995 96
719 3300005564 Ga0070664_101714597 Ga0070664_1017145971 96
720 3300005564 Ga0070664_101989152 Ga0070664_1019891522 96
721 3300005577 Ga0068857_100096862 Ga0068857_1000968624 96
722 3300005577 Ga0068857_100128196 Ga0068857_1001281965 96
723 3300005577 Ga0068857_100828304 Ga0068857_1008283042 96
724 3300005577 Ga0068857_101058490 Ga0068857_1010584902 96
725 3300005577 Ga0068857_101572916 Ga0068857_1015729162 96
726 3300005578 Ga0068854_100683089 Ga0068854_1006830892 96
727 3300005578 Ga0068854_101116855 Ga0068854_1011168552 96
728 3300005614 Ga0068856_100191608 Ga0068856_1001916083 96
729 3300005614 Ga0068856_100277013 Ga0068856_1002770134 96
730 3300005614 Ga0068856_100781455 Ga0068856_1007814552 96
731 3300005614 Ga0068856_101292082 Ga0068856_1012920822 96
732 3300005614 Ga0068856_101970962 Ga0068856_1019709622 96
733 3300005615 Ga0070702_100186251 Ga0070702_1001862512 96
734 3300005616 Ga0068852_100130647 Ga0068852_1001306473 96
735 3300005616 Ga0068852_102407536 Ga0068852_1024075362 96
736 3300005617 Ga0068859_100225122 Ga0068859_1002251222 96
737 3300005617 Ga0068859_100416049 Ga0068859_1004160491 96
738 3300005617 Ga0068859_100653974 Ga0068859_1006539742 96
739 3300005617 Ga0068859_101091707 Ga0068859_1010917072 96
740 3300005617 Ga0068859_102701731 Ga0068859_1027017312 96
741 3300005618 Ga0068864_100170784 Ga0068864_1001707843 96
742 3300005618 Ga0068864_100695509 Ga0068864_1006955092 96
743 3300005618 Ga0068864_101390974 Ga0068864_1013909742 96
744 3300005618 Ga0068864_101798307 Ga0068864_1017983072 96
745 3300005618 Ga0068864_102438990 Ga0068864_1024389901 96
746 3300005718 Ga0068866_10155481 Ga0068866_101554812 96
747 3300005718 Ga0068866_10320624 Ga0068866_103206242 96
748 3300005718 Ga0068866_10583336 Ga0068866_105833361 96
749 3300005719 Ga0068861_100084477 Ga0068861_1000844775 96
750 3300005719 Ga0068861_100275129 Ga0068861_1002751292 96
751 3300005719 Ga0068861_101018226 Ga0068861_1010182262 96
752 3300005834 Ga0068851_10074549 Ga0068851_100745492 96
753 3300005840 Ga0068870_10209043 Ga0068870_102090432 96
754 3300005840 Ga0068870_11056359 Ga0068870_110563592 96
755 3300005841 Ga0068863_100043883 Ga0068863_1000438838 96
756 3300005841 Ga0068863_100350018 Ga0068863_1003500183 96
757 3300005841 Ga0068863_101024711 Ga0068863_1010247112 96
758 3300005841 Ga0068863_102507882 Ga0068863_1025078821 96
759 3300005842 Ga0068858_100049282 Ga0068858_1000492827 96
760 3300005842 Ga0068858_100112898 Ga0068858_1001128985 96
761 3300005842 Ga0068858_100163902 Ga0068858_1001639023 96
762 3300005842 Ga0068858_100425301 Ga0068858_1004253012 96
763 3300005843 Ga0068860_100092223 Ga0068860_1000922234 96
764 3300005843 Ga0068860_100440964 Ga0068860_1004409642 96
765 3300005843 Ga0068860_100463463 Ga0068860_1004634633 96
766 3300005843 Ga0068860_101054688 Ga0068860_1010546882 96
767 3300005843 Ga0068860_101067238 Ga0068860_1010672381 96
768 3300005843 Ga0068860_102839372 Ga0068860_1028393721 96
769 3300005844 Ga0068862_100011381 Ga0068862_10001138111 96
770 3300005844 Ga0068862_100191186 Ga0068862_1001911863 96
771 3300005844 Ga0068862_100432931 Ga0068862_1004329313 96
772 3300005844 Ga0068862_101350880 Ga0068862_1013508802 96
773 3300005937 Ga0081455_10000048 Ga0081455_1000004852 96
774 3300005937 Ga0081455_10013116 Ga0081455_1001311616 96
775 3300005937 Ga0081455_10017489 Ga0081455_100174893 96
776 3300005937 Ga0081455_10099126 Ga0081455_100991265 96
777 3300005937 Ga0081455_10137446 Ga0081455_101374464 96
778 3300005981 Ga0081538_10001852 Ga0081538_1000185219 96
779 3300005983 Ga0081540_1095245 Ga0081540_10952453 96
780 3300005983 Ga0081540_1191416 Ga0081540_11914162 96
781 3300005985 Ga0081539_10000072 Ga0081539_1000007216 96
782 3300005985 Ga0081539_10009089 Ga0081539_100090895 96
783 3300006028 Ga0070717_10074954 Ga0070717_100749544 96
784 3300006028 Ga0070717_10477158 Ga0070717_104771583 96
785 3300006028 Ga0070717_10724336 Ga0070717_107243362 96
786 3300006028 Ga0070717_10845026 Ga0070717_108450262 96
787 3300006042 Ga0075368_10193637 Ga0075368_101936372 96
788 3300006048 Ga0075363_100273731 Ga0075363_1002737312 96
789 3300006048 Ga0075363_100421375 Ga0075363_1004213752 96
790 3300006048 Ga0075363_100712037 Ga0075363_1007120372 96
791 3300006051 Ga0075364_10249794 Ga0075364_102497942 96
792 3300006163 Ga0070715_10011442 Ga0070715_100114426 96
793 3300006173 Ga0070716_100180003 Ga0070716_1001800032 96
794 3300006173 Ga0070716_100317300 Ga0070716_1003173002 96
795 3300006175 Ga0070712_100004619 Ga0070712_10000461914 96
796 3300006175 Ga0070712_100314311 Ga0070712_1003143112 96
797 3300006177 Ga0075362_10096734 Ga0075362_100967342 96
798 3300006177 Ga0075362_10277492 Ga0075362_102774921 96
799 3300006178 Ga0075367_10319705 Ga0075367_103197052 96
800 3300006178 Ga0075367_10462486 Ga0075367_104624861 96
801 3300006178 Ga0075367_10488672 Ga0075367_104886722 96
802 3300006178 Ga0075367_10558546 Ga0075367_105585462 96
803 3300006195 Ga0075366_10042037 Ga0075366_100420377 96
804 3300006195 Ga0075366_10335185 Ga0075366_103351853 96
805 3300006195 Ga0075366_10467034 Ga0075366_104670342 96
806 3300006195 Ga0075366_10774579 Ga0075366_107745792 96
807 3300006237 Ga0097621_100106219 Ga0097621_1001062193 96
808 3300006237 Ga0097621_100141731 Ga0097621_1001417313 96
809 3300006237 Ga0097621_100318759 Ga0097621_1003187593 96
810 3300006237 Ga0097621_100778144 Ga0097621_1007781443 96
811 3300006237 Ga0097621_101172310 Ga0097621_1011723102 96
812 3300006353 Ga0075370_10025728 Ga0075370_100257287 96
813 3300006353 Ga0075370_10243018 Ga0075370_102430183 96
814 3300006358 Ga0068871_100071528 Ga0068871_1000715283 96
815 3300006358 Ga0068871_100392603 Ga0068871_1003926032 96
816 3300006358 Ga0068871_101195952 Ga0068871_1011959522 96
817 3300006844 Ga0075428_102272651 Ga0075428_1022726512 96
818 3300006846 Ga0075430_100113569 Ga0075430_1001135696 96
819 3300006846 Ga0075430_100275397 Ga0075430_1002753973 96
820 3300006847 Ga0075431_102202149 Ga0075431_1022021491 96
821 3300006852 Ga0075433_10227783 Ga0075433_102277831 96
822 3300006852 Ga0075433_10486718 Ga0075433_104867182 96
823 3300006852 Ga0075433_11139175 Ga0075433_111391752 96
824 3300006871 Ga0075434_100127605 Ga0075434_1001276055 96
825 3300006871 Ga0075434_100342016 Ga0075434_1003420162 96
826 3300006871 Ga0075434_100939960 Ga0075434_1009399602 96
827 3300006881 Ga0068865_100002505 Ga0068865_1000025056 96
828 3300006881 Ga0068865_100204889 Ga0068865_1002048892 96
829 3300006881 Ga0068865_100875544 Ga0068865_1008755442 96
830 3300006881 Ga0068865_100934570 Ga0068865_1009345702 96
831 3300006881 Ga0068865_101556208 Ga0068865_1015562082 96
832 3300006914 Ga0075436_100053121 Ga0075436_1000531212 96
833 3300006914 Ga0075436_100243577 Ga0075436_1002435773 96
834 3300006914 Ga0075436_101311785 Ga0075436_1013117852 96
835 3300006931 Ga0097620_100225140 Ga0097620_1002251404 96
836 3300006931 Ga0097620_100416056 Ga0097620_1004160561 96
837 3300006931 Ga0097620_100653863 Ga0097620_1006538632 96
838 3300006931 Ga0097620_101091665 Ga0097620_1010916652 96
839 3300006931 Ga0097620_102701815 Ga0097620_1027018151 96
840 3300007788 Ga0099795_10002056 Ga0099795_100020568 96
841 3300007788 Ga0099795_10357496 Ga0099795_103574962 96
842 3300009092 Ga0105250_10202203 Ga0105250_102022032 96
843 3300009093 Ga0105240_10118855 Ga0105240_101188555 96
844 3300009093 Ga0105240_10261448 Ga0105240_102614482 96
845 3300009093 Ga0105240_10313482 Ga0105240_103134824 96
846 3300009093 Ga0105240_10455243 Ga0105240_104552432 96
847 3300009093 Ga0105240_10546606 Ga0105240_105466063 96
848 3300009093 Ga0105240_10644980 Ga0105240_106449803 96
849 3300009093 Ga0105240_10775048 Ga0105240_107750482 96
850 3300009093 Ga0105240_10950412 Ga0105240_109504123 96
851 3300009093 Ga0105240_11671845 Ga0105240_116718452 96
852 3300009093 Ga0105240_12026371 Ga0105240_120263712 96
853 3300009093 Ga0105240_12217837 Ga0105240_122178371 96
854 3300009093 Ga0105240_12584970 Ga0105240_125849701 96
855 3300009094 Ga0111539_10065259 Ga0111539_100652597 96
856 3300009094 Ga0111539_10872514 Ga0111539_108725142 96
857 3300009094 Ga0111539_12489409 Ga0111539_124894092 96
858 3300009094 Ga0111539_13375196 Ga0111539_133751962 96
859 3300009098 Ga0105245_10289754 Ga0105245_102897543 96
860 3300009098 Ga0105245_11142459 Ga0105245_111424592 96
861 3300009098 Ga0105245_11300387 Ga0105245_113003871 96
862 3300009098 Ga0105245_12283177 Ga0105245_122831772 96
863 3300009101 Ga0105247_10189096 Ga0105247_101890963 96
864 3300009101 Ga0105247_10574377 Ga0105247_105743772 96
865 3300009101 Ga0105247_10618604 Ga0105247_106186042 96
866 3300009101 Ga0105247_11454536 Ga0105247_114545361 96
867 3300009147 Ga0114129_10210172 Ga0114129_102101725 96
868 3300009147 Ga0114129_10227354 Ga0114129_102273543 96
869 3300009147 Ga0114129_11135926 Ga0114129_111359262 96
870 3300009147 Ga0114129_12150191 Ga0114129_121501912 96
871 3300009148 Ga0105243_10014127 Ga0105243_100141278 96
872 3300009148 Ga0105243_10014172 Ga0105243_100141728 96
873 3300009148 Ga0105243_10865852 Ga0105243_108658522 96
874 3300009148 Ga0105243_11173214 Ga0105243_111732142 96
875 3300009174 Ga0105241_10113021 Ga0105241_101130212 96
876 3300009174 Ga0105241_10253442 Ga0105241_102534421 96
877 3300009174 Ga0105241_10267822 Ga0105241_102678223 96
878 3300009174 Ga0105241_10349871 Ga0105241_103498713 96
879 3300009174 Ga0105241_10773262 Ga0105241_107732622 96
880 3300009174 Ga0105241_10836780 Ga0105241_108367802 96
881 3300009174 Ga0105241_10926408 Ga0105241_109264082 96
882 3300009174 Ga0105241_11541385 Ga0105241_115413851 96
883 3300009174 Ga0105241_11924604 Ga0105241_119246042 96
884 3300009176 Ga0105242_10123893 Ga0105242_101238932 96
885 3300009176 Ga0105242_10256228 Ga0105242_102562283 96
886 3300009176 Ga0105242_10362506 Ga0105242_103625062 96
887 3300009177 Ga0105248_10063706 Ga0105248_100637065 96
888 3300009177 Ga0105248_10289075 Ga0105248_102890752 96
889 3300009177 Ga0105248_10451887 Ga0105248_104518873 96
890 3300009177 Ga0105248_10775680 Ga0105248_107756801 96
891 3300009177 Ga0105248_10787840 Ga0105248_107878402 96
892 3300009177 Ga0105248_12462277 Ga0105248_124622772 96
893 3300009545 Ga0105237_10016531 Ga0105237_100165315 96
894 3300009545 Ga0105237_10080860 Ga0105237_100808606 96
895 3300009545 Ga0105237_10155476 Ga0105237_101554763 96
896 3300009545 Ga0105237_10373062 Ga0105237_103730624 96
897 3300009545 Ga0105237_10526050 Ga0105237_105260503 96
898 3300009551 Ga0105238_10012597 Ga0105238_1001259712 96
899 3300009551 Ga0105238_10179895 Ga0105238_101798954 96
900 3300009551 Ga0105238_10215115 Ga0105238_102151152 96
901 3300009551 Ga0105238_10244606 Ga0105238_102446063 96
902 3300009551 Ga0105238_10315021 Ga0105238_103150212 96
903 3300009551 Ga0105238_10343086 Ga0105238_103430863 96
904 3300009551 Ga0105238_10561589 Ga0105238_105615892 96
905 3300009551 Ga0105238_10764574 Ga0105238_107645742 96
906 3300009551 Ga0105238_10806031 Ga0105238_108060312 96
907 3300009551 Ga0105238_11168422 Ga0105238_111684222 96
908 3300009551 Ga0105238_11204016 Ga0105238_112040162 96
909 3300009551 Ga0105238_11512957 Ga0105238_115129572 96
910 3300009551 Ga0105238_13063038 Ga0105238_130630382 96
911 3300009553 Ga0105249_10048120 Ga0105249_100481204 96
912 3300009553 Ga0105249_10064902 Ga0105249_100649022 96
913 3300009553 Ga0105249_10141467 Ga0105249_101414673 96
914 3300009553 Ga0105249_11396288 Ga0105249_113962882 96
915 3300009553 Ga0105249_12281628 Ga0105249_122816282 96
916 3300010159 Ga0099796_10124832 Ga0099796_101248322 96
917 3300010375 Ga0105239_10066260 Ga0105239_100662602 96
918 3300010375 Ga0105239_10138338 Ga0105239_101383386 96
919 3300010375 Ga0105239_10327892 Ga0105239_103278922 96
920 3300010375 Ga0105239_10592553 Ga0105239_105925532 96
921 3300010375 Ga0105239_10691783 Ga0105239_106917832 96
922 3300010375 Ga0105239_10759035 Ga0105239_107590352 96
923 3300010375 Ga0105239_11628158 Ga0105239_116281582 96
924 3300010375 Ga0105239_11904501 Ga0105239_119045011 96
925 3300011119 Ga0105246_10004854 Ga0105246_100048544 96
926 3300011119 Ga0105246_10062954 Ga0105246_100629542 96
927 3300011119 Ga0105246_10753088 Ga0105246_107530882 96
928 3300011119 Ga0105246_10854873 Ga0105246_108548732 96
929 3300011119 Ga0105246_11590571 Ga0105246_115905711 96
930 3300011119 Ga0105246_11914791 Ga0105246_119147911 96
931 3300011119 Ga0105246_12405411 Ga0105246_124054111 96
932 3300012476 Ga0157344_1004729 Ga0157344_10047292 96
933 3300012480 Ga0157346_1012317 Ga0157346_10123171 96
934 3300012483 Ga0157337_1010414 Ga0157337_10104142 96
935 3300012485 Ga0157325_1035635 Ga0157325_10356351 96
936 3300012498 Ga0157345_1022859 Ga0157345_10228591 96
937 3300012500 Ga0157314_1002718 Ga0157314_10027182 96
938 3300012502 Ga0157347_1010178 Ga0157347_10101783 96
939 3300012503 Ga0157313_1022476 Ga0157313_10224761 96
940 3300012505 Ga0157339_1025151 Ga0157339_10251511 96
941 3300012506 Ga0157324_1005414 Ga0157324_10054142 96
942 3300012507 Ga0157342_1002329 Ga0157342_10023293 96
943 3300012508 Ga0157315_1003570 Ga0157315_10035702 96
944 3300012510 Ga0157316_1002477 Ga0157316_10024772 96
945 3300012515 Ga0157338_1046649 Ga0157338_10466492 96
946 3300013100 Ga0157373_10204225 Ga0157373_102042252 96
947 3300013100 Ga0157373_10361875 Ga0157373_103618752 96
948 3300013100 Ga0157373_10435233 Ga0157373_104352332 96
949 3300013100 Ga0157373_10523795 Ga0157373_105237952 96
950 3300013100 Ga0157373_11371771 Ga0157373_113717711 96
951 3300013102 Ga0157371_10360525 Ga0157371_103605252 96
952 3300013102 Ga0157371_10634665 Ga0157371_106346651 96
953 3300013102 Ga0157371_10954468 Ga0157371_109544681 96
954 3300013102 Ga0157371_11054853 Ga0157371_110548532 96
955 3300013104 Ga0157370_10083851 Ga0157370_100838515 96
956 3300013104 Ga0157370_10324532 Ga0157370_103245322 96
957 3300013104 Ga0157370_11162771 Ga0157370_111627712 96
958 3300013104 Ga0157370_11398251 Ga0157370_113982512 96
959 3300013105 Ga0157369_10087882 Ga0157369_100878827 96
960 3300013105 Ga0157369_10135701 Ga0157369_101357015 96
961 3300013105 Ga0157369_10578454 Ga0157369_105784542 96
962 3300013105 Ga0157369_10707966 Ga0157369_107079662 96
963 3300013105 Ga0157369_10828958 Ga0157369_108289582 96
964 3300013105 Ga0157369_11315190 Ga0157369_113151902 96
965 3300013105 Ga0157369_11368116 Ga0157369_113681162 96
966 3300013296 Ga0157374_10133488 Ga0157374_101334884 96
967 3300013296 Ga0157374_10332353 Ga0157374_103323533 96
968 3300013296 Ga0157374_10382101 Ga0157374_103821011 96
969 3300013296 Ga0157374_10956313 Ga0157374_109563132 96
970 3300013297 Ga0157378_10115850 Ga0157378_101158502 96
971 3300013297 Ga0157378_10537404 Ga0157378_105374043 96
972 3300013297 Ga0157378_10775844 Ga0157378_107758442 96
973 3300013297 Ga0157378_13021990 Ga0157378_130219902 96
974 3300013306 Ga0163162_10632920 Ga0163162_106329203 96
975 3300013306 Ga0163162_10780723 Ga0163162_107807233 96
976 3300013306 Ga0163162_12249586 Ga0163162_122495862 96
977 3300013306 Ga0163162_13124403 Ga0163162_131244032 96
978 3300013307 Ga0157372_10327295 Ga0157372_103272953 96
979 3300013307 Ga0157372_10583662 Ga0157372_105836623 96
980 3300013307 Ga0157372_10622267 Ga0157372_106222672 96
981 3300013307 Ga0157372_11198800 Ga0157372_111988002 96
982 3300013307 Ga0157372_12846566 Ga0157372_128465661 96
983 3300013308 Ga0157375_10476831 Ga0157375_104768312 96
984 3300013308 Ga0157375_10952587 Ga0157375_109525872 96
985 3300013308 Ga0157375_11360480 Ga0157375_113604802 96
986 3300013308 Ga0157375_11760277 Ga0157375_117602772 96
987 3300014325 Ga0163163_10008003 Ga0163163_100080036 96
988 3300014325 Ga0163163_10050622 Ga0163163_100506228 96
989 3300014325 Ga0163163_10155427 Ga0163163_101554275 96
990 3300014325 Ga0163163_10483398 Ga0163163_104833982 96
991 3300014325 Ga0163163_10640651 Ga0163163_106406512 96
992 3300014325 Ga0163163_10893135 Ga0163163_108931352 96
993 3300014325 Ga0163163_11109392 Ga0163163_111093922 96
994 3300014325 Ga0163163_11666641 Ga0163163_116666412 96
995 3300014325 Ga0163163_12335132 Ga0163163_123351322 96
996 3300014325 Ga0163163_12874742 Ga0163163_128747421 96
997 3300014326 Ga0157380_10069944 Ga0157380_100699445 96
998 3300014326 Ga0157380_10450958 Ga0157380_104509583 96
999 3300014326 Ga0157380_10545240 Ga0157380_105452402 96
1000 3300014326 Ga0157380_10806218 Ga0157380_108062182 96
1001 3300014326 Ga0157380_10916393 Ga0157380_109163932 96
1002 3300014497 Ga0182008_10126397 Ga0182008_101263971 96
1003 3300014497 Ga0182008_10213644 Ga0182008_102136441 96
1004 3300014497 Ga0182008_10247911 Ga0182008_102479113 96
1005 3300014745 Ga0157377_10476575 Ga0157377_104765752 96
1006 3300014968 Ga0157379_10052289 Ga0157379_100522892 96
1007 3300014968 Ga0157379_10181186 Ga0157379_101811864 96
1008 3300014968 Ga0157379_10232957 Ga0157379_102329574 96
1009 3300014968 Ga0157379_10384430 Ga0157379_103844303 96
1010 3300014968 Ga0157379_10761071 Ga0157379_107610712 96
1011 3300014968 Ga0157379_11349508 Ga0157379_113495082 96
1012 3300014969 Ga0157376_10040837 Ga0157376_100408378 96
1013 3300014969 Ga0157376_10239568 Ga0157376_102395684 96
1014 3300014969 Ga0157376_10303079 Ga0157376_103030792 96
1015 3300014969 Ga0157376_10559227 Ga0157376_105592272 96
1016 3300014969 Ga0157376_10864631 Ga0157376_108646312 96
1017 3300014969 Ga0157376_11078476 Ga0157376_110784762 96
1018 3300014969 Ga0157376_11552520 Ga0157376_115525201 96
1019 3300014969 Ga0157376_12145208 Ga0157376_121452082 96
1020 3300015262 Ga0182007_10214516 Ga0182007_102145162 96
1021 3300017792 Ga0163161_10260428 Ga0163161_102604283 96
1022 3300017792 Ga0163161_12061192 Ga0163161_120611921 96
1023 3300020069 Ga0197907_10834854 Ga0197907_108348542 96
1024 3300020069 Ga0197907_10879882 Ga0197907_108798821 96
1025 3300020069 Ga0197907_11284989 Ga0197907_112849892 96
1026 3300020078 Ga0206352_10592541 Ga0206352_105925411 96
1027 3300020078 Ga0206352_10990522 Ga0206352_109905222 96
1028 3300020080 Ga0206350_11455779 Ga0206350_114557792 96
1029 3300020082 Ga0206353_10563244 Ga0206353_105632447 96
1030 3300021358 Ga0213873_10005735 Ga0213873_100057353 96
1031 3300021358 Ga0213873_10019508 Ga0213873_100195082 96
1032 3300021358 Ga0213873_10038734 Ga0213873_100387341 96
1033 3300021361 Ga0213872_10012804 Ga0213872_100128047 96
1034 3300021361 Ga0213872_10021018 Ga0213872_100210184 96
1035 3300021361 Ga0213872_10093098 Ga0213872_100930982 96
1036 3300021361 Ga0213872_10112292 Ga0213872_101122922 96
1037 3300021361 Ga0213872_10201651 Ga0213872_102016512 96
1038 3300021377 Ga0213874_10005081 Ga0213874_100050814 96
1039 3300021377 Ga0213874_10186857 Ga0213874_101868572 96
1040 3300021384 Ga0213876_10026215 Ga0213876_100262153 96
1041 3300021384 Ga0213876_10027585 Ga0213876_100275852 96
1042 3300021384 Ga0213876_10207718 Ga0213876_102077181 96
1043 3300021388 Ga0213875_10007338 Ga0213875_1000733812 96
1044 3300021388 Ga0213875_10017153 Ga0213875_100171537 96
1045 3300021388 Ga0213875_10023977 Ga0213875_100239777 96
1046 3300021388 Ga0213875_10042663 Ga0213875_100426632 96
1047 3300021388 Ga0213875_10042775 Ga0213875_100427754 96
1048 3300021388 Ga0213875_10120516 Ga0213875_101205161 96
1049 3300021388 Ga0213875_10163627 Ga0213875_101636272 96
1050 3300021441 Ga0213871_10003980 Ga0213871_100039804 96
1051 3300021441 Ga0213871_10012935 Ga0213871_100129354 96
1052 3300021441 Ga0213871_10312436 Ga0213871_103124361 96
1053 3300022467 Ga0224712_10039629 Ga0224712_100396292 96
1054 3300022467 Ga0224712_10064921 Ga0224712_100649213 96
1055 3300022467 Ga0224712_10119230 Ga0224712_101192302 96
1056 3300025231 Ga0207427_108978 Ga0207427_1089782 96
1057 3300025261 Ga0209233_1000013 Ga0209233_1000013740 96
1058 3300025261 Ga0209233_1003903 Ga0209233_10039035 96
1059 3300025261 Ga0209233_1011776 Ga0209233_10117765 96
1060 3300025291 Ga0209675_1020773 Ga0209675_10207733 96
1061 3300025292 Ga0209676_1000092 Ga0209676_100009216 96
1062 3300025292 Ga0209676_1004347 Ga0209676_10043478 96
1063 3300025298 Ga0209050_1007859 Ga0209050_100785911 96
1064 3300025298 Ga0209050_1010525 Ga0209050_10105258 96
1065 3300025298 Ga0209050_1041263 Ga0209050_10412632 96
1066 3300025299 Ga0209256_1018456 Ga0209256_10184565 96
1067 3300025299 Ga0209256_1057678 Ga0209256_10576781 96
1068 3300025303 Ga0209051_1021790 Ga0209051_10217903 96
1069 3300025304 Ga0209257_1005546 Ga0209257_10055468 96
1070 3300025304 Ga0209257_1044807 Ga0209257_10448071 96
1071 3300025321 Ga0207656_10084736 Ga0207656_100847362 96
1072 3300025893 Ga0207682_10050681 Ga0207682_100506813 96
1073 3300025893 Ga0207682_10279036 Ga0207682_102790362 96
1074 3300025898 Ga0207692_10010942 Ga0207692_100109424 96
1075 3300025898 Ga0207692_10182677 Ga0207692_101826772 96
1076 3300025898 Ga0207692_10385626 Ga0207692_103856262 96
1077 3300025899 Ga0207642_10017630 Ga0207642_100176305 96
1078 3300025899 Ga0207642_10088287 Ga0207642_100882873 96
1079 3300025899 Ga0207642_10242080 Ga0207642_102420802 96
1080 3300025900 Ga0207710_10052978 Ga0207710_100529783 96
1081 3300025900 Ga0207710_10303804 Ga0207710_103038042 96
1082 3300025901 Ga0207688_10166712 Ga0207688_101667123 96
1083 3300025903 Ga0207680_10002564 Ga0207680_1000256410 96
1084 3300025903 Ga0207680_10136372 Ga0207680_101363723 96
1085 3300025904 Ga0207647_10038225 Ga0207647_100382252 96
1086 3300025904 Ga0207647_10310841 Ga0207647_103108412 96
1087 3300025906 Ga0207699_10008830 Ga0207699_100088309 96
1088 3300025906 Ga0207699_10425897 Ga0207699_104258972 96
1089 3300025906 Ga0207699_10885593 Ga0207699_108855931 96
1090 3300025906 Ga0207699_11013020 Ga0207699_110130201 96
1091 3300025906 Ga0207699_11075577 Ga0207699_110755772 96
1092 3300025907 Ga0207645_10011392 Ga0207645_100113929 96
1093 3300025907 Ga0207645_10279815 Ga0207645_102798152 96
1094 3300025907 Ga0207645_10602094 Ga0207645_106020942 96
1095 3300025907 Ga0207645_10630619 Ga0207645_106306192 96
1096 3300025908 Ga0207643_10030805 Ga0207643_100308053 96
1097 3300025908 Ga0207643_10032595 Ga0207643_100325955 96
1098 3300025908 Ga0207643_10974748 Ga0207643_109747482 96
1099 3300025909 Ga0207705_10004720 Ga0207705_1000472016 96
1100 3300025909 Ga0207705_10101468 Ga0207705_101014685 96
1101 3300025909 Ga0207705_10837392 Ga0207705_108373922 96
1102 3300025910 Ga0207684_10122169 Ga0207684_101221692 96
1103 3300025910 Ga0207684_10354217 Ga0207684_103542173 96
1104 3300025910 Ga0207684_11107359 Ga0207684_111073592 96
1105 3300025911 Ga0207654_10063489 Ga0207654_100634892 96
1106 3300025911 Ga0207654_10065182 Ga0207654_100651825 96
1107 3300025911 Ga0207654_10199940 Ga0207654_101999404 96
1108 3300025911 Ga0207654_10278345 Ga0207654_102783453 96
1109 3300025911 Ga0207654_11447529 Ga0207654_114475292 96
1110 3300025912 Ga0207707_10017730 Ga0207707_100177307 96
1111 3300025912 Ga0207707_10156792 Ga0207707_101567923 96
1112 3300025912 Ga0207707_10358526 Ga0207707_103585262 96
1113 3300025912 Ga0207707_10391698 Ga0207707_103916982 96
1114 3300025912 Ga0207707_10445172 Ga0207707_104451722 96
1115 3300025912 Ga0207707_10539056 Ga0207707_105390563 96
1116 3300025912 Ga0207707_10574219 Ga0207707_105742191 96
1117 3300025912 Ga0207707_10630210 Ga0207707_106302102 96
1118 3300025913 Ga0207695_10163712 Ga0207695_101637124 96
1119 3300025913 Ga0207695_10178743 Ga0207695_101787434 96
1120 3300025913 Ga0207695_10284139 Ga0207695_102841394 96
1121 3300025913 Ga0207695_10384742 Ga0207695_103847423 96
1122 3300025913 Ga0207695_10396467 Ga0207695_103964672 96
1123 3300025913 Ga0207695_10808022 Ga0207695_108080222 96
1124 3300025913 Ga0207695_11259296 Ga0207695_112592962 96
1125 3300025913 Ga0207695_11442632 Ga0207695_114426322 96
1126 3300025914 Ga0207671_10066436 Ga0207671_100664364 96
1127 3300025914 Ga0207671_10158422 Ga0207671_101584223 96
1128 3300025914 Ga0207671_10354632 Ga0207671_103546322 96
1129 3300025914 Ga0207671_10480940 Ga0207671_104809402 96
1130 3300025914 Ga0207671_10621689 Ga0207671_106216892 96
1131 3300025915 Ga0207693_10024385 Ga0207693_100243857 96
1132 3300025915 Ga0207693_10216375 Ga0207693_102163752 96
1133 3300025915 Ga0207693_10312398 Ga0207693_103123982 96
1134 3300025915 Ga0207693_11474147 Ga0207693_114741471 96
1135 3300025916 Ga0207663_10350984 Ga0207663_103509841 96
1136 3300025916 Ga0207663_10573058 Ga0207663_105730582 96
1137 3300025916 Ga0207663_10914653 Ga0207663_109146532 96
1138 3300025916 Ga0207663_11278020 Ga0207663_112780202 96
1139 3300025917 Ga0207660_10003004 Ga0207660_100030049 96
1140 3300025917 Ga0207660_10043689 Ga0207660_100436894 96
1141 3300025917 Ga0207660_10153020 Ga0207660_101530202 96
1142 3300025917 Ga0207660_10243075 Ga0207660_102430752 96
1143 3300025917 Ga0207660_10371451 Ga0207660_103714513 96
1144 3300025917 Ga0207660_10700122 Ga0207660_107001222 96
1145 3300025917 Ga0207660_11152826 Ga0207660_111528262 96
1146 3300025919 Ga0207657_10037137 Ga0207657_100371378 96
1147 3300025919 Ga0207657_10063406 Ga0207657_100634062 96
1148 3300025919 Ga0207657_10423466 Ga0207657_104234662 96
1149 3300025920 Ga0207649_10000194 Ga0207649_1000019456 96
1150 3300025920 Ga0207649_10176862 Ga0207649_101768623 96
1151 3300025920 Ga0207649_10251578 Ga0207649_102515783 96
1152 3300025920 Ga0207649_10255186 Ga0207649_102551862 96
1153 3300025920 Ga0207649_10476632 Ga0207649_104766322 96
1154 3300025920 Ga0207649_10568649 Ga0207649_105686492 96
1155 3300025921 Ga0207652_10108322 Ga0207652_101083222 96
1156 3300025921 Ga0207652_10150019 Ga0207652_101500191 96
1157 3300025921 Ga0207652_10206951 Ga0207652_102069513 96
1158 3300025921 Ga0207652_10454365 Ga0207652_104543653 96
1159 3300025921 Ga0207652_10708442 Ga0207652_107084422 96
1160 3300025921 Ga0207652_10716193 Ga0207652_107161932 96
1161 3300025921 Ga0207652_11243291 Ga0207652_112432912 96
1162 3300025921 Ga0207652_11545672 Ga0207652_115456722 96
1163 3300025922 Ga0207646_10680554 Ga0207646_106805541 96
1164 3300025923 Ga0207681_10026657 Ga0207681_100266574 96
1165 3300025923 Ga0207681_10142714 Ga0207681_101427142 96
1166 3300025923 Ga0207681_10284058 Ga0207681_102840583 96
1167 3300025924 Ga0207694_10022428 Ga0207694_100224282 96
1168 3300025924 Ga0207694_10042706 Ga0207694_100427063 96
1169 3300025924 Ga0207694_10221393 Ga0207694_102213932 96
1170 3300025924 Ga0207694_10592428 Ga0207694_105924282 96
1171 3300025924 Ga0207694_11360236 Ga0207694_113602361 96
1172 3300025924 Ga0207694_11390346 Ga0207694_113903462 96
1173 3300025924 Ga0207694_11424682 Ga0207694_114246822 96
1174 3300025924 Ga0207694_11523464 Ga0207694_115234641 96
1175 3300025924 Ga0207694_11894025 Ga0207694_118940251 96
1176 3300025925 Ga0207650_10171098 Ga0207650_101710982 96
1177 3300025925 Ga0207650_10425877 Ga0207650_104258772 96
1178 3300025925 Ga0207650_10540337 Ga0207650_105403371 96
1179 3300025925 Ga0207650_10781595 Ga0207650_107815951 96
1180 3300025925 Ga0207650_11071988 Ga0207650_110719881 96
1181 3300025926 Ga0207659_10166081 Ga0207659_101660814 96
1182 3300025926 Ga0207659_10367555 Ga0207659_103675552 96
1183 3300025927 Ga0207687_10085895 Ga0207687_100858955 96
1184 3300025927 Ga0207687_10215504 Ga0207687_102155042 96
1185 3300025927 Ga0207687_10311953 Ga0207687_103119533 96
1186 3300025927 Ga0207687_10402010 Ga0207687_104020101 96
1187 3300025927 Ga0207687_11544316 Ga0207687_115443161 96
1188 3300025928 Ga0207700_10020136 Ga0207700_1002013610 96
1189 3300025928 Ga0207700_10121231 Ga0207700_101212313 96
1190 3300025928 Ga0207700_10145860 Ga0207700_101458601 96
1191 3300025928 Ga0207700_10322910 Ga0207700_103229102 96
1192 3300025928 Ga0207700_11114427 Ga0207700_111144271 96
1193 3300025929 Ga0207664_10015881 Ga0207664_1001588110 96
1194 3300025929 Ga0207664_11000656 Ga0207664_110006562 96
1195 3300025929 Ga0207664_11926278 Ga0207664_119262782 96
1196 3300025931 Ga0207644_10400322 Ga0207644_104003221 96
1197 3300025931 Ga0207644_11071391 Ga0207644_110713912 96
1198 3300025932 Ga0207690_10029346 Ga0207690_100293466 96
1199 3300025932 Ga0207690_10332331 Ga0207690_103323313 96
1200 3300025932 Ga0207690_11299527 Ga0207690_112995272 96
1201 3300025934 Ga0207686_10137320 Ga0207686_101373203 96
1202 3300025934 Ga0207686_10380969 Ga0207686_103809692 96
1203 3300025934 Ga0207686_10602867 Ga0207686_106028672 96
1204 3300025934 Ga0207686_10807746 Ga0207686_108077462 96
1205 3300025935 Ga0207709_10018685 Ga0207709_100186854 96
1206 3300025935 Ga0207709_10125051 Ga0207709_101250514 96
1207 3300025936 Ga0207670_10028318 Ga0207670_100283186 96
1208 3300025936 Ga0207670_10566270 Ga0207670_105662702 96
1209 3300025936 Ga0207670_10850450 Ga0207670_108504502 96
1210 3300025937 Ga0207669_10093454 Ga0207669_100934544 96
1211 3300025937 Ga0207669_10171086 Ga0207669_101710862 96
1212 3300025937 Ga0207669_10438509 Ga0207669_104385091 96
1213 3300025937 Ga0207669_10621926 Ga0207669_106219262 96
1214 3300025937 Ga0207669_10955462 Ga0207669_109554622 96
1215 3300025938 Ga0207704_10068198 Ga0207704_100681986 96
1216 3300025938 Ga0207704_10600811 Ga0207704_106008112 96
1217 3300025938 Ga0207704_10647320 Ga0207704_106473202 96
1218 3300025939 Ga0207665_10096951 Ga0207665_100969514 96
1219 3300025939 Ga0207665_10159215 Ga0207665_101592152 96
1220 3300025939 Ga0207665_10473408 Ga0207665_104734082 96
1221 3300025941 Ga0207711_10145656 Ga0207711_101456565 96
1222 3300025941 Ga0207711_10316184 Ga0207711_103161843 96
1223 3300025941 Ga0207711_10349566 Ga0207711_103495663 96
1224 3300025941 Ga0207711_10807876 Ga0207711_108078762 96
1225 3300025941 Ga0207711_11629537 Ga0207711_116295371 96
1226 3300025941 Ga0207711_11655553 Ga0207711_116555532 96
1227 3300025942 Ga0207689_10101680 Ga0207689_101016805 96
1228 3300025942 Ga0207689_10362866 Ga0207689_103628662 96
1229 3300025942 Ga0207689_11736626 Ga0207689_117366261 96
1230 3300025944 Ga0207661_10144696 Ga0207661_101446962 96
1231 3300025944 Ga0207661_10219381 Ga0207661_102193813 96
1232 3300025944 Ga0207661_10344571 Ga0207661_103445712 96
1233 3300025944 Ga0207661_10367957 Ga0207661_103679572 96
1234 3300025944 Ga0207661_10475832 Ga0207661_104758322 96
1235 3300025944 Ga0207661_11323273 Ga0207661_113232732 96
1236 3300025945 Ga0207679_10316118 Ga0207679_103161182 96
1237 3300025945 Ga0207679_10328620 Ga0207679_103286201 96
1238 3300025945 Ga0207679_11781860 Ga0207679_117818602 96
1239 3300025945 Ga0207679_11808868 Ga0207679_118088682 96
1240 3300025949 Ga0207667_10032409 Ga0207667_1003240912 96
1241 3300025949 Ga0207667_10128005 Ga0207667_101280052 96
1242 3300025949 Ga0207667_10190159 Ga0207667_101901593 96
1243 3300025949 Ga0207667_10769303 Ga0207667_107693032 96
1244 3300025949 Ga0207667_10776395 Ga0207667_107763952 96
1245 3300025949 Ga0207667_10884612 Ga0207667_108846122 96
1246 3300025949 Ga0207667_10988496 Ga0207667_109884962 96
1247 3300025949 Ga0207667_11353364 Ga0207667_113533642 96
1248 3300025960 Ga0207651_10169073 Ga0207651_101690732 96
1249 3300025960 Ga0207651_10532437 Ga0207651_105324372 96
1250 3300025960 Ga0207651_10865417 Ga0207651_108654172 96
1251 3300025960 Ga0207651_10968028 Ga0207651_109680282 96
1252 3300025961 Ga0207712_10027952 Ga0207712_100279522 96
1253 3300025961 Ga0207712_10029987 Ga0207712_100299876 96
1254 3300025961 Ga0207712_10392655 Ga0207712_103926552 96
1255 3300025961 Ga0207712_10409159 Ga0207712_104091592 96
1256 3300025961 Ga0207712_11434537 Ga0207712_114345372 96
1257 3300025972 Ga0207668_10076092 Ga0207668_100760922 96
1258 3300025972 Ga0207668_10753316 Ga0207668_107533162 96
1259 3300025972 Ga0207668_10860902 Ga0207668_108609022 96
1260 3300025972 Ga0207668_11101471 Ga0207668_111014712 96
1261 3300025981 Ga0207640_10274539 Ga0207640_102745393 96
1262 3300025981 Ga0207640_10778413 Ga0207640_107784132 96
1263 3300025986 Ga0207658_10058513 Ga0207658_100585132 96
1264 3300025986 Ga0207658_10167494 Ga0207658_101674942 96
1265 3300025986 Ga0207658_10708259 Ga0207658_107082592 96
1266 3300025986 Ga0207658_11350037 Ga0207658_113500372 96
1267 3300025986 Ga0207658_11552969 Ga0207658_115529691 96
1268 3300025986 Ga0207658_11823000 Ga0207658_118230001 96
1269 3300026023 Ga0207677_10368238 Ga0207677_103682382 96
1270 3300026023 Ga0207677_10731759 Ga0207677_107317592 96
1271 3300026023 Ga0207677_10809695 Ga0207677_108096952 96
1272 3300026035 Ga0207703_10027678 Ga0207703_100276782 96
1273 3300026035 Ga0207703_10097052 Ga0207703_100970521 96
1274 3300026035 Ga0207703_10761871 Ga0207703_107618712 96
1275 3300026035 Ga0207703_11793975 Ga0207703_117939752 96
1276 3300026041 Ga0207639_10060119 Ga0207639_100601195 96
1277 3300026041 Ga0207639_10114112 Ga0207639_101141124 96
1278 3300026041 Ga0207639_10147933 Ga0207639_101479335 96
1279 3300026041 Ga0207639_10369626 Ga0207639_103696263 96
1280 3300026041 Ga0207639_10752376 Ga0207639_107523763 96
1281 3300026041 Ga0207639_10846791 Ga0207639_108467912 96
1282 3300026041 Ga0207639_11656380 Ga0207639_116563802 96
1283 3300026067 Ga0207678_10000118 Ga0207678_1000011844 96
1284 3300026075 Ga0207708_10346128 Ga0207708_103461282 96
1285 3300026075 Ga0207708_10770664 Ga0207708_107706642 96
1286 3300026078 Ga0207702_10226977 Ga0207702_102269774 96
1287 3300026078 Ga0207702_10897278 Ga0207702_108972782 96
1288 3300026078 Ga0207702_10950716 Ga0207702_109507162 96
1289 3300026078 Ga0207702_11129747 Ga0207702_111297472 96
1290 3300026078 Ga0207702_11445335 Ga0207702_114453351 96
1291 3300026088 Ga0207641_10035109 Ga0207641_100351096 96
1292 3300026088 Ga0207641_10215049 Ga0207641_102150494 96
1293 3300026088 Ga0207641_10636383 Ga0207641_106363831 96
1294 3300026088 Ga0207641_10792941 Ga0207641_107929413 96
1295 3300026088 Ga0207641_11176651 Ga0207641_111766511 96
1296 3300026089 Ga0207648_10154508 Ga0207648_101545084 96
1297 3300026089 Ga0207648_10238236 Ga0207648_102382363 96
1298 3300026089 Ga0207648_10421221 Ga0207648_104212212 96
1299 3300026089 Ga0207648_11260003 Ga0207648_112600032 96
1300 3300026095 Ga0207676_10275805 Ga0207676_102758053 96
1301 3300026095 Ga0207676_10405870 Ga0207676_104058702 96
1302 3300026095 Ga0207676_10530481 Ga0207676_105304813 96
1303 3300026095 Ga0207676_10996869 Ga0207676_109968691 96
1304 3300026095 Ga0207676_11190143 Ga0207676_111901432 96
1305 3300026116 Ga0207674_10135964 Ga0207674_101359645 96
1306 3300026116 Ga0207674_10345588 Ga0207674_103455883 96
1307 3300026116 Ga0207674_10511916 Ga0207674_105119161 96
1308 3300026116 Ga0207674_10772138 Ga0207674_107721382 96
1309 3300026118 Ga0207675_100163578 Ga0207675_1001635783 96
1310 3300026118 Ga0207675_100486730 Ga0207675_1004867302 96
1311 3300026118 Ga0207675_100615881 Ga0207675_1006158813 96
1312 3300026121 Ga0207683_10018489 Ga0207683_100184899 96
1313 3300026121 Ga0207683_10026403 Ga0207683_100264038 96
1314 3300026121 Ga0207683_10103171 Ga0207683_101031713 96
1315 3300026121 Ga0207683_10237421 Ga0207683_102374213 96
1316 3300026121 Ga0207683_10263843 Ga0207683_102638433 96
1317 3300026121 Ga0207683_10380731 Ga0207683_103807312 96
1318 3300026142 Ga0207698_10074815 Ga0207698_100748155 96
1319 3300026142 Ga0207698_10127754 Ga0207698_101277544 96
1320 3300026142 Ga0207698_10144541 Ga0207698_101445414 96
1321 3300026142 Ga0207698_10668335 Ga0207698_106683352 96
1322 3300027471 Ga0209995_1004561 Ga0209995_10045612 96
1323 3300027512 Ga0209179_1000116 Ga0209179_100011613 96
1324 3300027665 Ga0209983_1006615 Ga0209983_10066156 96
1325 3300027695 Ga0209966_1000641 Ga0209966_100064111 96
1326 3300027907 Ga0207428_10000169 Ga0207428_1000016974 96
1327 3300027907 Ga0207428_10030716 Ga0207428_100307164 96
1328 3300027907 Ga0207428_10885962 Ga0207428_108859622 96
1329 3300028379 Ga0268266_10000557 Ga0268266_1000055716 96
1330 3300028379 Ga0268266_10005613 Ga0268266_1000561317 96
1331 3300028379 Ga0268266_10055515 Ga0268266_100555152 96
1332 3300028379 Ga0268266_10076582 Ga0268266_100765827 96
1333 3300028379 Ga0268266_10092509 Ga0268266_100925095 96
1334 3300028379 Ga0268266_10095842 Ga0268266_100958422 96
1335 3300028379 Ga0268266_10155348 Ga0268266_101553484 96
1336 3300028379 Ga0268266_10166733 Ga0268266_101667332 96
1337 3300028379 Ga0268266_10439319 Ga0268266_104393193 96
1338 3300028379 Ga0268266_10854206 Ga0268266_108542062 96
1339 3300028379 Ga0268266_11351711 Ga0268266_113517112 96
1340 3300028379 Ga0268266_11571301 Ga0268266_115713011 96
1341 3300028379 Ga0268266_11720622 Ga0268266_117206221 96
1342 3300028379 Ga0268266_12070157 Ga0268266_120701571 96
1343 3300028380 Ga0268265_10010282 Ga0268265_100102825 96
1344 3300028380 Ga0268265_10035295 Ga0268265_100352955 96
1345 3300028380 Ga0268265_10272456 Ga0268265_102724564 96
1346 3300028380 Ga0268265_11170634 Ga0268265_111706341 96
1347 3300028380 Ga0268265_11214200 Ga0268265_112142001 96
1348 3300028380 Ga0268265_11592757 Ga0268265_115927572 96
1349 3300028381 Ga0268264_10525570 Ga0268264_105255702 96
1350 3300028381 Ga0268264_11786672 Ga0268264_117866721 96
1351 3300028556 Ga0265337_1029032 Ga0265337_10290323 96
1352 3300028794 Ga0307515_10072629 Ga0307515_100726297 96
1353 3300028800 Ga0265338_10002896 Ga0265338_1000289631 96
1354 3300028800 Ga0265338_10008853 Ga0265338_1000885316 96
1355 3300028800 Ga0265338_10252984 Ga0265338_102529842 96
1356 3300029957 Ga0265324_10010483 Ga0265324_100104838 96
1357 3300029957 Ga0265324_10067274 Ga0265324_100672743 96
1358 3300030522 Ga0307512_10143919 Ga0307512_101439191 96
1359 3300030836 Ga0265767_105512 Ga0265767_1055122 96
1360 3300030863 Ga0265766_1006157 Ga0265766_10061572 96
1361 3300030882 Ga0265764_109258 Ga0265764_1092581 96
1362 3300030889 Ga0265761_109076 Ga0265761_1090761 96
1363 3300031090 Ga0265760_10212807 Ga0265760_102128071 96
1364 3300031240 Ga0265320_10022900 Ga0265320_100229005 96
1365 3300031242 Ga0265329_10324821 Ga0265329_103248212 96
1366 3300031247 Ga0265340_10042240 Ga0265340_100422403 96
1367 3300031250 Ga0265331_10000543 Ga0265331_1000054338 96
1368 3300031250 Ga0265331_10003502 Ga0265331_1000350216 96
1369 3300031250 Ga0265331_10013838 Ga0265331_100138385 96
1370 3300031250 Ga0265331_10016732 Ga0265331_100167328 96
1371 3300031250 Ga0265331_10171878 Ga0265331_101718783 96
1372 3300031250 Ga0265331_10249395 Ga0265331_102493952 96
1373 3300031251 Ga0265327_10000392 Ga0265327_10000392122 96
1374 3300031251 Ga0265327_10001257 Ga0265327_1000125733 96
1375 3300031251 Ga0265327_10082992 Ga0265327_100829922 96
1376 3300031251 Ga0265327_10188601 Ga0265327_101886012 96
1377 3300031251 Ga0265327_10357150 Ga0265327_103571502 96
1378 3300031344 Ga0265316_10023098 Ga0265316_100230985 96
1379 3300031344 Ga0265316_10228372 Ga0265316_102283723 96
1380 3300031456 Ga0307513_10545964 Ga0307513_105459641 96
1381 3300031548 Ga0307408_100343964 Ga0307408_1003439643 96
1382 3300031548 Ga0307408_100857199 Ga0307408_1008571992 96
1383 3300031595 Ga0265313_10004521 Ga0265313_1000452115 96
1384 3300031616 Ga0307508_10130442 Ga0307508_101304423 96
1385 3300031616 Ga0307508_10851291 Ga0307508_108512911 96
1386 3300031711 Ga0265314_10016595 Ga0265314_100165956 96
1387 3300031711 Ga0265314_10023749 Ga0265314_1002374910 96
1388 3300031711 Ga0265314_10056619 Ga0265314_100566194 96
1389 3300031711 Ga0265314_10107669 Ga0265314_101076692 96
1390 3300031711 Ga0265314_10179813 Ga0265314_101798132 96
1391 3300031711 Ga0265314_10648649 Ga0265314_106486492 96
1392 3300031730 Ga0307516_10069198 Ga0307516_100691984 96
1393 3300031730 Ga0307516_10128092 Ga0307516_101280923 96
1394 3300031730 Ga0307516_10239808 Ga0307516_102398083 96
1395 3300031730 Ga0307516_10646932 Ga0307516_106469321 96
1396 3300031731 Ga0307405_10794865 Ga0307405_107948652 96
1397 3300031731 Ga0307405_11447559 Ga0307405_114475591 96
1398 3300031824 Ga0307413_10024003 Ga0307413_100240038 96
1399 3300031852 Ga0307410_10015925 Ga0307410_100159256 96
1400 3300031852 Ga0307410_11938915 Ga0307410_119389151 96
1401 3300031901 Ga0307406_10576971 Ga0307406_105769712 96
1402 3300031901 Ga0307406_10863544 Ga0307406_108635442 96
1403 3300031903 Ga0307407_10020831 Ga0307407_100208315 96
1404 3300031903 Ga0307407_10154073 Ga0307407_101540731 96
1405 3300031903 Ga0307407_11490343 Ga0307407_114903431 96
1406 3300031903 Ga0307407_11593366 Ga0307407_115933661 96
1407 3300031911 Ga0307412_10319743 Ga0307412_103197433 96
1408 3300031911 Ga0307412_11991834 Ga0307412_119918341 96
1409 3300031995 Ga0307409_100305410 Ga0307409_1003054103 96
1410 3300031995 Ga0307409_100803285 Ga0307409_1008032852 96
1411 3300032002 Ga0307416_100088575 Ga0307416_1000885753 96
1412 3300032002 Ga0307416_101046865 Ga0307416_1010468652 96
1413 3300032002 Ga0307416_102437823 Ga0307416_1024378231 96
1414 3300032005 Ga0307411_10038579 Ga0307411_100385797 96
1415 3300032005 Ga0307411_10758494 Ga0307411_107584942 96
1416 3300032005 Ga0307411_11477840 Ga0307411_114778402 96
1417 3300032005 Ga0307411_11740186 Ga0307411_117401861 96
1418 3300032126 Ga0307415_100734163 Ga0307415_1007341633 96
1419 3300032126 Ga0307415_100893816 Ga0307415_1008938162 96
1420 3300032168 Ga0316593_10011301 Ga0316593_100113013 96
1421 3300032168 Ga0316593_10039890 Ga0316593_100398901 96
1422 3300032168 Ga0316593_10039922 Ga0316593_100399221 96
1423 3300033180 Ga0307510_10135648 Ga0307510_101356484 96
1424 3300033180 Ga0307510_10628395 Ga0307510_106283951 96
1425 3300033528 Ga0316588_1031798 Ga0316588_10317982 96
1426 3300034816 Ga0373930_0000191 Ga0373930_0000191_2968_3273 96
1427 3300034816 Ga0373930_0013501 Ga0373930_0013501_715_1020 96
1428 3300034817 Ga0373948_0002325 Ga0373948_0002325_481_786 96
1429 3300034818 Ga0373950_0000155 Ga0373950_0000155_9257_9562 96
1430 3300034819 Ga0373958_0002981 Ga0373958_0002981_2012_2317 96
1431 3300034820 Ga0373959_0001384 Ga0373959_0001384_1520_1825 96
1432 3300034957 Ga0373938_0000013 Ga0373938_0000013_3161_3466 96
1433 3300035084 Ga0373928_0000255 Ga0373928_0000255_8459_8764 96
1434 3300035085 Ga0373929_0003185 Ga0373929_0003185_677_982 96
1435 3300035086 Ga0373934_0275744 Ga0373934_0275744_36_341 96
1436 3300035088 Ga0373940_0001317 Ga0373940_0001317_4031_4336 96
1437 3300035090 Ga0373949_0001716 Ga0373949_0001716_659_964 96
1438 3300035091 Ga0373951_0000552 Ga0373951_0000552_4652_4957 96
1439 3300035092 Ga0373952_0000182 Ga0373952_0000182_2002_2307 96
1440 3300035111 Ga0373923_0002759 Ga0373923_0002759_2299_2604 96
1441 3300035111 Ga0373923_0040828 Ga0373923_0040828_394_699 96
1442 3300035111 Ga0373923_0096666 Ga0373923_0096666_704_1009 96
1443 3300035112 Ga0373932_0000252 Ga0373932_0000252_1416_1721 96
1444 3300035112 Ga0373932_0230488 Ga0373932_0230488_183_488 96
1445 3300035113 Ga0373936_0033903 Ga0373936_0033903_741_1046 96
1446 3300035113 Ga0373936_0276834 Ga0373936_0276834_69_374 96
1447 3300035113 Ga0373936_0277884 Ga0373936_0277884_254_559 96
1448 3300035113 Ga0373936_0447114 Ga0373936_0447114_166_471 96
1449 3300035114 Ga0373939_0006119 Ga0373939_0006119_1929_2234 96
1450 3300035115 Ga0373941_0036248 Ga0373941_0036248_889_1194 96
1451 3300035115 Ga0373941_0101183 Ga0373941_0101183_513_818 96
1452 3300035115 Ga0373941_0322843 Ga0373941_0322843_161_466 96
1453 3300035116 Ga0373945_0018664 Ga0373945_0018664_245_550 96
1454 3300035116 Ga0373945_0459882 Ga0373945_0459882_184_489 96
1455 3300035117 Ga0373953_0269230 Ga0373953_0269230_46_351 96
1456 3300035117 Ga0373953_0573873 Ga0373953_0573873_91_396 96
1457 3300035118 Ga0373954_0022106 Ga0373954_0022106_1223_1528 96
1458 3300035118 Ga0373954_0340621 Ga0373954_0340621_259_564 96
1459 3300035118 Ga0373954_0386414 Ga0373954_0386414_206_511 96
1460 3300035119 Ga0373956_0053480 Ga0373956_0053480_473_778 96
1461 3300035120 Ga0373957_0013550 Ga0373957_0013550_766_1071 96
1462 3300035121 Ga0373960_0000068 Ga0373960_0000068_9465_9770 96
1463 3300035121 Ga0373960_0074297 Ga0373960_0074297_599_904 96
1464 3300035121 Ga0373960_0091460 Ga0373960_0091460_286_591 96
1465 3300035170 Ga0373943_0058840 Ga0373943_0058840_1535_1840 96
1466 3300035170 Ga0373943_0063345 Ga0373943_0063345_813_1118 96
1467 3300035170 Ga0373943_0263265 Ga0373943_0263265_548_853 96
1468 3300035170 Ga0373943_0292669 Ga0373943_0292669_307_612 96
1469 3300035171 Ga0373946_0194612 Ga0373946_0194612_536_841 96
1470 3300035171 Ga0373946_0370831 Ga0373946_0370831_25_330 96
1471 3300035172 Ga0373955_0028306 Ga0373955_0028306_1927_2232 96
1472 3300035172 Ga0373955_0125577 Ga0373955_0125577_177_482 96
1473 3300035172 Ga0373955_0163547 Ga0373955_0163547_638_943 96
1474 3300035207 Ga0373942_0001815 Ga0373942_0001815_3159_3464 96
1475 3300035241 Ga0373961_0003115 Ga0373961_0003115_3833_4138 96
1476 3300035242 Ga0373962_0000112 Ga0373962_0000112_10803_11108 96
1477 3300035242 Ga0373962_0409820 Ga0373962_0409820_88_393 96
1478 3300035691 Ga0373931_0001634 Ga0373931_0001634_3709_4014 96
1479 3300035691 Ga0373931_0121321 Ga0373931_0121321_946_1251 96
1480 3300035691 Ga0373931_0508275 Ga0373931_0508275_373_678 96
1481 3300035691 Ga0373931_0573337 Ga0373931_0573337_169_474 96
1482 3300035692 Ga0373935_0004282 Ga0373935_0004282_6155_6460 96
1483 3300035692 Ga0373935_0027495 Ga0373935_0027495_1348_1653 96
1484 3300035692 Ga0373935_0069246 Ga0373935_0069246_1195_1500 96
1485 3300035692 Ga0373935_0133269 Ga0373935_0133269_390_695 96
1486 3300035692 Ga0373935_0360337 Ga0373935_0360337_709_1014 96
1487 3300035692 Ga0373935_1295526 Ga0373935_1295526_124_429 96
1488 3300035695 Ga0373927_0148977 Ga0373927_0148977_112_417 96
1489 3300035695 Ga0373927_0174637 Ga0373927_0174637_722_1027 96
1490 3300035695 Ga0373927_0196004 Ga0373927_0196004_693_998 96
1491 3300035695 Ga0373927_0238366 Ga0373927_0238366_337_642 96
1492 3300035695 Ga0373927_0248463 Ga0373927_0248463_830_1135 96
1493 3300035695 Ga0373927_0382694 Ga0373927_0382694_313_618 96
1494 3300035724 Ga0373933_0013505 Ga0373933_0013505_2157_2462 96
1495 3300035724 Ga0373933_0117754 Ga0373933_0117754_252_557 96
1496 3300035724 Ga0373933_0288470 Ga0373933_0288470_290_595 96
1497 3300035724 Ga0373933_0855275 Ga0373933_0855275_46_351 96
1498 3300035725 Ga0373947_0064868 Ga0373947_0064868_372_677 96
1499 3300035725 Ga0373947_0065025 Ga0373947_0065025_1273_1578 96
1500 3300035725 Ga0373947_0076251 Ga0373947_0076251_1622_1927 96
1501 3300035725 Ga0373947_0084575 Ga0373947_0084575_94_399 96
1502 3300035725 Ga0373947_0185690 Ga0373947_0185690_907_1212 96
1503 3300035725 Ga0373947_0531279 Ga0373947_0531279_357_662 96
1504 3300036401 Ga0373937_0000922 Ga0373937_0000922_14149_14454 96
1505 3300036401 Ga0373937_0008630 Ga0373937_0008630_8274_8579 96
1506 3300036401 Ga0373937_0032792 Ga0373937_0032792_3857_4162 96
1507 3300036401 Ga0373937_0062577 Ga0373937_0062577_2537_2842 96
1508 3300036401 Ga0373937_0083755 Ga0373937_0083755_2518_2823 96
1509 3300036401 Ga0373937_0178272 Ga0373937_0178272_1084_1389 96
1510 3300036401 Ga0373937_1094240 Ga0373937_1094240_271_576 96
1511 3300036457 Ga0265778_001977 Ga0265778_001977_128_433 96
1512 3300036457 Ga0265778_031317 Ga0265778_031317_105_410 96
1513 3300037068 Ga0373925_0008231 Ga0373925_0008231_1024_1329 96
1514 3300037068 Ga0373925_0040367 Ga0373925_0040367_2582_2887 96
1515 3300037068 Ga0373925_0041086 Ga0373925_0041086_753_1058 96
1516 3300037068 Ga0373925_0194637 Ga0373925_0194637_1012_1317 96
1517 3300037312 Ga0395899_0066694 Ga0395899_0066694_1913_2218 96
1518 3300037312 Ga0395899_0081254 Ga0395899_0081254_359_664 96
1519 3300037312 Ga0395899_0105847 Ga0395899_0105847_980_1285 96
1520 3300037418 Ga0395900_0021199 Ga0395900_0021199_473_778 96
1521 3300037418 Ga0395900_0451558 Ga0395900_0451558_665_970 96
1522 3300037418 Ga0395900_0452931 Ga0395900_0452931_349_654 96
1523 3300037418 Ga0395900_0597435 Ga0395900_0597435_122_427 96
1524 3300037418 Ga0395900_1408335 Ga0395900_1408335_248_553 96
1525 3300037466 Ga0395898_0079037 Ga0395898_0079037_728_1033 96
1526 3300037466 Ga0395898_0126504 Ga0395898_0126504_502_807 96
1527 3300037466 Ga0395898_0371181 Ga0395898_0371181_609_914 96
1528 3300037466 Ga0395898_0490950 Ga0395898_0490950_62_367 96
1529 3300037466 Ga0395898_1107123 Ga0395898_1107123_283_588 96
1530 3300037466 Ga0395898_1190711 Ga0395898_1190711_96_401 96
1531 3300037466 Ga0395898_1637903 Ga0395898_1637903_133_438 96
1532 3300037471 Ga0395905_0500202 Ga0395905_0500202_415_720 96
1533 3300037471 Ga0395905_1284528 Ga0395905_1284528_244_549 96
1534 3300037853 Ga0436364_0043783 Ga0436364_0043783_343_648 96
1535 3300037853 Ga0436364_0229979 Ga0436364_0229979_277_582 96
1536 3300037853 Ga0436364_0268578 Ga0436364_0268578_2490_2795 96
1537 3300037853 Ga0436364_0333490 Ga0436364_0333490_126_431 96
1538 3300037853 Ga0436364_0460289 Ga0436364_0460289_20_325 96
1539 3300037853 Ga0436364_0539801 Ga0436364_0539801_156_461 96
1540 3300037853 Ga0436364_0554982 Ga0436364_0554982_540_845 96
1541 3300037853 Ga0436364_0586291 Ga0436364_0586291_6842_7147 96
1542 3300037853 Ga0436364_0764338 Ga0436364_0764338_26540_26845 96
1543 3300037853 Ga0436364_1062354 Ga0436364_1062354_5110_5415 96
1544 3300037853 Ga0436364_1442444 Ga0436364_1442444_2164_2469 96
1545 3300037853 Ga0436364_1552061 Ga0436364_1552061_210_515 96
1546 3300038443 Ga0395901_0097542 Ga0395901_0097542_1432_1737 96
1547 3300038443 Ga0395901_0148983 Ga0395901_0148983_913_1218 96
1548 3300038443 Ga0395901_0177540 Ga0395901_0177540_469_774 96
1549 3300038443 Ga0395901_0213059 Ga0395901_0213059_810_1115 96
1550 3300038443 Ga0395901_0865522 Ga0395901_0865522_508_813 96
1551 3300038443 Ga0395901_0910439 Ga0395901_0910439_350_655 96
1552 3300038443 Ga0395901_1229977 Ga0395901_1229977_394_699 96
1553 3300038443 Ga0395901_2014754 Ga0395901_2014754_31_336 96
1554 3300038698 Ga0242419_011998 Ga0242419_011998_271_576 96
1555 3300038996 Ga0242420_001271 Ga0242420_001271_353_658 96
1556 3300039437 Ga0436365_0507021 Ga0436365_0507021_250_555 96
1557 3300039437 Ga0436365_0678411 Ga0436365_0678411_48_353 96
1558 3300039437 Ga0436365_1050783 Ga0436365_1050783_1794_2099 96
1559 3300039437 Ga0436365_1075680 Ga0436365_1075680_530_835 96
1560 3300039437 Ga0436365_1215018 Ga0436365_1215018_2818_3123 96
1561 3300039437 Ga0436365_1623855 Ga0436365_1623855_24_329 96
1562 3300039437 Ga0436365_1790914 Ga0436365_1790914_746_1051 96
1563 3300039437 Ga0436365_1902383 Ga0436365_1902383_313_618 96
1564 3300039438 Ga0436360_0232519 Ga0436360_0232519_186_491 96
1565 3300039438 Ga0436360_0248409 Ga0436360_0248409_484_789 96
1566 3300039438 Ga0436360_0259420 Ga0436360_0259420_286_591 96
1567 3300039438 Ga0436360_0272188 Ga0436360_0272188_285_590 96
1568 3300039438 Ga0436360_0360048 Ga0436360_0360048_1672_1977 96
1569 3300039438 Ga0436360_0493064 Ga0436360_0493064_79_384 96
1570 3300039438 Ga0436360_0527459 Ga0436360_0527459_237_542 96
1571 3300039438 Ga0436360_0663233 Ga0436360_0663233_27_332 96
1572 3300039438 Ga0436360_0765106 Ga0436360_0765106_46_351 96
1573 3300039438 Ga0436360_0846287 Ga0436360_0846287_908_1213 96
1574 3300039438 Ga0436360_1065206 Ga0436360_1065206_206_511 96
1575 3300039438 Ga0436360_1169610 Ga0436360_1169610_184_489 96
1576 3300039438 Ga0436360_1205890 Ga0436360_1205890_111_416 96
1577 3300039438 Ga0436360_1229176 Ga0436360_1229176_3303_3608 96
1578 3300039438 Ga0436360_1302627 Ga0436360_1302627_332_637 96
1579 3300039447 Ga0436361_0016113 Ga0436361_0016113_1899_2204 96
1580 3300039447 Ga0436361_0045826 Ga0436361_0045826_92_397 96
1581 3300039447 Ga0436361_0057420 Ga0436361_0057420_178_483 96
1582 3300039447 Ga0436361_0291526 Ga0436361_0291526_683_988 96
1583 3300039447 Ga0436361_0299606 Ga0436361_0299606_683_988 96
1584 3300039447 Ga0436361_0518587 Ga0436361_0518587_151_456 96
1585 3300039447 Ga0436361_0585521 Ga0436361_0585521_87_392 96
1586 3300039447 Ga0436361_0598899 Ga0436361_0598899_187_492 96
1587 3300039447 Ga0436361_0627073 Ga0436361_0627073_522_827 96
1588 3300039447 Ga0436361_0663751 Ga0436361_0663751_51_356 96
1589 3300039447 Ga0436361_0765661 Ga0436361_0765661_455_760 96
1590 3300039447 Ga0436361_0783925 Ga0436361_0783925_811_1116 96
1591 3300039447 Ga0436361_0878406 Ga0436361_0878406_1273_1578 96
1592 3300039447 Ga0436361_1000576 Ga0436361_1000576_201_506 96
1593 3300039447 Ga0436361_1164878 Ga0436361_1164878_6318_6623 96
1594 3300039447 Ga0436361_1167977 Ga0436361_1167977_442_747 96
1595 3300039450 Ga0436363_0247885 Ga0436363_0247885_159_464 96
1596 3300039450 Ga0436363_0315020 Ga0436363_0315020_1915_2220 96
1597 3300039450 Ga0436363_0548499 Ga0436363_0548499_70_375 96
1598 3300039450 Ga0436363_0687461 Ga0436363_0687461_183_488 96
1599 3300039450 Ga0436363_0799449 Ga0436363_0799449_326_631 96
1600 3300039450 Ga0436363_0819400 Ga0436363_0819400_276_581 96
1601 3300039450 Ga0436363_1206715 Ga0436363_1206715_208_513 96
1602 3300039450 Ga0436363_1250759 Ga0436363_1250759_916_1221 96
1603 3300039450 Ga0436363_1566193 Ga0436363_1566193_257_562 96
1604 3300039453 Ga0436362_0830432 Ga0436362_0830432_291_596 96
1605 3300039453 Ga0436362_0967331 Ga0436362_0967331_1283_1588 96
1606 3300039453 Ga0436362_1174560 Ga0436362_1174560_35_340 96
1607 3300039453 Ga0436362_1218939 Ga0436362_1218939_249_554 96
1608 3300041406 Ga0439439_0146717 Ga0439439_0146717_46_351 96
1609 3300041411 Ga0439466_0098324 Ga0439466_0098324_366_671 96
1610 3300041451 Ga0451791_0161050 Ga0451791_0161050_392_697 96
1611 3300041452 Ga0451793_0993829 Ga0451793_0993829_409_714 96
1612 3300041456 Ga0451795_1275112 Ga0451795_1275112_337_642 96
1613 3300041486 Ga0451807_0922472 Ga0451807_0922472_150_455 96
1614 3300041511 Ga0451855_1875439 Ga0451855_1875439_406_711 96
1615 3300041512 Ga0451853_1497689 Ga0451853_1497689_297_602 96
1616 3300041512 Ga0451853_2532658 Ga0451853_2532658_324_629 96
1617 3300042001 Ga0439441_019729 Ga0439441_019729_266_571 96
1618 3300042002 Ga0439442_044068 Ga0439442_044068_446_751 96
1619 3300042004 Ga0439445_0048451 Ga0439445_0048451_334_639 96
1620 3300042006 Ga0439432_195556 Ga0439432_195556_13_318 96
1621 3300042008 Ga0439450_057268 Ga0439450_057268_427_732 96
1622 3300042008 Ga0439450_169890 Ga0439450_169890_197_502 96
1623 3300042010 Ga0439452_043594 Ga0439452_043594_350_655 96
1624 3300042014 Ga0439457_106639 Ga0439457_106639_19_324 96
1625 3300042436 Ga0439435_0180555 Ga0439435_0180555_269_574 96
1626 3300042461 Ga0439460_0270366 Ga0439460_0270366_15_320 96
1627 3300042876 Ga0451577_0018151 Ga0451577_0018151_314_619 96
1628 3300042876 Ga0451577_0112731 Ga0451577_0112731_367_672 96
1629 3300042876 Ga0451577_1517393 Ga0451577_1517393_22_327 96
1630 3300042993 Ga0439440_0209909 Ga0439440_0209909_48_353 96
1631 3300044673 Ga0453683_0555259 Ga0453683_0555259_134_439 96
1632 3300044673 Ga0453683_1185856 Ga0453683_1185856_119_424 96
1633 3300044684 Ga0466966_0064041 Ga0466966_0064041_1556_1861 96
1634 3300044684 Ga0466966_0717170 Ga0466966_0717170_178_483 96
1635 3300044693 Ga0466961_0078638 Ga0466961_0078638_180_485 96
1636 3300044693 Ga0466961_0245939 Ga0466961_0245939_301_606 96
1637 3300044693 Ga0466961_0499899 Ga0466961_0499899_33_338 96
1638 3300044693 Ga0466961_0696513 Ga0466961_0696513_31_336 96
1639 3300044694 Ga0466963_0129768 Ga0466963_0129768_779_1084 96
1640 3300044694 Ga0466963_0346764 Ga0466963_0346764_15_320 96
1641 3300044694 Ga0466963_0349140 Ga0466963_0349140_22_327 96
1642 3300044694 Ga0466963_0984772 Ga0466963_0984772_213_518 96
1643 3300044712 Ga0453684_0000204 Ga0453684_0000204_6544_6849 96
1644 3300044712 Ga0453684_0001066 Ga0453684_0001066_6515_6820 96
1645 3300044712 Ga0453684_0005256 Ga0453684_0005256_19533_19838 96
1646 3300044712 Ga0453684_0157702 Ga0453684_0157702_1307_1612 96
1647 3300044712 Ga0453684_0890768 Ga0453684_0890768_450_755 96
1648 3300044719 Ga0466971_0166418 Ga0466971_0166418_522_827 96
1649 3300044719 Ga0466971_0497659 Ga0466971_0497659_105_410 96
1650 3300044735 Ga0466968_0184221 Ga0466968_0184221_192_497 96
1651 3300044735 Ga0466968_0299516 Ga0466968_0299516_153_458 96
1652 3300044765 Ga0466970_0432624 Ga0466970_0432624_84_389 96
1653 3300044765 Ga0466970_0466093 Ga0466970_0466093_78_383 96
1654 3300044842 Ga0466957_0059645 Ga0466957_0059645_1387_1692 96
1655 3300044842 Ga0466957_0082727 Ga0466957_0082727_661_966 96
1656 3300044842 Ga0466957_0496615 Ga0466957_0496615_216_521 96
1657 3300044901 Ga0466960_0498635 Ga0466960_0498635_287_592 96
1658 3300045049 Ga0466959_0646070 Ga0466959_0646070_330_635 96
1659 3300045051 Ga0451576_0003979 Ga0451576_0003979_12587_12892 96
1660 3300045051 Ga0451576_0110602 Ga0451576_0110602_2197_2502 96
1661 3300045051 Ga0451576_0205880 Ga0451576_0205880_85_390 96
1662 3300045051 Ga0451576_0646454 Ga0451576_0646454_76_381 96
1663 3300045051 Ga0451576_0878951 Ga0451576_0878951_451_756 96
1664 3300045051 Ga0451576_1158947 Ga0451576_1158947_451_756 96
1665 3300045051 Ga0451576_2048742 Ga0451576_2048742_53_358 96
1666 3300045836 Ga0466958_0191476 Ga0466958_0191476_64_369 96
1667 3300045836 Ga0466958_0816289 Ga0466958_0816289_135_440 96
1668 3300045836 Ga0466958_0977573 Ga0466958_0977573_43_348 96
1669 3300045836 Ga0466958_1153413 Ga0466958_1153413_37_342 96
1670 3300045976 Ga0466967_0126564 Ga0466967_0126564_1043_1348 96
1671 3300045976 Ga0466967_0448230 Ga0466967_0448230_745_1050 96
1672 3300045976 Ga0466967_0465705 Ga0466967_0465705_673_978 96
1673 3300045976 Ga0466967_0506163 Ga0466967_0506163_18_323 96
1674 3300045976 Ga0466967_1106467 Ga0466967_1106467_313_618 96
1675 3300045976 Ga0466967_1112442 Ga0466967_1112442_387_692 96
1676 3300045976 Ga0466967_2598278 Ga0466967_2598278_185_490 96
1677 3300046452 Ga0495617_131390 Ga0495617_131390_387_692 96
1678 3300046452 Ga0495617_220206 Ga0495617_220206_153_458 96
1679 3300046454 Ga0495592_0016148 Ga0495592_0016148_1481_1786 96
1680 3300046455 Ga0495603_0175103 Ga0495603_0175103_24_329 96
1681 3300046459 Ga0495629_0099980 Ga0495629_0099980_732_1037 96
1682 3300046459 Ga0495629_0120625 Ga0495629_0120625_1304_1609 96
1683 3300046459 Ga0495629_0216828 Ga0495629_0216828_370_675 96
1684 3300046459 Ga0495629_0442119 Ga0495629_0442119_378_683 96
1685 3300046460 Ga0495638_0108205 Ga0495638_0108205_1209_1514 96
1686 3300046460 Ga0495638_0392608 Ga0495638_0392608_25_330 96
1687 3300046461 Ga0495641_0559236 Ga0495641_0559236_100_405 96
1688 3300046462 Ga0495651_0013876 Ga0495651_0013876_2667_2972 96
1689 3300046462 Ga0495651_0070762 Ga0495651_0070762_680_985 96
1690 3300046463 Ga0495653_0133128 Ga0495653_0133128_1406_1711 96
1691 3300046472 Ga0495580_0875620 Ga0495580_0875620_138_443 96
1692 3300046473 Ga0495582_0409812 Ga0495582_0409812_271_576 96
1693 3300046475 Ga0495639_0518269 Ga0495639_0518269_69_374 96
1694 3300046476 Ga0495662_0338972 Ga0495662_0338972_256_561 96
1695 3300046477 Ga0495664_0014347 Ga0495664_0014347_2441_2746 96
1696 3300046477 Ga0495664_0272048 Ga0495664_0272048_480_785 96
1697 3300046477 Ga0495664_0454051 Ga0495664_0454051_235_540 96
1698 3300046492 Ga0495585_0180347 Ga0495585_0180347_653_958 96
1699 3300046499 Ga0495594_0085650 Ga0495594_0085650_200_505 96
1700 3300046499 Ga0495594_0127254 Ga0495594_0127254_617_922 96
1701 3300046499 Ga0495594_0751173 Ga0495594_0751173_227_532 96
1702 3300046506 Ga0495583_0274926 Ga0495583_0274926_45_350 96
1703 3300046507 Ga0495606_0055740 Ga0495606_0055740_391_696 96
1704 3300046507 Ga0495606_0248930 Ga0495606_0248930_122_427 96
1705 3300046507 Ga0495606_0467327 Ga0495606_0467327_81_386 96
1706 3300046511 Ga0495608_0005788 Ga0495608_0005788_3997_4302 96
1707 3300046511 Ga0495608_0312524 Ga0495608_0312524_239_544 96
1708 3300046514 Ga0495618_0352959 Ga0495618_0352959_549_854 96
1709 3300046515 Ga0495620_0178792 Ga0495620_0178792_149_454 96
1710 3300046516 Ga0495628_0110696 Ga0495628_0110696_845_1150 96
1711 3300046516 Ga0495628_0518092 Ga0495628_0518092_473_778 96
1712 3300046516 Ga0495628_1168676 Ga0495628_1168676_47_352 96
1713 3300046517 Ga0495630_0444399 Ga0495630_0444399_207_512 96
1714 3300046517 Ga0495630_0556229 Ga0495630_0556229_298_603 96
1715 3300046518 Ga0495631_0083702 Ga0495631_0083702_889_1194 96
1716 3300046519 Ga0495632_0088938 Ga0495632_0088938_234_542 96
1717 3300046519 Ga0495632_0223197 Ga0495632_0223197_34_339 96
1718 3300046528 Ga0495642_0031203 Ga0495642_0031203_119_424 96
1719 3300046528 Ga0495642_0111550 Ga0495642_0111550_243_548 96
1720 3300046529 Ga0495652_0104031 Ga0495652_0104031_22_327 96
1721 3300046529 Ga0495652_0361215 Ga0495652_0361215_308_613 96
1722 3300046530 Ga0495654_0052557 Ga0495654_0052557_263_568 96
1723 3300046531 Ga0495665_0328206 Ga0495665_0328206_259_564 96
1724 3300046533 Ga0495640_0170914 Ga0495640_0170914_406_711 96
1725 3300046533 Ga0495640_0361145 Ga0495640_0361145_461_766 96
1726 3300046536 Ga0495587_0006550 Ga0495587_0006550_2486_2791 96
1727 3300046538 Ga0495609_0084812 Ga0495609_0084812_152_457 96
1728 3300046539 Ga0495621_0007305 Ga0495621_0007305_1094_1399 96
1729 3300046543 Ga0495645_0006077 Ga0495645_0006077_1022_1327 96
1730 3300046543 Ga0495645_0496277 Ga0495645_0496277_61_366 96
1731 3300046557 Ga0495622_0005205 Ga0495622_0005205_1312_1617 96
1732 3300046559 Ga0495667_0013738 Ga0495667_0013738_3596_3901 96
1733 3300046559 Ga0495667_0192168 Ga0495667_0192168_519_824 96
1734 3300046615 Ga0495656_0058964 Ga0495656_0058964_864_1169 96
1735 3300046616 Ga0495668_0112847 Ga0495668_0112847_657_962 96
1736 3300046642 Ga0495634_0245950 Ga0495634_0245950_55_360 96
1737 3300046642 Ga0495634_0650807 Ga0495634_0650807_94_399 96
1738 3300046648 Ga0495611_0118236 Ga0495611_0118236_795_1100 96
1739 3300046660 Ga0495625_0674147 Ga0495625_0674147_161_466 96
1740 3300046663 Ga0495635_0081895 Ga0495635_0081895_1758_2063 96
1741 3300046663 Ga0495635_0159637 Ga0495635_0159637_98_403 96
1742 3300046663 Ga0495635_0318696 Ga0495635_0318696_587_892 96
1743 3300046663 Ga0495635_0377371 Ga0495635_0377371_373_678 96
1744 3300046665 Ga0495661_0193074 Ga0495661_0193074_508_813 96
1745 3300046674 Ga0495588_0565181 Ga0495588_0565181_15_320 96
1746 3300046675 Ga0495657_0089597 Ga0495657_0089597_76_381 96
1747 3300046675 Ga0495657_0195618 Ga0495657_0195618_843_1148 96
1748 3300046678 Ga0495599_0090673 Ga0495599_0090673_1065_1370 96
1749 3300046678 Ga0495599_0282643 Ga0495599_0282643_50_355 96
1750 3300046679 Ga0495623_0261596 Ga0495623_0261596_479_784 96
1751 3300046680 Ga0495646_0013300 Ga0495646_0013300_4232_4537 96
1752 3300046680 Ga0495646_0476338 Ga0495646_0476338_54_359 96
1753 3300046681 Ga0495647_0230568 Ga0495647_0230568_169_474 96
1754 3300046681 Ga0495647_0347880 Ga0495647_0347880_190_495 96
1755 3300046683 Ga0495658_0077899 Ga0495658_0077899_704_1009 96
1756 3300046683 Ga0495658_0105408 Ga0495658_0105408_555_860 96
1757 3300046684 Ga0495669_0056516 Ga0495669_0056516_693_998 96
1758 3300046689 Ga0495613_0288951 Ga0495613_0288951_494_799 96
1759 3300046689 Ga0495613_0609588 Ga0495613_0609588_203_508 96
1760 3300046690 Ga0495624_0254893 Ga0495624_0254893_271_576 96
1761 3300046692 Ga0495671_0322087 Ga0495671_0322087_66_371 96
1762 3300046692 Ga0495671_0630277 Ga0495671_0630277_94_399 96
1763 3300046694 Ga0495649_0200501 Ga0495649_0200501_387_692 96
1764 3300046694 Ga0495649_0484305 Ga0495649_0484305_260_565 96
1765 3300046694 Ga0495649_0521266 Ga0495649_0521266_212_517 96
1766 3300046694 Ga0495649_0648876 Ga0495649_0648876_178_483 96
1767 3300046794 Ga0495589_0252897 Ga0495589_0252897_167_472 96
1768 3300046794 Ga0495589_0345895 Ga0495589_0345895_178_483 96
1769 3300046809 Ga0495600_0171410 Ga0495600_0171410_1007_1312 96
1770 3300047315 Ga0495581_0222805 Ga0495581_0222805_411_716 96
1771 3300047317 Ga0495604_0064902 Ga0495604_0064902_1830_2135 96
1772 3300047317 Ga0495604_0599186 Ga0495604_0599186_339_644 96
1773 3300047318 Ga0495636_0145114 Ga0495636_0145114_134_439 96
1774 3300047319 Ga0495674_0022196 Ga0495674_0022196_2384_2689 96
1775 3300047319 Ga0495674_0152655 Ga0495674_0152655_805_1110 96
1776 3300047319 Ga0495674_0317586 Ga0495674_0317586_875_1180 96
1777 3300047319 Ga0495674_0484119 Ga0495674_0484119_665_970 96
1778 3300047319 Ga0495674_0486149 Ga0495674_0486149_371_676 96
1779 3300047320 Ga0495672_0010923 Ga0495672_0010923_2735_3040 96
1780 3300047320 Ga0495672_0097960 Ga0495672_0097960_292_597 96
1781 3300047320 Ga0495672_0241498 Ga0495672_0241498_546_851 96
1782 3300047320 Ga0495672_0382104 Ga0495672_0382104_58_363 96
1783 3300047321 Ga0495676_0701455 Ga0495676_0701455_228_533 96
1784 3300047321 Ga0495676_0863456 Ga0495676_0863456_236_541 96
1785 3300047322 Ga0495680_0079504 Ga0495680_0079504_633_938 96
1786 3300047323 Ga0495683_0023644 Ga0495683_0023644_1605_1910 96
1787 3300047444 Ga0495675_0034301 Ga0495675_0034301_1720_2025 96
1788 3300047444 Ga0495675_0125394 Ga0495675_0125394_984_1289 96
1789 3300047444 Ga0495675_0300096 Ga0495675_0300096_428_733 96
1790 3300047444 Ga0495675_0465897 Ga0495675_0465897_376_681 96
1791 3300047471 Ga0495684_0122366 Ga0495684_0122366_1555_1860 96
1792 3300047471 Ga0495684_0228897 Ga0495684_0228897_220_525 96
1793 3300047471 Ga0495684_0393069 Ga0495684_0393069_167_472 96
1794 3300047471 Ga0495684_0394642 Ga0495684_0394642_331_636 96
1795 3300047471 Ga0495684_0549839 Ga0495684_0549839_78_383 96
1796 3300047472 Ga0495686_0173970 Ga0495686_0173970_926_1231 96
1797 3300047472 Ga0495686_0389719 Ga0495686_0389719_414_719 96
1798 3300047673 Ga0495593_0711071 Ga0495593_0711071_69_374 96
1799 3300048088 Ga0495602_0000485 Ga0495602_0000485_21064_21369 96
1800 3300048088 Ga0495602_0331316 Ga0495602_0331316_726_1031 96
1801 3300048088 Ga0495602_0496778 Ga0495602_0496778_533_838 96
1802 3300048090 Ga0495615_0123520 Ga0495615_0123520_264_569 96
1803 3300048091 Ga0495626_0026549 Ga0495626_0026549_1018_1323 96
1804 3300048091 Ga0495626_0394216 Ga0495626_0394216_162_467 96
1805 3300048903 Ga0496100_0028163 Ga0496100_0028163_2578_2883 96
1806 3300048903 Ga0496100_0531081 Ga0496100_0531081_458_763 96
1807 3300048904 Ga0496101_0187660 Ga0496101_0187660_748_1053 96
1808 3300048904 Ga0496101_0385578 Ga0496101_0385578_494_799 96
1809 3300048905 Ga0496102_0021900 Ga0496102_0021900_2865_3170 96
1810 3300048905 Ga0496102_0089827 Ga0496102_0089827_1226_1531 96
1811 3300048906 Ga0496103_0005971 Ga0496103_0005971_2699_3004 96
1812 3300048907 Ga0496104_0017664 Ga0496104_0017664_1561_1866 96
1813 3300048907 Ga0496104_1095783 Ga0496104_1095783_56_361 96
1814 3300048909 Ga0496106_0004608 Ga0496106_0004608_7499_7804 96
1815 3300048909 Ga0496106_0127126 Ga0496106_0127126_34_339 96
1816 3300048909 Ga0496106_0617607 Ga0496106_0617607_194_499 96
1817 3300048910 Ga0496107_0008725 Ga0496107_0008725_3308_3613 96
1818 3300048910 Ga0496107_0041203 Ga0496107_0041203_2968_3273 96
1819 3300048911 Ga0496108_0731634 Ga0496108_0731634_418_723 96
1820 3300048911 Ga0496108_1099120 Ga0496108_1099120_43_348 96
1821 3300048912 Ga0496109_0334424 Ga0496109_0334424_714_1019 96
1822 3300048913 Ga0496110_0508118 Ga0496110_0508118_279_584 96
1823 3300048913 Ga0496110_0610112 Ga0496110_0610112_79_384 96
1824 3300048914 Ga0496111_0603211 Ga0496111_0603211_439_744 96
1825 3300048914 Ga0496111_0725350 Ga0496111_0725350_85_390 96
1826 3300048915 Ga0496112_0415216 Ga0496112_0415216_522_827 96
1827 3300048916 Ga0496113_0642497 Ga0496113_0642497_501_806 96
1828 3300048916 Ga0496113_0784735 Ga0496113_0784735_420_725 96
1829 3300048917 Ga0496114_0024865 Ga0496114_0024865_3721_4026 96
1830 3300048918 Ga0496115_0001671 Ga0496115_0001671_6260_6565 96
1831 3300048918 Ga0496115_0552779 Ga0496115_0552779_450_755 96
1832 3300048918 Ga0496115_1197618 Ga0496115_1197618_146_451 96
1833 3300048923 Ga0496120_0132303 Ga0496120_0132303_207_512 96
1834 3300048923 Ga0496120_0283637 Ga0496120_0283637_296_601 96
1835 3300048924 Ga0496121_0386560 Ga0496121_0386560_169_474 96
1836 3300048929 Ga0496126_0123506 Ga0496126_0123506_138_443 96
1837 3300049127 Ga0501306_011195 Ga0501306_011195_546_851 96
1838 3300049127 Ga0501306_011303 Ga0501306_011303_726_1031 96
1839 3300049128 Ga0501308_004474 Ga0501308_004474_64_369 96
1840 3300049128 Ga0501308_088930 Ga0501308_088930_111_416 96
1841 3300049130 Ga0501310_022382 Ga0501310_022382_47_352 96
1842 3300049160 Ga0501304_027739 Ga0501304_027739_42_347 96
1843 3300049161 Ga0501305_012393 Ga0501305_012393_534_839 96
1844 3300049162 Ga0501307_007377 Ga0501307_007377_317_622 96
1845 3300049162 Ga0501307_033780 Ga0501307_033780_250_555 96
1846 3300049527 Ga0501311_017110 Ga0501311_017110_170_475 96
1847 3300049527 Ga0501311_027428 Ga0501311_027428_58_363 96
1848 3300049527 Ga0501311_051585 Ga0501311_051585_165_470 96
1849 3300049528 Ga0501312_012174 Ga0501312_012174_632_937 96
1850 3300049528 Ga0501312_013150 Ga0501312_013150_360_665 96
1851 3300049529 Ga0501313_013109 Ga0501313_013109_333_638 96
1852 3300049529 Ga0501313_051720 Ga0501313_051720_239_544 96
1853 3300049531 Ga0501315_002668 Ga0501315_002668_522_827 96
1854 3300049531 Ga0501315_079589 Ga0501315_079589_47_352 96
1855 3300049532 Ga0501316_003868 Ga0501316_003868_580_885 96
1856 3300049533 Ga0501317_001666 Ga0501317_001666_28_333 96
1857 3300049533 Ga0501317_009684 Ga0501317_009684_448_753 96
1858 3300049533 Ga0501317_015990 Ga0501317_015990_250_555 96
1859 3300049533 Ga0501317_023822 Ga0501317_023822_144_449 96
1860 3300049533 Ga0501317_029983 Ga0501317_029983_456_761 96
1861 3300049534 Ga0501318_002881 Ga0501318_002881_1068_1373 96
1862 3300049534 Ga0501318_003003 Ga0501318_003003_536_841 96
1863 3300049534 Ga0501318_005635 Ga0501318_005635_450_755 96
1864 3300049534 Ga0501318_016453 Ga0501318_016453_482_787 96
1865 3300049534 Ga0501318_024801 Ga0501318_024801_23_328 96
1866 3300049534 Ga0501318_045469 Ga0501318_045469_134_439 96
1867 3300049534 Ga0501318_073419 Ga0501318_073419_29_334 96
1868 3300049536 Ga0501320_055674 Ga0501320_055674_66_371 96
1869 3300049537 Ga0501321_006571 Ga0501321_006571_358_663 96
1870 3300049540 Ga0501324_002934 Ga0501324_002934_886_1191 96
1871 3300049540 Ga0501324_025654 Ga0501324_025654_242_547 96
1872 3300049568 Ga0501031_0131538 Ga0501031_0131538_514_819 96
1873 3300049568 Ga0501031_0318414 Ga0501031_0318414_519_824 96
1874 3300049569 Ga0501032_0019862 Ga0501032_0019862_2910_3215 96
1875 3300049569 Ga0501032_0076360 Ga0501032_0076360_239_544 96
1876 3300049569 Ga0501032_0104516 Ga0501032_0104516_947_1252 96
1877 3300049569 Ga0501032_0893540 Ga0501032_0893540_47_352 96
1878 3300049570 Ga0501033_0005260 Ga0501033_0005260_5840_6145 96
1879 3300049570 Ga0501033_0012240 Ga0501033_0012240_1422_1727 96
1880 3300049570 Ga0501033_0020706 Ga0501033_0020706_1694_1999 96
1881 3300049570 Ga0501033_0106944 Ga0501033_0106944_1479_1784 96
1882 3300049570 Ga0501033_0975686 Ga0501033_0975686_69_374 96
1883 3300049571 Ga0501034_0056638 Ga0501034_0056638_3550_3855 96
1884 3300049571 Ga0501034_0171459 Ga0501034_0171459_1046_1351 96
1885 3300049571 Ga0501034_0188771 Ga0501034_0188771_959_1264 96
1886 3300049571 Ga0501034_0198693 Ga0501034_0198693_24_329 96
1887 3300049571 Ga0501034_0347968 Ga0501034_0347968_964_1269 96
1888 3300049571 Ga0501034_0479868 Ga0501034_0479868_649_954 96
1889 3300049571 Ga0501034_0493116 Ga0501034_0493116_117_422 96
1890 3300049571 Ga0501034_0640364 Ga0501034_0640364_187_492 96
1891 3300049571 Ga0501034_0876666 Ga0501034_0876666_144_449 96
1892 3300049571 Ga0501034_0948957 Ga0501034_0948957_341_646 96
1893 3300049572 Ga0501036_0075956 Ga0501036_0075956_991_1308 96
1894 3300049572 Ga0501036_0249878 Ga0501036_0249878_892_1197 96
1895 3300049572 Ga0501036_0308062 Ga0501036_0308062_918_1223 96
1896 3300049572 Ga0501036_0380494 Ga0501036_0380494_414_719 96
1897 3300049572 Ga0501036_0415122 Ga0501036_0415122_400_705 96
1898 3300049572 Ga0501036_0565163 Ga0501036_0565163_104_409 96
1899 3300049572 Ga0501036_0629985 Ga0501036_0629985_338_643 96
1900 3300049572 Ga0501036_0741396 Ga0501036_0741396_77_382 96
1901 3300049572 Ga0501036_1169245 Ga0501036_1169245_242_547 96
1902 3300049573 Ga0501037_0013050 Ga0501037_0013050_2780_3085 96
1903 3300049573 Ga0501037_0098875 Ga0501037_0098875_1560_1865 96
1904 3300049573 Ga0501037_0108796 Ga0501037_0108796_1521_1826 96
1905 3300049573 Ga0501037_0123771 Ga0501037_0123771_1417_1722 96
1906 3300049573 Ga0501037_0259993 Ga0501037_0259993_305_610 96
1907 3300049573 Ga0501037_0502501 Ga0501037_0502501_338_643 96
1908 3300049573 Ga0501037_0958892 Ga0501037_0958892_110_415 96
1909 3300049574 Ga0501038_0096205 Ga0501038_0096205_1422_1727 96
1910 3300049574 Ga0501038_0408010 Ga0501038_0408010_21_326 96
1911 3300049574 Ga0501038_0933239 Ga0501038_0933239_144_449 96
1912 3300049574 Ga0501038_1381271 Ga0501038_1381271_61_366 96
1913 3300049575 Ga0501039_0098169 Ga0501039_0098169_1742_2047 96
1914 3300049575 Ga0501039_0133948 Ga0501039_0133948_457_762 96
1915 3300049575 Ga0501039_0309306 Ga0501039_0309306_662_979 96
1916 3300049575 Ga0501039_0582557 Ga0501039_0582557_202_507 96
1917 3300049575 Ga0501039_0759757 Ga0501039_0759757_323_628 96
1918 3300049575 Ga0501039_1006196 Ga0501039_1006196_199_504 96
1919 3300049576 Ga0501040_0065678 Ga0501040_0065678_1948_2253 96
1920 3300049577 Ga0501041_0383436 Ga0501041_0383436_319_624 96
1921 3300049578 Ga0501042_0135548 Ga0501042_0135548_187_504 96
1922 3300049578 Ga0501042_1363722 Ga0501042_1363722_87_392 96
1923 3300049579 Ga0501043_0014584 Ga0501043_0014584_5393_5698 96
1924 3300049579 Ga0501043_0045694 Ga0501043_0045694_1426_1731 96
1925 3300049579 Ga0501043_0147562 Ga0501043_0147562_691_996 96
1926 3300049579 Ga0501043_0179217 Ga0501043_0179217_835_1140 96
1927 3300049579 Ga0501043_0372880 Ga0501043_0372880_633_938 96
1928 3300049579 Ga0501043_0611113 Ga0501043_0611113_317_622 96
1929 3300049580 Ga0501046_0011762 Ga0501046_0011762_6259_6564 96
1930 3300049580 Ga0501046_0099104 Ga0501046_0099104_790_1095 96
1931 3300049580 Ga0501046_0239452 Ga0501046_0239452_273_578 96
1932 3300049580 Ga0501046_0432622 Ga0501046_0432622_189_494 96
1933 3300049581 Ga0501047_0002319 Ga0501047_0002319_10773_11078 96
1934 3300049581 Ga0501047_0042378 Ga0501047_0042378_3460_3765 96
1935 3300049581 Ga0501047_0059259 Ga0501047_0059259_821_1126 96
1936 3300049581 Ga0501047_0138742 Ga0501047_0138742_543_848 96
1937 3300049581 Ga0501047_0154945 Ga0501047_0154945_398_703 96
1938 3300049581 Ga0501047_0180149 Ga0501047_0180149_511_816 96
1939 3300049581 Ga0501047_0267505 Ga0501047_0267505_334_639 96
1940 3300049581 Ga0501047_0285627 Ga0501047_0285627_648_953 96
1941 3300049581 Ga0501047_0757844 Ga0501047_0757844_338_643 96
1942 3300049582 Ga0501048_0051367 Ga0501048_0051367_2505_2810 96
1943 3300049582 Ga0501048_0088154 Ga0501048_0088154_1874_2179 96
1944 3300049582 Ga0501048_0101952 Ga0501048_0101952_1693_1998 96
1945 3300049582 Ga0501048_0155341 Ga0501048_0155341_144_449 96
1946 3300049582 Ga0501048_0239734 Ga0501048_0239734_935_1252 96
1947 3300049582 Ga0501048_0556179 Ga0501048_0556179_42_347 96
1948 3300049582 Ga0501048_0627839 Ga0501048_0627839_375_680 96
1949 3300049583 Ga0501067_0108900 Ga0501067_0108900_228_533 96
1950 3300049583 Ga0501067_0162644 Ga0501067_0162644_339_644 96
1951 3300049583 Ga0501067_0179124 Ga0501067_0179124_745_1050 96
1952 3300049584 Ga0501068_0036227 Ga0501068_0036227_557_862 96
1953 3300049584 Ga0501068_0243618 Ga0501068_0243618_580_885 96
1954 3300049584 Ga0501068_0337764 Ga0501068_0337764_514_819 96
1955 3300049584 Ga0501068_0435800 Ga0501068_0435800_124_429 96
1956 3300049584 Ga0501068_0803807 Ga0501068_0803807_46_351 96
1957 3300049584 Ga0501068_0905982 Ga0501068_0905982_225_530 96
1958 3300049584 Ga0501068_0923954 Ga0501068_0923954_210_515 96
1959 3300049585 Ga0501069_0058742 Ga0501069_0058742_883_1188 96
1960 3300049585 Ga0501069_0079151 Ga0501069_0079151_1421_1726 96
1961 3300049585 Ga0501069_0459450 Ga0501069_0459450_31_336 96
1962 3300049585 Ga0501069_0640660 Ga0501069_0640660_106_411 96
1963 3300049586 Ga0501070_0199363 Ga0501070_0199363_37_342 96
1964 3300049586 Ga0501070_0517666 Ga0501070_0517666_487_792 96
1965 3300049586 Ga0501070_0859167 Ga0501070_0859167_273_578 96
1966 3300049587 Ga0501071_0057831 Ga0501071_0057831_1573_1878 96
1967 3300049587 Ga0501071_0252161 Ga0501071_0252161_41_346 96
1968 3300049587 Ga0501071_0296191 Ga0501071_0296191_389_694 96
1969 3300049587 Ga0501071_0303954 Ga0501071_0303954_144_449 96
1970 3300049587 Ga0501071_0577330 Ga0501071_0577330_523_840 96
1971 3300049587 Ga0501071_0651782 Ga0501071_0651782_290_595 96
1972 3300049587 Ga0501071_0817517 Ga0501071_0817517_255_560 96
1973 3300049587 Ga0501071_1128412 Ga0501071_1128412_250_555 96
1974 3300049588 Ga0501072_0052932 Ga0501072_0052932_359_664 96
1975 3300049588 Ga0501072_0131259 Ga0501072_0131259_1441_1746 96
1976 3300049588 Ga0501072_0770225 Ga0501072_0770225_40_345 96
1977 3300049588 Ga0501072_0846029 Ga0501072_0846029_37_342 96
1978 3300049589 Ga0501073_0021555 Ga0501073_0021555_2530_2835 96
1979 3300049589 Ga0501073_0061078 Ga0501073_0061078_1063_1368 96
1980 3300049589 Ga0501073_0168051 Ga0501073_0168051_1070_1375 96
1981 3300049589 Ga0501073_0313950 Ga0501073_0313950_144_449 96
1982 3300049589 Ga0501073_0432746 Ga0501073_0432746_490_795 96
1983 3300049589 Ga0501073_0489000 Ga0501073_0489000_432_737 96
1984 3300049589 Ga0501073_0918746 Ga0501073_0918746_42_347 96
1985 3300049589 Ga0501073_1204701 Ga0501073_1204701_24_329 96
1986 3300049590 Ga0501074_0079197 Ga0501074_0079197_158_463 96
1987 3300049590 Ga0501074_0565600 Ga0501074_0565600_393_698 96
1988 3300049591 Ga0501075_0063131 Ga0501075_0063131_1036_1341 96
1989 3300049591 Ga0501075_0173674 Ga0501075_0173674_487_792 96
1990 3300049592 Ga0501076_0013544 Ga0501076_0013544_2790_3095 96
1991 3300049592 Ga0501076_0247028 Ga0501076_0247028_346_651 96
1992 3300049593 Ga0501077_0165265 Ga0501077_0165265_979_1284 96
1993 3300049593 Ga0501077_0196471 Ga0501077_0196471_340_645 96
1994 3300049593 Ga0501077_0389959 Ga0501077_0389959_376_681 96
1995 3300049593 Ga0501077_0978032 Ga0501077_0978032_43_348 96
1996 3300049741 Ga0501079_0108926 Ga0501079_0108926_1457_1762 96
1997 3300049741 Ga0501079_0721469 Ga0501079_0721469_220_525 96
1998 3300049742 Ga0501080_0071546 Ga0501080_0071546_1564_1869 96
1999 3300049742 Ga0501080_0098262 Ga0501080_0098262_1895_2200 96
2000 3300049742 Ga0501080_0113812 Ga0501080_0113812_1162_1467 96
2001 3300049742 Ga0501080_0170095 Ga0501080_0170095_198_503 96
2002 3300049742 Ga0501080_0313821 Ga0501080_0313821_774_1079 96
2003 3300049742 Ga0501080_0329025 Ga0501080_0329025_860_1165 96
2004 3300049742 Ga0501080_0332884 Ga0501080_0332884_989_1294 96
2005 3300049742 Ga0501080_0799651 Ga0501080_0799651_112_417 96
2006 3300049742 Ga0501080_0870879 Ga0501080_0870879_144_449 96
2007 3300049742 Ga0501080_1120692 Ga0501080_1120692_210_515 96
2008 3300049742 Ga0501080_1134541 Ga0501080_1134541_227_532 96
2009 3300049742 Ga0501080_1221465 Ga0501080_1221465_322_627 96
2010 3300049742 Ga0501080_1305695 Ga0501080_1305695_10_315 96
2011 3300049742 Ga0501080_1457080 Ga0501080_1457080_42_347 96
2012 3300049742 Ga0501080_1787282 Ga0501080_1787282_26_331 96
2013 3300049743 Ga0501081_0009109 Ga0501081_0009109_3198_3503 96
2014 3300049743 Ga0501081_0018650 Ga0501081_0018650_143_448 96
2015 3300049743 Ga0501081_0771951 Ga0501081_0771951_230_535 96
2016 3300049744 Ga0501083_0082701 Ga0501083_0082701_1122_1427 96
2017 3300049744 Ga0501083_0109534 Ga0501083_0109534_1307_1612 96
2018 3300049744 Ga0501083_0154246 Ga0501083_0154246_323_628 96
2019 3300049744 Ga0501083_0190488 Ga0501083_0190488_273_578 96
2020 3300049744 Ga0501083_0232547 Ga0501083_0232547_750_1055 96
2021 3300049822 Ga0501035_0048543 Ga0501035_0048543_1599_1904 96
2022 3300049822 Ga0501035_0438103 Ga0501035_0438103_762_1067 96
2023 3300049822 Ga0501035_0510636 Ga0501035_0510636_325_630 96
2024 3300049822 Ga0501035_0555601 Ga0501035_0555601_247_552 96
2025 3300049822 Ga0501035_0622580 Ga0501035_0622580_144_449 96
2026 3300049822 Ga0501035_0754471 Ga0501035_0754471_89_394 96
2027 3300049822 Ga0501035_0880720 Ga0501035_0880720_98_403 96
2028 3300049822 Ga0501035_0896113 Ga0501035_0896113_160_465 96
2029 3300049823 Ga0501044_0015755 Ga0501044_0015755_3512_3817 96
2030 3300049823 Ga0501044_0032628 Ga0501044_0032628_1280_1585 96
2031 3300049823 Ga0501044_0044540 Ga0501044_0044540_1714_2019 96
2032 3300049823 Ga0501044_0050289 Ga0501044_0050289_939_1244 96
2033 3300049823 Ga0501044_0081352 Ga0501044_0081352_169_474 96
2034 3300049823 Ga0501044_0112831 Ga0501044_0112831_1535_1840 96
2035 3300049823 Ga0501044_0150030 Ga0501044_0150030_483_788 96
2036 3300049823 Ga0501044_0337074 Ga0501044_0337074_144_449 96
2037 3300049823 Ga0501044_0381983 Ga0501044_0381983_842_1147 96
2038 3300049823 Ga0501044_0411454 Ga0501044_0411454_595_900 96
2039 3300049823 Ga0501044_0531262 Ga0501044_0531262_433_738 96
2040 3300049823 Ga0501044_0584065 Ga0501044_0584065_38_343 96
2041 3300049824 Ga0501045_0038945 Ga0501045_0038945_350_655 96
2042 3300049824 Ga0501045_0216057 Ga0501045_0216057_364_669 96
2043 3300049824 Ga0501045_0373205 Ga0501045_0373205_466_771 96
2044 3300050489 nmdc:mga03683_214353_c1 nmdc:mga03683_214353_c1_471_776 96
2045 3300050489 nmdc:mga03683_436293_c1 nmdc:mga03683_436293_c1_41_346 96
2046 3300050489 nmdc:mga03683_81488_c1 nmdc:mga03683_81488_c1_964_1269 96
2047 3300050489 nmdc:mga03683_94213_c1 nmdc:mga03683_94213_c1_591_896 96
2048 3300050490 nmdc:mga03n38_522045_c1 nmdc:mga03n38_522045_c1_212_517 96
2049 3300050490 nmdc:mga03n38_593050_c1 nmdc:mga03n38_593050_c1_173_478 96
2050 3300050491 nmdc:mga00v17_250152_c1 nmdc:mga00v17_250152_c1_294_599 96
2051 3300050491 nmdc:mga00v17_720986_c1 nmdc:mga00v17_720986_c1_217_522 96
2052 3300050492 nmdc:mga0yw44_553277_c1 nmdc:mga0yw44_553277_c1_308_613 96
2053 3300050492 nmdc:mga0yw44_752128_c1 nmdc:mga0yw44_752128_c1_107_412 96
2054 3300050493 nmdc:mga0k408_14041_c1 nmdc:mga0k408_14041_c1_762_1067 96
2055 3300050493 nmdc:mga0k408_148475_c1 nmdc:mga0k408_148475_c1_768_1073 96
2056 3300050493 nmdc:mga0k408_240476_c1 nmdc:mga0k408_240476_c1_158_463 96
2057 3300050493 nmdc:mga0k408_408156_c1 nmdc:mga0k408_408156_c1_117_422 96
2058 3300050493 nmdc:mga0k408_775120_c1 nmdc:mga0k408_775120_c1_83_388 96
2059 3300050494 nmdc:mga06z11_395022_c1 nmdc:mga06z11_395022_c1_301_606 96
2060 3300050494 nmdc:mga06z11_631274_c1 nmdc:mga06z11_631274_c1_310_615 96
2061 3300050495 nmdc:mga04h51_531736_c1 nmdc:mga04h51_531736_c1_182_487 96
2062 3300050496 nmdc:mga07m45_247664_c1 nmdc:mga07m45_247664_c1_432_737 96
2063 3300050507 nmdc:mga05p37_1877201_c1 nmdc:mga05p37_1877201_c1_73_378 96
2064 3300050507 nmdc:mga05p37_208661_c1 nmdc:mga05p37_208661_c1_687_992 96
2065 3300050507 nmdc:mga05p37_703200_c1 nmdc:mga05p37_703200_c1_752_1057 96
2066 3300050508 nmdc:mga09592_1445486_c1 nmdc:mga09592_1445486_c1_103_408 96
2067 3300050508 nmdc:mga09592_274466_c1 nmdc:mga09592_274466_c1_428_733 96
2068 3300050510 nmdc:mga06r32_1721329_c1 nmdc:mga06r32_1721329_c1_154_459 96
2069 3300050511 nmdc:mga08y16_1093548_c1 nmdc:mga08y16_1093548_c1_266_571 96
2070 3300050511 nmdc:mga08y16_205_c1 nmdc:mga08y16_205_c1_6950_7255 96
2071 3300050511 nmdc:mga08y16_3117_c1 nmdc:mga08y16_3117_c1_4894_5199 96
2072 3300050512 nmdc:mga0n895_287400_c1 nmdc:mga0n895_287400_c1_569_874 96
2073 3300050512 nmdc:mga0n895_445621_c1 nmdc:mga0n895_445621_c1_712_1017 96
2074 3300050512 nmdc:mga0n895_455742_c1 nmdc:mga0n895_455742_c1_484_789 96
2075 3300050512 nmdc:mga0n895_611333_c1 nmdc:mga0n895_611333_c1_314_619 96
2076 3300050513 nmdc:mga0rr50_1624502_c1 nmdc:mga0rr50_1624502_c1_145_450 96
2077 3300050514 nmdc:mga08x19_309104_c1 nmdc:mga08x19_309104_c1_165_470 96
2078 3300050514 nmdc:mga08x19_437170_c1 nmdc:mga08x19_437170_c1_57_362 96
2079 3300050514 nmdc:mga08x19_541883_c1 nmdc:mga08x19_541883_c1_54_359 96
2080 3300050514 nmdc:mga08x19_691923_c1 nmdc:mga08x19_691923_c1_335_640 96
2081 3300050515 nmdc:mga0a205_206624_c1 nmdc:mga0a205_206624_c1_1160_1465 96
2082 3300050515 nmdc:mga0a205_399680_c1 nmdc:mga0a205_399680_c1_536_841 96
2083 3300050515 nmdc:mga0a205_858010_c1 nmdc:mga0a205_858010_c1_125_430 96
2084 3300050516 nmdc:mga0sz30_5573_c1 nmdc:mga0sz30_5573_c1_1304_1609 96
2085 3300053077 Ga0495601_0057176 Ga0495601_0057176_1657_1962 96
2086 3300053077 Ga0495601_0613037 Ga0495601_0613037_359_664 96
2087 3300053077 Ga0495601_0833131 Ga0495601_0833131_188_493 96
2088 3300053077 Ga0495601_0977994 Ga0495601_0977994_127_432 96
2089 3300053078 Ga0495612_0001954 Ga0495612_0001954_3665_3970 96
2090 3300053080 Ga0500635_0079760 Ga0500635_0079760_364_669 96
2091 3300053080 Ga0500635_0089208 Ga0500635_0089208_311_616 96
2092 3300053085 Ga0495619_0075345 Ga0495619_0075345_1849_2154 96
2093 3300053086 Ga0500578_0149619 Ga0500578_0149619_108_413 96
2094 3300053087 Ga0500643_022828 Ga0500643_022828_191_496 96
2095 3300053087 Ga0500643_132082 Ga0500643_132082_354_659 96
2096 3300053087 Ga0500643_135613 Ga0500643_135613_247_552 96
2097 3300053088 Ga0500644_0009620 Ga0500644_0009620_1553_1858 96
2098 3300053088 Ga0500644_0034020 Ga0500644_0034020_1085_1390 96
2099 3300053088 Ga0500644_0168401 Ga0500644_0168401_158_463 96
2100 3300053088 Ga0500644_0336959 Ga0500644_0336959_202_507 96
2101 3300053090 Ga0500646_0036995 Ga0500646_0036995_765_1070 96
2102 3300053090 Ga0500646_0042165 Ga0500646_0042165_812_1117 96
2103 3300053093 Ga0500651_0353068 Ga0500651_0353068_266_571 96
2104 3300053096 Ga0500641_0000684 Ga0500641_0000684_3185_3490 96
2105 3300053098 Ga0500650_0068634 Ga0500650_0068634_598_903 96
2106 3300053098 Ga0500650_0080533 Ga0500650_0080533_365_670 96
2107 3300053099 Ga0500654_077292 Ga0500654_077292_425_730 96
2108 3300053103 Ga0500555_041782 Ga0500555_041782_186_491 96
2109 3300053104 Ga0500556_0288197 Ga0500556_0288197_182_487 96
2110 3300053105 Ga0500557_157332 Ga0500557_157332_351_656 96
2111 3300053116 Ga0500592_053054 Ga0500592_053054_338_643 96
2112 3300053118 Ga0500594_0019853 Ga0500594_0019853_615_920 96
2113 3300053119 Ga0500595_001661 Ga0500595_001661_1033_1338 96
2114 3300053119 Ga0500595_089684 Ga0500595_089684_237_542 96
2115 3300053119 Ga0500595_101232 Ga0500595_101232_77_382 96
2116 3300053120 Ga0500597_212073 Ga0500597_212073_273_578 96
2117 3300053126 Ga0500621_124217 Ga0500621_124217_662_967 96
2118 3300053130 Ga0500642_0001424 Ga0500642_0001424_1257_1562 96
2119 3300053130 Ga0500642_0230453 Ga0500642_0230453_59_364 96
2120 3300053134 Ga0500658_0046521 Ga0500658_0046521_677_982 96
2121 3300053136 Ga0500559_0164356 Ga0500559_0164356_198_503 96
2122 3300053136 Ga0500559_0370957 Ga0500559_0370957_288_593 96
2123 3300053139 Ga0500568_0029142 Ga0500568_0029142_732_1037 96
2124 3300053142 Ga0500577_0059353 Ga0500577_0059353_403_708 96
2125 3300053142 Ga0500577_0216954 Ga0500577_0216954_331_636 96
2126 3300053146 Ga0500588_0003321 Ga0500588_0003321_902_1207 96
2127 3300053146 Ga0500588_0133973 Ga0500588_0133973_230_535 96
2128 3300053146 Ga0500588_0202995 Ga0500588_0202995_397_702 96
2129 3300053151 Ga0500604_0016509 Ga0500604_0016509_94_399 96
2130 3300053151 Ga0500604_0033041 Ga0500604_0033041_796_1101 96
2131 3300053153 Ga0500616_0002871 Ga0500616_0002871_6956_7261 96
2132 3300053154 Ga0500619_222275 Ga0500619_222275_224_529 96
2133 3300053156 Ga0500622_0047353 Ga0500622_0047353_223_528 96
2134 3300053156 Ga0500622_0129144 Ga0500622_0129144_813_1118 96
2135 3300053160 Ga0500633_0148704 Ga0500633_0148704_34_339 96
2136 3300053177 Ga0500636_0445628 Ga0500636_0445628_81_386 96
2137 3300053731 Ga0500609_001079 Ga0500609_001079_554_859 96
2138 3300053731 Ga0500609_002556 Ga0500609_002556_1871_2176 96
2139 3300053732 Ga0500656_006057 Ga0500656_006057_229_534 96
2140 3300053739 Ga0500587_026309 Ga0500587_026309_229_534 96
2141 3300054114 Ga0501084_0062068 Ga0501084_0062068_621_926 96
2142 3300054114 Ga0501084_0066631 Ga0501084_0066631_1807_2112 96
2143 3300054114 Ga0501084_0208090 Ga0501084_0208090_160_465 96
2144 3300054114 Ga0501084_0230662 Ga0501084_0230662_1197_1502 96
2145 3300054114 Ga0501084_0464415 Ga0501084_0464415_607_912 96
2146 3300054114 Ga0501084_0804493 Ga0501084_0804493_271_576 96
2147 3300054114 Ga0501084_1121746 Ga0501084_1121746_176_481 96
2148 3300054114 Ga0501084_1130221 Ga0501084_1130221_298_603 96
2149 3300054114 Ga0501084_1360722 Ga0501084_1360722_77_382 96
2150 3300059421 Ga0590071_006547 Ga0590071_006547_728_1033 96
2151 3300059423 Ga0590074_078193 Ga0590074_078193_210_515 96
2152 3300059424 Ga0590075_010263 Ga0590075_010263_557_862 96
2153 3300059426 Ga0590077_016365 Ga0590077_016365_61_366 96
2154 3300059477 Ga0587084_059576 Ga0587084_059576_301_606 96
2155 3300059491 Ga0587070_072652 Ga0587070_072652_383_688 96
2156 3300059492 Ga0587073_0087772 Ga0587073_0087772_71_376 96
2157 3300059503 Ga0587080_052290 Ga0587080_052290_421_726 96
2158 3300059504 Ga0587082_008975 Ga0587082_008975_483_788 96
2159 3300059505 Ga0587083_0072825 Ga0587083_0072825_442_747 96
2160 3300059604 Ga0587098_052953 Ga0587098_052953_184_489 96
2161 3300059645 Ga0587076_084925 Ga0587076_084925_251_556 96
2162 3300059647 Ga0587079_127439 Ga0587079_127439_144_449 96
2163 3300059655 Ga0587114_026899 Ga0587114_026899_99_404 96
2164 3300060247 Ga0587096_07987 Ga0587096_07987_137_442 96
2165 3300060346 Ga0587111_0001675 Ga0587111_0001675_924_1229 96
2166 3300060346 Ga0587111_0074243 Ga0587111_0074243_332_637 96
2167 3300060353 Ga0501082_0016308 Ga0501082_0016308_3261_3566 96
2168 3300060353 Ga0501082_0069701 Ga0501082_0069701_816_1121 96
2169 3300060353 Ga0501082_0091200 Ga0501082_0091200_2106_2411 96
2170 3300060353 Ga0501082_0119945 Ga0501082_0119945_490_795 96
2171 3300060353 Ga0501082_0120716 Ga0501082_0120716_468_773 96
2172 3300060353 Ga0501082_0208204 Ga0501082_0208204_944_1249 96
2173 3300060353 Ga0501082_0214341 Ga0501082_0214341_353_658 96
2174 3300060353 Ga0501082_0356957 Ga0501082_0356957_671_976 96
2175 3300060353 Ga0501082_0522514 Ga0501082_0522514_661_966 96
2176 3300060353 Ga0501082_1161788 Ga0501082_1161788_157_462 96
2177 3300061719 Ga0466962_0043530 Ga0466962_0043530_556_861 96
2178 3300061734 Ga0530510_0015198 Ga0530510_0015198_2578_2883 96
2179 3300061734 Ga0530510_0480852 Ga0530510_0480852_416_721 96
2180 3300061734 Ga0530510_1071595 Ga0530510_1071595_259_576 96
2181 iso_pu_bacteria 641228493 641337349 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

64

117

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pf2-assembly1.cif.gz_B crystal structure of amino acids 1220-1276 of human beta cardiac myosin fused to gp7 and eb1 0.9811 19 44
4tx3-assembly1.cif.gz_A complex of the x-domain and oxyb from teicoplanin biosynthesis 0.9031 14 44
6fsh-assembly3.cif.gz_C crystal structure of hybrid p450 oxybtei(bc/fgvan) 0.8679 14 44
3tuf-assembly1.cif.gz_A structure of the spoiiq-spoiiiah pore forming complex. 0.8671 11 44
6fsh-assembly2.cif.gz_B crystal structure of hybrid p450 oxybtei(bc/fgvan) 0.8651 14 44
ID Description Score Start End Superfamily
af_Q556G4_163_296_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 1.009 20 42 1.25.10.10
af_K7K3I6_14_100_3.30.260.10 Alpha Beta;2-Layer Sandwich;GROEL; domain 2;TCP-1-like chaperonin intermediate domain 0.9681 19 43 3.30.260.10
af_O94545_7_983_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9583 19 43 1.25.10.10
af_P05690_325_646_1.25.10.20 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Vitellinogen, superhelical 0.9571 19 43 1.25.10.20
af_A0A1D6DUH0_104_283_1.25.40.530 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain 0.9414 16 44 1.25.40.530
ID Description Score Start End GO Terms
AF-A0A8A6W3U2-F1-model_v4 Ribosomal protein S14 0.8446 12 96 GO:0005739
GO:0005840
AF-A0A081CMI9-F1-model_v4 Transcription initiation factor TFIID subunit 9 0.8379 12 95 GO:0000124
GO:0003713
GO:0003735
GO:0005669
GO:0005840
GO:0006412
GO:0016251
GO:0046982
GO:0051123
GO:1990904
AF-A0A0D6EIY8-F1-model_v4 SPOSA6832_01560-mRNA-1:cds 0.8343 10 96 GO:0003735
GO:0005763
GO:0006412
AF-A0A8A9WR53-F1-model_v4 Ribosomal protein S14 0.8327 14 96 GO:0005739
GO:0005840
GO:0016020
AF-A0A7M3RX07-F1-model_v4 deleted 0.831 11 66

Feature Viewer

pLDDT pTM Quality
82.44 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map