F496516
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2181 | 1026 | 1736 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_11656380|Ga0207639_116563802 |
| Length | 118 |
| Sequence | LENGWASPVCSGGKEDRMAKTSQVNRNKMRERMAGRDKGKRKALKDIVMDRTLPVEDRFNASLKLAQLPRNGAKVRVRLRCELTGRARGNYRKFKLCRIALRDLASAGQIPGMVKASW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 9 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 10 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 11 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 12 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 13 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 14 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 15 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 16 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 17 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 18 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 19 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 20 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 21 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 22 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 23 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 26 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 29 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 30 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 31 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 32 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 33 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 34 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 35 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 36 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 37 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 38 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 39 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 40 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 41 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 42 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 43 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 44 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 45 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 46 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 47 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 48 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 49 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 50 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 51 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 52 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 53 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 54 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 55 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 56 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 57 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 58 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 59 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 60 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 61 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 62 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 63 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 64 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 65 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 66 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 67 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 68 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 69 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 70 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 71 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 72 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 73 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 74 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 75 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 76 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 77 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 78 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 79 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 80 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 81 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 82 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 83 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 84 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 85 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 86 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 87 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 88 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 89 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 90 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 91 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 92 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 93 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 94 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 95 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 96 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 97 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 98 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 99 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 100 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 101 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 102 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 103 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 104 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 105 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 106 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 107 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 108 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 109 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 110 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 111 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 112 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 113 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 114 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 115 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 116 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 117 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 118 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 119 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 120 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 121 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 122 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 123 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 124 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 125 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 126 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 127 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 128 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 129 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 130 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 131 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 132 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 133 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 134 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 135 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 136 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 137 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 138 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 139 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 140 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 141 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 142 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 143 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 144 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 145 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 146 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 147 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 148 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 149 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 150 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 151 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 152 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 153 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 154 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 155 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 156 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 157 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 158 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 159 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 160 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 161 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 162 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 163 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 164 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 165 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 166 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 167 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 168 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 169 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 170 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 171 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 172 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 173 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 174 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 175 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 176 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 177 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 178 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 179 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 180 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 181 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 182 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 183 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 184 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 185 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 186 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 187 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 188 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 189 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 190 | 2922368715 | |||
| 191 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 192 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 193 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 194 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 195 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 196 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 197 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 198 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 199 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 200 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 201 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 202 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 203 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 204 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 205 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 206 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 207 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 208 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 209 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 210 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 211 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 212 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 213 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 214 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 215 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 216 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 217 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 218 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 219 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 220 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 221 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 222 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 223 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 224 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 225 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 226 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 227 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 228 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 229 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 230 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 231 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 232 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 233 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 234 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 235 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 236 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 237 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 238 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 239 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 240 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 241 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 242 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 243 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 244 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 245 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 246 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 247 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 248 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 249 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 250 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 251 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 252 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 253 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 254 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 255 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 256 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 257 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 258 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 259 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 260 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 261 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 262 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 263 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 264 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 265 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 266 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 267 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 268 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 269 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 270 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 271 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 272 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 273 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 274 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 275 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 276 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 277 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 278 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 279 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 280 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 281 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 282 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 283 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 284 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 285 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 286 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 287 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 288 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 289 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 290 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 291 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 292 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 293 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 294 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 295 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 296 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 297 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 298 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 299 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 300 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 301 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 302 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 303 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 304 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 305 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 306 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 307 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 308 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 309 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 310 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 311 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 312 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 313 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 314 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 315 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 316 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 317 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 318 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 319 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 320 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 321 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 322 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 323 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 324 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 325 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 326 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 327 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 328 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 329 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 330 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 331 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 332 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 333 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 334 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 335 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 336 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 337 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 338 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 339 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 340 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 341 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 342 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 343 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 344 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 345 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 346 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 347 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 348 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 349 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 350 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 351 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 352 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 353 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 354 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 355 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 356 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 357 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 358 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 359 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 360 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 361 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 362 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 363 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 364 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 365 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 366 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 367 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 368 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 369 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 370 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 371 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 372 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 373 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 374 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 375 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 376 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 377 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 378 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 379 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 380 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 381 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 382 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 383 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 384 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 385 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 386 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 387 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 388 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 389 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 390 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 391 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 392 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 393 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 394 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 395 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 396 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 397 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 398 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 399 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 400 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 401 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 402 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 403 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 405 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 407 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 408 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 409 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 410 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 411 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 414 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 415 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 416 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 417 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 418 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 419 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 420 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 421 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 422 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 423 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 424 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 425 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 426 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 427 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 428 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 429 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 430 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 431 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 432 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 433 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 434 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 435 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 436 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 437 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 438 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 439 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 440 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 441 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 442 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 443 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 444 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 445 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 446 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 447 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 448 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 449 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 450 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 451 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 452 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 453 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 454 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 455 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 456 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 457 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 458 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 459 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 460 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 461 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 462 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 463 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 464 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 465 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 466 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 467 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 468 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 469 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 470 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 471 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 472 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 474 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 475 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 476 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 477 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 478 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 479 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 480 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 481 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 482 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 483 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 484 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 485 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 486 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 487 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 488 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 489 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 490 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 491 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 492 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 493 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 494 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 495 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 496 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 498 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 499 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 500 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 501 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 502 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 503 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 504 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 505 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 506 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 508 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 509 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 510 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 511 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 512 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 513 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 514 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 515 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 516 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 518 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 520 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 522 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 523 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 525 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 526 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 527 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 528 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 529 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 530 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 531 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 532 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 533 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 534 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 535 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 536 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 537 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 538 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 539 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 540 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 541 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 542 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 543 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 544 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 545 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 546 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 547 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 548 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 549 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 550 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 551 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 552 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 553 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 556 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 557 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 558 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 560 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 562 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 563 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 564 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 565 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 566 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 567 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 568 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 569 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 570 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 571 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 572 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 573 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 574 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 575 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 576 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 578 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 579 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 580 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 582 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 584 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 651 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 655 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 656 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 657 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 658 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 659 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 665 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 666 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 667 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 668 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 669 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 670 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 671 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 672 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 673 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 674 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 675 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 676 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 677 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 678 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 679 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 680 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 681 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 682 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 683 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 684 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 685 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 686 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 687 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 689 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 691 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 692 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 693 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 694 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 695 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 696 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 697 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 698 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 699 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 700 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 701 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 702 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 703 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 704 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 705 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 706 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 707 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 708 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 709 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 710 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 711 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 712 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 713 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 714 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 715 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 716 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 717 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 718 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 719 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 720 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 721 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 722 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 723 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 724 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 725 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 726 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 727 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 728 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 729 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 730 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 731 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 732 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 733 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 734 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 735 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 736 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 737 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 738 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 739 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 740 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 741 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 742 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 743 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 744 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 745 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 746 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 747 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 748 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 749 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 750 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 751 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 752 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 753 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 754 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 755 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 756 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 757 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 758 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 759 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 760 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 761 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 762 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 763 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 764 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 765 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 766 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 767 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 768 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 769 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 770 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 771 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 772 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 773 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 774 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 820 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 821 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 822 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 823 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 824 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 825 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 826 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 827 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 832 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 833 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 834 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 835 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 837 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 838 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 839 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 840 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 841 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 842 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 843 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 844 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 845 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 846 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 847 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 848 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 849 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 850 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 851 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 852 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 853 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 854 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 855 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 856 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 857 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 858 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 859 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 860 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 861 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 862 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 863 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 864 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 865 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 866 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 867 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 868 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 869 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 870 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 871 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 872 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 873 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 874 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 875 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 876 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 877 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 878 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 879 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 880 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 881 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 882 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 883 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 884 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 885 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 886 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 887 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 888 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 889 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 890 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 891 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 892 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 893 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 894 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 895 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 896 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 897 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 898 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 899 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 900 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 901 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 902 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 903 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 904 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 905 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 906 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 907 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 908 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 909 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 910 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 911 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 912 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 913 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 914 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 915 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 916 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 917 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 918 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 919 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 920 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 921 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 922 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 923 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 924 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 925 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 926 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 927 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 928 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 929 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 930 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 933 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 935 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 936 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 937 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 938 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 939 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 940 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 941 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 942 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 943 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 944 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 945 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 946 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 947 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 948 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 949 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 950 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 951 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 952 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 953 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 954 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 955 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 956 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 957 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 958 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 959 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 960 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 961 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 962 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 963 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 964 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 965 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 966 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 967 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 968 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 969 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 970 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 971 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 972 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 973 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 974 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 975 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 976 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 977 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 978 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 979 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 980 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 981 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 982 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 983 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 984 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 985 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 986 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 987 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 988 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 989 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 990 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 991 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 992 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 993 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 994 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 995 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 996 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 997 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 998 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 999 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1000 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1001 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1002 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1003 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1004 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1005 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1006 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1007 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1008 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 1009 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1010 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1011 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1012 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 1013 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1014 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1015 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1016 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1017 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1018 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1019 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 1020 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1021 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 1022 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1023 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1024 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 1025 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1026 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.33 |
| Metatranscriptomes | 3.3 |
| Isolates | 20.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.77 |
| Nodule | 16.6 |
| Rhizoplane | 1.74 |
| Rhizosphere | 70.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000035 | 3300000041 | Bacteria | 26838 |
| 2 | ARSoilYngRDRAFT_c00061 | 3300000042 | Bacteria | 17682 |
| 3 | ARcpr5yngRDRAFT_c000075 | 3300000043 | Bacteria | 16570 |
| 4 | ARSoilOldRDRAFT_c000053 | 3300000044 | Bacteria | 23841 |
| 5 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 6 | JGI24737J22298_10005496 | 3300001990 | Bacteria | 4373 |
| 7 | JGI25165J46597_1034619 | 3300003214 | Bacteria | 650 |
| 8 | JGI26129J50193_1002889 | 3300003349 | Bacteria | 1209 |
| 9 | Ga0058863_11612769 | 3300004799 | Bacteria | 1005 |
| 10 | Ga0058861_11519652 | 3300004800 | Bacteria | 574 |
| 11 | Ga0065717_1003757 | 3300005276 | Bacteria | 1179 |
| 12 | Ga0065716_1001741 | 3300005277 | Bacteria | 3669 |
| 13 | Ga0065714_10430914 | 3300005288 | Bacteria | 554 |
| 14 | Ga0065712_10099639 | 3300005290 | Bacteria | 2084 |
| 15 | Ga0065712_10725715 | 3300005290 | Bacteria | 526 |
| 16 | Ga0065715_10002477 | 3300005293 | Bacteria | 7875 |
| 17 | Ga0065707_10107090 | 3300005295 | Bacteria | 2569 |
| 18 | Ga0070658_10137105 | 3300005327 | Bacteria | 2042 |
| 19 | Ga0070658_10322637 | 3300005327 | Bacteria | 1319 |
| 20 | Ga0070658_11200369 | 3300005327 | Bacteria | 659 |
| 21 | Ga0070676_10287217 | 3300005328 | Bacteria | 1110 |
| 22 | Ga0070676_10477116 | 3300005328 | Bacteria | 881 |
| 23 | Ga0070676_10747768 | 3300005328 | Bacteria | 717 |
| 24 | Ga0070683_100088671 | 3300005329 | Bacteria | 2902 |
| 25 | Ga0070683_100455703 | 3300005329 | Bacteria | 1220 |
| 26 | Ga0070683_100525775 | 3300005329 | Bacteria | 1130 |
| 27 | Ga0070683_100772090 | 3300005329 | Bacteria | 921 |
| 28 | Ga0070690_100020637 | 3300005330 | Bacteria | 4015 |
| 29 | Ga0070670_100162525 | 3300005331 | Bacteria | 1935 |
| 30 | Ga0070670_100687280 | 3300005331 | Bacteria | 919 |
| 31 | Ga0070670_100768266 | 3300005331 | Bacteria | 869 |
| 32 | Ga0070677_10816915 | 3300005333 | Bacteria | 533 |
| 33 | Ga0068869_100070091 | 3300005334 | Bacteria | 2593 |
| 34 | Ga0068869_100104915 | 3300005334 | Bacteria | 2143 |
| 35 | Ga0068869_100544126 | 3300005334 | Bacteria | 974 |
| 36 | Ga0068869_100673877 | 3300005334 | Bacteria | 880 |
| 37 | Ga0070666_10023127 | 3300005335 | Bacteria | 4042 |
| 38 | Ga0070666_10329282 | 3300005335 | Bacteria | 1090 |
| 39 | Ga0070680_100019894 | 3300005336 | Bacteria | 5323 |
| 40 | Ga0070680_100045978 | 3300005336 | Bacteria | 3550 |
| 41 | Ga0070680_100072787 | 3300005336 | Bacteria | 2825 |
| 42 | Ga0070680_100248532 | 3300005336 | Bacteria | 1504 |
| 43 | Ga0070680_100739003 | 3300005336 | Bacteria | 847 |
| 44 | Ga0070680_100851267 | 3300005336 | Bacteria | 786 |
| 45 | Ga0070680_101201131 | 3300005336 | Bacteria | 656 |
| 46 | Ga0070682_100023836 | 3300005337 | Bacteria | 3637 |
| 47 | Ga0070682_100716296 | 3300005337 | Bacteria | 804 |
| 48 | Ga0070682_100938223 | 3300005337 | Bacteria | 714 |
| 49 | Ga0070682_101349580 | 3300005337 | Bacteria | 608 |
| 50 | Ga0068868_100199244 | 3300005338 | Bacteria | 1668 |
| 51 | Ga0068868_100291153 | 3300005338 | Bacteria | 1384 |
| 52 | Ga0068868_100405385 | 3300005338 | Bacteria | 1177 |
| 53 | Ga0068868_101440077 | 3300005338 | Bacteria | 643 |
| 54 | Ga0070660_100018276 | 3300005339 | Bacteria | 5121 |
| 55 | Ga0070660_100040143 | 3300005339 | Bacteria | 3560 |
| 56 | Ga0070660_100052268 | 3300005339 | Bacteria | 3150 |
| 57 | Ga0070660_100379564 | 3300005339 | Bacteria | 1167 |
| 58 | Ga0070660_100907907 | 3300005339 | Bacteria | 743 |
| 59 | Ga0070689_100053325 | 3300005340 | Bacteria | 3129 |
| 60 | Ga0070689_100810262 | 3300005340 | Bacteria | 824 |
| 61 | Ga0070689_101509819 | 3300005340 | Bacteria | 609 |
| 62 | Ga0070691_10024352 | 3300005341 | Bacteria | 2813 |
| 63 | Ga0070691_10226777 | 3300005341 | Bacteria | 992 |
| 64 | Ga0070691_10306108 | 3300005341 | Bacteria | 870 |
| 65 | Ga0070661_100158458 | 3300005344 | Bacteria | 1713 |
| 66 | Ga0070661_100582676 | 3300005344 | Bacteria | 903 |
| 67 | Ga0070668_100038563 | 3300005347 | Bacteria | 3652 |
| 68 | Ga0070668_100452846 | 3300005347 | Bacteria | 1104 |
| 69 | Ga0070668_100850994 | 3300005347 | Bacteria | 813 |
| 70 | Ga0070668_101028917 | 3300005347 | Bacteria | 741 |
| 71 | Ga0070669_100023313 | 3300005353 | Bacteria | 4432 |
| 72 | Ga0070669_100023914 | 3300005353 | Bacteria | 4377 |
| 73 | Ga0070675_100055612 | 3300005354 | Bacteria | 3258 |
| 74 | Ga0070675_100226391 | 3300005354 | Bacteria | 1630 |
| 75 | Ga0070675_100350669 | 3300005354 | Bacteria | 1309 |
| 76 | Ga0070675_100534805 | 3300005354 | Bacteria | 1059 |
| 77 | Ga0070675_100597549 | 3300005354 | Bacteria | 1001 |
| 78 | Ga0070671_100309895 | 3300005355 | Bacteria | 1344 |
| 79 | Ga0070671_101577543 | 3300005355 | Bacteria | 582 |
| 80 | Ga0070671_101584924 | 3300005355 | Bacteria | 580 |
| 81 | Ga0070674_100001266 | 3300005356 | Bacteria | 13294 |
| 82 | Ga0070674_100041872 | 3300005356 | Bacteria | 3107 |
| 83 | Ga0070674_100063433 | 3300005356 | Bacteria | 2586 |
| 84 | Ga0070673_100592233 | 3300005364 | Bacteria | 1011 |
| 85 | Ga0070673_101623517 | 3300005364 | Bacteria | 611 |
| 86 | Ga0070688_100013675 | 3300005365 | Bacteria | 4583 |
| 87 | Ga0070688_101442699 | 3300005365 | Bacteria | 559 |
| 88 | Ga0070659_100311578 | 3300005366 | Bacteria | 1314 |
| 89 | Ga0070659_101218788 | 3300005366 | Bacteria | 666 |
| 90 | Ga0070659_101253243 | 3300005366 | Bacteria | 657 |
| 91 | Ga0070659_101337529 | 3300005366 | Bacteria | 636 |
| 92 | Ga0070667_100061525 | 3300005367 | Bacteria | 3179 |
| 93 | Ga0070667_100067572 | 3300005367 | Bacteria | 3039 |
| 94 | Ga0070667_100342781 | 3300005367 | Bacteria | 1352 |
| 95 | Ga0070667_100354428 | 3300005367 | Bacteria | 1329 |
| 96 | Ga0070667_101874074 | 3300005367 | Bacteria | 564 |
| 97 | Ga0070703_10006226 | 3300005406 | Bacteria | 3340 |
| 98 | Ga0070709_10078673 | 3300005434 | Bacteria | 2146 |
| 99 | Ga0070709_10504056 | 3300005434 | Bacteria | 920 |
| 100 | Ga0070709_10614722 | 3300005434 | Bacteria | 838 |
| 101 | Ga0070709_10883751 | 3300005434 | Bacteria | 706 |
| 102 | Ga0070714_100011267 | 3300005435 | Bacteria | 7088 |
| 103 | Ga0070714_101439883 | 3300005435 | Bacteria | 673 |
| 104 | Ga0070713_100001675 | 3300005436 | Bacteria | 14235 |
| 105 | Ga0070713_100443886 | 3300005436 | Bacteria | 1218 |
| 106 | Ga0070713_100909268 | 3300005436 | Bacteria | 847 |
| 107 | Ga0070713_100995054 | 3300005436 | Bacteria | 809 |
| 108 | Ga0070713_101050050 | 3300005436 | Bacteria | 787 |
| 109 | Ga0070713_101275263 | 3300005436 | Bacteria | 712 |
| 110 | Ga0070713_101285700 | 3300005436 | Bacteria | 709 |
| 111 | Ga0070713_102099842 | 3300005436 | Bacteria | 548 |
| 112 | Ga0070713_102174607 | 3300005436 | Bacteria | 538 |
| 113 | Ga0070710_10049219 | 3300005437 | Bacteria | 2357 |
| 114 | Ga0070710_10412417 | 3300005437 | Bacteria | 908 |
| 115 | Ga0070710_11060605 | 3300005437 | Bacteria | 593 |
| 116 | Ga0070701_10041914 | 3300005438 | Bacteria | 2334 |
| 117 | Ga0070711_100071215 | 3300005439 | Bacteria | 2449 |
| 118 | Ga0070711_100389457 | 3300005439 | Bacteria | 1129 |
| 119 | Ga0070711_100727388 | 3300005439 | Bacteria | 837 |
| 120 | Ga0070705_100053071 | 3300005440 | Bacteria | 2371 |
| 121 | Ga0070705_100054595 | 3300005440 | Bacteria | 2344 |
| 122 | Ga0070705_100811235 | 3300005440 | Bacteria | 745 |
| 123 | Ga0070700_100474427 | 3300005441 | Bacteria | 957 |
| 124 | Ga0070700_100708498 | 3300005441 | Bacteria | 801 |
| 125 | Ga0070694_100020300 | 3300005444 | Bacteria | 4234 |
| 126 | Ga0070694_100056701 | 3300005444 | Bacteria | 2661 |
| 127 | Ga0070694_101318053 | 3300005444 | Bacteria | 608 |
| 128 | Ga0070708_100551887 | 3300005445 | Bacteria | 1087 |
| 129 | Ga0070663_100034462 | 3300005455 | Bacteria | 3506 |
| 130 | Ga0070663_101907264 | 3300005455 | Bacteria | 534 |
| 131 | Ga0070678_100021125 | 3300005456 | Bacteria | 4286 |
| 132 | Ga0070678_100021594 | 3300005456 | Bacteria | 4249 |
| 133 | Ga0070678_100122832 | 3300005456 | Bacteria | 2050 |
| 134 | Ga0070678_100323616 | 3300005456 | Bacteria | 1317 |
| 135 | Ga0070678_100568500 | 3300005456 | Bacteria | 1008 |
| 136 | Ga0070678_100760487 | 3300005456 | Bacteria | 877 |
| 137 | Ga0070678_101059090 | 3300005456 | Bacteria | 747 |
| 138 | Ga0070662_100021397 | 3300005457 | Bacteria | 4415 |
| 139 | Ga0070662_101093878 | 3300005457 | Bacteria | 684 |
| 140 | Ga0070681_10007102 | 3300005458 | Bacteria | 10905 |
| 141 | Ga0070681_10263987 | 3300005458 | Bacteria | 1633 |
| 142 | Ga0070681_10354805 | 3300005458 | Bacteria | 1377 |
| 143 | Ga0070681_10479877 | 3300005458 | Bacteria | 1156 |
| 144 | Ga0070681_10697971 | 3300005458 | Bacteria | 930 |
| 145 | Ga0070681_10890099 | 3300005458 | Bacteria | 808 |
| 146 | Ga0070681_11741244 | 3300005458 | Bacteria | 550 |
| 147 | Ga0068867_100100755 | 3300005459 | Bacteria | 2205 |
| 148 | Ga0068867_100106725 | 3300005459 | Bacteria | 2146 |
| 149 | Ga0068867_100241062 | 3300005459 | Bacteria | 1466 |
| 150 | Ga0068867_100513407 | 3300005459 | Bacteria | 1032 |
| 151 | Ga0068867_100798158 | 3300005459 | Bacteria | 842 |
| 152 | Ga0070685_10012732 | 3300005466 | Bacteria | 4425 |
| 153 | Ga0070685_10190747 | 3300005466 | Bacteria | 1326 |
| 154 | Ga0070706_100045185 | 3300005467 | Bacteria | 4069 |
| 155 | Ga0070706_100343409 | 3300005467 | Bacteria | 1392 |
| 156 | Ga0070707_100307016 | 3300005468 | Bacteria | 1542 |
| 157 | Ga0070707_100471842 | 3300005468 | Bacteria | 1216 |
| 158 | Ga0070698_100327715 | 3300005471 | Bacteria | 1462 |
| 159 | Ga0070699_100120889 | 3300005518 | Bacteria | 2303 |
| 160 | Ga0070699_100188037 | 3300005518 | Bacteria | 1834 |
| 161 | Ga0070679_100039101 | 3300005530 | Bacteria | 4715 |
| 162 | Ga0070679_100082939 | 3300005530 | Bacteria | 3195 |
| 163 | Ga0070679_100092871 | 3300005530 | Bacteria | 3005 |
| 164 | Ga0070679_100235905 | 3300005530 | Bacteria | 1788 |
| 165 | Ga0070679_100356169 | 3300005530 | Bacteria | 1411 |
| 166 | Ga0070679_100373412 | 3300005530 | Bacteria | 1373 |
| 167 | Ga0070679_100398817 | 3300005530 | Bacteria | 1322 |
| 168 | Ga0070679_100629447 | 3300005530 | Bacteria | 1016 |
| 169 | Ga0070679_100931182 | 3300005530 | Bacteria | 812 |
| 170 | Ga0070679_100939174 | 3300005530 | Bacteria | 809 |
| 171 | Ga0070679_101484904 | 3300005530 | Bacteria | 625 |
| 172 | Ga0070679_101517440 | 3300005530 | Bacteria | 617 |
| 173 | Ga0070679_101644542 | 3300005530 | Bacteria | 590 |
| 174 | Ga0070684_100073460 | 3300005535 | Bacteria | 3013 |
| 175 | Ga0070684_100444811 | 3300005535 | Bacteria | 1197 |
| 176 | Ga0070684_100819267 | 3300005535 | Bacteria | 870 |
| 177 | Ga0070684_101199306 | 3300005535 | Bacteria | 714 |
| 178 | Ga0070684_101913630 | 3300005535 | Bacteria | 560 |
| 179 | Ga0070697_100715234 | 3300005536 | Bacteria | 884 |
| 180 | Ga0068853_100006917 | 3300005539 | Bacteria | 9054 |
| 181 | Ga0068853_100173535 | 3300005539 | Bacteria | 1952 |
| 182 | Ga0068853_100295709 | 3300005539 | Bacteria | 1495 |
| 183 | Ga0068853_100308432 | 3300005539 | Bacteria | 1464 |
| 184 | Ga0068853_100402370 | 3300005539 | Bacteria | 1281 |
| 185 | Ga0068853_100896521 | 3300005539 | Bacteria | 852 |
| 186 | Ga0068853_102080199 | 3300005539 | Bacteria | 551 |
| 187 | Ga0070672_100075788 | 3300005543 | Bacteria | 2686 |
| 188 | Ga0070686_100026380 | 3300005544 | Bacteria | 3507 |
| 189 | Ga0070686_100568573 | 3300005544 | Bacteria | 889 |
| 190 | Ga0070686_101396448 | 3300005544 | Bacteria | 587 |
| 191 | Ga0070686_101508823 | 3300005544 | Bacteria | 566 |
| 192 | Ga0070695_100037771 | 3300005545 | Bacteria | 3045 |
| 193 | Ga0070695_100040449 | 3300005545 | Bacteria | 2951 |
| 194 | Ga0070696_100006293 | 3300005546 | Bacteria | 7950 |
| 195 | Ga0070696_100010439 | 3300005546 | Bacteria | 6223 |
| 196 | Ga0070696_100074654 | 3300005546 | Bacteria | 2391 |
| 197 | Ga0070696_100464160 | 3300005546 | Bacteria | 1001 |
| 198 | Ga0070696_100716140 | 3300005546 | Bacteria | 817 |
| 199 | Ga0070693_100011024 | 3300005547 | Bacteria | 4545 |
| 200 | Ga0070693_100167752 | 3300005547 | Bacteria | 1403 |
| 201 | Ga0070693_100804690 | 3300005547 | Bacteria | 697 |
| 202 | Ga0070693_101375393 | 3300005547 | Bacteria | 548 |
| 203 | Ga0070665_100014624 | 3300005548 | Bacteria | 7876 |
| 204 | Ga0070665_100074982 | 3300005548 | Bacteria | 3389 |
| 205 | Ga0070665_100087868 | 3300005548 | Bacteria | 3114 |
| 206 | Ga0070665_100157888 | 3300005548 | Bacteria | 2270 |
| 207 | Ga0070665_100182589 | 3300005548 | Bacteria | 2099 |
| 208 | Ga0070665_100331108 | 3300005548 | Bacteria | 1527 |
| 209 | Ga0070665_100340969 | 3300005548 | Bacteria | 1503 |
| 210 | Ga0070665_100414332 | 3300005548 | Bacteria | 1356 |
| 211 | Ga0070665_100612837 | 3300005548 | Bacteria | 1102 |
| 212 | Ga0070665_101381074 | 3300005548 | Bacteria | 714 |
| 213 | Ga0070665_101480620 | 3300005548 | Bacteria | 687 |
| 214 | Ga0070665_101900889 | 3300005548 | Bacteria | 601 |
| 215 | Ga0070665_102367133 | 3300005548 | Bacteria | 534 |
| 216 | Ga0070704_100930546 | 3300005549 | Bacteria | 783 |
| 217 | Ga0068855_100107936 | 3300005563 | Bacteria | 3198 |
| 218 | Ga0068855_100218784 | 3300005563 | Bacteria | 2137 |
| 219 | Ga0068855_100377233 | 3300005563 | Bacteria | 1558 |
| 220 | Ga0068855_100551499 | 3300005563 | Bacteria | 1247 |
| 221 | Ga0068855_100856090 | 3300005563 | Bacteria | 963 |
| 222 | Ga0068855_101168688 | 3300005563 | Bacteria | 801 |
| 223 | Ga0068855_101411038 | 3300005563 | Bacteria | 717 |
| 224 | Ga0068855_101569489 | 3300005563 | Bacteria | 674 |
| 225 | Ga0068855_102108968 | 3300005563 | Bacteria | 567 |
| 226 | Ga0070664_100068199 | 3300005564 | Bacteria | 3041 |
| 227 | Ga0070664_101714597 | 3300005564 | Bacteria | 595 |
| 228 | Ga0070664_101989152 | 3300005564 | Bacteria | 551 |
| 229 | Ga0068857_100096862 | 3300005577 | Bacteria | 2644 |
| 230 | Ga0068857_100128196 | 3300005577 | Bacteria | 2287 |
| 231 | Ga0068857_100828304 | 3300005577 | Bacteria | 885 |
| 232 | Ga0068857_101058490 | 3300005577 | Bacteria | 782 |
| 233 | Ga0068857_101572916 | 3300005577 | Bacteria | 641 |
| 234 | Ga0068854_100683089 | 3300005578 | Bacteria | 885 |
| 235 | Ga0068854_101116855 | 3300005578 | Bacteria | 703 |
| 236 | Ga0068856_100191608 | 3300005614 | Bacteria | 2058 |
| 237 | Ga0068856_100277013 | 3300005614 | Bacteria | 1694 |
| 238 | Ga0068856_100781455 | 3300005614 | Bacteria | 975 |
| 239 | Ga0068856_101292082 | 3300005614 | Bacteria | 745 |
| 240 | Ga0068856_101970962 | 3300005614 | Bacteria | 594 |
| 241 | Ga0070702_100186251 | 3300005615 | Bacteria | 1362 |
| 242 | Ga0068852_100130647 | 3300005616 | Bacteria | 2312 |
| 243 | Ga0068852_102407536 | 3300005616 | Bacteria | 547 |
| 244 | Ga0068859_100225122 | 3300005617 | Bacteria | 1964 |
| 245 | Ga0068859_100416049 | 3300005617 | Bacteria | 1440 |
| 246 | Ga0068859_100653974 | 3300005617 | Bacteria | 1143 |
| 247 | Ga0068859_101091707 | 3300005617 | Bacteria | 878 |
| 248 | Ga0068859_102701731 | 3300005617 | Bacteria | 545 |
| 249 | Ga0068864_100170784 | 3300005618 | Bacteria | 1982 |
| 250 | Ga0068864_100695509 | 3300005618 | Bacteria | 993 |
| 251 | Ga0068864_101390974 | 3300005618 | Bacteria | 703 |
| 252 | Ga0068864_101798307 | 3300005618 | Bacteria | 618 |
| 253 | Ga0068864_102438990 | 3300005618 | Bacteria | 529 |
| 254 | Ga0068866_10155481 | 3300005718 | Bacteria | 1328 |
| 255 | Ga0068866_10320624 | 3300005718 | Bacteria | 975 |
| 256 | Ga0068866_10583336 | 3300005718 | Bacteria | 752 |
| 257 | Ga0068861_100084477 | 3300005719 | Bacteria | 2492 |
| 258 | Ga0068861_100275129 | 3300005719 | Bacteria | 1447 |
| 259 | Ga0068861_101018226 | 3300005719 | Bacteria | 791 |
| 260 | Ga0068851_10074549 | 3300005834 | Bacteria | 1762 |
| 261 | Ga0068870_10209043 | 3300005840 | Bacteria | 1188 |
| 262 | Ga0068870_11056359 | 3300005840 | Bacteria | 582 |
| 263 | Ga0068863_100043883 | 3300005841 | Bacteria | 4244 |
| 264 | Ga0068863_100350018 | 3300005841 | Bacteria | 1438 |
| 265 | Ga0068863_101024711 | 3300005841 | Bacteria | 829 |
| 266 | Ga0068863_102507882 | 3300005841 | Bacteria | 525 |
| 267 | Ga0068858_100049282 | 3300005842 | Bacteria | 3900 |
| 268 | Ga0068858_100112898 | 3300005842 | Bacteria | 2538 |
| 269 | Ga0068858_100163902 | 3300005842 | Bacteria | 2094 |
| 270 | Ga0068858_100425301 | 3300005842 | Bacteria | 1277 |
| 271 | Ga0068860_100092223 | 3300005843 | Bacteria | 2886 |
| 272 | Ga0068860_100440964 | 3300005843 | Bacteria | 1293 |
| 273 | Ga0068860_100463463 | 3300005843 | Bacteria | 1261 |
| 274 | Ga0068860_101054688 | 3300005843 | Bacteria | 831 |
| 275 | Ga0068860_101067238 | 3300005843 | Bacteria | 827 |
| 276 | Ga0068860_102839372 | 3300005843 | Bacteria | 502 |
| 277 | Ga0068862_100011381 | 3300005844 | Bacteria | 7344 |
| 278 | Ga0068862_100191186 | 3300005844 | Bacteria | 1842 |
| 279 | Ga0068862_100432931 | 3300005844 | Bacteria | 1237 |
| 280 | Ga0068862_101350880 | 3300005844 | Bacteria | 715 |
| 281 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 282 | Ga0081455_10013116 | 3300005937 | Bacteria | 8213 |
| 283 | Ga0081455_10017489 | 3300005937 | Bacteria | 6870 |
| 284 | Ga0081455_10099126 | 3300005937 | Bacteria | 2344 |
| 285 | Ga0081455_10137446 | 3300005937 | Bacteria | 1902 |
| 286 | Ga0081538_10001852 | 3300005981 | Bacteria | 21341 |
| 287 | Ga0081540_1095245 | 3300005983 | Bacteria | 1298 |
| 288 | Ga0081540_1191416 | 3300005983 | Bacteria | 754 |
| 289 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 290 | Ga0081539_10009089 | 3300005985 | Bacteria | 8416 |
| 291 | Ga0070717_10074954 | 3300006028 | Bacteria | 2829 |
| 292 | Ga0070717_10477158 | 3300006028 | Bacteria | 1126 |
| 293 | Ga0070717_10724336 | 3300006028 | Bacteria | 904 |
| 294 | Ga0070717_10845026 | 3300006028 | Bacteria | 833 |
| 295 | Ga0075368_10193637 | 3300006042 | Bacteria | 859 |
| 296 | Ga0075363_100273731 | 3300006048 | Bacteria | 976 |
| 297 | Ga0075363_100421375 | 3300006048 | Bacteria | 786 |
| 298 | Ga0075363_100712037 | 3300006048 | Bacteria | 607 |
| 299 | Ga0075364_10249794 | 3300006051 | Bacteria | 1205 |
| 300 | Ga0070715_10011442 | 3300006163 | Bacteria | 3196 |
| 301 | Ga0070716_100180003 | 3300006173 | Bacteria | 1387 |
| 302 | Ga0070716_100317300 | 3300006173 | Bacteria | 1091 |
| 303 | Ga0070712_100004619 | 3300006175 | Bacteria | 8513 |
| 304 | Ga0070712_100314311 | 3300006175 | Bacteria | 1272 |
| 305 | Ga0075362_10096734 | 3300006177 | Bacteria | 1376 |
| 306 | Ga0075362_10277492 | 3300006177 | Bacteria | 828 |
| 307 | Ga0075367_10319705 | 3300006178 | Bacteria | 978 |
| 308 | Ga0075367_10462486 | 3300006178 | Bacteria | 804 |
| 309 | Ga0075367_10488672 | 3300006178 | Bacteria | 781 |
| 310 | Ga0075367_10558546 | 3300006178 | Bacteria | 727 |
| 311 | Ga0075366_10042037 | 3300006195 | Bacteria | 2706 |
| 312 | Ga0075366_10335185 | 3300006195 | Bacteria | 927 |
| 313 | Ga0075366_10467034 | 3300006195 | Bacteria | 779 |
| 314 | Ga0075366_10774579 | 3300006195 | Bacteria | 596 |
| 315 | Ga0097621_100106219 | 3300006237 | Bacteria | 2368 |
| 316 | Ga0097621_100141731 | 3300006237 | Bacteria | 2054 |
| 317 | Ga0097621_100318759 | 3300006237 | Bacteria | 1376 |
| 318 | Ga0097621_100778144 | 3300006237 | Bacteria | 885 |
| 319 | Ga0097621_101172310 | 3300006237 | Bacteria | 723 |
| 320 | Ga0075370_10025728 | 3300006353 | Bacteria | 3256 |
| 321 | Ga0075370_10243018 | 3300006353 | Bacteria | 1066 |
| 322 | Ga0068871_100071528 | 3300006358 | Bacteria | 2853 |
| 323 | Ga0068871_100392603 | 3300006358 | Bacteria | 1234 |
| 324 | Ga0068871_101195952 | 3300006358 | Bacteria | 713 |
| 325 | Ga0075428_102272651 | 3300006844 | Bacteria | 558 |
| 326 | Ga0075430_100113569 | 3300006846 | Bacteria | 2257 |
| 327 | Ga0075430_100275397 | 3300006846 | Bacteria | 1392 |
| 328 | Ga0075431_101210725 | 3300006847 | Bacteria | 718 |
| 329 | Ga0075431_102202149 | 3300006847 | Bacteria | 506 |
| 330 | Ga0075433_10227783 | 3300006852 | Bacteria | 1655 |
| 331 | Ga0075433_10486718 | 3300006852 | Bacteria | 1087 |
| 332 | Ga0075433_11139175 | 3300006852 | Bacteria | 678 |
| 333 | Ga0075434_100127605 | 3300006871 | Bacteria | 2561 |
| 334 | Ga0075434_100342016 | 3300006871 | Bacteria | 1517 |
| 335 | Ga0075434_100939960 | 3300006871 | Bacteria | 879 |
| 336 | Ga0068865_100002505 | 3300006881 | Bacteria | 10873 |
| 337 | Ga0068865_100204889 | 3300006881 | Bacteria | 1533 |
| 338 | Ga0068865_100875544 | 3300006881 | Bacteria | 779 |
| 339 | Ga0068865_100934570 | 3300006881 | Bacteria | 756 |
| 340 | Ga0068865_101556208 | 3300006881 | Bacteria | 593 |
| 341 | Ga0075436_100053121 | 3300006914 | Bacteria | 2797 |
| 342 | Ga0075436_100243577 | 3300006914 | Bacteria | 1279 |
| 343 | Ga0075436_101311785 | 3300006914 | Bacteria | 548 |
| 344 | Ga0097620_100225140 | 3300006931 | Bacteria | 1964 |
| 345 | Ga0097620_100416056 | 3300006931 | Bacteria | 1440 |
| 346 | Ga0097620_100653863 | 3300006931 | Bacteria | 1143 |
| 347 | Ga0097620_101091665 | 3300006931 | Bacteria | 878 |
| 348 | Ga0097620_102701815 | 3300006931 | Bacteria | 545 |
| 349 | Ga0099795_10002056 | 3300007788 | Bacteria | 4620 |
| 350 | Ga0099795_10357496 | 3300007788 | Bacteria | 655 |
| 351 | Ga0105250_10202203 | 3300009092 | Bacteria | 838 |
| 352 | Ga0105240_10118855 | 3300009093 | Bacteria | 3185 |
| 353 | Ga0105240_10261448 | 3300009093 | Bacteria | 1996 |
| 354 | Ga0105240_10313482 | 3300009093 | Bacteria | 1790 |
| 355 | Ga0105240_10455243 | 3300009093 | Bacteria | 1431 |
| 356 | Ga0105240_10546606 | 3300009093 | Bacteria | 1282 |
| 357 | Ga0105240_10644980 | 3300009093 | Bacteria | 1161 |
| 358 | Ga0105240_10775048 | 3300009093 | Bacteria | 1041 |
| 359 | Ga0105240_10950412 | 3300009093 | Bacteria | 922 |
| 360 | Ga0105240_11671845 | 3300009093 | Bacteria | 665 |
| 361 | Ga0105240_12026371 | 3300009093 | Bacteria | 598 |
| 362 | Ga0105240_12217837 | 3300009093 | Bacteria | 569 |
| 363 | Ga0105240_12584970 | 3300009093 | Bacteria | 525 |
| 364 | Ga0111539_10065259 | 3300009094 | Bacteria | 4303 |
| 365 | Ga0111539_10872514 | 3300009094 | Bacteria | 1047 |
| 366 | Ga0111539_12489409 | 3300009094 | Bacteria | 600 |
| 367 | Ga0111539_13375196 | 3300009094 | Bacteria | 514 |
| 368 | Ga0105245_10289754 | 3300009098 | Bacteria | 1603 |
| 369 | Ga0105245_11142459 | 3300009098 | Bacteria | 826 |
| 370 | Ga0105245_11300387 | 3300009098 | Bacteria | 776 |
| 371 | Ga0105245_12283177 | 3300009098 | Bacteria | 595 |
| 372 | Ga0105247_10189096 | 3300009101 | Bacteria | 1378 |
| 373 | Ga0105247_10574377 | 3300009101 | Bacteria | 832 |
| 374 | Ga0105247_10618604 | 3300009101 | Bacteria | 805 |
| 375 | Ga0105247_11454536 | 3300009101 | Bacteria | 557 |
| 376 | Ga0114129_10210172 | 3300009147 | Bacteria | 2631 |
| 377 | Ga0114129_10227354 | 3300009147 | Bacteria | 2514 |
| 378 | Ga0114129_11135926 | 3300009147 | Bacteria | 976 |
| 379 | Ga0114129_12150191 | 3300009147 | Bacteria | 672 |
| 380 | Ga0105243_10014127 | 3300009148 | Bacteria | 6039 |
| 381 | Ga0105243_10014172 | 3300009148 | Bacteria | 6032 |
| 382 | Ga0105243_10865852 | 3300009148 | Bacteria | 896 |
| 383 | Ga0105243_11173214 | 3300009148 | Bacteria | 780 |
| 384 | Ga0105241_10113021 | 3300009174 | Bacteria | 2176 |
| 385 | Ga0105241_10253442 | 3300009174 | Bacteria | 1493 |
| 386 | Ga0105241_10267822 | 3300009174 | Bacteria | 1454 |
| 387 | Ga0105241_10349871 | 3300009174 | Bacteria | 1283 |
| 388 | Ga0105241_10773262 | 3300009174 | Bacteria | 882 |
| 389 | Ga0105241_10836780 | 3300009174 | Bacteria | 850 |
| 390 | Ga0105241_10926408 | 3300009174 | Bacteria | 811 |
| 391 | Ga0105241_11541385 | 3300009174 | Bacteria | 641 |
| 392 | Ga0105241_11924604 | 3300009174 | Bacteria | 580 |
| 393 | Ga0105242_10123893 | 3300009176 | Bacteria | 2222 |
| 394 | Ga0105242_10256228 | 3300009176 | Bacteria | 1579 |
| 395 | Ga0105242_10362506 | 3300009176 | Bacteria | 1342 |
| 396 | Ga0105248_10063706 | 3300009177 | Bacteria | 4138 |
| 397 | Ga0105248_10289075 | 3300009177 | Bacteria | 1846 |
| 398 | Ga0105248_10451887 | 3300009177 | Bacteria | 1448 |
| 399 | Ga0105248_10775680 | 3300009177 | Bacteria | 1082 |
| 400 | Ga0105248_10787840 | 3300009177 | Bacteria | 1073 |
| 401 | Ga0105248_12462277 | 3300009177 | Bacteria | 593 |
| 402 | Ga0105237_10016531 | 3300009545 | Bacteria | 7666 |
| 403 | Ga0105237_10080860 | 3300009545 | Bacteria | 3240 |
| 404 | Ga0105237_10155476 | 3300009545 | Bacteria | 2283 |
| 405 | Ga0105237_10373062 | 3300009545 | Bacteria | 1431 |
| 406 | Ga0105237_10526050 | 3300009545 | Bacteria | 1189 |
| 407 | Ga0105238_10012597 | 3300009551 | Bacteria | 8537 |
| 408 | Ga0105238_10179895 | 3300009551 | Bacteria | 2092 |
| 409 | Ga0105238_10215115 | 3300009551 | Bacteria | 1898 |
| 410 | Ga0105238_10244606 | 3300009551 | Bacteria | 1772 |
| 411 | Ga0105238_10315021 | 3300009551 | Bacteria | 1550 |
| 412 | Ga0105238_10343086 | 3300009551 | Bacteria | 1482 |
| 413 | Ga0105238_10561589 | 3300009551 | Bacteria | 1146 |
| 414 | Ga0105238_10764574 | 3300009551 | Bacteria | 981 |
| 415 | Ga0105238_10806031 | 3300009551 | Bacteria | 955 |
| 416 | Ga0105238_11168422 | 3300009551 | Bacteria | 793 |
| 417 | Ga0105238_11204016 | 3300009551 | Bacteria | 782 |
| 418 | Ga0105238_11512957 | 3300009551 | Bacteria | 700 |
| 419 | Ga0105238_13063038 | 3300009551 | Bacteria | 502 |
| 420 | Ga0105249_10048120 | 3300009553 | Bacteria | 3888 |
| 421 | Ga0105249_10064902 | 3300009553 | Bacteria | 3357 |
| 422 | Ga0105249_10141467 | 3300009553 | Bacteria | 2308 |
| 423 | Ga0105249_11396288 | 3300009553 | Bacteria | 772 |
| 424 | Ga0105249_12281628 | 3300009553 | Bacteria | 614 |
| 425 | Ga0099796_10124832 | 3300010159 | Bacteria | 993 |
| 426 | Ga0105239_10066260 | 3300010375 | Bacteria | 3967 |
| 427 | Ga0105239_10138338 | 3300010375 | Bacteria | 2712 |
| 428 | Ga0105239_10327892 | 3300010375 | Bacteria | 1727 |
| 429 | Ga0105239_10592553 | 3300010375 | Bacteria | 1264 |
| 430 | Ga0105239_10691783 | 3300010375 | Bacteria | 1166 |
| 431 | Ga0105239_10759035 | 3300010375 | Bacteria | 1110 |
| 432 | Ga0105239_11628158 | 3300010375 | Bacteria | 747 |
| 433 | Ga0105239_11904501 | 3300010375 | Bacteria | 690 |
| 434 | Ga0105246_10004854 | 3300011119 | Bacteria | 8191 |
| 435 | Ga0105246_10062954 | 3300011119 | Bacteria | 2586 |
| 436 | Ga0105246_10753088 | 3300011119 | Bacteria | 859 |
| 437 | Ga0105246_10854873 | 3300011119 | Bacteria | 812 |
| 438 | Ga0105246_11590571 | 3300011119 | Bacteria | 617 |
| 439 | Ga0105246_11914791 | 3300011119 | Bacteria | 570 |
| 440 | Ga0105246_12405411 | 3300011119 | Bacteria | 517 |
| 441 | Ga0157344_1004729 | 3300012476 | Bacteria | 821 |
| 442 | Ga0157346_1012317 | 3300012480 | Bacteria | 646 |
| 443 | Ga0157337_1010414 | 3300012483 | Bacteria | 719 |
| 444 | Ga0157325_1035635 | 3300012485 | Bacteria | 520 |
| 445 | Ga0157345_1022859 | 3300012498 | Bacteria | 650 |
| 446 | Ga0157314_1002718 | 3300012500 | Bacteria | 1228 |
| 447 | Ga0157347_1010178 | 3300012502 | Bacteria | 983 |
| 448 | Ga0157313_1022476 | 3300012503 | Bacteria | 655 |
| 449 | Ga0157339_1025151 | 3300012505 | Bacteria | 661 |
| 450 | Ga0157324_1005414 | 3300012506 | Bacteria | 923 |
| 451 | Ga0157342_1002329 | 3300012507 | Bacteria | 1532 |
| 452 | Ga0157315_1003570 | 3300012508 | Bacteria | 1057 |
| 453 | Ga0157316_1002477 | 3300012510 | Bacteria | 1254 |
| 454 | Ga0157338_1046649 | 3300012515 | Bacteria | 608 |
| 455 | Ga0157373_10204225 | 3300013100 | Bacteria | 1393 |
| 456 | Ga0157373_10361875 | 3300013100 | Bacteria | 1036 |
| 457 | Ga0157373_10435233 | 3300013100 | Bacteria | 942 |
| 458 | Ga0157373_10523795 | 3300013100 | Bacteria | 858 |
| 459 | Ga0157373_11371771 | 3300013100 | Bacteria | 537 |
| 460 | Ga0157371_10360525 | 3300013102 | Bacteria | 1059 |
| 461 | Ga0157371_10634665 | 3300013102 | Bacteria | 796 |
| 462 | Ga0157371_10954468 | 3300013102 | Bacteria | 652 |
| 463 | Ga0157371_11054853 | 3300013102 | Bacteria | 622 |
| 464 | Ga0157370_10083851 | 3300013104 | Bacteria | 2996 |
| 465 | Ga0157370_10324532 | 3300013104 | Bacteria | 1420 |
| 466 | Ga0157370_10620972 | 3300013104 | Bacteria | 989 |
| 467 | Ga0157370_11162771 | 3300013104 | Bacteria | 697 |
| 468 | Ga0157370_11398251 | 3300013104 | Bacteria | 630 |
| 469 | Ga0157369_10087882 | 3300013105 | Bacteria | 3319 |
| 470 | Ga0157369_10135701 | 3300013105 | Bacteria | 2605 |
| 471 | Ga0157369_10578454 | 3300013105 | Bacteria | 1160 |
| 472 | Ga0157369_10707966 | 3300013105 | Bacteria | 1037 |
| 473 | Ga0157369_10828958 | 3300013105 | Bacteria | 950 |
| 474 | Ga0157369_11315190 | 3300013105 | Bacteria | 737 |
| 475 | Ga0157369_11368116 | 3300013105 | Bacteria | 721 |
| 476 | Ga0157369_12306567 | 3300013105 | Bacteria | 545 |
| 477 | Ga0157374_10133488 | 3300013296 | Bacteria | 2404 |
| 478 | Ga0157374_10332353 | 3300013296 | Bacteria | 1508 |
| 479 | Ga0157374_10382101 | 3300013296 | Bacteria | 1403 |
| 480 | Ga0157374_10956313 | 3300013296 | Bacteria | 875 |
| 481 | Ga0157378_10115850 | 3300013297 | Bacteria | 2464 |
| 482 | Ga0157378_10537404 | 3300013297 | Bacteria | 1173 |
| 483 | Ga0157378_10775844 | 3300013297 | Bacteria | 983 |
| 484 | Ga0157378_13021990 | 3300013297 | Bacteria | 522 |
| 485 | Ga0163162_10632920 | 3300013306 | Bacteria | 1194 |
| 486 | Ga0163162_10780723 | 3300013306 | Bacteria | 1073 |
| 487 | Ga0163162_12249586 | 3300013306 | Bacteria | 626 |
| 488 | Ga0163162_13124403 | 3300013306 | Bacteria | 532 |
| 489 | Ga0157372_10327295 | 3300013307 | Bacteria | 1784 |
| 490 | Ga0157372_10583662 | 3300013307 | Bacteria | 1303 |
| 491 | Ga0157372_10622267 | 3300013307 | Bacteria | 1258 |
| 492 | Ga0157372_11198800 | 3300013307 | Bacteria | 877 |
| 493 | Ga0157372_12846566 | 3300013307 | Bacteria | 554 |
| 494 | Ga0157375_10476831 | 3300013308 | Bacteria | 1413 |
| 495 | Ga0157375_10952587 | 3300013308 | Bacteria | 1000 |
| 496 | Ga0157375_11360480 | 3300013308 | Bacteria | 836 |
| 497 | Ga0157375_11760277 | 3300013308 | Bacteria | 734 |
| 498 | Ga0163163_10008003 | 3300014325 | Bacteria | 9355 |
| 499 | Ga0163163_10050622 | 3300014325 | Bacteria | 4091 |
| 500 | Ga0163163_10155427 | 3300014325 | Bacteria | 2332 |
| 501 | Ga0163163_10483398 | 3300014325 | Bacteria | 1299 |
| 502 | Ga0163163_10640651 | 3300014325 | Bacteria | 1126 |
| 503 | Ga0163163_10893135 | 3300014325 | Bacteria | 952 |
| 504 | Ga0163163_11109392 | 3300014325 | Bacteria | 854 |
| 505 | Ga0163163_11666641 | 3300014325 | Bacteria | 698 |
| 506 | Ga0163163_12335132 | 3300014325 | Bacteria | 593 |
| 507 | Ga0163163_12874742 | 3300014325 | Bacteria | 537 |
| 508 | Ga0157380_10069944 | 3300014326 | Bacteria | 2834 |
| 509 | Ga0157380_10450958 | 3300014326 | Bacteria | 1235 |
| 510 | Ga0157380_10545240 | 3300014326 | Bacteria | 1136 |
| 511 | Ga0157380_10806218 | 3300014326 | Bacteria | 956 |
| 512 | Ga0157380_10916393 | 3300014326 | Bacteria | 904 |
| 513 | Ga0182008_10126397 | 3300014497 | Bacteria | 1273 |
| 514 | Ga0182008_10213644 | 3300014497 | Bacteria | 985 |
| 515 | Ga0182008_10247911 | 3300014497 | Bacteria | 918 |
| 516 | Ga0157377_10476575 | 3300014745 | Bacteria | 867 |
| 517 | Ga0157379_10052289 | 3300014968 | Bacteria | 3649 |
| 518 | Ga0157379_10181186 | 3300014968 | Bacteria | 1903 |
| 519 | Ga0157379_10232957 | 3300014968 | Bacteria | 1670 |
| 520 | Ga0157379_10384430 | 3300014968 | Bacteria | 1288 |
| 521 | Ga0157379_10761071 | 3300014968 | Bacteria | 912 |
| 522 | Ga0157379_11349508 | 3300014968 | Bacteria | 690 |
| 523 | Ga0157376_10040837 | 3300014969 | Bacteria | 3794 |
| 524 | Ga0157376_10239568 | 3300014969 | Bacteria | 1690 |
| 525 | Ga0157376_10303079 | 3300014969 | Bacteria | 1513 |
| 526 | Ga0157376_10559227 | 3300014969 | Bacteria | 1133 |
| 527 | Ga0157376_10864631 | 3300014969 | Bacteria | 920 |
| 528 | Ga0157376_11078476 | 3300014969 | Bacteria | 828 |
| 529 | Ga0157376_11552520 | 3300014969 | Bacteria | 696 |
| 530 | Ga0157376_12145208 | 3300014969 | Bacteria | 597 |
| 531 | Ga0182007_10214516 | 3300015262 | Bacteria | 678 |
| 532 | Ga0163161_10260428 | 3300017792 | Bacteria | 1354 |
| 533 | Ga0163161_12061192 | 3300017792 | Bacteria | 507 |
| 534 | Ga0197907_10834854 | 3300020069 | Bacteria | 1122 |
| 535 | Ga0197907_10879882 | 3300020069 | Bacteria | 1094 |
| 536 | Ga0197907_11284989 | 3300020069 | Bacteria | 850 |
| 537 | Ga0206352_10592541 | 3300020078 | Bacteria | 559 |
| 538 | Ga0206352_10990522 | 3300020078 | Bacteria | 4035 |
| 539 | Ga0206350_11455779 | 3300020080 | Bacteria | 775 |
| 540 | Ga0206353_10563244 | 3300020082 | Bacteria | 4006 |
| 541 | Ga0213873_10005735 | 3300021358 | Bacteria | 2402 |
| 542 | Ga0213873_10019508 | 3300021358 | Bacteria | 1574 |
| 543 | Ga0213873_10038734 | 3300021358 | Bacteria | 1219 |
| 544 | Ga0213872_10012804 | 3300021361 | Bacteria | 3938 |
| 545 | Ga0213872_10021018 | 3300021361 | Bacteria | 3005 |
| 546 | Ga0213872_10093098 | 3300021361 | Bacteria | 1347 |
| 547 | Ga0213872_10112292 | 3300021361 | Bacteria | 1210 |
| 548 | Ga0213872_10201651 | 3300021361 | Bacteria | 852 |
| 549 | Ga0213874_10005081 | 3300021377 | Bacteria | 3046 |
| 550 | Ga0213874_10186857 | 3300021377 | Bacteria | 739 |
| 551 | Ga0213876_10026215 | 3300021384 | Bacteria | 3074 |
| 552 | Ga0213876_10027585 | 3300021384 | Bacteria | 2996 |
| 553 | Ga0213876_10207718 | 3300021384 | Bacteria | 1041 |
| 554 | Ga0213875_10007338 | 3300021388 | Bacteria | 5700 |
| 555 | Ga0213875_10017153 | 3300021388 | Bacteria | 3503 |
| 556 | Ga0213875_10023977 | 3300021388 | Bacteria | 2911 |
| 557 | Ga0213875_10042663 | 3300021388 | Bacteria | 2130 |
| 558 | Ga0213875_10042775 | 3300021388 | Bacteria | 2127 |
| 559 | Ga0213875_10120516 | 3300021388 | Bacteria | 1226 |
| 560 | Ga0213875_10163627 | 3300021388 | Bacteria | 1044 |
| 561 | Ga0213871_10003980 | 3300021441 | Bacteria | 2912 |
| 562 | Ga0213871_10012935 | 3300021441 | Bacteria | 1949 |
| 563 | Ga0213871_10312436 | 3300021441 | Bacteria | 509 |
| 564 | Ga0224712_10039629 | 3300022467 | Bacteria | 1767 |
| 565 | Ga0224712_10064921 | 3300022467 | Bacteria | 1465 |
| 566 | Ga0224712_10119230 | 3300022467 | Bacteria | 1141 |
| 567 | Ga0207427_108978 | 3300025231 | Bacteria | 1091 |
| 568 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 569 | Ga0209233_1003903 | 3300025261 | Bacteria | 5177 |
| 570 | Ga0209233_1011776 | 3300025261 | Bacteria | 2566 |
| 571 | Ga0209675_1020773 | 3300025291 | Bacteria | 1769 |
| 572 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 573 | Ga0209676_1004347 | 3300025292 | Bacteria | 7943 |
| 574 | Ga0209050_1007859 | 3300025298 | Bacteria | 5857 |
| 575 | Ga0209050_1010525 | 3300025298 | Bacteria | 4545 |
| 576 | Ga0209050_1041263 | 3300025298 | Bacteria | 1274 |
| 577 | Ga0209256_1018456 | 3300025299 | Bacteria | 2265 |
| 578 | Ga0209256_1057678 | 3300025299 | Bacteria | 915 |
| 579 | Ga0209051_1021790 | 3300025303 | Bacteria | 2715 |
| 580 | Ga0209257_1005546 | 3300025304 | Bacteria | 8787 |
| 581 | Ga0209257_1044807 | 3300025304 | Bacteria | 1289 |
| 582 | Ga0207656_10084736 | 3300025321 | Bacteria | 1430 |
| 583 | Ga0207682_10050681 | 3300025893 | Bacteria | 1717 |
| 584 | Ga0207682_10279036 | 3300025893 | Bacteria | 781 |
| 585 | Ga0207692_10010942 | 3300025898 | Bacteria | 3841 |
| 586 | Ga0207692_10182677 | 3300025898 | Bacteria | 1223 |
| 587 | Ga0207692_10385626 | 3300025898 | Bacteria | 871 |
| 588 | Ga0207642_10017630 | 3300025899 | Bacteria | 2721 |
| 589 | Ga0207642_10088287 | 3300025899 | Bacteria | 1525 |
| 590 | Ga0207642_10242080 | 3300025899 | Bacteria | 1019 |
| 591 | Ga0207710_10052978 | 3300025900 | Bacteria | 1825 |
| 592 | Ga0207710_10303804 | 3300025900 | Bacteria | 807 |
| 593 | Ga0207688_10166712 | 3300025901 | Bacteria | 1308 |
| 594 | Ga0207680_10002564 | 3300025903 | Bacteria | 8470 |
| 595 | Ga0207680_10136372 | 3300025903 | Bacteria | 1622 |
| 596 | Ga0207647_10038225 | 3300025904 | Bacteria | 3036 |
| 597 | Ga0207647_10310841 | 3300025904 | Bacteria | 896 |
| 598 | Ga0207699_10008830 | 3300025906 | Bacteria | 4992 |
| 599 | Ga0207699_10425897 | 3300025906 | Bacteria | 949 |
| 600 | Ga0207699_10885593 | 3300025906 | Bacteria | 658 |
| 601 | Ga0207699_11013020 | 3300025906 | Bacteria | 614 |
| 602 | Ga0207699_11075577 | 3300025906 | Bacteria | 595 |
| 603 | Ga0207645_10011392 | 3300025907 | Bacteria | 6075 |
| 604 | Ga0207645_10279815 | 3300025907 | Bacteria | 1108 |
| 605 | Ga0207645_10602094 | 3300025907 | Bacteria | 746 |
| 606 | Ga0207645_10630619 | 3300025907 | Bacteria | 728 |
| 607 | Ga0207643_10030805 | 3300025908 | Bacteria | 2989 |
| 608 | Ga0207643_10032595 | 3300025908 | Bacteria | 2911 |
| 609 | Ga0207643_10974748 | 3300025908 | Bacteria | 549 |
| 610 | Ga0207705_10004720 | 3300025909 | Bacteria | 10265 |
| 611 | Ga0207705_10101468 | 3300025909 | Bacteria | 2117 |
| 612 | Ga0207705_10462889 | 3300025909 | Bacteria | 984 |
| 613 | Ga0207705_10837392 | 3300025909 | Bacteria | 713 |
| 614 | Ga0207684_10122169 | 3300025910 | Bacteria | 2233 |
| 615 | Ga0207684_10354217 | 3300025910 | Bacteria | 1263 |
| 616 | Ga0207684_11107359 | 3300025910 | Bacteria | 659 |
| 617 | Ga0207654_10063489 | 3300025911 | Bacteria | 2168 |
| 618 | Ga0207654_10065182 | 3300025911 | Bacteria | 2144 |
| 619 | Ga0207654_10199940 | 3300025911 | Bacteria | 1315 |
| 620 | Ga0207654_10278345 | 3300025911 | Bacteria | 1131 |
| 621 | Ga0207654_11447529 | 3300025911 | Bacteria | 501 |
| 622 | Ga0207707_10017730 | 3300025912 | Bacteria | 6211 |
| 623 | Ga0207707_10156792 | 3300025912 | Bacteria | 1991 |
| 624 | Ga0207707_10358526 | 3300025912 | Bacteria | 1256 |
| 625 | Ga0207707_10391698 | 3300025912 | Bacteria | 1193 |
| 626 | Ga0207707_10445172 | 3300025912 | Bacteria | 1109 |
| 627 | Ga0207707_10539056 | 3300025912 | Bacteria | 992 |
| 628 | Ga0207707_10574219 | 3300025912 | Bacteria | 956 |
| 629 | Ga0207707_10630210 | 3300025912 | Bacteria | 905 |
| 630 | Ga0207695_10163712 | 3300025913 | Bacteria | 2154 |
| 631 | Ga0207695_10178743 | 3300025913 | Bacteria | 2044 |
| 632 | Ga0207695_10284139 | 3300025913 | Bacteria | 1548 |
| 633 | Ga0207695_10384742 | 3300025913 | Bacteria | 1288 |
| 634 | Ga0207695_10396467 | 3300025913 | Bacteria | 1265 |
| 635 | Ga0207695_10808022 | 3300025913 | Bacteria | 818 |
| 636 | Ga0207695_11259296 | 3300025913 | Bacteria | 620 |
| 637 | Ga0207695_11442632 | 3300025913 | Bacteria | 569 |
| 638 | Ga0207671_10066436 | 3300025914 | Bacteria | 2684 |
| 639 | Ga0207671_10158422 | 3300025914 | Bacteria | 1752 |
| 640 | Ga0207671_10354632 | 3300025914 | Bacteria | 1163 |
| 641 | Ga0207671_10480940 | 3300025914 | Bacteria | 990 |
| 642 | Ga0207671_10621689 | 3300025914 | Bacteria | 861 |
| 643 | Ga0207693_10024385 | 3300025915 | Bacteria | 4800 |
| 644 | Ga0207693_10216375 | 3300025915 | Bacteria | 1505 |
| 645 | Ga0207693_10312398 | 3300025915 | Bacteria | 1231 |
| 646 | Ga0207693_11474147 | 3300025915 | Bacteria | 503 |
| 647 | Ga0207663_10350984 | 3300025916 | Bacteria | 1117 |
| 648 | Ga0207663_10573058 | 3300025916 | Bacteria | 884 |
| 649 | Ga0207663_10914653 | 3300025916 | Bacteria | 702 |
| 650 | Ga0207663_11278020 | 3300025916 | Bacteria | 591 |
| 651 | Ga0207660_10003004 | 3300025917 | Bacteria | 11039 |
| 652 | Ga0207660_10043689 | 3300025917 | Bacteria | 3149 |
| 653 | Ga0207660_10153020 | 3300025917 | Bacteria | 1774 |
| 654 | Ga0207660_10243075 | 3300025917 | Bacteria | 1418 |
| 655 | Ga0207660_10371451 | 3300025917 | Bacteria | 1148 |
| 656 | Ga0207660_10700122 | 3300025917 | Bacteria | 826 |
| 657 | Ga0207660_11152826 | 3300025917 | Bacteria | 631 |
| 658 | Ga0207657_10037137 | 3300025919 | Bacteria | 4355 |
| 659 | Ga0207657_10063406 | 3300025919 | Bacteria | 3160 |
| 660 | Ga0207657_10423466 | 3300025919 | Bacteria | 1046 |
| 661 | Ga0207649_10000194 | 3300025920 | Bacteria | 50112 |
| 662 | Ga0207649_10176862 | 3300025920 | Bacteria | 1491 |
| 663 | Ga0207649_10251578 | 3300025920 | Bacteria | 1273 |
| 664 | Ga0207649_10255186 | 3300025920 | Bacteria | 1265 |
| 665 | Ga0207649_10476632 | 3300025920 | Bacteria | 946 |
| 666 | Ga0207649_10568649 | 3300025920 | Bacteria | 869 |
| 667 | Ga0207652_10108322 | 3300025921 | Bacteria | 2462 |
| 668 | Ga0207652_10150019 | 3300025921 | Bacteria | 2087 |
| 669 | Ga0207652_10206951 | 3300025921 | Bacteria | 1766 |
| 670 | Ga0207652_10454365 | 3300025921 | Bacteria | 1155 |
| 671 | Ga0207652_10708442 | 3300025921 | Bacteria | 898 |
| 672 | Ga0207652_10716193 | 3300025921 | Bacteria | 892 |
| 673 | Ga0207652_11243291 | 3300025921 | Bacteria | 647 |
| 674 | Ga0207652_11545672 | 3300025921 | Bacteria | 568 |
| 675 | Ga0207646_10680554 | 3300025922 | Bacteria | 921 |
| 676 | Ga0207681_10026657 | 3300025923 | Bacteria | 3730 |
| 677 | Ga0207681_10142714 | 3300025923 | Bacteria | 1785 |
| 678 | Ga0207681_10284058 | 3300025923 | Bacteria | 1304 |
| 679 | Ga0207694_10022428 | 3300025924 | Bacteria | 4789 |
| 680 | Ga0207694_10042706 | 3300025924 | Bacteria | 3498 |
| 681 | Ga0207694_10221393 | 3300025924 | Bacteria | 1544 |
| 682 | Ga0207694_10592428 | 3300025924 | Bacteria | 932 |
| 683 | Ga0207694_11360236 | 3300025924 | Bacteria | 600 |
| 684 | Ga0207694_11390346 | 3300025924 | Bacteria | 593 |
| 685 | Ga0207694_11424682 | 3300025924 | Bacteria | 585 |
| 686 | Ga0207694_11523464 | 3300025924 | Bacteria | 564 |
| 687 | Ga0207694_11894025 | 3300025924 | Bacteria | 500 |
| 688 | Ga0207650_10171098 | 3300025925 | Bacteria | 1726 |
| 689 | Ga0207650_10425877 | 3300025925 | Bacteria | 1102 |
| 690 | Ga0207650_10540337 | 3300025925 | Bacteria | 977 |
| 691 | Ga0207650_10781595 | 3300025925 | Bacteria | 809 |
| 692 | Ga0207650_11071988 | 3300025925 | Bacteria | 686 |
| 693 | Ga0207659_10166081 | 3300025926 | Bacteria | 1737 |
| 694 | Ga0207659_10367555 | 3300025926 | Bacteria | 1197 |
| 695 | Ga0207687_10085895 | 3300025927 | Bacteria | 2284 |
| 696 | Ga0207687_10215504 | 3300025927 | Bacteria | 1508 |
| 697 | Ga0207687_10311953 | 3300025927 | Bacteria | 1270 |
| 698 | Ga0207687_10402010 | 3300025927 | Bacteria | 1127 |
| 699 | Ga0207687_11544316 | 3300025927 | Bacteria | 570 |
| 700 | Ga0207700_10020136 | 3300025928 | Bacteria | 4523 |
| 701 | Ga0207700_10121231 | 3300025928 | Bacteria | 2121 |
| 702 | Ga0207700_10145860 | 3300025928 | Bacteria | 1950 |
| 703 | Ga0207700_10322910 | 3300025928 | Bacteria | 1338 |
| 704 | Ga0207700_11114427 | 3300025928 | Bacteria | 705 |
| 705 | Ga0207664_10015881 | 3300025929 | Bacteria | 5482 |
| 706 | Ga0207664_11000656 | 3300025929 | Bacteria | 749 |
| 707 | Ga0207664_11926278 | 3300025929 | Bacteria | 514 |
| 708 | Ga0207644_10400322 | 3300025931 | Bacteria | 1122 |
| 709 | Ga0207644_11071391 | 3300025931 | Bacteria | 677 |
| 710 | Ga0207690_10029346 | 3300025932 | Bacteria | 3496 |
| 711 | Ga0207690_10332331 | 3300025932 | Bacteria | 1197 |
| 712 | Ga0207690_11299527 | 3300025932 | Bacteria | 608 |
| 713 | Ga0207686_10137320 | 3300025934 | Bacteria | 1685 |
| 714 | Ga0207686_10380969 | 3300025934 | Bacteria | 1070 |
| 715 | Ga0207686_10602867 | 3300025934 | Bacteria | 864 |
| 716 | Ga0207686_10807746 | 3300025934 | Bacteria | 752 |
| 717 | Ga0207709_10018685 | 3300025935 | Bacteria | 3887 |
| 718 | Ga0207709_10125051 | 3300025935 | Bacteria | 1743 |
| 719 | Ga0207670_10028318 | 3300025936 | Bacteria | 3555 |
| 720 | Ga0207670_10566270 | 3300025936 | Bacteria | 930 |
| 721 | Ga0207670_10850450 | 3300025936 | Bacteria | 762 |
| 722 | Ga0207669_10093454 | 3300025937 | Bacteria | 1965 |
| 723 | Ga0207669_10171086 | 3300025937 | Bacteria | 1546 |
| 724 | Ga0207669_10438509 | 3300025937 | Bacteria | 1032 |
| 725 | Ga0207669_10621926 | 3300025937 | Bacteria | 880 |
| 726 | Ga0207669_10955462 | 3300025937 | Bacteria | 718 |
| 727 | Ga0207704_10068198 | 3300025938 | Bacteria | 2241 |
| 728 | Ga0207704_10600811 | 3300025938 | Bacteria | 901 |
| 729 | Ga0207704_10647320 | 3300025938 | Bacteria | 870 |
| 730 | Ga0207665_10096951 | 3300025939 | Bacteria | 2052 |
| 731 | Ga0207665_10159215 | 3300025939 | Bacteria | 1623 |
| 732 | Ga0207665_10473408 | 3300025939 | Bacteria | 964 |
| 733 | Ga0207711_10145656 | 3300025941 | Bacteria | 2134 |
| 734 | Ga0207711_10316184 | 3300025941 | Bacteria | 1442 |
| 735 | Ga0207711_10349566 | 3300025941 | Bacteria | 1369 |
| 736 | Ga0207711_10807876 | 3300025941 | Bacteria | 873 |
| 737 | Ga0207711_11629537 | 3300025941 | Bacteria | 589 |
| 738 | Ga0207711_11655553 | 3300025941 | Bacteria | 583 |
| 739 | Ga0207689_10101680 | 3300025942 | Bacteria | 2361 |
| 740 | Ga0207689_10362866 | 3300025942 | Bacteria | 1205 |
| 741 | Ga0207689_11736626 | 3300025942 | Bacteria | 516 |
| 742 | Ga0207661_10144696 | 3300025944 | Bacteria | 2049 |
| 743 | Ga0207661_10219381 | 3300025944 | Bacteria | 1680 |
| 744 | Ga0207661_10344571 | 3300025944 | Bacteria | 1343 |
| 745 | Ga0207661_10367957 | 3300025944 | Bacteria | 1299 |
| 746 | Ga0207661_10475832 | 3300025944 | Bacteria | 1140 |
| 747 | Ga0207661_11323273 | 3300025944 | Bacteria | 662 |
| 748 | Ga0207679_10316118 | 3300025945 | Bacteria | 1351 |
| 749 | Ga0207679_10328620 | 3300025945 | Bacteria | 1326 |
| 750 | Ga0207679_11781860 | 3300025945 | Bacteria | 563 |
| 751 | Ga0207679_11808868 | 3300025945 | Bacteria | 558 |
| 752 | Ga0207667_10032409 | 3300025949 | Bacteria | 5632 |
| 753 | Ga0207667_10128005 | 3300025949 | Bacteria | 2615 |
| 754 | Ga0207667_10190159 | 3300025949 | Bacteria | 2106 |
| 755 | Ga0207667_10769303 | 3300025949 | Bacteria | 961 |
| 756 | Ga0207667_10776395 | 3300025949 | Bacteria | 956 |
| 757 | Ga0207667_10884612 | 3300025949 | Bacteria | 886 |
| 758 | Ga0207667_10988496 | 3300025949 | Bacteria | 829 |
| 759 | Ga0207667_11353364 | 3300025949 | Bacteria | 687 |
| 760 | Ga0207651_10169073 | 3300025960 | Bacteria | 1722 |
| 761 | Ga0207651_10532437 | 3300025960 | Bacteria | 1019 |
| 762 | Ga0207651_10865417 | 3300025960 | Bacteria | 804 |
| 763 | Ga0207651_10968028 | 3300025960 | Bacteria | 760 |
| 764 | Ga0207712_10027952 | 3300025961 | Bacteria | 3769 |
| 765 | Ga0207712_10029987 | 3300025961 | Bacteria | 3654 |
| 766 | Ga0207712_10392655 | 3300025961 | Bacteria | 1164 |
| 767 | Ga0207712_10409159 | 3300025961 | Bacteria | 1142 |
| 768 | Ga0207712_11434537 | 3300025961 | Bacteria | 618 |
| 769 | Ga0207668_10076092 | 3300025972 | Bacteria | 2415 |
| 770 | Ga0207668_10753316 | 3300025972 | Bacteria | 859 |
| 771 | Ga0207668_10860902 | 3300025972 | Bacteria | 805 |
| 772 | Ga0207668_11101471 | 3300025972 | Bacteria | 712 |
| 773 | Ga0207640_10274539 | 3300025981 | Bacteria | 1321 |
| 774 | Ga0207640_10778413 | 3300025981 | Bacteria | 827 |
| 775 | Ga0207658_10058513 | 3300025986 | Bacteria | 2868 |
| 776 | Ga0207658_10167494 | 3300025986 | Bacteria | 1806 |
| 777 | Ga0207658_10708259 | 3300025986 | Bacteria | 910 |
| 778 | Ga0207658_11350037 | 3300025986 | Bacteria | 652 |
| 779 | Ga0207658_11552969 | 3300025986 | Bacteria | 605 |
| 780 | Ga0207658_11823000 | 3300025986 | Bacteria | 555 |
| 781 | Ga0207677_10368238 | 3300026023 | Bacteria | 1209 |
| 782 | Ga0207677_10731759 | 3300026023 | Bacteria | 880 |
| 783 | Ga0207677_10809695 | 3300026023 | Bacteria | 839 |
| 784 | Ga0207703_10027678 | 3300026035 | Bacteria | 4464 |
| 785 | Ga0207703_10097052 | 3300026035 | Bacteria | 2489 |
| 786 | Ga0207703_10761871 | 3300026035 | Bacteria | 923 |
| 787 | Ga0207703_11793975 | 3300026035 | Bacteria | 590 |
| 788 | Ga0207639_10060119 | 3300026041 | Bacteria | 2931 |
| 789 | Ga0207639_10114112 | 3300026041 | Bacteria | 2207 |
| 790 | Ga0207639_10147933 | 3300026041 | Bacteria | 1964 |
| 791 | Ga0207639_10369626 | 3300026041 | Bacteria | 1285 |
| 792 | Ga0207639_10752376 | 3300026041 | Bacteria | 906 |
| 793 | Ga0207639_10846791 | 3300026041 | Bacteria | 853 |
| 794 | Ga0207639_11656380 | 3300026041 | Bacteria | 600 |
| 795 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 796 | Ga0207708_10346128 | 3300026075 | Bacteria | 1218 |
| 797 | Ga0207708_10770664 | 3300026075 | Bacteria | 827 |
| 798 | Ga0207702_10226977 | 3300026078 | Bacteria | 1743 |
| 799 | Ga0207702_10897278 | 3300026078 | Bacteria | 878 |
| 800 | Ga0207702_10950716 | 3300026078 | Bacteria | 852 |
| 801 | Ga0207702_11129747 | 3300026078 | Bacteria | 777 |
| 802 | Ga0207702_11445335 | 3300026078 | Bacteria | 681 |
| 803 | Ga0207641_10035109 | 3300026088 | Bacteria | 4175 |
| 804 | Ga0207641_10215049 | 3300026088 | Bacteria | 1779 |
| 805 | Ga0207641_10636383 | 3300026088 | Bacteria | 1047 |
| 806 | Ga0207641_10792941 | 3300026088 | Bacteria | 937 |
| 807 | Ga0207641_11176651 | 3300026088 | Bacteria | 766 |
| 808 | Ga0207648_10154508 | 3300026089 | Bacteria | 2025 |
| 809 | Ga0207648_10238236 | 3300026089 | Bacteria | 1619 |
| 810 | Ga0207648_10421221 | 3300026089 | Bacteria | 1212 |
| 811 | Ga0207648_11260003 | 3300026089 | Bacteria | 695 |
| 812 | Ga0207676_10275805 | 3300026095 | Bacteria | 1525 |
| 813 | Ga0207676_10405870 | 3300026095 | Bacteria | 1274 |
| 814 | Ga0207676_10530481 | 3300026095 | Bacteria | 1122 |
| 815 | Ga0207676_10996869 | 3300026095 | Bacteria | 825 |
| 816 | Ga0207676_11190143 | 3300026095 | Bacteria | 755 |
| 817 | Ga0207674_10135964 | 3300026116 | Bacteria | 2420 |
| 818 | Ga0207674_10345588 | 3300026116 | Bacteria | 1438 |
| 819 | Ga0207674_10511916 | 3300026116 | Bacteria | 1159 |
| 820 | Ga0207674_10772138 | 3300026116 | Bacteria | 928 |
| 821 | Ga0207675_100163578 | 3300026118 | Bacteria | 2124 |
| 822 | Ga0207675_100486730 | 3300026118 | Bacteria | 1227 |
| 823 | Ga0207675_100615881 | 3300026118 | Bacteria | 1090 |
| 824 | Ga0207683_10018489 | 3300026121 | Bacteria | 5947 |
| 825 | Ga0207683_10026403 | 3300026121 | Bacteria | 5012 |
| 826 | Ga0207683_10103171 | 3300026121 | Bacteria | 2547 |
| 827 | Ga0207683_10237421 | 3300026121 | Bacteria | 1663 |
| 828 | Ga0207683_10263843 | 3300026121 | Bacteria | 1573 |
| 829 | Ga0207683_10380731 | 3300026121 | Bacteria | 1297 |
| 830 | Ga0207698_10074815 | 3300026142 | Bacteria | 2703 |
| 831 | Ga0207698_10127754 | 3300026142 | Bacteria | 2166 |
| 832 | Ga0207698_10144541 | 3300026142 | Bacteria | 2055 |
| 833 | Ga0207698_10668335 | 3300026142 | Bacteria | 1031 |
| 834 | Ga0209995_1004561 | 3300027471 | Bacteria | 2216 |
| 835 | Ga0209179_1000116 | 3300027512 | Bacteria | 9269 |
| 836 | Ga0209983_1006615 | 3300027665 | Bacteria | 2378 |
| 837 | Ga0209966_1000641 | 3300027695 | Bacteria | 7848 |
| 838 | Ga0207428_10000169 | 3300027907 | Bacteria | 90667 |
| 839 | Ga0207428_10030716 | 3300027907 | Bacteria | 4439 |
| 840 | Ga0207428_10885962 | 3300027907 | Bacteria | 631 |
| 841 | Ga0268266_10000557 | 3300028379 | Bacteria | 51935 |
| 842 | Ga0268266_10005613 | 3300028379 | Bacteria | 11650 |
| 843 | Ga0268266_10055515 | 3300028379 | Bacteria | 3405 |
| 844 | Ga0268266_10076582 | 3300028379 | Bacteria | 2907 |
| 845 | Ga0268266_10092509 | 3300028379 | Bacteria | 2653 |
| 846 | Ga0268266_10095842 | 3300028379 | Bacteria | 2606 |
| 847 | Ga0268266_10155348 | 3300028379 | Bacteria | 2066 |
| 848 | Ga0268266_10166733 | 3300028379 | Bacteria | 1996 |
| 849 | Ga0268266_10439319 | 3300028379 | Bacteria | 1239 |
| 850 | Ga0268266_10854206 | 3300028379 | Bacteria | 880 |
| 851 | Ga0268266_11351711 | 3300028379 | Bacteria | 688 |
| 852 | Ga0268266_11571301 | 3300028379 | Bacteria | 633 |
| 853 | Ga0268266_11720622 | 3300028379 | Bacteria | 602 |
| 854 | Ga0268266_12070157 | 3300028379 | Bacteria | 542 |
| 855 | Ga0268265_10010282 | 3300028380 | Bacteria | 6319 |
| 856 | Ga0268265_10035295 | 3300028380 | Bacteria | 3652 |
| 857 | Ga0268265_10272456 | 3300028380 | Bacteria | 1510 |
| 858 | Ga0268265_11170634 | 3300028380 | Bacteria | 765 |
| 859 | Ga0268265_11214200 | 3300028380 | Bacteria | 752 |
| 860 | Ga0268265_11592757 | 3300028380 | Bacteria | 658 |
| 861 | Ga0268264_10525570 | 3300028381 | Bacteria | 1157 |
| 862 | Ga0268264_11786672 | 3300028381 | Bacteria | 625 |
| 863 | Ga0265337_1029032 | 3300028556 | Bacteria | 1656 |
| 864 | Ga0307515_10072629 | 3300028794 | Bacteria | 4638 |
| 865 | Ga0265338_10002896 | 3300028800 | Bacteria | 24981 |
| 866 | Ga0265338_10008853 | 3300028800 | Bacteria | 12137 |
| 867 | Ga0265338_10252984 | 3300028800 | Bacteria | 1299 |
| 868 | Ga0265324_10010483 | 3300029957 | Bacteria | 3571 |
| 869 | Ga0265324_10067274 | 3300029957 | Bacteria | 1222 |
| 870 | Ga0307512_10143919 | 3300030522 | Bacteria | 1449 |
| 871 | Ga0265767_105512 | 3300030836 | Bacteria | 769 |
| 872 | Ga0265766_1006157 | 3300030863 | Bacteria | 779 |
| 873 | Ga0265764_109258 | 3300030882 | Bacteria | 606 |
| 874 | Ga0265761_109076 | 3300030889 | Bacteria | 565 |
| 875 | Ga0265760_10212807 | 3300031090 | Bacteria | 657 |
| 876 | Ga0265320_10022900 | 3300031240 | Bacteria | 3335 |
| 877 | Ga0265329_10324821 | 3300031242 | Bacteria | 523 |
| 878 | Ga0265340_10042240 | 3300031247 | Bacteria | 2239 |
| 879 | Ga0265339_10078316 | 3300031249 | Bacteria | 1750 |
| 880 | Ga0265331_10000543 | 3300031250 | Bacteria | 34421 |
| 881 | Ga0265331_10003502 | 3300031250 | Bacteria | 10110 |
| 882 | Ga0265331_10013838 | 3300031250 | Bacteria | 4322 |
| 883 | Ga0265331_10016732 | 3300031250 | Bacteria | 3843 |
| 884 | Ga0265331_10171878 | 3300031250 | Bacteria | 980 |
| 885 | Ga0265331_10249395 | 3300031250 | Bacteria | 796 |
| 886 | Ga0265327_10000392 | 3300031251 | Bacteria | 82296 |
| 887 | Ga0265327_10001257 | 3300031251 | Bacteria | 33614 |
| 888 | Ga0265327_10082992 | 3300031251 | Bacteria | 1578 |
| 889 | Ga0265327_10188601 | 3300031251 | Bacteria | 939 |
| 890 | Ga0265327_10357150 | 3300031251 | Bacteria | 638 |
| 891 | Ga0265316_10023098 | 3300031344 | Bacteria | 5229 |
| 892 | Ga0265316_10228372 | 3300031344 | Bacteria | 1371 |
| 893 | Ga0307513_10545964 | 3300031456 | Bacteria | 872 |
| 894 | Ga0307408_100343964 | 3300031548 | Bacteria | 1263 |
| 895 | Ga0307408_100857199 | 3300031548 | Bacteria | 829 |
| 896 | Ga0265313_10004521 | 3300031595 | Bacteria | 10621 |
| 897 | Ga0307508_10130442 | 3300031616 | Bacteria | 2117 |
| 898 | Ga0307508_10851291 | 3300031616 | Bacteria | 533 |
| 899 | Ga0265314_10016595 | 3300031711 | Bacteria | 5808 |
| 900 | Ga0265314_10023749 | 3300031711 | Bacteria | 4666 |
| 901 | Ga0265314_10056619 | 3300031711 | Bacteria | 2697 |
| 902 | Ga0265314_10107669 | 3300031711 | Bacteria | 1778 |
| 903 | Ga0265314_10179813 | 3300031711 | Bacteria | 1269 |
| 904 | Ga0265314_10648649 | 3300031711 | Bacteria | 539 |
| 905 | Ga0307516_10069198 | 3300031730 | Bacteria | 3396 |
| 906 | Ga0307516_10128092 | 3300031730 | Bacteria | 2321 |
| 907 | Ga0307516_10239808 | 3300031730 | Bacteria | 1512 |
| 908 | Ga0307516_10646932 | 3300031730 | Bacteria | 712 |
| 909 | Ga0307405_10794865 | 3300031731 | Bacteria | 792 |
| 910 | Ga0307405_11447559 | 3300031731 | Bacteria | 602 |
| 911 | Ga0307413_10024003 | 3300031824 | Bacteria | 3315 |
| 912 | Ga0307410_10015925 | 3300031852 | Bacteria | 4470 |
| 913 | Ga0307410_11938915 | 3300031852 | Bacteria | 525 |
| 914 | Ga0307406_10576971 | 3300031901 | Bacteria | 924 |
| 915 | Ga0307406_10863544 | 3300031901 | Bacteria | 768 |
| 916 | Ga0307407_10020831 | 3300031903 | Bacteria | 3368 |
| 917 | Ga0307407_10154073 | 3300031903 | Bacteria | 1497 |
| 918 | Ga0307407_11490343 | 3300031903 | Bacteria | 535 |
| 919 | Ga0307407_11593366 | 3300031903 | Bacteria | 518 |
| 920 | Ga0307412_10319743 | 3300031911 | Bacteria | 1234 |
| 921 | Ga0307412_11991834 | 3300031911 | Bacteria | 537 |
| 922 | Ga0307409_100305410 | 3300031995 | Bacteria | 1482 |
| 923 | Ga0307409_100803285 | 3300031995 | Bacteria | 948 |
| 924 | Ga0307416_100088575 | 3300032002 | Bacteria | 2647 |
| 925 | Ga0307416_101046865 | 3300032002 | Bacteria | 920 |
| 926 | Ga0307416_102437823 | 3300032002 | Bacteria | 622 |
| 927 | Ga0307411_10038579 | 3300032005 | Bacteria | 3014 |
| 928 | Ga0307411_10758494 | 3300032005 | Bacteria | 851 |
| 929 | Ga0307411_11477840 | 3300032005 | Bacteria | 624 |
| 930 | Ga0307411_11740186 | 3300032005 | Bacteria | 578 |
| 931 | Ga0307415_100734163 | 3300032126 | Bacteria | 895 |
| 932 | Ga0307415_100893816 | 3300032126 | Bacteria | 818 |
| 933 | Ga0316593_10011301 | 3300032168 | Bacteria | 2590 |
| 934 | Ga0316593_10039890 | 3300032168 | Bacteria | 1559 |
| 935 | Ga0316593_10039922 | 3300032168 | Bacteria | 1559 |
| 936 | Ga0307510_10135648 | 3300033180 | Bacteria | 2120 |
| 937 | Ga0307510_10628395 | 3300033180 | Bacteria | 529 |
| 938 | Ga0316588_1031798 | 3300033528 | Bacteria | 1240 |
| 939 | Ga0373930_0000191 | 3300034816 | Bacteria | 7407 |
| 940 | Ga0373930_0013501 | 3300034816 | Bacteria | 1507 |
| 941 | Ga0373948_0002325 | 3300034817 | Bacteria | 2793 |
| 942 | Ga0373950_0000155 | 3300034818 | Bacteria | 10219 |
| 943 | Ga0373958_0002981 | 3300034819 | Bacteria | 2419 |
| 944 | Ga0373959_0001384 | 3300034820 | Bacteria | 3879 |
| 945 | Ga0373938_0000013 | 3300034957 | Bacteria | 24269 |
| 946 | Ga0373928_0000255 | 3300035084 | Bacteria | 10564 |
| 947 | Ga0373929_0003185 | 3300035085 | Bacteria | 2974 |
| 948 | Ga0373934_0275744 | 3300035086 | Bacteria | 696 |
| 949 | Ga0373940_0001317 | 3300035088 | Bacteria | 4421 |
| 950 | Ga0373949_0001716 | 3300035090 | Bacteria | 6065 |
| 951 | Ga0373951_0000552 | 3300035091 | Bacteria | 10501 |
| 952 | Ga0373951_0144568 | 3300035091 | Bacteria | 663 |
| 953 | Ga0373952_0000182 | 3300035092 | Bacteria | 9790 |
| 954 | Ga0373923_0002759 | 3300035111 | Bacteria | 5485 |
| 955 | Ga0373923_0040828 | 3300035111 | Bacteria | 1911 |
| 956 | Ga0373923_0096666 | 3300035111 | Bacteria | 1298 |
| 957 | Ga0373932_0000252 | 3300035112 | Bacteria | 16339 |
| 958 | Ga0373932_0230488 | 3300035112 | Bacteria | 669 |
| 959 | Ga0373936_0033903 | 3300035113 | Bacteria | 2026 |
| 960 | Ga0373936_0276834 | 3300035113 | Bacteria | 754 |
| 961 | Ga0373936_0277884 | 3300035113 | Bacteria | 752 |
| 962 | Ga0373936_0447114 | 3300035113 | Bacteria | 597 |
| 963 | Ga0373939_0006119 | 3300035114 | Bacteria | 2892 |
| 964 | Ga0373941_0036248 | 3300035115 | Bacteria | 1499 |
| 965 | Ga0373941_0101183 | 3300035115 | Bacteria | 1003 |
| 966 | Ga0373941_0322843 | 3300035115 | Bacteria | 621 |
| 967 | Ga0373945_0018664 | 3300035116 | Bacteria | 2361 |
| 968 | Ga0373945_0459882 | 3300035116 | Bacteria | 564 |
| 969 | Ga0373953_0269230 | 3300035117 | Bacteria | 742 |
| 970 | Ga0373953_0573873 | 3300035117 | Bacteria | 502 |
| 971 | Ga0373954_0022106 | 3300035118 | Bacteria | 2884 |
| 972 | Ga0373954_0340621 | 3300035118 | Bacteria | 740 |
| 973 | Ga0373954_0386414 | 3300035118 | Bacteria | 692 |
| 974 | Ga0373956_0053480 | 3300035119 | Bacteria | 1818 |
| 975 | Ga0373957_0013550 | 3300035120 | Bacteria | 2769 |
| 976 | Ga0373960_0000068 | 3300035121 | Bacteria | 14664 |
| 977 | Ga0373960_0074297 | 3300035121 | Bacteria | 1058 |
| 978 | Ga0373960_0091460 | 3300035121 | Bacteria | 973 |
| 979 | Ga0373943_0058840 | 3300035170 | Bacteria | 1914 |
| 980 | Ga0373943_0063345 | 3300035170 | Bacteria | 1853 |
| 981 | Ga0373943_0263265 | 3300035170 | Bacteria | 971 |
| 982 | Ga0373943_0292669 | 3300035170 | Bacteria | 923 |
| 983 | Ga0373946_0194612 | 3300035171 | Bacteria | 968 |
| 984 | Ga0373946_0370831 | 3300035171 | Bacteria | 719 |
| 985 | Ga0373955_0028306 | 3300035172 | Bacteria | 2904 |
| 986 | Ga0373955_0125577 | 3300035172 | Bacteria | 1495 |
| 987 | Ga0373955_0163547 | 3300035172 | Bacteria | 1315 |
| 988 | Ga0373942_0001815 | 3300035207 | Bacteria | 5399 |
| 989 | Ga0373961_0003115 | 3300035241 | Bacteria | 4156 |
| 990 | Ga0373962_0000112 | 3300035242 | Bacteria | 16939 |
| 991 | Ga0373962_0409820 | 3300035242 | Bacteria | 500 |
| 992 | Ga0373931_0001634 | 3300035691 | Bacteria | 9691 |
| 993 | Ga0373931_0121321 | 3300035691 | Bacteria | 1494 |
| 994 | Ga0373931_0508275 | 3300035691 | Bacteria | 778 |
| 995 | Ga0373931_0545513 | 3300035691 | Bacteria | 753 |
| 996 | Ga0373931_0573337 | 3300035691 | Bacteria | 735 |
| 997 | Ga0373935_0004282 | 3300035692 | Bacteria | 8374 |
| 998 | Ga0373935_0027495 | 3300035692 | Bacteria | 3515 |
| 999 | Ga0373935_0069246 | 3300035692 | Bacteria | 2272 |
| 1000 | Ga0373935_0133269 | 3300035692 | Bacteria | 1672 |
| 1001 | Ga0373935_0360337 | 3300035692 | Bacteria | 1038 |
| 1002 | Ga0373935_1295526 | 3300035692 | Bacteria | 544 |
| 1003 | Ga0373927_0148977 | 3300035695 | Bacteria | 1532 |
| 1004 | Ga0373927_0174637 | 3300035695 | Bacteria | 1409 |
| 1005 | Ga0373927_0196004 | 3300035695 | Bacteria | 1325 |
| 1006 | Ga0373927_0238366 | 3300035695 | Bacteria | 1195 |
| 1007 | Ga0373927_0248463 | 3300035695 | Bacteria | 1169 |
| 1008 | Ga0373927_0382694 | 3300035695 | Bacteria | 928 |
| 1009 | Ga0373933_0013505 | 3300035724 | Bacteria | 4528 |
| 1010 | Ga0373933_0117754 | 3300035724 | Bacteria | 1661 |
| 1011 | Ga0373933_0288470 | 3300035724 | Bacteria | 1061 |
| 1012 | Ga0373933_0855275 | 3300035724 | Bacteria | 599 |
| 1013 | Ga0373947_0064868 | 3300035725 | Bacteria | 2227 |
| 1014 | Ga0373947_0065025 | 3300035725 | Bacteria | 2224 |
| 1015 | Ga0373947_0076251 | 3300035725 | Bacteria | 2066 |
| 1016 | Ga0373947_0084575 | 3300035725 | Bacteria | 1969 |
| 1017 | Ga0373947_0185690 | 3300035725 | Bacteria | 1355 |
| 1018 | Ga0373947_0531279 | 3300035725 | Bacteria | 800 |
| 1019 | Ga0373937_0000922 | 3300036401 | Bacteria | 24939 |
| 1020 | Ga0373937_0008630 | 3300036401 | Bacteria | 8853 |
| 1021 | Ga0373937_0032792 | 3300036401 | Bacteria | 4713 |
| 1022 | Ga0373937_0062577 | 3300036401 | Bacteria | 3421 |
| 1023 | Ga0373937_0083755 | 3300036401 | Bacteria | 2950 |
| 1024 | Ga0373937_0178272 | 3300036401 | Bacteria | 1995 |
| 1025 | Ga0373937_1094240 | 3300036401 | Bacteria | 746 |
| 1026 | Ga0265778_001977 | 3300036457 | Bacteria | 1929 |
| 1027 | Ga0265778_031317 | 3300036457 | Bacteria | 688 |
| 1028 | Ga0373925_0008231 | 3300037068 | Bacteria | 7590 |
| 1029 | Ga0373925_0040367 | 3300037068 | Bacteria | 3455 |
| 1030 | Ga0373925_0041086 | 3300037068 | Bacteria | 3426 |
| 1031 | Ga0373925_0194637 | 3300037068 | Bacteria | 1610 |
| 1032 | Ga0395899_0066694 | 3300037312 | Bacteria | 2642 |
| 1033 | Ga0395899_0081254 | 3300037312 | Bacteria | 2358 |
| 1034 | Ga0395899_0105847 | 3300037312 | Bacteria | 2026 |
| 1035 | Ga0395899_0439057 | 3300037312 | Bacteria | 857 |
| 1036 | Ga0395900_0021199 | 3300037418 | Bacteria | 6643 |
| 1037 | Ga0395900_0451558 | 3300037418 | Bacteria | 1242 |
| 1038 | Ga0395900_0452931 | 3300037418 | Bacteria | 1239 |
| 1039 | Ga0395900_0597435 | 3300037418 | Bacteria | 1044 |
| 1040 | Ga0395900_0803481 | 3300037418 | Bacteria | 868 |
| 1041 | Ga0395900_1408335 | 3300037418 | Bacteria | 610 |
| 1042 | Ga0395898_0007760 | 3300037466 | Bacteria | 11394 |
| 1043 | Ga0395898_0079037 | 3300037466 | Bacteria | 3173 |
| 1044 | Ga0395898_0126504 | 3300037466 | Bacteria | 2448 |
| 1045 | Ga0395898_0371181 | 3300037466 | Bacteria | 1364 |
| 1046 | Ga0395898_0490950 | 3300037466 | Bacteria | 1168 |
| 1047 | Ga0395898_1107123 | 3300037466 | Bacteria | 725 |
| 1048 | Ga0395898_1190711 | 3300037466 | Bacteria | 693 |
| 1049 | Ga0395898_1637903 | 3300037466 | Bacteria | 567 |
| 1050 | Ga0395905_0500202 | 3300037471 | Bacteria | 1116 |
| 1051 | Ga0395905_1284528 | 3300037471 | Bacteria | 636 |
| 1052 | Ga0436364_0043783 | 3300037853 | Bacteria | 1539 |
| 1053 | Ga0436364_0229979 | 3300037853 | Bacteria | 599 |
| 1054 | Ga0436364_0268578 | 3300037853 | Bacteria | 6831 |
| 1055 | Ga0436364_0333490 | 3300037853 | Bacteria | 1361 |
| 1056 | Ga0436364_0460289 | 3300037853 | Bacteria | 662 |
| 1057 | Ga0436364_0539801 | 3300037853 | Bacteria | 6263 |
| 1058 | Ga0436364_0554982 | 3300037853 | Bacteria | 6536 |
| 1059 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 1060 | Ga0436364_0764338 | 3300037853 | Bacteria | 31107 |
| 1061 | Ga0436364_1062354 | 3300037853 | Bacteria | 22499 |
| 1062 | Ga0436364_1442444 | 3300037853 | Bacteria | 2695 |
| 1063 | Ga0436364_1552061 | 3300037853 | Bacteria | 1475 |
| 1064 | Ga0395901_0097542 | 3300038443 | Bacteria | 3081 |
| 1065 | Ga0395901_0148983 | 3300038443 | Bacteria | 2459 |
| 1066 | Ga0395901_0177540 | 3300038443 | Bacteria | 2233 |
| 1067 | Ga0395901_0213059 | 3300038443 | Bacteria | 2021 |
| 1068 | Ga0395901_0865522 | 3300038443 | Bacteria | 888 |
| 1069 | Ga0395901_0910439 | 3300038443 | Bacteria | 861 |
| 1070 | Ga0395901_1229977 | 3300038443 | Bacteria | 713 |
| 1071 | Ga0395901_2014754 | 3300038443 | Bacteria | 523 |
| 1072 | Ga0242419_011998 | 3300038698 | Bacteria | 673 |
| 1073 | Ga0242420_001271 | 3300038996 | Bacteria | 3314 |
| 1074 | Ga0436365_0507021 | 3300039437 | Bacteria | 1157 |
| 1075 | Ga0436365_0678411 | 3300039437 | Bacteria | 1162 |
| 1076 | Ga0436365_1050783 | 3300039437 | Bacteria | 5796 |
| 1077 | Ga0436365_1075680 | 3300039437 | Bacteria | 1065 |
| 1078 | Ga0436365_1215018 | 3300039437 | Bacteria | 3685 |
| 1079 | Ga0436365_1302455 | 3300039437 | Bacteria | 561 |
| 1080 | Ga0436365_1623855 | 3300039437 | Bacteria | 823 |
| 1081 | Ga0436365_1790914 | 3300039437 | Bacteria | 1254 |
| 1082 | Ga0436365_1902383 | 3300039437 | Bacteria | 639 |
| 1083 | Ga0436360_0155823 | 3300039438 | Bacteria | 3366 |
| 1084 | Ga0436360_0232519 | 3300039438 | Bacteria | 567 |
| 1085 | Ga0436360_0248409 | 3300039438 | Bacteria | 1628 |
| 1086 | Ga0436360_0259420 | 3300039438 | Bacteria | 1483 |
| 1087 | Ga0436360_0272188 | 3300039438 | Bacteria | 1079 |
| 1088 | Ga0436360_0360048 | 3300039438 | Bacteria | 2053 |
| 1089 | Ga0436360_0493064 | 3300039438 | Bacteria | 663 |
| 1090 | Ga0436360_0527459 | 3300039438 | Bacteria | 565 |
| 1091 | Ga0436360_0663233 | 3300039438 | Bacteria | 1764 |
| 1092 | Ga0436360_0765106 | 3300039438 | Bacteria | 766 |
| 1093 | Ga0436360_0846287 | 3300039438 | Bacteria | 1406 |
| 1094 | Ga0436360_1065206 | 3300039438 | Bacteria | 2112 |
| 1095 | Ga0436360_1169610 | 3300039438 | Bacteria | 1664 |
| 1096 | Ga0436360_1205890 | 3300039438 | Bacteria | 570 |
| 1097 | Ga0436360_1229176 | 3300039438 | Bacteria | 14016 |
| 1098 | Ga0436360_1302627 | 3300039438 | Bacteria | 833 |
| 1099 | Ga0436361_0016113 | 3300039447 | Bacteria | 2363 |
| 1100 | Ga0436361_0045826 | 3300039447 | Bacteria | 575 |
| 1101 | Ga0436361_0057420 | 3300039447 | Bacteria | 546 |
| 1102 | Ga0436361_0291526 | 3300039447 | Bacteria | 1090 |
| 1103 | Ga0436361_0299606 | 3300039447 | Bacteria | 1108 |
| 1104 | Ga0436361_0518587 | 3300039447 | Bacteria | 518 |
| 1105 | Ga0436361_0585521 | 3300039447 | Bacteria | 1258 |
| 1106 | Ga0436361_0598899 | 3300039447 | Bacteria | 866 |
| 1107 | Ga0436361_0627073 | 3300039447 | Bacteria | 1475 |
| 1108 | Ga0436361_0663751 | 3300039447 | Bacteria | 690 |
| 1109 | Ga0436361_0765661 | 3300039447 | Bacteria | 1143 |
| 1110 | Ga0436361_0783925 | 3300039447 | Bacteria | 1300 |
| 1111 | Ga0436361_0878406 | 3300039447 | Bacteria | 2465 |
| 1112 | Ga0436361_1000576 | 3300039447 | Bacteria | 708 |
| 1113 | Ga0436361_1164878 | 3300039447 | Bacteria | 6643 |
| 1114 | Ga0436361_1167977 | 3300039447 | Bacteria | 1546 |
| 1115 | Ga0436363_0247885 | 3300039450 | Bacteria | 1179 |
| 1116 | Ga0436363_0315020 | 3300039450 | Bacteria | 4092 |
| 1117 | Ga0436363_0548499 | 3300039450 | Bacteria | 501 |
| 1118 | Ga0436363_0687461 | 3300039450 | Bacteria | 593 |
| 1119 | Ga0436363_0799449 | 3300039450 | Bacteria | 820 |
| 1120 | Ga0436363_0819400 | 3300039450 | Bacteria | 598 |
| 1121 | Ga0436363_1206715 | 3300039450 | Bacteria | 584 |
| 1122 | Ga0436363_1250759 | 3300039450 | Bacteria | 1287 |
| 1123 | Ga0436363_1566193 | 3300039450 | Bacteria | 582 |
| 1124 | Ga0436362_0830432 | 3300039453 | Bacteria | 773 |
| 1125 | Ga0436362_0967331 | 3300039453 | Bacteria | 6970 |
| 1126 | Ga0436362_1063337 | 3300039453 | Bacteria | 1225 |
| 1127 | Ga0436362_1174560 | 3300039453 | Bacteria | 587 |
| 1128 | Ga0436362_1218939 | 3300039453 | Bacteria | 646 |
| 1129 | Ga0439439_0146717 | 3300041406 | Bacteria | 668 |
| 1130 | Ga0439466_0098324 | 3300041411 | Bacteria | 914 |
| 1131 | Ga0451791_0161050 | 3300041451 | Bacteria | 895 |
| 1132 | Ga0451793_0993829 | 3300041452 | Bacteria | 1169 |
| 1133 | Ga0451795_1275112 | 3300041456 | Bacteria | 716 |
| 1134 | Ga0451807_0922472 | 3300041486 | Bacteria | 1171 |
| 1135 | Ga0451855_1875439 | 3300041511 | Bacteria | 724 |
| 1136 | Ga0451853_1497689 | 3300041512 | Bacteria | 880 |
| 1137 | Ga0451853_2532658 | 3300041512 | Bacteria | 762 |
| 1138 | Ga0439441_019729 | 3300042001 | Bacteria | 1229 |
| 1139 | Ga0439442_044068 | 3300042002 | Bacteria | 940 |
| 1140 | Ga0439445_0048451 | 3300042004 | Bacteria | 1143 |
| 1141 | Ga0439432_195556 | 3300042006 | Bacteria | 587 |
| 1142 | Ga0439450_057268 | 3300042008 | Bacteria | 936 |
| 1143 | Ga0439450_169890 | 3300042008 | Unclassified | 577 |
| 1144 | Ga0439452_043594 | 3300042010 | Bacteria | 1049 |
| 1145 | Ga0439457_106639 | 3300042014 | Bacteria | 656 |
| 1146 | Ga0439435_0180555 | 3300042436 | Bacteria | 689 |
| 1147 | Ga0439460_0270366 | 3300042461 | Bacteria | 590 |
| 1148 | Ga0451577_0018151 | 3300042876 | Bacteria | 6483 |
| 1149 | Ga0451577_0112731 | 3300042876 | Bacteria | 2434 |
| 1150 | Ga0451577_1517393 | 3300042876 | Bacteria | 592 |
| 1151 | Ga0439440_0209909 | 3300042993 | Bacteria | 580 |
| 1152 | Ga0453683_0555259 | 3300044673 | Bacteria | 747 |
| 1153 | Ga0453683_1185856 | 3300044673 | Bacteria | 511 |
| 1154 | Ga0466966_0064041 | 3300044684 | Bacteria | 2316 |
| 1155 | Ga0466966_0717170 | 3300044684 | Bacteria | 603 |
| 1156 | Ga0466961_0078638 | 3300044693 | Bacteria | 2089 |
| 1157 | Ga0466961_0245939 | 3300044693 | Bacteria | 1099 |
| 1158 | Ga0466961_0499899 | 3300044693 | Bacteria | 734 |
| 1159 | Ga0466961_0696513 | 3300044693 | Bacteria | 609 |
| 1160 | Ga0466963_0129768 | 3300044694 | Bacteria | 1740 |
| 1161 | Ga0466963_0346764 | 3300044694 | Bacteria | 1046 |
| 1162 | Ga0466963_0349140 | 3300044694 | Bacteria | 1042 |
| 1163 | Ga0466963_0984772 | 3300044694 | Bacteria | 594 |
| 1164 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 1165 | Ga0453684_0001066 | 3300044712 | Bacteria | 87216 |
| 1166 | Ga0453684_0005256 | 3300044712 | Bacteria | 25882 |
| 1167 | Ga0453684_0157702 | 3300044712 | Bacteria | 2689 |
| 1168 | Ga0453684_0890768 | 3300044712 | Bacteria | 954 |
| 1169 | Ga0466971_0166418 | 3300044719 | Bacteria | 1033 |
| 1170 | Ga0466971_0497659 | 3300044719 | Bacteria | 601 |
| 1171 | Ga0466968_0184221 | 3300044735 | Bacteria | 972 |
| 1172 | Ga0466968_0299516 | 3300044735 | Bacteria | 773 |
| 1173 | Ga0466970_0432624 | 3300044765 | Bacteria | 753 |
| 1174 | Ga0466970_0466093 | 3300044765 | Bacteria | 725 |
| 1175 | Ga0466957_0059645 | 3300044842 | Bacteria | 2339 |
| 1176 | Ga0466957_0082727 | 3300044842 | Bacteria | 2001 |
| 1177 | Ga0466957_0496615 | 3300044842 | Bacteria | 845 |
| 1178 | Ga0466960_0498635 | 3300044901 | Bacteria | 713 |
| 1179 | Ga0466959_0646070 | 3300045049 | Bacteria | 710 |
| 1180 | Ga0451576_0003979 | 3300045051 | Bacteria | 19673 |
| 1181 | Ga0451576_0110602 | 3300045051 | Bacteria | 2859 |
| 1182 | Ga0451576_0205880 | 3300045051 | Bacteria | 2054 |
| 1183 | Ga0451576_0646454 | 3300045051 | Bacteria | 1111 |
| 1184 | Ga0451576_0878951 | 3300045051 | Bacteria | 941 |
| 1185 | Ga0451576_1158947 | 3300045051 | Bacteria | 808 |
| 1186 | Ga0451576_2048742 | 3300045051 | Bacteria | 589 |
| 1187 | Ga0466958_0191476 | 3300045836 | Bacteria | 1300 |
| 1188 | Ga0466958_0816289 | 3300045836 | Bacteria | 608 |
| 1189 | Ga0466958_0977573 | 3300045836 | Bacteria | 552 |
| 1190 | Ga0466958_1153413 | 3300045836 | Bacteria | 506 |
| 1191 | Ga0466967_0126564 | 3300045976 | Bacteria | 2367 |
| 1192 | Ga0466967_0448230 | 3300045976 | Bacteria | 1261 |
| 1193 | Ga0466967_0465705 | 3300045976 | Bacteria | 1237 |
| 1194 | Ga0466967_0506163 | 3300045976 | Bacteria | 1186 |
| 1195 | Ga0466967_1106467 | 3300045976 | Bacteria | 789 |
| 1196 | Ga0466967_1112442 | 3300045976 | Bacteria | 787 |
| 1197 | Ga0466967_2598278 | 3300045976 | Bacteria | 501 |
| 1198 | Ga0495617_131390 | 3300046452 | Bacteria | 803 |
| 1199 | Ga0495617_220206 | 3300046452 | Bacteria | 590 |
| 1200 | Ga0495592_0016148 | 3300046454 | Bacteria | 5665 |
| 1201 | Ga0495603_0175103 | 3300046455 | Bacteria | 1242 |
| 1202 | Ga0495629_0099980 | 3300046459 | Bacteria | 2024 |
| 1203 | Ga0495629_0120625 | 3300046459 | Bacteria | 1827 |
| 1204 | Ga0495629_0216828 | 3300046459 | Bacteria | 1321 |
| 1205 | Ga0495629_0442119 | 3300046459 | Bacteria | 881 |
| 1206 | Ga0495638_0108205 | 3300046460 | Bacteria | 1654 |
| 1207 | Ga0495638_0392608 | 3300046460 | Bacteria | 722 |
| 1208 | Ga0495641_0559236 | 3300046461 | Bacteria | 522 |
| 1209 | Ga0495651_0013876 | 3300046462 | Bacteria | 6233 |
| 1210 | Ga0495651_0070762 | 3300046462 | Bacteria | 2654 |
| 1211 | Ga0495653_0133128 | 3300046463 | Bacteria | 1757 |
| 1212 | Ga0495580_0875620 | 3300046472 | Bacteria | 578 |
| 1213 | Ga0495582_0409812 | 3300046473 | Bacteria | 782 |
| 1214 | Ga0495639_0518269 | 3300046475 | Bacteria | 609 |
| 1215 | Ga0495662_0338972 | 3300046476 | Bacteria | 739 |
| 1216 | Ga0495664_0014347 | 3300046477 | Bacteria | 4490 |
| 1217 | Ga0495664_0272048 | 3300046477 | Bacteria | 1024 |
| 1218 | Ga0495664_0454051 | 3300046477 | Bacteria | 767 |
| 1219 | Ga0495585_0180347 | 3300046492 | Bacteria | 1086 |
| 1220 | Ga0495594_0085650 | 3300046499 | Bacteria | 1763 |
| 1221 | Ga0495594_0127254 | 3300046499 | Bacteria | 1442 |
| 1222 | Ga0495594_0751173 | 3300046499 | Bacteria | 551 |
| 1223 | Ga0495583_0274926 | 3300046506 | Bacteria | 672 |
| 1224 | Ga0495606_0055740 | 3300046507 | Bacteria | 2555 |
| 1225 | Ga0495606_0248930 | 3300046507 | Bacteria | 987 |
| 1226 | Ga0495606_0467327 | 3300046507 | Bacteria | 643 |
| 1227 | Ga0495608_0005788 | 3300046511 | Bacteria | 8807 |
| 1228 | Ga0495608_0312524 | 3300046511 | Bacteria | 972 |
| 1229 | Ga0495618_0352959 | 3300046514 | Bacteria | 906 |
| 1230 | Ga0495620_0178792 | 3300046515 | Bacteria | 821 |
| 1231 | Ga0495628_0110696 | 3300046516 | Bacteria | 2112 |
| 1232 | Ga0495628_0518092 | 3300046516 | Bacteria | 859 |
| 1233 | Ga0495628_1168676 | 3300046516 | Bacteria | 523 |
| 1234 | Ga0495630_0444399 | 3300046517 | Bacteria | 994 |
| 1235 | Ga0495630_0556229 | 3300046517 | Bacteria | 880 |
| 1236 | Ga0495631_0083702 | 3300046518 | Bacteria | 1375 |
| 1237 | Ga0495632_0088938 | 3300046519 | Bacteria | 1467 |
| 1238 | Ga0495632_0223197 | 3300046519 | Bacteria | 852 |
| 1239 | Ga0495642_0031203 | 3300046528 | Bacteria | 2136 |
| 1240 | Ga0495642_0111550 | 3300046528 | Bacteria | 1170 |
| 1241 | Ga0495652_0104031 | 3300046529 | Bacteria | 2297 |
| 1242 | Ga0495652_0361215 | 3300046529 | Bacteria | 1038 |
| 1243 | Ga0495654_0052557 | 3300046530 | Bacteria | 1983 |
| 1244 | Ga0495665_0328206 | 3300046531 | Bacteria | 781 |
| 1245 | Ga0495640_0170914 | 3300046533 | Bacteria | 1389 |
| 1246 | Ga0495640_0361145 | 3300046533 | Bacteria | 895 |
| 1247 | Ga0495587_0006550 | 3300046536 | Bacteria | 7580 |
| 1248 | Ga0495609_0084812 | 3300046538 | Bacteria | 1382 |
| 1249 | Ga0495621_0007305 | 3300046539 | Bacteria | 3267 |
| 1250 | Ga0495645_0006077 | 3300046543 | Bacteria | 8353 |
| 1251 | Ga0495645_0496277 | 3300046543 | Bacteria | 764 |
| 1252 | Ga0495622_0005205 | 3300046557 | Bacteria | 6029 |
| 1253 | Ga0495667_0013738 | 3300046559 | Bacteria | 5471 |
| 1254 | Ga0495667_0192168 | 3300046559 | Bacteria | 1308 |
| 1255 | Ga0495656_0058964 | 3300046615 | Bacteria | 1668 |
| 1256 | Ga0495668_0112847 | 3300046616 | Bacteria | 1487 |
| 1257 | Ga0495634_0245950 | 3300046642 | Bacteria | 1096 |
| 1258 | Ga0495634_0650807 | 3300046642 | Bacteria | 609 |
| 1259 | Ga0495611_0118236 | 3300046648 | Bacteria | 1235 |
| 1260 | Ga0495625_0674147 | 3300046660 | Bacteria | 613 |
| 1261 | Ga0495635_0081895 | 3300046663 | Bacteria | 2208 |
| 1262 | Ga0495635_0159637 | 3300046663 | Bacteria | 1534 |
| 1263 | Ga0495635_0318696 | 3300046663 | Bacteria | 1041 |
| 1264 | Ga0495635_0377371 | 3300046663 | Bacteria | 944 |
| 1265 | Ga0495661_0193074 | 3300046665 | Bacteria | 1071 |
| 1266 | Ga0495588_0565181 | 3300046674 | Bacteria | 596 |
| 1267 | Ga0495657_0089597 | 3300046675 | Bacteria | 1976 |
| 1268 | Ga0495657_0195618 | 3300046675 | Bacteria | 1234 |
| 1269 | Ga0495599_0090673 | 3300046678 | Bacteria | 1907 |
| 1270 | Ga0495599_0282643 | 3300046678 | Bacteria | 1005 |
| 1271 | Ga0495623_0261596 | 3300046679 | Bacteria | 969 |
| 1272 | Ga0495646_0013300 | 3300046680 | Bacteria | 5230 |
| 1273 | Ga0495646_0476338 | 3300046680 | Bacteria | 643 |
| 1274 | Ga0495647_0230568 | 3300046681 | Bacteria | 820 |
| 1275 | Ga0495647_0347880 | 3300046681 | Bacteria | 674 |
| 1276 | Ga0495658_0077899 | 3300046683 | Bacteria | 1939 |
| 1277 | Ga0495658_0105408 | 3300046683 | Bacteria | 1689 |
| 1278 | Ga0495669_0056516 | 3300046684 | Bacteria | 1769 |
| 1279 | Ga0495613_0288951 | 3300046689 | Bacteria | 1137 |
| 1280 | Ga0495613_0609588 | 3300046689 | Bacteria | 726 |
| 1281 | Ga0495624_0254893 | 3300046690 | Bacteria | 1061 |
| 1282 | Ga0495671_0322087 | 3300046692 | Bacteria | 742 |
| 1283 | Ga0495671_0630277 | 3300046692 | Bacteria | 510 |
| 1284 | Ga0495649_0200501 | 3300046694 | Bacteria | 1036 |
| 1285 | Ga0495649_0484305 | 3300046694 | Bacteria | 616 |
| 1286 | Ga0495649_0521266 | 3300046694 | Bacteria | 590 |
| 1287 | Ga0495649_0648876 | 3300046694 | Bacteria | 519 |
| 1288 | Ga0495589_0252897 | 3300046794 | Bacteria | 823 |
| 1289 | Ga0495589_0345895 | 3300046794 | Bacteria | 685 |
| 1290 | Ga0495600_0171410 | 3300046809 | Bacteria | 1401 |
| 1291 | Ga0495581_0222805 | 3300047315 | Bacteria | 1103 |
| 1292 | Ga0495604_0064902 | 3300047317 | Bacteria | 2781 |
| 1293 | Ga0495604_0599186 | 3300047317 | Bacteria | 707 |
| 1294 | Ga0495636_0145114 | 3300047318 | Bacteria | 1062 |
| 1295 | Ga0495674_0022196 | 3300047319 | Bacteria | 5855 |
| 1296 | Ga0495674_0152655 | 3300047319 | Bacteria | 1936 |
| 1297 | Ga0495674_0317586 | 3300047319 | Bacteria | 1270 |
| 1298 | Ga0495674_0484119 | 3300047319 | Bacteria | 991 |
| 1299 | Ga0495674_0486149 | 3300047319 | Bacteria | 989 |
| 1300 | Ga0495672_0010923 | 3300047320 | Bacteria | 6440 |
| 1301 | Ga0495672_0097960 | 3300047320 | Bacteria | 1596 |
| 1302 | Ga0495672_0241498 | 3300047320 | Bacteria | 882 |
| 1303 | Ga0495672_0382104 | 3300047320 | Bacteria | 647 |
| 1304 | Ga0495676_0701455 | 3300047321 | Bacteria | 655 |
| 1305 | Ga0495676_0863456 | 3300047321 | Bacteria | 581 |
| 1306 | Ga0495680_0079504 | 3300047322 | Bacteria | 2479 |
| 1307 | Ga0495683_0023644 | 3300047323 | Bacteria | 3158 |
| 1308 | Ga0495675_0034301 | 3300047444 | Bacteria | 3240 |
| 1309 | Ga0495675_0125394 | 3300047444 | Bacteria | 1598 |
| 1310 | Ga0495675_0300096 | 3300047444 | Bacteria | 954 |
| 1311 | Ga0495675_0465897 | 3300047444 | Bacteria | 729 |
| 1312 | Ga0495684_0122366 | 3300047471 | Bacteria | 1959 |
| 1313 | Ga0495684_0228897 | 3300047471 | Bacteria | 1360 |
| 1314 | Ga0495684_0393069 | 3300047471 | Bacteria | 975 |
| 1315 | Ga0495684_0394642 | 3300047471 | Bacteria | 973 |
| 1316 | Ga0495684_0549839 | 3300047471 | Bacteria | 786 |
| 1317 | Ga0495686_0173970 | 3300047472 | Bacteria | 1251 |
| 1318 | Ga0495686_0389719 | 3300047472 | Bacteria | 750 |
| 1319 | Ga0495593_0711071 | 3300047673 | Bacteria | 505 |
| 1320 | Ga0495602_0000485 | 3300048088 | Bacteria | 36933 |
| 1321 | Ga0495602_0331316 | 3300048088 | Bacteria | 1104 |
| 1322 | Ga0495602_0496778 | 3300048088 | Bacteria | 853 |
| 1323 | Ga0495615_0123520 | 3300048090 | Bacteria | 751 |
| 1324 | Ga0495626_0026549 | 3300048091 | Bacteria | 2822 |
| 1325 | Ga0495626_0394216 | 3300048091 | Bacteria | 536 |
| 1326 | Ga0496100_0028163 | 3300048903 | Bacteria | 3463 |
| 1327 | Ga0496100_0531081 | 3300048903 | Bacteria | 909 |
| 1328 | Ga0496101_0187660 | 3300048904 | Bacteria | 1594 |
| 1329 | Ga0496101_0385578 | 3300048904 | Bacteria | 1103 |
| 1330 | Ga0496102_0021900 | 3300048905 | Bacteria | 5658 |
| 1331 | Ga0496102_0089827 | 3300048905 | Bacteria | 2842 |
| 1332 | Ga0496103_0005971 | 3300048906 | Bacteria | 7283 |
| 1333 | Ga0496104_0017664 | 3300048907 | Bacteria | 6502 |
| 1334 | Ga0496104_0156871 | 3300048907 | Bacteria | 2184 |
| 1335 | Ga0496104_1095783 | 3300048907 | Bacteria | 700 |
| 1336 | Ga0496105_0294096 | 3300048908 | Bacteria | 1307 |
| 1337 | Ga0496106_0004608 | 3300048909 | Bacteria | 10225 |
| 1338 | Ga0496106_0127126 | 3300048909 | Bacteria | 1996 |
| 1339 | Ga0496106_0617607 | 3300048909 | Bacteria | 868 |
| 1340 | Ga0496107_0008725 | 3300048910 | Bacteria | 7023 |
| 1341 | Ga0496107_0041203 | 3300048910 | Bacteria | 3316 |
| 1342 | Ga0496108_0266859 | 3300048911 | Bacteria | 1490 |
| 1343 | Ga0496108_0731634 | 3300048911 | Bacteria | 857 |
| 1344 | Ga0496108_1099120 | 3300048911 | Bacteria | 676 |
| 1345 | Ga0496109_0334424 | 3300048912 | Bacteria | 1430 |
| 1346 | Ga0496110_0508118 | 3300048913 | Bacteria | 1097 |
| 1347 | Ga0496110_0610112 | 3300048913 | Bacteria | 989 |
| 1348 | Ga0496111_0603211 | 3300048914 | Bacteria | 804 |
| 1349 | Ga0496111_0725350 | 3300048914 | Bacteria | 722 |
| 1350 | Ga0496112_0415216 | 3300048915 | Bacteria | 1285 |
| 1351 | Ga0496113_0642497 | 3300048916 | Bacteria | 849 |
| 1352 | Ga0496113_0784735 | 3300048916 | Bacteria | 757 |
| 1353 | Ga0496114_0024865 | 3300048917 | Bacteria | 4890 |
| 1354 | Ga0496115_0001671 | 3300048918 | Bacteria | 15949 |
| 1355 | Ga0496115_0552779 | 3300048918 | Bacteria | 920 |
| 1356 | Ga0496115_1197618 | 3300048918 | Bacteria | 571 |
| 1357 | Ga0496120_0132303 | 3300048923 | Bacteria | 1276 |
| 1358 | Ga0496120_0283637 | 3300048923 | Bacteria | 764 |
| 1359 | Ga0496121_0386560 | 3300048924 | Bacteria | 921 |
| 1360 | Ga0496126_0123506 | 3300048929 | Bacteria | 2243 |
| 1361 | Ga0496126_0403954 | 3300048929 | Bacteria | 1107 |
| 1362 | Ga0501306_011195 | 3300049127 | Bacteria | 1141 |
| 1363 | Ga0501306_011303 | 3300049127 | Bacteria | 1137 |
| 1364 | Ga0501308_004474 | 3300049128 | Bacteria | 1349 |
| 1365 | Ga0501308_088930 | 3300049128 | Bacteria | 500 |
| 1366 | Ga0501310_022382 | 3300049130 | Bacteria | 797 |
| 1367 | Ga0501304_027739 | 3300049160 | Bacteria | 590 |
| 1368 | Ga0501305_012393 | 3300049161 | Bacteria | 1166 |
| 1369 | Ga0501307_007377 | 3300049162 | Bacteria | 1211 |
| 1370 | Ga0501307_033780 | 3300049162 | Bacteria | 720 |
| 1371 | Ga0501311_017110 | 3300049527 | Bacteria | 951 |
| 1372 | Ga0501311_027428 | 3300049527 | Bacteria | 808 |
| 1373 | Ga0501311_051585 | 3300049527 | Bacteria | 646 |
| 1374 | Ga0501312_012174 | 3300049528 | Bacteria | 1180 |
| 1375 | Ga0501312_013150 | 3300049528 | Bacteria | 1148 |
| 1376 | Ga0501312_046864 | 3300049528 | Bacteria | 720 |
| 1377 | Ga0501313_013109 | 3300049529 | Bacteria | 971 |
| 1378 | Ga0501313_051720 | 3300049529 | Bacteria | 569 |
| 1379 | Ga0501315_002668 | 3300049531 | Bacteria | 1707 |
| 1380 | Ga0501315_079589 | 3300049531 | Bacteria | 555 |
| 1381 | Ga0501316_003868 | 3300049532 | Bacteria | 1479 |
| 1382 | Ga0501317_001666 | 3300049533 | Bacteria | 1965 |
| 1383 | Ga0501317_009684 | 3300049533 | Bacteria | 1137 |
| 1384 | Ga0501317_015990 | 3300049533 | Bacteria | 968 |
| 1385 | Ga0501317_023822 | 3300049533 | Bacteria | 847 |
| 1386 | Ga0501317_029983 | 3300049533 | Bacteria | 785 |
| 1387 | Ga0501318_002881 | 3300049534 | Bacteria | 1531 |
| 1388 | Ga0501318_003003 | 3300049534 | Bacteria | 1513 |
| 1389 | Ga0501318_005635 | 3300049534 | Bacteria | 1250 |
| 1390 | Ga0501318_016453 | 3300049534 | Bacteria | 894 |
| 1391 | Ga0501318_024801 | 3300049534 | Bacteria | 783 |
| 1392 | Ga0501318_045469 | 3300049534 | Bacteria | 639 |
| 1393 | Ga0501318_073419 | 3300049534 | Bacteria | 544 |
| 1394 | Ga0501320_055674 | 3300049536 | Bacteria | 547 |
| 1395 | Ga0501321_006571 | 3300049537 | Bacteria | 1186 |
| 1396 | Ga0501324_002934 | 3300049540 | Bacteria | 1276 |
| 1397 | Ga0501324_025654 | 3300049540 | Bacteria | 623 |
| 1398 | Ga0501031_0131538 | 3300049568 | Bacteria | 1635 |
| 1399 | Ga0501031_0304347 | 3300049568 | Bacteria | 1033 |
| 1400 | Ga0501031_0318414 | 3300049568 | Bacteria | 1008 |
| 1401 | Ga0501032_0019862 | 3300049569 | Bacteria | 4691 |
| 1402 | Ga0501032_0076360 | 3300049569 | Bacteria | 2231 |
| 1403 | Ga0501032_0104516 | 3300049569 | Bacteria | 1876 |
| 1404 | Ga0501032_0893540 | 3300049569 | Bacteria | 559 |
| 1405 | Ga0501033_0005260 | 3300049570 | Bacteria | 10269 |
| 1406 | Ga0501033_0012240 | 3300049570 | Bacteria | 6548 |
| 1407 | Ga0501033_0020706 | 3300049570 | Bacteria | 4970 |
| 1408 | Ga0501033_0106944 | 3300049570 | Bacteria | 2038 |
| 1409 | Ga0501033_0206968 | 3300049570 | Bacteria | 1400 |
| 1410 | Ga0501033_0975686 | 3300049570 | Bacteria | 567 |
| 1411 | Ga0501034_0000208 | 3300049571 | Bacteria | 111739 |
| 1412 | Ga0501034_0009460 | 3300049571 | Bacteria | 10201 |
| 1413 | Ga0501034_0056638 | 3300049571 | Bacteria | 3943 |
| 1414 | Ga0501034_0171459 | 3300049571 | Bacteria | 2137 |
| 1415 | Ga0501034_0188771 | 3300049571 | Bacteria | 2024 |
| 1416 | Ga0501034_0198693 | 3300049571 | Bacteria | 1964 |
| 1417 | Ga0501034_0331645 | 3300049571 | Bacteria | 1453 |
| 1418 | Ga0501034_0347968 | 3300049571 | Bacteria | 1411 |
| 1419 | Ga0501034_0479868 | 3300049571 | Bacteria | 1159 |
| 1420 | Ga0501034_0493116 | 3300049571 | Bacteria | 1139 |
| 1421 | Ga0501034_0640364 | 3300049571 | Bacteria | 965 |
| 1422 | Ga0501034_0876666 | 3300049571 | Bacteria | 786 |
| 1423 | Ga0501034_0948957 | 3300049571 | Bacteria | 746 |
| 1424 | Ga0501036_0050702 | 3300049572 | Bacteria | 3515 |
| 1425 | Ga0501036_0075956 | 3300049572 | Bacteria | 2842 |
| 1426 | Ga0501036_0249878 | 3300049572 | Bacteria | 1486 |
| 1427 | Ga0501036_0308062 | 3300049572 | Bacteria | 1324 |
| 1428 | Ga0501036_0380494 | 3300049572 | Bacteria | 1178 |
| 1429 | Ga0501036_0415122 | 3300049572 | Bacteria | 1122 |
| 1430 | Ga0501036_0565163 | 3300049572 | Bacteria | 945 |
| 1431 | Ga0501036_0629985 | 3300049572 | Bacteria | 888 |
| 1432 | Ga0501036_0741396 | 3300049572 | Bacteria | 811 |
| 1433 | Ga0501036_1169245 | 3300049572 | Bacteria | 627 |
| 1434 | Ga0501037_0007990 | 3300049573 | Bacteria | 7753 |
| 1435 | Ga0501037_0013050 | 3300049573 | Bacteria | 6127 |
| 1436 | Ga0501037_0098875 | 3300049573 | Bacteria | 2107 |
| 1437 | Ga0501037_0108796 | 3300049573 | Bacteria | 1997 |
| 1438 | Ga0501037_0123771 | 3300049573 | Bacteria | 1858 |
| 1439 | Ga0501037_0259993 | 3300049573 | Bacteria | 1213 |
| 1440 | Ga0501037_0502501 | 3300049573 | Bacteria | 822 |
| 1441 | Ga0501037_0958892 | 3300049573 | Bacteria | 558 |
| 1442 | Ga0501038_0009962 | 3300049574 | Bacteria | 8704 |
| 1443 | Ga0501038_0096205 | 3300049574 | Bacteria | 2472 |
| 1444 | Ga0501038_0408010 | 3300049574 | Bacteria | 1050 |
| 1445 | Ga0501038_0933239 | 3300049574 | Bacteria | 639 |
| 1446 | Ga0501038_1381271 | 3300049574 | Bacteria | 506 |
| 1447 | Ga0501039_0000072 | 3300049575 | Bacteria | 76673 |
| 1448 | Ga0501039_0098169 | 3300049575 | Bacteria | 2285 |
| 1449 | Ga0501039_0133948 | 3300049575 | Bacteria | 1945 |
| 1450 | Ga0501039_0309306 | 3300049575 | Unclassified | 1242 |
| 1451 | Ga0501039_0582557 | 3300049575 | Bacteria | 877 |
| 1452 | Ga0501039_0759757 | 3300049575 | Bacteria | 757 |
| 1453 | Ga0501039_1006196 | 3300049575 | Bacteria | 647 |
| 1454 | Ga0501040_0065678 | 3300049576 | Bacteria | 2499 |
| 1455 | Ga0501041_0383436 | 3300049577 | Bacteria | 889 |
| 1456 | Ga0501042_0135548 | 3300049578 | Bacteria | 1775 |
| 1457 | Ga0501042_1363722 | 3300049578 | Bacteria | 517 |
| 1458 | Ga0501043_0014584 | 3300049579 | Bacteria | 6152 |
| 1459 | Ga0501043_0045694 | 3300049579 | Bacteria | 3444 |
| 1460 | Ga0501043_0147562 | 3300049579 | Bacteria | 1841 |
| 1461 | Ga0501043_0179217 | 3300049579 | Bacteria | 1651 |
| 1462 | Ga0501043_0372880 | 3300049579 | Bacteria | 1081 |
| 1463 | Ga0501043_0611113 | 3300049579 | Bacteria | 804 |
| 1464 | Ga0501043_0983070 | 3300049579 | Bacteria | 601 |
| 1465 | Ga0501046_0004977 | 3300049580 | Bacteria | 11926 |
| 1466 | Ga0501046_0011762 | 3300049580 | Bacteria | 7472 |
| 1467 | Ga0501046_0083492 | 3300049580 | Bacteria | 2466 |
| 1468 | Ga0501046_0099104 | 3300049580 | Bacteria | 2237 |
| 1469 | Ga0501046_0239452 | 3300049580 | Bacteria | 1338 |
| 1470 | Ga0501046_0432622 | 3300049580 | Bacteria | 948 |
| 1471 | Ga0501047_0001212 | 3300049581 | Bacteria | 25586 |
| 1472 | Ga0501047_0002319 | 3300049581 | Bacteria | 18206 |
| 1473 | Ga0501047_0042378 | 3300049581 | Bacteria | 4399 |
| 1474 | Ga0501047_0059259 | 3300049581 | Bacteria | 3696 |
| 1475 | Ga0501047_0138742 | 3300049581 | Bacteria | 2310 |
| 1476 | Ga0501047_0154693 | 3300049581 | Bacteria | 2167 |
| 1477 | Ga0501047_0154945 | 3300049581 | Bacteria | 2165 |
| 1478 | Ga0501047_0180149 | 3300049581 | Bacteria | 1980 |
| 1479 | Ga0501047_0267505 | 3300049581 | Bacteria | 1556 |
| 1480 | Ga0501047_0285627 | 3300049581 | Bacteria | 1494 |
| 1481 | Ga0501047_0415754 | 3300049581 | Bacteria | 1176 |
| 1482 | Ga0501047_0757844 | 3300049581 | Bacteria | 786 |
| 1483 | Ga0501048_0051367 | 3300049582 | Bacteria | 2935 |
| 1484 | Ga0501048_0088154 | 3300049582 | Bacteria | 2189 |
| 1485 | Ga0501048_0101952 | 3300049582 | Bacteria | 2025 |
| 1486 | Ga0501048_0155341 | 3300049582 | Bacteria | 1618 |
| 1487 | Ga0501048_0239734 | 3300049582 | Unclassified | 1287 |
| 1488 | Ga0501048_0556179 | 3300049582 | Bacteria | 823 |
| 1489 | Ga0501048_0627839 | 3300049582 | Bacteria | 771 |
| 1490 | Ga0501067_0001590 | 3300049583 | Bacteria | 12434 |
| 1491 | Ga0501067_0108900 | 3300049583 | Bacteria | 1540 |
| 1492 | Ga0501067_0162644 | 3300049583 | Bacteria | 1243 |
| 1493 | Ga0501067_0179124 | 3300049583 | Bacteria | 1181 |
| 1494 | Ga0501068_0036227 | 3300049584 | Bacteria | 2949 |
| 1495 | Ga0501068_0243618 | 3300049584 | Bacteria | 1145 |
| 1496 | Ga0501068_0337764 | 3300049584 | Bacteria | 967 |
| 1497 | Ga0501068_0435800 | 3300049584 | Bacteria | 847 |
| 1498 | Ga0501068_0803807 | 3300049584 | Bacteria | 617 |
| 1499 | Ga0501068_0905982 | 3300049584 | Bacteria | 580 |
| 1500 | Ga0501068_0923954 | 3300049584 | Bacteria | 574 |
| 1501 | Ga0501069_0058742 | 3300049585 | Bacteria | 2146 |
| 1502 | Ga0501069_0079151 | 3300049585 | Bacteria | 1849 |
| 1503 | Ga0501069_0459450 | 3300049585 | Bacteria | 757 |
| 1504 | Ga0501069_0640660 | 3300049585 | Bacteria | 639 |
| 1505 | Ga0501070_0068712 | 3300049586 | Bacteria | 2933 |
| 1506 | Ga0501070_0199363 | 3300049586 | Bacteria | 1644 |
| 1507 | Ga0501070_0348364 | 3300049586 | Bacteria | 1202 |
| 1508 | Ga0501070_0517666 | 3300049586 | Bacteria | 957 |
| 1509 | Ga0501070_0859167 | 3300049586 | Bacteria | 709 |
| 1510 | Ga0501071_0057831 | 3300049587 | Bacteria | 2803 |
| 1511 | Ga0501071_0252161 | 3300049587 | Bacteria | 1332 |
| 1512 | Ga0501071_0296191 | 3300049587 | Bacteria | 1226 |
| 1513 | Ga0501071_0303954 | 3300049587 | Bacteria | 1209 |
| 1514 | Ga0501071_0577330 | 3300049587 | Bacteria | 864 |
| 1515 | Ga0501071_0651782 | 3300049587 | Bacteria | 810 |
| 1516 | Ga0501071_0817517 | 3300049587 | Bacteria | 719 |
| 1517 | Ga0501071_1128412 | 3300049587 | Bacteria | 606 |
| 1518 | Ga0501072_0052932 | 3300049588 | Bacteria | 3196 |
| 1519 | Ga0501072_0131259 | 3300049588 | Bacteria | 1997 |
| 1520 | Ga0501072_0770225 | 3300049588 | Bacteria | 754 |
| 1521 | Ga0501072_0846029 | 3300049588 | Bacteria | 715 |
| 1522 | Ga0501073_0021555 | 3300049589 | Bacteria | 4644 |
| 1523 | Ga0501073_0025762 | 3300049589 | Bacteria | 4214 |
| 1524 | Ga0501073_0061078 | 3300049589 | Bacteria | 2630 |
| 1525 | Ga0501073_0168051 | 3300049589 | Bacteria | 1518 |
| 1526 | Ga0501073_0229610 | 3300049589 | Bacteria | 1282 |
| 1527 | Ga0501073_0313950 | 3300049589 | Bacteria | 1081 |
| 1528 | Ga0501073_0432746 | 3300049589 | Bacteria | 909 |
| 1529 | Ga0501073_0489000 | 3300049589 | Bacteria | 851 |
| 1530 | Ga0501073_0529454 | 3300049589 | Bacteria | 814 |
| 1531 | Ga0501073_0918746 | 3300049589 | Bacteria | 602 |
| 1532 | Ga0501073_1204701 | 3300049589 | Bacteria | 520 |
| 1533 | Ga0501074_0079197 | 3300049590 | Bacteria | 2358 |
| 1534 | Ga0501074_0565600 | 3300049590 | Bacteria | 805 |
| 1535 | Ga0501075_0063131 | 3300049591 | Bacteria | 2793 |
| 1536 | Ga0501075_0173674 | 3300049591 | Bacteria | 1645 |
| 1537 | Ga0501076_0013544 | 3300049592 | Bacteria | 6114 |
| 1538 | Ga0501076_0247028 | 3300049592 | Bacteria | 1460 |
| 1539 | Ga0501077_0165265 | 3300049593 | Bacteria | 1406 |
| 1540 | Ga0501077_0196471 | 3300049593 | Bacteria | 1281 |
| 1541 | Ga0501077_0389959 | 3300049593 | Bacteria | 890 |
| 1542 | Ga0501077_0978032 | 3300049593 | Bacteria | 545 |
| 1543 | Ga0501079_0108926 | 3300049741 | Bacteria | 2151 |
| 1544 | Ga0501079_0721469 | 3300049741 | Bacteria | 785 |
| 1545 | Ga0501080_0000005 | 3300049742 | Bacteria | 176271 |
| 1546 | Ga0501080_0071546 | 3300049742 | Bacteria | 3226 |
| 1547 | Ga0501080_0098262 | 3300049742 | Bacteria | 2717 |
| 1548 | Ga0501080_0113812 | 3300049742 | Bacteria | 2508 |
| 1549 | Ga0501080_0170095 | 3300049742 | Bacteria | 2010 |
| 1550 | Ga0501080_0313821 | 3300049742 | Bacteria | 1421 |
| 1551 | Ga0501080_0329025 | 3300049742 | Bacteria | 1382 |
| 1552 | Ga0501080_0332884 | 3300049742 | Bacteria | 1373 |
| 1553 | Ga0501080_0799651 | 3300049742 | Bacteria | 827 |
| 1554 | Ga0501080_0870879 | 3300049742 | Bacteria | 786 |
| 1555 | Ga0501080_1120692 | 3300049742 | Bacteria | 679 |
| 1556 | Ga0501080_1134541 | 3300049742 | Bacteria | 674 |
| 1557 | Ga0501080_1221465 | 3300049742 | Bacteria | 646 |
| 1558 | Ga0501080_1305695 | 3300049742 | Bacteria | 621 |
| 1559 | Ga0501080_1457080 | 3300049742 | Bacteria | 583 |
| 1560 | Ga0501080_1787282 | 3300049742 | Bacteria | 517 |
| 1561 | Ga0501081_0009109 | 3300049743 | Bacteria | 6458 |
| 1562 | Ga0501081_0018650 | 3300049743 | Bacteria | 4611 |
| 1563 | Ga0501081_0771951 | 3300049743 | Bacteria | 723 |
| 1564 | Ga0501083_0082701 | 3300049744 | Bacteria | 2127 |
| 1565 | Ga0501083_0109534 | 3300049744 | Bacteria | 1816 |
| 1566 | Ga0501083_0154246 | 3300049744 | Bacteria | 1504 |
| 1567 | Ga0501083_0190488 | 3300049744 | Bacteria | 1338 |
| 1568 | Ga0501083_0232547 | 3300049744 | Bacteria | 1200 |
| 1569 | Ga0501035_0000049 | 3300049822 | Bacteria | 145684 |
| 1570 | Ga0501035_0048543 | 3300049822 | Bacteria | 3807 |
| 1571 | Ga0501035_0084852 | 3300049822 | Bacteria | 2793 |
| 1572 | Ga0501035_0438103 | 3300049822 | Bacteria | 1083 |
| 1573 | Ga0501035_0510636 | 3300049822 | Bacteria | 988 |
| 1574 | Ga0501035_0555601 | 3300049822 | Bacteria | 940 |
| 1575 | Ga0501035_0622580 | 3300049822 | Bacteria | 877 |
| 1576 | Ga0501035_0754471 | 3300049822 | Bacteria | 781 |
| 1577 | Ga0501035_0880720 | 3300049822 | Bacteria | 710 |
| 1578 | Ga0501035_0896113 | 3300049822 | Bacteria | 703 |
| 1579 | Ga0501044_0000030 | 3300049823 | Bacteria | 173442 |
| 1580 | Ga0501044_0015755 | 3300049823 | Bacteria | 8141 |
| 1581 | Ga0501044_0032628 | 3300049823 | Bacteria | 5473 |
| 1582 | Ga0501044_0044540 | 3300049823 | Bacteria | 4604 |
| 1583 | Ga0501044_0050289 | 3300049823 | Bacteria | 4302 |
| 1584 | Ga0501044_0081352 | 3300049823 | Bacteria | 3279 |
| 1585 | Ga0501044_0099821 | 3300049823 | Bacteria | 2921 |
| 1586 | Ga0501044_0112831 | 3300049823 | Bacteria | 2725 |
| 1587 | Ga0501044_0150030 | 3300049823 | Bacteria | 2314 |
| 1588 | Ga0501044_0337074 | 3300049823 | Bacteria | 1429 |
| 1589 | Ga0501044_0381983 | 3300049823 | Bacteria | 1323 |
| 1590 | Ga0501044_0411454 | 3300049823 | Bacteria | 1263 |
| 1591 | Ga0501044_0531262 | 3300049823 | Bacteria | 1075 |
| 1592 | Ga0501044_0584065 | 3300049823 | Bacteria | 1011 |
| 1593 | Ga0501044_1291788 | 3300049823 | Bacteria | 596 |
| 1594 | Ga0501045_0037773 | 3300049824 | Bacteria | 3511 |
| 1595 | Ga0501045_0038945 | 3300049824 | Bacteria | 3459 |
| 1596 | Ga0501045_0216057 | 3300049824 | Bacteria | 1428 |
| 1597 | Ga0501045_0373205 | 3300049824 | Bacteria | 1062 |
| 1598 | nmdc:mga03683_214353_c1 | 3300050489 | Bacteria | 887 |
| 1599 | nmdc:mga03683_436293_c1 | 3300050489 | Bacteria | 629 |
| 1600 | nmdc:mga03683_81488_c1 | 3300050489 | Bacteria | 1398 |
| 1601 | nmdc:mga03683_94213_c1 | 3300050489 | Bacteria | 1309 |
| 1602 | nmdc:mga03n38_522045_c1 | 3300050490 | Bacteria | 669 |
| 1603 | nmdc:mga03n38_593050_c1 | 3300050490 | Bacteria | 630 |
| 1604 | nmdc:mga00v17_250152_c1 | 3300050491 | Bacteria | 1149 |
| 1605 | nmdc:mga00v17_720986_c1 | 3300050491 | Bacteria | 638 |
| 1606 | nmdc:mga0yw44_553277_c1 | 3300050492 | Bacteria | 781 |
| 1607 | nmdc:mga0yw44_752128_c1 | 3300050492 | Bacteria | 662 |
| 1608 | nmdc:mga0k408_14041_c1 | 3300050493 | Bacteria | 4404 |
| 1609 | nmdc:mga0k408_148475_c1 | 3300050493 | Bacteria | 1396 |
| 1610 | nmdc:mga0k408_240476_c1 | 3300050493 | Bacteria | 1081 |
| 1611 | nmdc:mga0k408_408156_c1 | 3300050493 | Bacteria | 808 |
| 1612 | nmdc:mga0k408_775120_c1 | 3300050493 | Bacteria | 560 |
| 1613 | nmdc:mga06z11_395022_c1 | 3300050494 | Bacteria | 832 |
| 1614 | nmdc:mga06z11_631274_c1 | 3300050494 | Bacteria | 652 |
| 1615 | nmdc:mga04h51_531736_c1 | 3300050495 | Bacteria | 505 |
| 1616 | nmdc:mga07m45_247664_c1 | 3300050496 | Bacteria | 1037 |
| 1617 | nmdc:mga05p37_1877201_c1 | 3300050507 | Bacteria | 574 |
| 1618 | nmdc:mga05p37_208661_c1 | 3300050507 | Bacteria | 2362 |
| 1619 | nmdc:mga05p37_703200_c1 | 3300050507 | Bacteria | 1122 |
| 1620 | nmdc:mga09592_1445486_c1 | 3300050508 | Bacteria | 561 |
| 1621 | nmdc:mga09592_274466_c1 | 3300050508 | Bacteria | 1462 |
| 1622 | nmdc:mga06r32_1721329_c1 | 3300050510 | Bacteria | 564 |
| 1623 | nmdc:mga08y16_1093548_c1 | 3300050511 | Bacteria | 773 |
| 1624 | nmdc:mga08y16_205_c1 | 3300050511 | Bacteria | 53058 |
| 1625 | nmdc:mga08y16_3117_c1 | 3300050511 | Bacteria | 17166 |
| 1626 | nmdc:mga0n895_287400_c1 | 3300050512 | Bacteria | 1667 |
| 1627 | nmdc:mga0n895_445621_c1 | 3300050512 | Bacteria | 1307 |
| 1628 | nmdc:mga0n895_455742_c1 | 3300050512 | Bacteria | 1291 |
| 1629 | nmdc:mga0n895_611333_c1 | 3300050512 | Bacteria | 1091 |
| 1630 | nmdc:mga0rr50_1624502_c1 | 3300050513 | Bacteria | 545 |
| 1631 | nmdc:mga08x19_309104_c1 | 3300050514 | Bacteria | 1099 |
| 1632 | nmdc:mga08x19_437170_c1 | 3300050514 | Bacteria | 920 |
| 1633 | nmdc:mga08x19_541883_c1 | 3300050514 | Bacteria | 823 |
| 1634 | nmdc:mga08x19_691923_c1 | 3300050514 | Bacteria | 723 |
| 1635 | nmdc:mga0a205_206624_c1 | 3300050515 | Bacteria | 1555 |
| 1636 | nmdc:mga0a205_399680_c1 | 3300050515 | Bacteria | 1238 |
| 1637 | nmdc:mga0a205_858010_c1 | 3300050515 | Bacteria | 755 |
| 1638 | nmdc:mga0sz30_5573_c1 | 3300050516 | Bacteria | 4138 |
| 1639 | Ga0495601_0057176 | 3300053077 | Bacteria | 2471 |
| 1640 | Ga0495601_0613037 | 3300053077 | Bacteria | 698 |
| 1641 | Ga0495601_0833131 | 3300053077 | Bacteria | 585 |
| 1642 | Ga0495601_0977994 | 3300053077 | Bacteria | 533 |
| 1643 | Ga0495612_0001954 | 3300053078 | Bacteria | 8488 |
| 1644 | Ga0500635_0079760 | 3300053080 | Bacteria | 1174 |
| 1645 | Ga0500635_0089208 | 3300053080 | Bacteria | 1119 |
| 1646 | Ga0495619_0075345 | 3300053085 | Bacteria | 2264 |
| 1647 | Ga0500578_0149619 | 3300053086 | Bacteria | 1455 |
| 1648 | Ga0500643_022828 | 3300053087 | Bacteria | 2008 |
| 1649 | Ga0500643_132082 | 3300053087 | Bacteria | 671 |
| 1650 | Ga0500643_135613 | 3300053087 | Bacteria | 662 |
| 1651 | Ga0500644_0009620 | 3300053088 | Bacteria | 2592 |
| 1652 | Ga0500644_0034020 | 3300053088 | Bacteria | 1641 |
| 1653 | Ga0500644_0168401 | 3300053088 | Bacteria | 890 |
| 1654 | Ga0500644_0336959 | 3300053088 | Bacteria | 651 |
| 1655 | Ga0500646_0036995 | 3300053090 | Bacteria | 1362 |
| 1656 | Ga0500646_0042165 | 3300053090 | Bacteria | 1288 |
| 1657 | Ga0500646_0351149 | 3300053090 | Bacteria | 537 |
| 1658 | Ga0500651_0353068 | 3300053093 | Bacteria | 834 |
| 1659 | Ga0500641_0000684 | 3300053096 | Bacteria | 12231 |
| 1660 | Ga0500650_0068634 | 3300053098 | Bacteria | 1657 |
| 1661 | Ga0500650_0080533 | 3300053098 | Bacteria | 1523 |
| 1662 | Ga0500654_077292 | 3300053099 | Bacteria | 1578 |
| 1663 | Ga0500555_041782 | 3300053103 | Bacteria | 1275 |
| 1664 | Ga0500556_0288197 | 3300053104 | Bacteria | 643 |
| 1665 | Ga0500557_157332 | 3300053105 | Bacteria | 746 |
| 1666 | Ga0500592_053054 | 3300053116 | Bacteria | 660 |
| 1667 | Ga0500594_0019853 | 3300053118 | Bacteria | 1669 |
| 1668 | Ga0500595_001661 | 3300053119 | Bacteria | 11694 |
| 1669 | Ga0500595_089684 | 3300053119 | Bacteria | 891 |
| 1670 | Ga0500595_101232 | 3300053119 | Bacteria | 825 |
| 1671 | Ga0500597_212073 | 3300053120 | Bacteria | 809 |
| 1672 | Ga0500621_124217 | 3300053126 | Bacteria | 996 |
| 1673 | Ga0500642_0001424 | 3300053130 | Bacteria | 6858 |
| 1674 | Ga0500642_0230453 | 3300053130 | Bacteria | 856 |
| 1675 | Ga0500658_0046521 | 3300053134 | Bacteria | 1757 |
| 1676 | Ga0500559_0164356 | 3300053136 | Bacteria | 1043 |
| 1677 | Ga0500559_0370957 | 3300053136 | Bacteria | 668 |
| 1678 | Ga0500568_0029142 | 3300053139 | Bacteria | 2293 |
| 1679 | Ga0500577_0059353 | 3300053142 | Bacteria | 1466 |
| 1680 | Ga0500577_0216954 | 3300053142 | Bacteria | 828 |
| 1681 | Ga0500588_0003321 | 3300053146 | Bacteria | 3381 |
| 1682 | Ga0500588_0133973 | 3300053146 | Bacteria | 884 |
| 1683 | Ga0500588_0202995 | 3300053146 | Bacteria | 735 |
| 1684 | Ga0500604_0016509 | 3300053151 | Bacteria | 2034 |
| 1685 | Ga0500604_0033041 | 3300053151 | Bacteria | 1528 |
| 1686 | Ga0500616_0002871 | 3300053153 | Bacteria | 13824 |
| 1687 | Ga0500619_222275 | 3300053154 | Bacteria | 629 |
| 1688 | Ga0500622_0047353 | 3300053156 | Bacteria | 2221 |
| 1689 | Ga0500622_0129144 | 3300053156 | Bacteria | 1217 |
| 1690 | Ga0500633_0148704 | 3300053160 | Bacteria | 878 |
| 1691 | Ga0500636_0445628 | 3300053177 | Bacteria | 587 |
| 1692 | Ga0500609_001079 | 3300053731 | Bacteria | 4070 |
| 1693 | Ga0500609_002556 | 3300053731 | Bacteria | 2592 |
| 1694 | Ga0500656_006057 | 3300053732 | Bacteria | 1215 |
| 1695 | Ga0500587_026309 | 3300053739 | Bacteria | 780 |
| 1696 | Ga0501084_0062068 | 3300054114 | Bacteria | 3129 |
| 1697 | Ga0501084_0066631 | 3300054114 | Bacteria | 3013 |
| 1698 | Ga0501084_0208090 | 3300054114 | Bacteria | 1650 |
| 1699 | Ga0501084_0230662 | 3300054114 | Bacteria | 1563 |
| 1700 | Ga0501084_0464415 | 3300054114 | Bacteria | 1070 |
| 1701 | Ga0501084_0804493 | 3300054114 | Bacteria | 792 |
| 1702 | Ga0501084_1121746 | 3300054114 | Bacteria | 660 |
| 1703 | Ga0501084_1130221 | 3300054114 | Bacteria | 657 |
| 1704 | Ga0501084_1360722 | 3300054114 | Bacteria | 595 |
| 1705 | Ga0590071_006547 | 3300059421 | Bacteria | 2769 |
| 1706 | Ga0590074_078193 | 3300059423 | Bacteria | 629 |
| 1707 | Ga0590075_010263 | 3300059424 | Bacteria | 2253 |
| 1708 | Ga0590077_016365 | 3300059426 | Bacteria | 1555 |
| 1709 | Ga0587084_059576 | 3300059477 | Bacteria | 697 |
| 1710 | Ga0587070_072652 | 3300059491 | Bacteria | 737 |
| 1711 | Ga0587073_0087772 | 3300059492 | Bacteria | 785 |
| 1712 | Ga0587080_052290 | 3300059503 | Bacteria | 775 |
| 1713 | Ga0587082_008975 | 3300059504 | Bacteria | 1408 |
| 1714 | Ga0587083_0072825 | 3300059505 | Bacteria | 801 |
| 1715 | Ga0587098_052953 | 3300059604 | Bacteria | 620 |
| 1716 | Ga0587076_084925 | 3300059645 | Bacteria | 682 |
| 1717 | Ga0587079_127439 | 3300059647 | Bacteria | 636 |
| 1718 | Ga0587114_026899 | 3300059655 | Bacteria | 854 |
| 1719 | Ga0587096_07987 | 3300060247 | Bacteria | 503 |
| 1720 | Ga0587111_0001675 | 3300060346 | Bacteria | 2755 |
| 1721 | Ga0587111_0074243 | 3300060346 | Bacteria | 800 |
| 1722 | Ga0501082_0016308 | 3300060353 | Bacteria | 6395 |
| 1723 | Ga0501082_0021073 | 3300060353 | Bacteria | 5621 |
| 1724 | Ga0501082_0069701 | 3300060353 | Bacteria | 3028 |
| 1725 | Ga0501082_0091200 | 3300060353 | Bacteria | 2631 |
| 1726 | Ga0501082_0119945 | 3300060353 | Bacteria | 2279 |
| 1727 | Ga0501082_0120716 | 3300060353 | Bacteria | 2272 |
| 1728 | Ga0501082_0208204 | 3300060353 | Bacteria | 1701 |
| 1729 | Ga0501082_0214341 | 3300060353 | Bacteria | 1675 |
| 1730 | Ga0501082_0356957 | 3300060353 | Bacteria | 1275 |
| 1731 | Ga0501082_0522514 | 3300060353 | Bacteria | 1038 |
| 1732 | Ga0501082_1161788 | 3300060353 | Bacteria | 675 |
| 1733 | Ga0466962_0043530 | 3300061719 | Bacteria | 2148 |
| 1734 | Ga0530510_0015198 | 3300061734 | Bacteria | 5436 |
| 1735 | Ga0530510_0480852 | 3300061734 | Bacteria | 941 |
| 1736 | Ga0530510_1071595 | 3300061734 | Unclassified | 617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0155823 | Ga0436360_0155823_2312_2599 | 90 |
| 2 | 3300039453 | Ga0436362_1063337 | Ga0436362_1063337_29_316 | 90 |
| 3 | 3300049823 | Ga0501044_1291788 | Ga0501044_1291788_16_303 | 90 |
| 4 | 3300049528 | Ga0501312_046864 | Ga0501312_046864_176_466 | 91 |
| 5 | 3300048929 | Ga0496126_0403954 | Ga0496126_0403954_763_1056 | 92 |
| 6 | iso_pu_bacteria | 2507262055 | 2507509769 | 92 |
| 7 | iso_pu_bacteria | 2508501009 | 2508543785 | 92 |
| 8 | iso_pu_bacteria | 2508501042 | 2508698427 | 92 |
| 9 | iso_pu_bacteria | 2508501122 | 2509112685 | 92 |
| 10 | iso_pu_bacteria | 2509276019 | 2509380425 | 92 |
| 11 | iso_pu_bacteria | 2510065057 | 2510308399 | 92 |
| 12 | iso_pu_bacteria | 2511231028 | 2511396969 | 92 |
| 13 | iso_pu_bacteria | 2511231052 | 2511501270 | 92 |
| 14 | iso_pu_bacteria | 2512875026 | 2512971976 | 92 |
| 15 | iso_pu_bacteria | 2513237086 | 2513587132 | 92 |
| 16 | iso_pu_bacteria | 2513237089 | 2513607079 | 92 |
| 17 | iso_pu_bacteria | 2513237091 | 2513620839 | 92 |
| 18 | iso_pu_bacteria | 2513237092 | 2513625281 | 92 |
| 19 | iso_pu_bacteria | 2513237094 | 2513644598 | 92 |
| 20 | iso_pu_bacteria | 2513237095 | 2513646165 | 92 |
| 21 | iso_pu_bacteria | 2513237096 | 2513658401 | 92 |
| 22 | iso_pu_bacteria | 2513237101 | 2513695928 | 92 |
| 23 | iso_pu_bacteria | 2513237102 | 2513701044 | 92 |
| 24 | iso_pu_bacteria | 2513237104 | 2513715007 | 92 |
| 25 | iso_pu_bacteria | 2513237137 | 2513857523 | 92 |
| 26 | iso_pu_bacteria | 2513237139 | 2513875847 | 92 |
| 27 | iso_pu_bacteria | 2513237140 | 2513886842 | 92 |
| 28 | iso_pu_bacteria | 2513237141 | 2513894240 | 92 |
| 29 | iso_pu_bacteria | 2513237143 | 2513906983 | 92 |
| 30 | iso_pu_bacteria | 2513237145 | 2513920107 | 92 |
| 31 | iso_pu_bacteria | 2513237156 | 2513987840 | 92 |
| 32 | iso_pu_bacteria | 2513237160 | 2514008881 | 92 |
| 33 | iso_pu_bacteria | 2513237161 | 2514011486 | 92 |
| 34 | iso_pu_bacteria | 2515154107 | 2515613330 | 92 |
| 35 | iso_pu_bacteria | 2515154112 | 2515630019 | 92 |
| 36 | iso_pu_bacteria | 2516143018 | 2516209148 | 92 |
| 37 | iso_pu_bacteria | 2516653046 | 2516892552 | 92 |
| 38 | iso_pu_bacteria | 2517093001 | 2517103531 | 92 |
| 39 | iso_pu_bacteria | 2517487022 | 2517569364 | 92 |
| 40 | iso_pu_bacteria | 2517572143 | 2517893476 | 92 |
| 41 | iso_pu_bacteria | 2524023205 | 2524441040 | 92 |
| 42 | iso_pu_bacteria | 2524023207 | 2524454327 | 92 |
| 43 | iso_pu_bacteria | 2524023250 | 2524609946 | 92 |
| 44 | iso_pu_bacteria | 2528768022 | 2528856452 | 92 |
| 45 | iso_pu_bacteria | 2551306084 | 2551678256 | 92 |
| 46 | iso_pu_bacteria | 2551306085 | 2551687647 | 92 |
| 47 | iso_pu_bacteria | 2551306086 | 2551695271 | 92 |
| 48 | iso_pu_bacteria | 2551306087 | 2551699383 | 92 |
| 49 | iso_pu_bacteria | 2551306089 | 2551711311 | 92 |
| 50 | iso_pu_bacteria | 2551306090 | 2551723058 | 92 |
| 51 | iso_pu_bacteria | 2551306091 | 2551728466 | 92 |
| 52 | iso_pu_bacteria | 2551306091 | 2551730897 | 92 |
| 53 | iso_pu_bacteria | 2551306092 | 2551733993 | 92 |
| 54 | iso_pu_bacteria | 2551306093 | 2551742265 | 92 |
| 55 | iso_pu_bacteria | 2558860100 | 2558863229 | 92 |
| 56 | iso_pu_bacteria | 2558860983 | 2561468204 | 92 |
| 57 | iso_pu_bacteria | 2602042107 | 2603859858 | 92 |
| 58 | iso_pu_bacteria | 2617270735 | 2617349293 | 92 |
| 59 | iso_pu_bacteria | 2617270741 | 2617378184 | 92 |
| 60 | iso_pu_bacteria | 2643221547 | 2643755792 | 92 |
| 61 | iso_pu_bacteria | 2657244999 | 2657686415 | 92 |
| 62 | iso_pu_bacteria | 2667528175 | 2671118114 | 92 |
| 63 | iso_pu_bacteria | 2690316117 | 2692316535 | 92 |
| 64 | iso_pu_bacteria | 2713897090 | 2715499428 | 92 |
| 65 | iso_pu_bacteria | 2744054633 | 2745082437 | 92 |
| 66 | iso_pu_bacteria | 2751185821 | 2753460136 | 92 |
| 67 | iso_pu_bacteria | 2791355082 | 2792581299 | 92 |
| 68 | iso_pu_bacteria | 2791355091 | 2792624835 | 92 |
| 69 | iso_pu_bacteria | 2791355092 | 2792630869 | 92 |
| 70 | iso_pu_bacteria | 2791355094 | 2792642399 | 92 |
| 71 | iso_pu_bacteria | 2791355196 | 2793060257 | 92 |
| 72 | iso_pu_bacteria | 2802428858 | 2802719377 | 92 |
| 73 | iso_pu_bacteria | 2802428859 | 2802723062 | 92 |
| 74 | iso_pu_bacteria | 2802428860 | 2802734753 | 92 |
| 75 | iso_pu_bacteria | 2802428861 | 2802741299 | 92 |
| 76 | iso_pu_bacteria | 2802428862 | 2802745048 | 92 |
| 77 | iso_pu_bacteria | 2802428863 | 2802751483 | 92 |
| 78 | iso_pu_bacteria | 2802429268 | 2804751745 | 92 |
| 79 | iso_pu_bacteria | 2802429603 | 2805917623 | 92 |
| 80 | iso_pu_bacteria | 2816332527 | 2818241496 | 92 |
| 81 | iso_pu_bacteria | 2824600985 | 2824602126 | 92 |
| 82 | iso_pu_bacteria | 2824609381 | 2824610114 | 92 |
| 83 | iso_pu_bacteria | 2824617872 | 2824620078 | 92 |
| 84 | iso_pu_bacteria | 2824626560 | 2824627711 | 92 |
| 85 | iso_pu_bacteria | 2824635225 | 2824636720 | 92 |
| 86 | iso_pu_bacteria | 2824644064 | 2824645013 | 92 |
| 87 | iso_pu_bacteria | 2824653114 | 2824654970 | 92 |
| 88 | iso_pu_bacteria | 2824661429 | 2824662368 | 92 |
| 89 | iso_pu_bacteria | 2824671348 | 2824672617 | 92 |
| 90 | iso_pu_bacteria | 2824679649 | 2824680833 | 92 |
| 91 | iso_pu_bacteria | 2824687955 | 2824689050 | 92 |
| 92 | iso_pu_bacteria | 2824696289 | 2824697417 | 92 |
| 93 | iso_pu_bacteria | 2824704595 | 2824706685 | 92 |
| 94 | iso_pu_bacteria | 2824714736 | 2824715425 | 92 |
| 95 | iso_pu_bacteria | 2824723954 | 2824724720 | 92 |
| 96 | iso_pu_bacteria | 2824732956 | 2824733548 | 92 |
| 97 | iso_pu_bacteria | 2824746037 | 2824746923 | 92 |
| 98 | iso_pu_bacteria | 2824753945 | 2824759427 | 92 |
| 99 | iso_pu_bacteria | 2824763712 | 2824769663 | 92 |
| 100 | iso_pu_bacteria | 2824773399 | 2824774026 | 92 |
| 101 | iso_pu_bacteria | 2834578030 | 2834579300 | 92 |
| 102 | iso_pu_bacteria | 2838074704 | 2838079219 | 92 |
| 103 | iso_pu_bacteria | 2838122688 | 2838130075 | 92 |
| 104 | iso_pu_bacteria | 2841941048 | 2841941232 | 92 |
| 105 | iso_pu_bacteria | 2841949485 | 2841952741 | 92 |
| 106 | iso_pu_bacteria | 2841957949 | 2841962254 | 92 |
| 107 | iso_pu_bacteria | 2841966195 | 2841967387 | 92 |
| 108 | iso_pu_bacteria | 2841974524 | 2841979215 | 92 |
| 109 | iso_pu_bacteria | 2841983080 | 2841990791 | 92 |
| 110 | iso_pu_bacteria | 2842038055 | 2842038631 | 92 |
| 111 | iso_pu_bacteria | 2842045827 | 2842048424 | 92 |
| 112 | iso_pu_bacteria | 2842775625 | 2842778826 | 92 |
| 113 | iso_pu_bacteria | 2844315083 | 2844318029 | 92 |
| 114 | iso_pu_bacteria | 2847417321 | 2847418399 | 92 |
| 115 | iso_pu_bacteria | 2847930680 | 2847934840 | 92 |
| 116 | iso_pu_bacteria | 2847939898 | 2847945405 | 92 |
| 117 | iso_pu_bacteria | 2848992105 | 2848993378 | 92 |
| 118 | iso_pu_bacteria | 2849076700 | 2849080407 | 92 |
| 119 | iso_pu_bacteria | 2850079185 | 2850081036 | 92 |
| 120 | iso_pu_bacteria | 2855825444 | 2855831622 | 92 |
| 121 | iso_pu_bacteria | 2855839649 | 2855840740 | 92 |
| 122 | iso_pu_bacteria | 2855872281 | 2855873436 | 92 |
| 123 | iso_pu_bacteria | 2857509624 | 2857510240 | 92 |
| 124 | iso_pu_bacteria | 2857524615 | 2857528506 | 92 |
| 125 | iso_pu_bacteria | 2858800743 | 2858801267 | 92 |
| 126 | iso_pu_bacteria | 2874590934 | 2874595122 | 92 |
| 127 | iso_pu_bacteria | 2874604998 | 2874610930 | 92 |
| 128 | iso_pu_bacteria | 2874612657 | 2874615645 | 92 |
| 129 | iso_pu_bacteria | 2874620515 | 2874621668 | 92 |
| 130 | iso_pu_bacteria | 2874645413 | 2874650983 | 92 |
| 131 | iso_pu_bacteria | 2876761206 | 2876765737 | 92 |
| 132 | iso_pu_bacteria | 2876771140 | 2876775058 | 92 |
| 133 | iso_pu_bacteria | 2876808645 | 2876810444 | 92 |
| 134 | iso_pu_bacteria | 2876818435 | 2876823873 | 92 |
| 135 | iso_pu_bacteria | 2879074833 | 2879080501 | 92 |
| 136 | iso_pu_bacteria | 2879083081 | 2879089287 | 92 |
| 137 | iso_pu_bacteria | 2879099564 | 2879109349 | 92 |
| 138 | iso_pu_bacteria | 2879110137 | 2879110543 | 92 |
| 139 | iso_pu_bacteria | 2879127579 | 2879134893 | 92 |
| 140 | iso_pu_bacteria | 2879142872 | 2879149204 | 92 |
| 141 | iso_pu_bacteria | 2881364244 | 2881366234 | 92 |
| 142 | iso_pu_bacteria | 2881665667 | 2881671575 | 92 |
| 143 | iso_pu_bacteria | 2883291878 | 2883294824 | 92 |
| 144 | iso_pu_bacteria | 2883354860 | 2883356690 | 92 |
| 145 | iso_pu_bacteria | 2883577096 | 2883581689 | 92 |
| 146 | iso_pu_bacteria | 2885366525 | 2885372827 | 92 |
| 147 | iso_pu_bacteria | 2885374607 | 2885380937 | 92 |
| 148 | iso_pu_bacteria | 2885409591 | 2885413050 | 92 |
| 149 | iso_pu_bacteria | 2888378607 | 2888382826 | 92 |
| 150 | iso_pu_bacteria | 2888388044 | 2888394974 | 92 |
| 151 | iso_pu_bacteria | 2888419890 | 2888423305 | 92 |
| 152 | iso_pu_bacteria | 2896384573 | 2896386890 | 92 |
| 153 | iso_pu_bacteria | 2898795034 | 2898796980 | 92 |
| 154 | iso_pu_bacteria | 2899275550 | 2899277167 | 92 |
| 155 | iso_pu_bacteria | 2903727486 | 2903729662 | 92 |
| 156 | iso_pu_bacteria | 2904666416 | 2904668615 | 92 |
| 157 | iso_pu_bacteria | 2904690495 | 2904696904 | 92 |
| 158 | iso_pu_bacteria | 2904711408 | 2904716663 | 92 |
| 159 | iso_pu_bacteria | 2906602504 | 2906605810 | 92 |
| 160 | iso_pu_bacteria | 2906635258 | 2906642776 | 92 |
| 161 | iso_pu_bacteria | 2906643746 | 2906644207 | 92 |
| 162 | iso_pu_bacteria | 2906660503 | 2906665911 | 92 |
| 163 | iso_pu_bacteria | 2908739725 | 2908743882 | 92 |
| 164 | iso_pu_bacteria | 2908756301 | 2908761480 | 92 |
| 165 | iso_pu_bacteria | 2908775508 | 2908778948 | 92 |
| 166 | iso_pu_bacteria | 2909399089 | 2909399547 | 92 |
| 167 | iso_pu_bacteria | 2913295892 | 2913301779 | 92 |
| 168 | iso_pu_bacteria | 2915980308 | 2915985670 | 92 |
| 169 | iso_pu_bacteria | 2915986958 | 2915991799 | 92 |
| 170 | iso_pu_bacteria | 2915993759 | 2916000602 | 92 |
| 171 | iso_pu_bacteria | 2916000859 | 2916007566 | 92 |
| 172 | iso_pu_bacteria | 2916007675 | 2916008884 | 92 |
| 173 | iso_pu_bacteria | 2916014648 | 2916018777 | 92 |
| 174 | iso_pu_bacteria | 2916021584 | 2916026385 | 92 |
| 175 | iso_pu_bacteria | 2916028427 | 2916034648 | 92 |
| 176 | iso_pu_bacteria | 2916035215 | 2916040629 | 92 |
| 177 | iso_pu_bacteria | 2916041962 | 2916048203 | 92 |
| 178 | iso_pu_bacteria | 2916048683 | 2916054392 | 92 |
| 179 | iso_pu_bacteria | 2916055098 | 2916060801 | 92 |
| 180 | iso_pu_bacteria | 2916061851 | 2916068165 | 92 |
| 181 | iso_pu_bacteria | 2916068649 | 2916075019 | 92 |
| 182 | iso_pu_bacteria | 2916076590 | 2916078671 | 92 |
| 183 | iso_pu_bacteria | 2919073203 | 2919076129 | 92 |
| 184 | iso_pu_bacteria | 2919679072 | 2919682198 | 92 |
| 185 | iso_pu_bacteria | 2920760137 | 2920765477 | 92 |
| 186 | iso_pu_bacteria | 2921201388 | 2921208180 | 92 |
| 187 | iso_pu_bacteria | 2921208531 | 2921209427 | 92 |
| 188 | iso_pu_bacteria | 2921237296 | 2921242269 | 92 |
| 189 | iso_pu_bacteria | 2921244191 | 2921248070 | 92 |
| 190 | iso_pu_bacteria | 2921250672 | 2921256120 | 92 |
| 191 | iso_pu_bacteria | 2921257292 | 2921263456 | 92 |
| 192 | iso_pu_bacteria | 2921263974 | 2921270093 | 92 |
| 193 | iso_pu_bacteria | 2921282425 | 2921285911 | 92 |
| 194 | iso_pu_bacteria | 2921289301 | 2921296760 | 92 |
| 195 | iso_pu_bacteria | 2921296804 | 2921299129 | 92 |
| 196 | iso_pu_bacteria | 2922368715 | 2922375214 | 92 |
| 197 | iso_pu_bacteria | 2922393267 | 2922395234 | 92 |
| 198 | iso_pu_bacteria | 2924144063 | 2924147665 | 92 |
| 199 | iso_pu_bacteria | 2924150972 | 2924157722 | 92 |
| 200 | iso_pu_bacteria | 2924158325 | 2924165047 | 92 |
| 201 | iso_pu_bacteria | 2924165586 | 2924172867 | 92 |
| 202 | iso_pu_bacteria | 2924172951 | 2924179192 | 92 |
| 203 | iso_pu_bacteria | 2924179722 | 2924184587 | 92 |
| 204 | iso_pu_bacteria | 2924186466 | 2924192971 | 92 |
| 205 | iso_pu_bacteria | 2924193448 | 2924199581 | 92 |
| 206 | iso_pu_bacteria | 2924200457 | 2924204257 | 92 |
| 207 | iso_pu_bacteria | 2924207177 | 2924213331 | 92 |
| 208 | iso_pu_bacteria | 2924214083 | 2924214803 | 92 |
| 209 | iso_pu_bacteria | 2924221636 | 2924221988 | 92 |
| 210 | iso_pu_bacteria | 2924228884 | 2924233680 | 92 |
| 211 | iso_pu_bacteria | 2929615660 | 2929615902 | 92 |
| 212 | iso_pu_bacteria | 2929624759 | 2929630515 | 92 |
| 213 | iso_pu_bacteria | 2932784394 | 2932792460 | 92 |
| 214 | iso_pu_bacteria | 2932794094 | 2932800394 | 92 |
| 215 | iso_pu_bacteria | 2932801729 | 2932804567 | 92 |
| 216 | iso_pu_bacteria | 2932809354 | 2932813959 | 92 |
| 217 | iso_pu_bacteria | 2932818245 | 2932819529 | 92 |
| 218 | iso_pu_bacteria | 2932828146 | 2932833765 | 92 |
| 219 | iso_pu_bacteria | 2933577622 | 2933578812 | 92 |
| 220 | iso_pu_bacteria | 2935608549 | 2935611372 | 92 |
| 221 | iso_pu_bacteria | 2935616580 | 2935618731 | 92 |
| 222 | iso_pu_bacteria | 2935630451 | 2935637737 | 92 |
| 223 | iso_pu_bacteria | 2935638405 | 2935644429 | 92 |
| 224 | iso_pu_bacteria | 2935648319 | 2935648756 | 92 |
| 225 | iso_pu_bacteria | 2935656913 | 2935657161 | 92 |
| 226 | iso_pu_bacteria | 2935665750 | 2935674167 | 92 |
| 227 | iso_pu_bacteria | 2935675223 | 2935678551 | 92 |
| 228 | iso_pu_bacteria | 2935684952 | 2935687952 | 92 |
| 229 | iso_pu_bacteria | 2935694250 | 2935701436 | 92 |
| 230 | iso_pu_bacteria | 2935703347 | 2935708286 | 92 |
| 231 | iso_pu_bacteria | 2935713505 | 2935714972 | 92 |
| 232 | iso_pu_bacteria | 2935722832 | 2935726463 | 92 |
| 233 | iso_pu_bacteria | 2935732158 | 2935733790 | 92 |
| 234 | iso_pu_bacteria | 2935741537 | 2935743169 | 92 |
| 235 | iso_pu_bacteria | 2935750917 | 2935754792 | 92 |
| 236 | iso_pu_bacteria | 2935760218 | 2935765500 | 92 |
| 237 | iso_pu_bacteria | 2935769743 | 2935775253 | 92 |
| 238 | iso_pu_bacteria | 2935777560 | 2935779547 | 92 |
| 239 | iso_pu_bacteria | 2935785616 | 2935791549 | 92 |
| 240 | iso_pu_bacteria | 2935793552 | 2935799861 | 92 |
| 241 | iso_pu_bacteria | 2935801545 | 2935805453 | 92 |
| 242 | iso_pu_bacteria | 2935810662 | 2935816747 | 92 |
| 243 | iso_pu_bacteria | 2935819856 | 2935820849 | 92 |
| 244 | iso_pu_bacteria | 2935827899 | 2935833822 | 92 |
| 245 | iso_pu_bacteria | 2935837841 | 2935839493 | 92 |
| 246 | iso_pu_bacteria | 2935847175 | 2935850891 | 92 |
| 247 | iso_pu_bacteria | 2935855204 | 2935857096 | 92 |
| 248 | iso_pu_bacteria | 2935864058 | 2935864640 | 92 |
| 249 | iso_pu_bacteria | 2935873716 | 2935876418 | 92 |
| 250 | iso_pu_bacteria | 2935883170 | 2935889761 | 92 |
| 251 | iso_pu_bacteria | 2935908558 | 2935913742 | 92 |
| 252 | iso_pu_bacteria | 2935916978 | 2935920268 | 92 |
| 253 | iso_pu_bacteria | 2935926038 | 2935930607 | 92 |
| 254 | iso_pu_bacteria | 2935934488 | 2935939420 | 92 |
| 255 | iso_pu_bacteria | 2935942939 | 2935946369 | 92 |
| 256 | iso_pu_bacteria | 2935951376 | 2935955792 | 92 |
| 257 | iso_pu_bacteria | 2935959822 | 2935966948 | 92 |
| 258 | iso_pu_bacteria | 2935967501 | 2935972498 | 92 |
| 259 | iso_pu_bacteria | 2935975950 | 2935981671 | 92 |
| 260 | iso_pu_bacteria | 2935984226 | 2935991046 | 92 |
| 261 | iso_pu_bacteria | 2935992306 | 2935997613 | 92 |
| 262 | iso_pu_bacteria | 2936002035 | 2936007131 | 92 |
| 263 | iso_pu_bacteria | 2936011229 | 2936011666 | 92 |
| 264 | iso_pu_bacteria | 2936019824 | 2936020261 | 92 |
| 265 | iso_pu_bacteria | 2936028420 | 2936028956 | 92 |
| 266 | iso_pu_bacteria | 2936037263 | 2936042991 | 92 |
| 267 | iso_pu_bacteria | 2936046547 | 2936046984 | 92 |
| 268 | iso_pu_bacteria | 2936055302 | 2936058136 | 92 |
| 269 | iso_pu_bacteria | 2936996657 | 2937001415 | 92 |
| 270 | iso_pu_bacteria | 2937002841 | 2937008149 | 92 |
| 271 | iso_pu_bacteria | 2937009748 | 2937015643 | 92 |
| 272 | iso_pu_bacteria | 2937016420 | 2937019597 | 92 |
| 273 | iso_pu_bacteria | 2937023124 | 2937028372 | 92 |
| 274 | iso_pu_bacteria | 2937029754 | 2937034846 | 92 |
| 275 | iso_pu_bacteria | 2937036028 | 2937040788 | 92 |
| 276 | iso_pu_bacteria | 2937042894 | 2937049361 | 92 |
| 277 | iso_pu_bacteria | 2937049772 | 2937056387 | 92 |
| 278 | iso_pu_bacteria | 2937056579 | 2937060866 | 92 |
| 279 | iso_pu_bacteria | 2937063883 | 2937069360 | 92 |
| 280 | iso_pu_bacteria | 2937071275 | 2937076550 | 92 |
| 281 | iso_pu_bacteria | 2937078374 | 2937079347 | 92 |
| 282 | iso_pu_bacteria | 2937084907 | 2937088452 | 92 |
| 283 | iso_pu_bacteria | 2937091812 | 2937096834 | 92 |
| 284 | iso_pu_bacteria | 2937098957 | 2937105917 | 92 |
| 285 | iso_pu_bacteria | 2937106411 | 2937113067 | 92 |
| 286 | iso_pu_bacteria | 2937113482 | 2937118553 | 92 |
| 287 | iso_pu_bacteria | 2937119839 | 2937125241 | 92 |
| 288 | iso_pu_bacteria | 2937126314 | 2937129966 | 92 |
| 289 | iso_pu_bacteria | 2940556831 | 2940559831 | 92 |
| 290 | iso_pu_bacteria | 2941507105 | 2941514410 | 92 |
| 291 | iso_pu_bacteria | 2941515067 | 2941522306 | 92 |
| 292 | iso_pu_bacteria | 2941523033 | 2941530175 | 92 |
| 293 | iso_pu_bacteria | 2941531003 | 2941536079 | 92 |
| 294 | iso_pu_bacteria | 2941538514 | 2941540182 | 92 |
| 295 | iso_pu_bacteria | 2957375807 | 2957377134 | 92 |
| 296 | iso_pu_bacteria | 2957382221 | 2957385714 | 92 |
| 297 | iso_pu_bacteria | 2957388812 | 2957388837 | 92 |
| 298 | iso_pu_bacteria | 2957395598 | 2957401727 | 92 |
| 299 | iso_pu_bacteria | 2957402308 | 2957406443 | 92 |
| 300 | iso_pu_bacteria | 2957408893 | 2957414196 | 92 |
| 301 | iso_pu_bacteria | 2957415311 | 2957418170 | 92 |
| 302 | iso_pu_bacteria | 2957422303 | 2957429135 | 92 |
| 303 | iso_pu_bacteria | 2957430029 | 2957435564 | 92 |
| 304 | iso_pu_bacteria | 2957437181 | 2957443032 | 92 |
| 305 | iso_pu_bacteria | 2957443900 | 2957449777 | 92 |
| 306 | iso_pu_bacteria | 2957450854 | 2957453200 | 92 |
| 307 | iso_pu_bacteria | 2957457609 | 2957464200 | 92 |
| 308 | iso_pu_bacteria | 2957464669 | 2957468118 | 92 |
| 309 | iso_pu_bacteria | 2957471148 | 2957477677 | 92 |
| 310 | iso_pu_bacteria | 2957478035 | 2957483696 | 92 |
| 311 | iso_pu_bacteria | 2957484790 | 2957491287 | 92 |
| 312 | iso_pu_bacteria | 2957491536 | 2957496676 | 92 |
| 313 | iso_pu_bacteria | 2957498199 | 2957504894 | 92 |
| 314 | iso_pu_bacteria | 2957505466 | 2957512928 | 92 |
| 315 | iso_pu_bacteria | 2960584000 | 2960586006 | 92 |
| 316 | iso_pu_bacteria | 2960591022 | 2960593521 | 92 |
| 317 | iso_pu_bacteria | 2960597568 | 2960602384 | 92 |
| 318 | iso_pu_bacteria | 2960603979 | 2960608997 | 92 |
| 319 | iso_pu_bacteria | 2960610863 | 2960616766 | 92 |
| 320 | iso_pu_bacteria | 2960617483 | 2960623099 | 92 |
| 321 | iso_pu_bacteria | 2960624210 | 2960630978 | 92 |
| 322 | iso_pu_bacteria | 2960631154 | 2960636894 | 92 |
| 323 | iso_pu_bacteria | 2960637947 | 2960639644 | 92 |
| 324 | iso_pu_bacteria | 2960645483 | 2960652509 | 92 |
| 325 | iso_pu_bacteria | 2960652885 | 2960655269 | 92 |
| 326 | iso_pu_bacteria | 2960660292 | 2960666654 | 92 |
| 327 | iso_pu_bacteria | 2960667422 | 2960673105 | 92 |
| 328 | iso_pu_bacteria | 2960674078 | 2960677297 | 92 |
| 329 | iso_pu_bacteria | 2960680706 | 2960686303 | 92 |
| 330 | iso_pu_bacteria | 2960687367 | 2960693518 | 92 |
| 331 | iso_pu_bacteria | 2960693952 | 2960700505 | 92 |
| 332 | iso_pu_bacteria | 2964607997 | 2964611281 | 92 |
| 333 | iso_pu_bacteria | 2964615318 | 2964621256 | 92 |
| 334 | iso_pu_bacteria | 2964621998 | 2964626446 | 92 |
| 335 | iso_pu_bacteria | 2964628898 | 2964635552 | 92 |
| 336 | iso_pu_bacteria | 2964636051 | 2964641215 | 92 |
| 337 | iso_pu_bacteria | 2964643177 | 2964647062 | 92 |
| 338 | iso_pu_bacteria | 2964649959 | 2964655515 | 92 |
| 339 | iso_pu_bacteria | 2964656573 | 2964661950 | 92 |
| 340 | iso_pu_bacteria | 2964663802 | 2964670119 | 92 |
| 341 | iso_pu_bacteria | 2964670856 | 2964677222 | 92 |
| 342 | iso_pu_bacteria | 2964678106 | 2964684934 | 92 |
| 343 | iso_pu_bacteria | 2964685014 | 2964691768 | 92 |
| 344 | iso_pu_bacteria | 2964691889 | 2964698505 | 92 |
| 345 | iso_pu_bacteria | 2964698721 | 2964703423 | 92 |
| 346 | iso_pu_bacteria | 2964705432 | 2964710558 | 92 |
| 347 | iso_pu_bacteria | 2964712639 | 2964713689 | 92 |
| 348 | iso_pu_bacteria | 2964719344 | 2964721089 | 92 |
| 349 | iso_pu_bacteria | 2967664464 | 2967671051 | 92 |
| 350 | iso_pu_bacteria | 2967671571 | 2967672375 | 92 |
| 351 | iso_pu_bacteria | 2967678726 | 2967683411 | 92 |
| 352 | iso_pu_bacteria | 2967686174 | 2967692231 | 92 |
| 353 | iso_pu_bacteria | 2967693043 | 2967694499 | 92 |
| 354 | iso_pu_bacteria | 2967699805 | 2967702493 | 92 |
| 355 | iso_pu_bacteria | 2967706974 | 2967714197 | 92 |
| 356 | iso_pu_bacteria | 2967714385 | 2967718840 | 92 |
| 357 | iso_pu_bacteria | 2967721400 | 2967726174 | 92 |
| 358 | iso_pu_bacteria | 2967728569 | 2967729654 | 92 |
| 359 | iso_pu_bacteria | 2967735183 | 2967739546 | 92 |
| 360 | iso_pu_bacteria | 2967742019 | 2967745162 | 92 |
| 361 | iso_pu_bacteria | 2967748971 | 2967754767 | 92 |
| 362 | iso_pu_bacteria | 2967755722 | 2967762224 | 92 |
| 363 | iso_pu_bacteria | 2967762386 | 2967766742 | 92 |
| 364 | iso_pu_bacteria | 2967769361 | 2967775202 | 92 |
| 365 | iso_pu_bacteria | 2967775926 | 2967782611 | 92 |
| 366 | iso_pu_bacteria | 2970019648 | 2970026359 | 92 |
| 367 | iso_pu_bacteria | 2970026789 | 2970033118 | 92 |
| 368 | iso_pu_bacteria | 2970033650 | 2970034151 | 92 |
| 369 | iso_pu_bacteria | 2970040964 | 2970046973 | 92 |
| 370 | iso_pu_bacteria | 2970047711 | 2970051792 | 92 |
| 371 | iso_pu_bacteria | 2970054988 | 2970060503 | 92 |
| 372 | iso_pu_bacteria | 2970061556 | 2970062284 | 92 |
| 373 | iso_pu_bacteria | 2970068827 | 2970069234 | 92 |
| 374 | iso_pu_bacteria | 2970076120 | 2970079544 | 92 |
| 375 | iso_pu_bacteria | 2970082768 | 2970086674 | 92 |
| 376 | iso_pu_bacteria | 2970088815 | 2970091741 | 92 |
| 377 | iso_pu_bacteria | 2970095765 | 2970102542 | 92 |
| 378 | iso_pu_bacteria | 2970102677 | 2970107854 | 92 |
| 379 | iso_pu_bacteria | 2970109326 | 2970115553 | 92 |
| 380 | iso_pu_bacteria | 2970116247 | 2970120779 | 92 |
| 381 | iso_pu_bacteria | 2970122695 | 2970128522 | 92 |
| 382 | iso_pu_bacteria | 2970129317 | 2970129811 | 92 |
| 383 | iso_pu_bacteria | 2970136068 | 2970143454 | 92 |
| 384 | iso_pu_bacteria | 2970143518 | 2970149808 | 92 |
| 385 | iso_pu_bacteria | 2970149975 | 2970156339 | 92 |
| 386 | iso_pu_bacteria | 2970156795 | 2970158344 | 92 |
| 387 | iso_pu_bacteria | 2970164137 | 2970167604 | 92 |
| 388 | iso_pu_bacteria | 2970170962 | 2970173591 | 92 |
| 389 | iso_pu_bacteria | 2970177841 | 2970178670 | 92 |
| 390 | iso_pu_bacteria | 2970184632 | 2970190744 | 92 |
| 391 | iso_pu_bacteria | 2970191845 | 2970198219 | 92 |
| 392 | iso_pu_bacteria | 2977516862 | 2977520505 | 92 |
| 393 | iso_pu_bacteria | 2977523885 | 2977530228 | 92 |
| 394 | iso_pu_bacteria | 2977530762 | 2977532342 | 92 |
| 395 | iso_pu_bacteria | 2977537788 | 2977541444 | 92 |
| 396 | iso_pu_bacteria | 2977544691 | 2977551375 | 92 |
| 397 | iso_pu_bacteria | 2977551784 | 2977557502 | 92 |
| 398 | iso_pu_bacteria | 2977558990 | 2977559961 | 92 |
| 399 | iso_pu_bacteria | 2977565890 | 2977569826 | 92 |
| 400 | iso_pu_bacteria | 2977572785 | 2977578822 | 92 |
| 401 | iso_pu_bacteria | 2977579622 | 2977583940 | 92 |
| 402 | iso_pu_bacteria | 2996310559 | 2996310962 | 92 |
| 403 | iso_pu_bacteria | 3005474847 | 3005479145 | 92 |
| 404 | iso_pu_bacteria | 3005483717 | 3005488154 | 92 |
| 405 | iso_pu_bacteria | 3005506211 | 3005512698 | 92 |
| 406 | iso_pu_bacteria | 3005587118 | 3005590464 | 92 |
| 407 | iso_pu_bacteria | 3005594810 | 3005598079 | 92 |
| 408 | iso_pu_bacteria | 3005718088 | 3005721269 | 92 |
| 409 | iso_pu_bacteria | 643348555 | 643392487 | 92 |
| 410 | iso_pu_bacteria | 643692032 | 643825409 | 92 |
| 411 | iso_pu_bacteria | 648276728 | 648741351 | 92 |
| 412 | iso_pu_bacteria | 8003992118 | 8003993238 | 92 |
| 413 | iso_pu_bacteria | 8003999396 | 8004000495 | 92 |
| 414 | iso_pu_bacteria | 8006926726 | 8006930386 | 92 |
| 415 | iso_pu_bacteria | 8006984368 | 8006986867 | 92 |
| 416 | iso_pu_bacteria | 8006994254 | 8006996086 | 92 |
| 417 | iso_pu_bacteria | 8016511872 | 8016514672 | 92 |
| 418 | iso_pu_bacteria | 8016522445 | 8016530771 | 92 |
| 419 | iso_pu_bacteria | 8016530956 | 8016536062 | 92 |
| 420 | iso_pu_bacteria | 8016539877 | 8016540341 | 92 |
| 421 | iso_pu_bacteria | 8016548790 | 8016552889 | 92 |
| 422 | iso_pu_bacteria | 8016557553 | 8016561268 | 92 |
| 423 | iso_pu_bacteria | 8016566248 | 8016574408 | 92 |
| 424 | iso_pu_bacteria | 8016575299 | 8016578506 | 92 |
| 425 | iso_pu_bacteria | 8016595262 | 8016599125 | 92 |
| 426 | iso_pu_bacteria | 8016603502 | 8016611923 | 92 |
| 427 | iso_pu_bacteria | 8016613128 | 8016621881 | 92 |
| 428 | iso_pu_bacteria | 8016622563 | 8016627973 | 92 |
| 429 | iso_pu_bacteria | 8016630954 | 8016632296 | 92 |
| 430 | iso_pu_bacteria | 8017057580 | 8017061762 | 92 |
| 431 | iso_pu_bacteria | 8019530166 | 8019535788 | 92 |
| 432 | iso_pu_bacteria | 8019538911 | 8019543691 | 92 |
| 433 | iso_pu_bacteria | 8019547302 | 8019555081 | 92 |
| 434 | iso_pu_bacteria | 8019576017 | 8019581262 | 92 |
| 435 | iso_pu_bacteria | 8019586578 | 8019588889 | 92 |
| 436 | iso_pu_bacteria | 8019597564 | 8019602345 | 92 |
| 437 | iso_pu_bacteria | 8019608314 | 8019616216 | 92 |
| 438 | iso_pu_bacteria | 8019619141 | 8019626836 | 92 |
| 439 | iso_pu_bacteria | 8019629233 | 8019635676 | 92 |
| 440 | iso_pu_bacteria | 8019638758 | 8019644009 | 92 |
| 441 | iso_pu_bacteria | 8019648815 | 8019657006 | 92 |
| 442 | iso_pu_bacteria | 8019659431 | 8019663473 | 92 |
| 443 | iso_pu_bacteria | 8019668869 | 8019673086 | 92 |
| 444 | iso_pu_bacteria | 8019687851 | 8019688751 | 92 |
| 445 | iso_pu_bacteria | 8049293176 | 8049294290 | 92 |
| 446 | iso_pu_bacteria | 8055742211 | 8055747549 | 92 |
| 447 | iso_pu_bacteria | 8056689827 | 8056691241 | 92 |
| 448 | iso_pu_bacteria | 8056967851 | 8056972375 | 92 |
| 449 | iso_pu_bacteria | 8057132660 | 8057134780 | 92 |
| 450 | 3300005327 | Ga0070658_10322637 | Ga0070658_103226373 | 93 |
| 451 | 3300005455 | Ga0070663_101907264 | Ga0070663_1019072642 | 93 |
| 452 | 3300005458 | Ga0070681_11741244 | Ga0070681_117412442 | 93 |
| 453 | 3300005530 | Ga0070679_100373412 | Ga0070679_1003734122 | 93 |
| 454 | 3300005539 | Ga0068853_102080199 | Ga0068853_1020801991 | 93 |
| 455 | 3300013104 | Ga0157370_10620972 | Ga0157370_106209722 | 93 |
| 456 | 3300013105 | Ga0157369_12306567 | Ga0157369_123065672 | 93 |
| 457 | 3300025909 | Ga0207705_10462889 | Ga0207705_104628892 | 93 |
| 458 | 3300031249 | Ga0265339_10078316 | Ga0265339_100783162 | 93 |
| 459 | 3300037312 | Ga0395899_0439057 | Ga0395899_0439057_512_817 | 93 |
| 460 | 3300037418 | Ga0395900_0803481 | Ga0395900_0803481_157_462 | 93 |
| 461 | 3300037466 | Ga0395898_0007760 | Ga0395898_0007760_8680_8985 | 93 |
| 462 | 3300049568 | Ga0501031_0304347 | Ga0501031_0304347_66_371 | 93 |
| 463 | 3300049570 | Ga0501033_0206968 | Ga0501033_0206968_475_780 | 93 |
| 464 | 3300049571 | Ga0501034_0000208 | Ga0501034_0000208_35378_35683 | 93 |
| 465 | 3300049571 | Ga0501034_0009460 | Ga0501034_0009460_2480_2785 | 93 |
| 466 | 3300049571 | Ga0501034_0331645 | Ga0501034_0331645_194_499 | 93 |
| 467 | 3300049572 | Ga0501036_0050702 | Ga0501036_0050702_676_981 | 93 |
| 468 | 3300049573 | Ga0501037_0007990 | Ga0501037_0007990_1654_1959 | 93 |
| 469 | 3300049574 | Ga0501038_0009962 | Ga0501038_0009962_1706_2011 | 93 |
| 470 | 3300049575 | Ga0501039_0000072 | Ga0501039_0000072_66545_66850 | 93 |
| 471 | 3300049579 | Ga0501043_0983070 | Ga0501043_0983070_156_461 | 93 |
| 472 | 3300049580 | Ga0501046_0004977 | Ga0501046_0004977_4445_4750 | 93 |
| 473 | 3300049580 | Ga0501046_0083492 | Ga0501046_0083492_1637_1942 | 93 |
| 474 | 3300049581 | Ga0501047_0001212 | Ga0501047_0001212_15370_15675 | 93 |
| 475 | 3300049581 | Ga0501047_0154693 | Ga0501047_0154693_890_1195 | 93 |
| 476 | 3300049581 | Ga0501047_0415754 | Ga0501047_0415754_74_379 | 93 |
| 477 | 3300049583 | Ga0501067_0001590 | Ga0501067_0001590_583_888 | 93 |
| 478 | 3300049586 | Ga0501070_0068712 | Ga0501070_0068712_774_1079 | 93 |
| 479 | 3300049586 | Ga0501070_0348364 | Ga0501070_0348364_780_1085 | 93 |
| 480 | 3300049589 | Ga0501073_0025762 | Ga0501073_0025762_25_330 | 93 |
| 481 | 3300049589 | Ga0501073_0229610 | Ga0501073_0229610_505_810 | 93 |
| 482 | 3300049589 | Ga0501073_0529454 | Ga0501073_0529454_255_560 | 93 |
| 483 | 3300049742 | Ga0501080_0000005 | Ga0501080_0000005_159702_160007 | 93 |
| 484 | 3300049822 | Ga0501035_0000049 | Ga0501035_0000049_38846_39151 | 93 |
| 485 | 3300049822 | Ga0501035_0084852 | Ga0501035_0084852_955_1260 | 93 |
| 486 | 3300049823 | Ga0501044_0000030 | Ga0501044_0000030_66606_66911 | 93 |
| 487 | 3300049823 | Ga0501044_0099821 | Ga0501044_0099821_536_841 | 93 |
| 488 | 3300049824 | Ga0501045_0037773 | Ga0501045_0037773_1089_1394 | 93 |
| 489 | 3300053090 | Ga0500646_0351149 | Ga0500646_0351149_210_506 | 93 |
| 490 | 3300060353 | Ga0501082_0021073 | Ga0501082_0021073_3499_3804 | 93 |
| 491 | 3300006847 | Ga0075431_101210725 | Ga0075431_1012107252 | 95 |
| 492 | 3300035091 | Ga0373951_0144568 | Ga0373951_0144568_210_515 | 95 |
| 493 | 3300035691 | Ga0373931_0545513 | Ga0373931_0545513_205_510 | 95 |
| 494 | 3300039437 | Ga0436365_1302455 | Ga0436365_1302455_124_429 | 95 |
| 495 | 3300048907 | Ga0496104_0156871 | Ga0496104_0156871_1537_1842 | 95 |
| 496 | 3300048908 | Ga0496105_0294096 | Ga0496105_0294096_550_855 | 95 |
| 497 | 3300048911 | Ga0496108_0266859 | Ga0496108_0266859_486_791 | 95 |
| 498 | 3300000041 | ARcpr5oldR_c000035 | ARcpr5oldR_00003523 | 96 |
| 499 | 3300000042 | ARSoilYngRDRAFT_c00061 | ARSoilYngRDRAFT_0006116 | 96 |
| 500 | 3300000043 | ARcpr5yngRDRAFT_c000075 | ARcpr5yngRDRAFT_00007511 | 96 |
| 501 | 3300000044 | ARSoilOldRDRAFT_c000053 | ARSoilOldRDRAFT_00005311 | 96 |
| 502 | 3300000652 | ARCol0yngRDRAFT_1000025 | ARCol0yngRDRAFT_100002515 | 96 |
| 503 | 3300001990 | JGI24737J22298_10005496 | JGI24737J22298_100054967 | 96 |
| 504 | 3300003214 | JGI25165J46597_1034619 | JGI25165J46597_10346191 | 96 |
| 505 | 3300003349 | JGI26129J50193_1002889 | JGI26129J50193_10028892 | 96 |
| 506 | 3300004799 | Ga0058863_11612769 | Ga0058863_116127692 | 96 |
| 507 | 3300004800 | Ga0058861_11519652 | Ga0058861_115196521 | 96 |
| 508 | 3300005276 | Ga0065717_1003757 | Ga0065717_10037572 | 96 |
| 509 | 3300005277 | Ga0065716_1001741 | Ga0065716_10017413 | 96 |
| 510 | 3300005288 | Ga0065714_10430914 | Ga0065714_104309142 | 96 |
| 511 | 3300005290 | Ga0065712_10099639 | Ga0065712_100996395 | 96 |
| 512 | 3300005290 | Ga0065712_10725715 | Ga0065712_107257151 | 96 |
| 513 | 3300005293 | Ga0065715_10002477 | Ga0065715_1000247711 | 96 |
| 514 | 3300005295 | Ga0065707_10107090 | Ga0065707_101070903 | 96 |
| 515 | 3300005327 | Ga0070658_10137105 | Ga0070658_101371052 | 96 |
| 516 | 3300005327 | Ga0070658_11200369 | Ga0070658_112003692 | 96 |
| 517 | 3300005328 | Ga0070676_10287217 | Ga0070676_102872172 | 96 |
| 518 | 3300005328 | Ga0070676_10477116 | Ga0070676_104771162 | 96 |
| 519 | 3300005328 | Ga0070676_10747768 | Ga0070676_107477681 | 96 |
| 520 | 3300005329 | Ga0070683_100088671 | Ga0070683_1000886712 | 96 |
| 521 | 3300005329 | Ga0070683_100455703 | Ga0070683_1004557032 | 96 |
| 522 | 3300005329 | Ga0070683_100525775 | Ga0070683_1005257752 | 96 |
| 523 | 3300005329 | Ga0070683_100772090 | Ga0070683_1007720902 | 96 |
| 524 | 3300005330 | Ga0070690_100020637 | Ga0070690_1000206374 | 96 |
| 525 | 3300005331 | Ga0070670_100162525 | Ga0070670_1001625253 | 96 |
| 526 | 3300005331 | Ga0070670_100687280 | Ga0070670_1006872802 | 96 |
| 527 | 3300005331 | Ga0070670_100768266 | Ga0070670_1007682662 | 96 |
| 528 | 3300005333 | Ga0070677_10816915 | Ga0070677_108169151 | 96 |
| 529 | 3300005334 | Ga0068869_100070091 | Ga0068869_1000700916 | 96 |
| 530 | 3300005334 | Ga0068869_100104915 | Ga0068869_1001049151 | 96 |
| 531 | 3300005334 | Ga0068869_100544126 | Ga0068869_1005441262 | 96 |
| 532 | 3300005334 | Ga0068869_100673877 | Ga0068869_1006738772 | 96 |
| 533 | 3300005335 | Ga0070666_10023127 | Ga0070666_100231277 | 96 |
| 534 | 3300005335 | Ga0070666_10329282 | Ga0070666_103292823 | 96 |
| 535 | 3300005336 | Ga0070680_100019894 | Ga0070680_1000198948 | 96 |
| 536 | 3300005336 | Ga0070680_100045978 | Ga0070680_1000459785 | 96 |
| 537 | 3300005336 | Ga0070680_100072787 | Ga0070680_1000727874 | 96 |
| 538 | 3300005336 | Ga0070680_100248532 | Ga0070680_1002485322 | 96 |
| 539 | 3300005336 | Ga0070680_100739003 | Ga0070680_1007390032 | 96 |
| 540 | 3300005336 | Ga0070680_100851267 | Ga0070680_1008512672 | 96 |
| 541 | 3300005336 | Ga0070680_101201131 | Ga0070680_1012011312 | 96 |
| 542 | 3300005337 | Ga0070682_100023836 | Ga0070682_1000238363 | 96 |
| 543 | 3300005337 | Ga0070682_100716296 | Ga0070682_1007162962 | 96 |
| 544 | 3300005337 | Ga0070682_100938223 | Ga0070682_1009382232 | 96 |
| 545 | 3300005337 | Ga0070682_101349580 | Ga0070682_1013495801 | 96 |
| 546 | 3300005338 | Ga0068868_100199244 | Ga0068868_1001992443 | 96 |
| 547 | 3300005338 | Ga0068868_100291153 | Ga0068868_1002911531 | 96 |
| 548 | 3300005338 | Ga0068868_100405385 | Ga0068868_1004053852 | 96 |
| 549 | 3300005338 | Ga0068868_101440077 | Ga0068868_1014400772 | 96 |
| 550 | 3300005339 | Ga0070660_100018276 | Ga0070660_1000182768 | 96 |
| 551 | 3300005339 | Ga0070660_100040143 | Ga0070660_1000401437 | 96 |
| 552 | 3300005339 | Ga0070660_100052268 | Ga0070660_1000522683 | 96 |
| 553 | 3300005339 | Ga0070660_100379564 | Ga0070660_1003795642 | 96 |
| 554 | 3300005339 | Ga0070660_100907907 | Ga0070660_1009079072 | 96 |
| 555 | 3300005340 | Ga0070689_100053325 | Ga0070689_1000533253 | 96 |
| 556 | 3300005340 | Ga0070689_100810262 | Ga0070689_1008102622 | 96 |
| 557 | 3300005340 | Ga0070689_101509819 | Ga0070689_1015098192 | 96 |
| 558 | 3300005341 | Ga0070691_10024352 | Ga0070691_100243524 | 96 |
| 559 | 3300005341 | Ga0070691_10226777 | Ga0070691_102267772 | 96 |
| 560 | 3300005341 | Ga0070691_10306108 | Ga0070691_103061081 | 96 |
| 561 | 3300005344 | Ga0070661_100158458 | Ga0070661_1001584584 | 96 |
| 562 | 3300005344 | Ga0070661_100582676 | Ga0070661_1005826762 | 96 |
| 563 | 3300005347 | Ga0070668_100038563 | Ga0070668_1000385632 | 96 |
| 564 | 3300005347 | Ga0070668_100452846 | Ga0070668_1004528462 | 96 |
| 565 | 3300005347 | Ga0070668_100850994 | Ga0070668_1008509942 | 96 |
| 566 | 3300005347 | Ga0070668_101028917 | Ga0070668_1010289172 | 96 |
| 567 | 3300005353 | Ga0070669_100023313 | Ga0070669_1000233133 | 96 |
| 568 | 3300005353 | Ga0070669_100023914 | Ga0070669_1000239143 | 96 |
| 569 | 3300005354 | Ga0070675_100055612 | Ga0070675_1000556123 | 96 |
| 570 | 3300005354 | Ga0070675_100226391 | Ga0070675_1002263913 | 96 |
| 571 | 3300005354 | Ga0070675_100350669 | Ga0070675_1003506692 | 96 |
| 572 | 3300005354 | Ga0070675_100534805 | Ga0070675_1005348053 | 96 |
| 573 | 3300005354 | Ga0070675_100597549 | Ga0070675_1005975492 | 96 |
| 574 | 3300005355 | Ga0070671_100309895 | Ga0070671_1003098951 | 96 |
| 575 | 3300005355 | Ga0070671_101577543 | Ga0070671_1015775432 | 96 |
| 576 | 3300005355 | Ga0070671_101584924 | Ga0070671_1015849242 | 96 |
| 577 | 3300005356 | Ga0070674_100001266 | Ga0070674_10000126612 | 96 |
| 578 | 3300005356 | Ga0070674_100041872 | Ga0070674_1000418724 | 96 |
| 579 | 3300005356 | Ga0070674_100063433 | Ga0070674_1000634332 | 96 |
| 580 | 3300005364 | Ga0070673_100592233 | Ga0070673_1005922332 | 96 |
| 581 | 3300005364 | Ga0070673_101623517 | Ga0070673_1016235172 | 96 |
| 582 | 3300005365 | Ga0070688_100013675 | Ga0070688_1000136757 | 96 |
| 583 | 3300005365 | Ga0070688_101442699 | Ga0070688_1014426992 | 96 |
| 584 | 3300005366 | Ga0070659_100311578 | Ga0070659_1003115782 | 96 |
| 585 | 3300005366 | Ga0070659_101218788 | Ga0070659_1012187882 | 96 |
| 586 | 3300005366 | Ga0070659_101253243 | Ga0070659_1012532432 | 96 |
| 587 | 3300005366 | Ga0070659_101337529 | Ga0070659_1013375292 | 96 |
| 588 | 3300005367 | Ga0070667_100061525 | Ga0070667_1000615257 | 96 |
| 589 | 3300005367 | Ga0070667_100067572 | Ga0070667_1000675728 | 96 |
| 590 | 3300005367 | Ga0070667_100342781 | Ga0070667_1003427811 | 96 |
| 591 | 3300005367 | Ga0070667_100354428 | Ga0070667_1003544283 | 96 |
| 592 | 3300005367 | Ga0070667_101874074 | Ga0070667_1018740742 | 96 |
| 593 | 3300005406 | Ga0070703_10006226 | Ga0070703_100062263 | 96 |
| 594 | 3300005434 | Ga0070709_10078673 | Ga0070709_100786733 | 96 |
| 595 | 3300005434 | Ga0070709_10504056 | Ga0070709_105040562 | 96 |
| 596 | 3300005434 | Ga0070709_10614722 | Ga0070709_106147222 | 96 |
| 597 | 3300005434 | Ga0070709_10883751 | Ga0070709_108837511 | 96 |
| 598 | 3300005435 | Ga0070714_100011267 | Ga0070714_1000112679 | 96 |
| 599 | 3300005435 | Ga0070714_101439883 | Ga0070714_1014398832 | 96 |
| 600 | 3300005436 | Ga0070713_100001675 | Ga0070713_10000167512 | 96 |
| 601 | 3300005436 | Ga0070713_100443886 | Ga0070713_1004438863 | 96 |
| 602 | 3300005436 | Ga0070713_100909268 | Ga0070713_1009092682 | 96 |
| 603 | 3300005436 | Ga0070713_100995054 | Ga0070713_1009950542 | 96 |
| 604 | 3300005436 | Ga0070713_101050050 | Ga0070713_1010500501 | 96 |
| 605 | 3300005436 | Ga0070713_101275263 | Ga0070713_1012752632 | 96 |
| 606 | 3300005436 | Ga0070713_101285700 | Ga0070713_1012857001 | 96 |
| 607 | 3300005436 | Ga0070713_102099842 | Ga0070713_1020998421 | 96 |
| 608 | 3300005436 | Ga0070713_102174607 | Ga0070713_1021746071 | 96 |
| 609 | 3300005437 | Ga0070710_10049219 | Ga0070710_100492193 | 96 |
| 610 | 3300005437 | Ga0070710_10412417 | Ga0070710_104124172 | 96 |
| 611 | 3300005437 | Ga0070710_11060605 | Ga0070710_110606051 | 96 |
| 612 | 3300005438 | Ga0070701_10041914 | Ga0070701_100419144 | 96 |
| 613 | 3300005439 | Ga0070711_100071215 | Ga0070711_1000712155 | 96 |
| 614 | 3300005439 | Ga0070711_100389457 | Ga0070711_1003894572 | 96 |
| 615 | 3300005439 | Ga0070711_100727388 | Ga0070711_1007273882 | 96 |
| 616 | 3300005440 | Ga0070705_100053071 | Ga0070705_1000530714 | 96 |
| 617 | 3300005440 | Ga0070705_100054595 | Ga0070705_1000545955 | 96 |
| 618 | 3300005440 | Ga0070705_100811235 | Ga0070705_1008112352 | 96 |
| 619 | 3300005441 | Ga0070700_100474427 | Ga0070700_1004744272 | 96 |
| 620 | 3300005441 | Ga0070700_100708498 | Ga0070700_1007084982 | 96 |
| 621 | 3300005444 | Ga0070694_100020300 | Ga0070694_1000203007 | 96 |
| 622 | 3300005444 | Ga0070694_100056701 | Ga0070694_1000567016 | 96 |
| 623 | 3300005444 | Ga0070694_101318053 | Ga0070694_1013180532 | 96 |
| 624 | 3300005445 | Ga0070708_100551887 | Ga0070708_1005518872 | 96 |
| 625 | 3300005455 | Ga0070663_100034462 | Ga0070663_1000344628 | 96 |
| 626 | 3300005456 | Ga0070678_100021125 | Ga0070678_1000211254 | 96 |
| 627 | 3300005456 | Ga0070678_100021594 | Ga0070678_1000215945 | 96 |
| 628 | 3300005456 | Ga0070678_100122832 | Ga0070678_1001228325 | 96 |
| 629 | 3300005456 | Ga0070678_100323616 | Ga0070678_1003236162 | 96 |
| 630 | 3300005456 | Ga0070678_100568500 | Ga0070678_1005685002 | 96 |
| 631 | 3300005456 | Ga0070678_100760487 | Ga0070678_1007604872 | 96 |
| 632 | 3300005456 | Ga0070678_101059090 | Ga0070678_1010590901 | 96 |
| 633 | 3300005457 | Ga0070662_100021397 | Ga0070662_1000213973 | 96 |
| 634 | 3300005457 | Ga0070662_101093878 | Ga0070662_1010938782 | 96 |
| 635 | 3300005458 | Ga0070681_10007102 | Ga0070681_100071029 | 96 |
| 636 | 3300005458 | Ga0070681_10263987 | Ga0070681_102639871 | 96 |
| 637 | 3300005458 | Ga0070681_10354805 | Ga0070681_103548053 | 96 |
| 638 | 3300005458 | Ga0070681_10479877 | Ga0070681_104798772 | 96 |
| 639 | 3300005458 | Ga0070681_10697971 | Ga0070681_106979712 | 96 |
| 640 | 3300005458 | Ga0070681_10890099 | Ga0070681_108900992 | 96 |
| 641 | 3300005459 | Ga0068867_100100755 | Ga0068867_1001007554 | 96 |
| 642 | 3300005459 | Ga0068867_100106725 | Ga0068867_1001067253 | 96 |
| 643 | 3300005459 | Ga0068867_100241062 | Ga0068867_1002410623 | 96 |
| 644 | 3300005459 | Ga0068867_100513407 | Ga0068867_1005134072 | 96 |
| 645 | 3300005459 | Ga0068867_100798158 | Ga0068867_1007981582 | 96 |
| 646 | 3300005466 | Ga0070685_10012732 | Ga0070685_100127327 | 96 |
| 647 | 3300005466 | Ga0070685_10190747 | Ga0070685_101907473 | 96 |
| 648 | 3300005467 | Ga0070706_100045185 | Ga0070706_1000451855 | 96 |
| 649 | 3300005467 | Ga0070706_100343409 | Ga0070706_1003434093 | 96 |
| 650 | 3300005468 | Ga0070707_100307016 | Ga0070707_1003070162 | 96 |
| 651 | 3300005468 | Ga0070707_100471842 | Ga0070707_1004718421 | 96 |
| 652 | 3300005471 | Ga0070698_100327715 | Ga0070698_1003277151 | 96 |
| 653 | 3300005518 | Ga0070699_100120889 | Ga0070699_1001208892 | 96 |
| 654 | 3300005518 | Ga0070699_100188037 | Ga0070699_1001880373 | 96 |
| 655 | 3300005530 | Ga0070679_100039101 | Ga0070679_1000391017 | 96 |
| 656 | 3300005530 | Ga0070679_100082939 | Ga0070679_1000829395 | 96 |
| 657 | 3300005530 | Ga0070679_100092871 | Ga0070679_1000928712 | 96 |
| 658 | 3300005530 | Ga0070679_100235905 | Ga0070679_1002359052 | 96 |
| 659 | 3300005530 | Ga0070679_100356169 | Ga0070679_1003561692 | 96 |
| 660 | 3300005530 | Ga0070679_100398817 | Ga0070679_1003988172 | 96 |
| 661 | 3300005530 | Ga0070679_100629447 | Ga0070679_1006294472 | 96 |
| 662 | 3300005530 | Ga0070679_100931182 | Ga0070679_1009311822 | 96 |
| 663 | 3300005530 | Ga0070679_100939174 | Ga0070679_1009391742 | 96 |
| 664 | 3300005530 | Ga0070679_101484904 | Ga0070679_1014849041 | 96 |
| 665 | 3300005530 | Ga0070679_101517440 | Ga0070679_1015174402 | 96 |
| 666 | 3300005530 | Ga0070679_101644542 | Ga0070679_1016445422 | 96 |
| 667 | 3300005535 | Ga0070684_100073460 | Ga0070684_1000734604 | 96 |
| 668 | 3300005535 | Ga0070684_100444811 | Ga0070684_1004448112 | 96 |
| 669 | 3300005535 | Ga0070684_100819267 | Ga0070684_1008192672 | 96 |
| 670 | 3300005535 | Ga0070684_101199306 | Ga0070684_1011993061 | 96 |
| 671 | 3300005535 | Ga0070684_101913630 | Ga0070684_1019136301 | 96 |
| 672 | 3300005536 | Ga0070697_100715234 | Ga0070697_1007152342 | 96 |
| 673 | 3300005539 | Ga0068853_100006917 | Ga0068853_10000691715 | 96 |
| 674 | 3300005539 | Ga0068853_100173535 | Ga0068853_1001735354 | 96 |
| 675 | 3300005539 | Ga0068853_100295709 | Ga0068853_1002957092 | 96 |
| 676 | 3300005539 | Ga0068853_100308432 | Ga0068853_1003084323 | 96 |
| 677 | 3300005539 | Ga0068853_100402370 | Ga0068853_1004023701 | 96 |
| 678 | 3300005539 | Ga0068853_100896521 | Ga0068853_1008965212 | 96 |
| 679 | 3300005543 | Ga0070672_100075788 | Ga0070672_1000757883 | 96 |
| 680 | 3300005544 | Ga0070686_100026380 | Ga0070686_1000263803 | 96 |
| 681 | 3300005544 | Ga0070686_100568573 | Ga0070686_1005685732 | 96 |
| 682 | 3300005544 | Ga0070686_101396448 | Ga0070686_1013964481 | 96 |
| 683 | 3300005544 | Ga0070686_101508823 | Ga0070686_1015088232 | 96 |
| 684 | 3300005545 | Ga0070695_100037771 | Ga0070695_1000377717 | 96 |
| 685 | 3300005545 | Ga0070695_100040449 | Ga0070695_1000404494 | 96 |
| 686 | 3300005546 | Ga0070696_100006293 | Ga0070696_1000062938 | 96 |
| 687 | 3300005546 | Ga0070696_100010439 | Ga0070696_1000104397 | 96 |
| 688 | 3300005546 | Ga0070696_100074654 | Ga0070696_1000746543 | 96 |
| 689 | 3300005546 | Ga0070696_100464160 | Ga0070696_1004641602 | 96 |
| 690 | 3300005546 | Ga0070696_100716140 | Ga0070696_1007161402 | 96 |
| 691 | 3300005547 | Ga0070693_100011024 | Ga0070693_1000110246 | 96 |
| 692 | 3300005547 | Ga0070693_100167752 | Ga0070693_1001677522 | 96 |
| 693 | 3300005547 | Ga0070693_100804690 | Ga0070693_1008046901 | 96 |
| 694 | 3300005547 | Ga0070693_101375393 | Ga0070693_1013753932 | 96 |
| 695 | 3300005548 | Ga0070665_100014624 | Ga0070665_10001462416 | 96 |
| 696 | 3300005548 | Ga0070665_100074982 | Ga0070665_1000749828 | 96 |
| 697 | 3300005548 | Ga0070665_100087868 | Ga0070665_1000878685 | 96 |
| 698 | 3300005548 | Ga0070665_100157888 | Ga0070665_1001578884 | 96 |
| 699 | 3300005548 | Ga0070665_100182589 | Ga0070665_1001825895 | 96 |
| 700 | 3300005548 | Ga0070665_100331108 | Ga0070665_1003311083 | 96 |
| 701 | 3300005548 | Ga0070665_100340969 | Ga0070665_1003409694 | 96 |
| 702 | 3300005548 | Ga0070665_100414332 | Ga0070665_1004143322 | 96 |
| 703 | 3300005548 | Ga0070665_100612837 | Ga0070665_1006128372 | 96 |
| 704 | 3300005548 | Ga0070665_101381074 | Ga0070665_1013810741 | 96 |
| 705 | 3300005548 | Ga0070665_101480620 | Ga0070665_1014806202 | 96 |
| 706 | 3300005548 | Ga0070665_101900889 | Ga0070665_1019008892 | 96 |
| 707 | 3300005548 | Ga0070665_102367133 | Ga0070665_1023671331 | 96 |
| 708 | 3300005549 | Ga0070704_100930546 | Ga0070704_1009305461 | 96 |
| 709 | 3300005563 | Ga0068855_100107936 | Ga0068855_1001079368 | 96 |
| 710 | 3300005563 | Ga0068855_100218784 | Ga0068855_1002187842 | 96 |
| 711 | 3300005563 | Ga0068855_100377233 | Ga0068855_1003772332 | 96 |
| 712 | 3300005563 | Ga0068855_100551499 | Ga0068855_1005514993 | 96 |
| 713 | 3300005563 | Ga0068855_100856090 | Ga0068855_1008560902 | 96 |
| 714 | 3300005563 | Ga0068855_101168688 | Ga0068855_1011686881 | 96 |
| 715 | 3300005563 | Ga0068855_101411038 | Ga0068855_1014110382 | 96 |
| 716 | 3300005563 | Ga0068855_101569489 | Ga0068855_1015694892 | 96 |
| 717 | 3300005563 | Ga0068855_102108968 | Ga0068855_1021089681 | 96 |
| 718 | 3300005564 | Ga0070664_100068199 | Ga0070664_1000681995 | 96 |
| 719 | 3300005564 | Ga0070664_101714597 | Ga0070664_1017145971 | 96 |
| 720 | 3300005564 | Ga0070664_101989152 | Ga0070664_1019891522 | 96 |
| 721 | 3300005577 | Ga0068857_100096862 | Ga0068857_1000968624 | 96 |
| 722 | 3300005577 | Ga0068857_100128196 | Ga0068857_1001281965 | 96 |
| 723 | 3300005577 | Ga0068857_100828304 | Ga0068857_1008283042 | 96 |
| 724 | 3300005577 | Ga0068857_101058490 | Ga0068857_1010584902 | 96 |
| 725 | 3300005577 | Ga0068857_101572916 | Ga0068857_1015729162 | 96 |
| 726 | 3300005578 | Ga0068854_100683089 | Ga0068854_1006830892 | 96 |
| 727 | 3300005578 | Ga0068854_101116855 | Ga0068854_1011168552 | 96 |
| 728 | 3300005614 | Ga0068856_100191608 | Ga0068856_1001916083 | 96 |
| 729 | 3300005614 | Ga0068856_100277013 | Ga0068856_1002770134 | 96 |
| 730 | 3300005614 | Ga0068856_100781455 | Ga0068856_1007814552 | 96 |
| 731 | 3300005614 | Ga0068856_101292082 | Ga0068856_1012920822 | 96 |
| 732 | 3300005614 | Ga0068856_101970962 | Ga0068856_1019709622 | 96 |
| 733 | 3300005615 | Ga0070702_100186251 | Ga0070702_1001862512 | 96 |
| 734 | 3300005616 | Ga0068852_100130647 | Ga0068852_1001306473 | 96 |
| 735 | 3300005616 | Ga0068852_102407536 | Ga0068852_1024075362 | 96 |
| 736 | 3300005617 | Ga0068859_100225122 | Ga0068859_1002251222 | 96 |
| 737 | 3300005617 | Ga0068859_100416049 | Ga0068859_1004160491 | 96 |
| 738 | 3300005617 | Ga0068859_100653974 | Ga0068859_1006539742 | 96 |
| 739 | 3300005617 | Ga0068859_101091707 | Ga0068859_1010917072 | 96 |
| 740 | 3300005617 | Ga0068859_102701731 | Ga0068859_1027017312 | 96 |
| 741 | 3300005618 | Ga0068864_100170784 | Ga0068864_1001707843 | 96 |
| 742 | 3300005618 | Ga0068864_100695509 | Ga0068864_1006955092 | 96 |
| 743 | 3300005618 | Ga0068864_101390974 | Ga0068864_1013909742 | 96 |
| 744 | 3300005618 | Ga0068864_101798307 | Ga0068864_1017983072 | 96 |
| 745 | 3300005618 | Ga0068864_102438990 | Ga0068864_1024389901 | 96 |
| 746 | 3300005718 | Ga0068866_10155481 | Ga0068866_101554812 | 96 |
| 747 | 3300005718 | Ga0068866_10320624 | Ga0068866_103206242 | 96 |
| 748 | 3300005718 | Ga0068866_10583336 | Ga0068866_105833361 | 96 |
| 749 | 3300005719 | Ga0068861_100084477 | Ga0068861_1000844775 | 96 |
| 750 | 3300005719 | Ga0068861_100275129 | Ga0068861_1002751292 | 96 |
| 751 | 3300005719 | Ga0068861_101018226 | Ga0068861_1010182262 | 96 |
| 752 | 3300005834 | Ga0068851_10074549 | Ga0068851_100745492 | 96 |
| 753 | 3300005840 | Ga0068870_10209043 | Ga0068870_102090432 | 96 |
| 754 | 3300005840 | Ga0068870_11056359 | Ga0068870_110563592 | 96 |
| 755 | 3300005841 | Ga0068863_100043883 | Ga0068863_1000438838 | 96 |
| 756 | 3300005841 | Ga0068863_100350018 | Ga0068863_1003500183 | 96 |
| 757 | 3300005841 | Ga0068863_101024711 | Ga0068863_1010247112 | 96 |
| 758 | 3300005841 | Ga0068863_102507882 | Ga0068863_1025078821 | 96 |
| 759 | 3300005842 | Ga0068858_100049282 | Ga0068858_1000492827 | 96 |
| 760 | 3300005842 | Ga0068858_100112898 | Ga0068858_1001128985 | 96 |
| 761 | 3300005842 | Ga0068858_100163902 | Ga0068858_1001639023 | 96 |
| 762 | 3300005842 | Ga0068858_100425301 | Ga0068858_1004253012 | 96 |
| 763 | 3300005843 | Ga0068860_100092223 | Ga0068860_1000922234 | 96 |
| 764 | 3300005843 | Ga0068860_100440964 | Ga0068860_1004409642 | 96 |
| 765 | 3300005843 | Ga0068860_100463463 | Ga0068860_1004634633 | 96 |
| 766 | 3300005843 | Ga0068860_101054688 | Ga0068860_1010546882 | 96 |
| 767 | 3300005843 | Ga0068860_101067238 | Ga0068860_1010672381 | 96 |
| 768 | 3300005843 | Ga0068860_102839372 | Ga0068860_1028393721 | 96 |
| 769 | 3300005844 | Ga0068862_100011381 | Ga0068862_10001138111 | 96 |
| 770 | 3300005844 | Ga0068862_100191186 | Ga0068862_1001911863 | 96 |
| 771 | 3300005844 | Ga0068862_100432931 | Ga0068862_1004329313 | 96 |
| 772 | 3300005844 | Ga0068862_101350880 | Ga0068862_1013508802 | 96 |
| 773 | 3300005937 | Ga0081455_10000048 | Ga0081455_1000004852 | 96 |
| 774 | 3300005937 | Ga0081455_10013116 | Ga0081455_1001311616 | 96 |
| 775 | 3300005937 | Ga0081455_10017489 | Ga0081455_100174893 | 96 |
| 776 | 3300005937 | Ga0081455_10099126 | Ga0081455_100991265 | 96 |
| 777 | 3300005937 | Ga0081455_10137446 | Ga0081455_101374464 | 96 |
| 778 | 3300005981 | Ga0081538_10001852 | Ga0081538_1000185219 | 96 |
| 779 | 3300005983 | Ga0081540_1095245 | Ga0081540_10952453 | 96 |
| 780 | 3300005983 | Ga0081540_1191416 | Ga0081540_11914162 | 96 |
| 781 | 3300005985 | Ga0081539_10000072 | Ga0081539_1000007216 | 96 |
| 782 | 3300005985 | Ga0081539_10009089 | Ga0081539_100090895 | 96 |
| 783 | 3300006028 | Ga0070717_10074954 | Ga0070717_100749544 | 96 |
| 784 | 3300006028 | Ga0070717_10477158 | Ga0070717_104771583 | 96 |
| 785 | 3300006028 | Ga0070717_10724336 | Ga0070717_107243362 | 96 |
| 786 | 3300006028 | Ga0070717_10845026 | Ga0070717_108450262 | 96 |
| 787 | 3300006042 | Ga0075368_10193637 | Ga0075368_101936372 | 96 |
| 788 | 3300006048 | Ga0075363_100273731 | Ga0075363_1002737312 | 96 |
| 789 | 3300006048 | Ga0075363_100421375 | Ga0075363_1004213752 | 96 |
| 790 | 3300006048 | Ga0075363_100712037 | Ga0075363_1007120372 | 96 |
| 791 | 3300006051 | Ga0075364_10249794 | Ga0075364_102497942 | 96 |
| 792 | 3300006163 | Ga0070715_10011442 | Ga0070715_100114426 | 96 |
| 793 | 3300006173 | Ga0070716_100180003 | Ga0070716_1001800032 | 96 |
| 794 | 3300006173 | Ga0070716_100317300 | Ga0070716_1003173002 | 96 |
| 795 | 3300006175 | Ga0070712_100004619 | Ga0070712_10000461914 | 96 |
| 796 | 3300006175 | Ga0070712_100314311 | Ga0070712_1003143112 | 96 |
| 797 | 3300006177 | Ga0075362_10096734 | Ga0075362_100967342 | 96 |
| 798 | 3300006177 | Ga0075362_10277492 | Ga0075362_102774921 | 96 |
| 799 | 3300006178 | Ga0075367_10319705 | Ga0075367_103197052 | 96 |
| 800 | 3300006178 | Ga0075367_10462486 | Ga0075367_104624861 | 96 |
| 801 | 3300006178 | Ga0075367_10488672 | Ga0075367_104886722 | 96 |
| 802 | 3300006178 | Ga0075367_10558546 | Ga0075367_105585462 | 96 |
| 803 | 3300006195 | Ga0075366_10042037 | Ga0075366_100420377 | 96 |
| 804 | 3300006195 | Ga0075366_10335185 | Ga0075366_103351853 | 96 |
| 805 | 3300006195 | Ga0075366_10467034 | Ga0075366_104670342 | 96 |
| 806 | 3300006195 | Ga0075366_10774579 | Ga0075366_107745792 | 96 |
| 807 | 3300006237 | Ga0097621_100106219 | Ga0097621_1001062193 | 96 |
| 808 | 3300006237 | Ga0097621_100141731 | Ga0097621_1001417313 | 96 |
| 809 | 3300006237 | Ga0097621_100318759 | Ga0097621_1003187593 | 96 |
| 810 | 3300006237 | Ga0097621_100778144 | Ga0097621_1007781443 | 96 |
| 811 | 3300006237 | Ga0097621_101172310 | Ga0097621_1011723102 | 96 |
| 812 | 3300006353 | Ga0075370_10025728 | Ga0075370_100257287 | 96 |
| 813 | 3300006353 | Ga0075370_10243018 | Ga0075370_102430183 | 96 |
| 814 | 3300006358 | Ga0068871_100071528 | Ga0068871_1000715283 | 96 |
| 815 | 3300006358 | Ga0068871_100392603 | Ga0068871_1003926032 | 96 |
| 816 | 3300006358 | Ga0068871_101195952 | Ga0068871_1011959522 | 96 |
| 817 | 3300006844 | Ga0075428_102272651 | Ga0075428_1022726512 | 96 |
| 818 | 3300006846 | Ga0075430_100113569 | Ga0075430_1001135696 | 96 |
| 819 | 3300006846 | Ga0075430_100275397 | Ga0075430_1002753973 | 96 |
| 820 | 3300006847 | Ga0075431_102202149 | Ga0075431_1022021491 | 96 |
| 821 | 3300006852 | Ga0075433_10227783 | Ga0075433_102277831 | 96 |
| 822 | 3300006852 | Ga0075433_10486718 | Ga0075433_104867182 | 96 |
| 823 | 3300006852 | Ga0075433_11139175 | Ga0075433_111391752 | 96 |
| 824 | 3300006871 | Ga0075434_100127605 | Ga0075434_1001276055 | 96 |
| 825 | 3300006871 | Ga0075434_100342016 | Ga0075434_1003420162 | 96 |
| 826 | 3300006871 | Ga0075434_100939960 | Ga0075434_1009399602 | 96 |
| 827 | 3300006881 | Ga0068865_100002505 | Ga0068865_1000025056 | 96 |
| 828 | 3300006881 | Ga0068865_100204889 | Ga0068865_1002048892 | 96 |
| 829 | 3300006881 | Ga0068865_100875544 | Ga0068865_1008755442 | 96 |
| 830 | 3300006881 | Ga0068865_100934570 | Ga0068865_1009345702 | 96 |
| 831 | 3300006881 | Ga0068865_101556208 | Ga0068865_1015562082 | 96 |
| 832 | 3300006914 | Ga0075436_100053121 | Ga0075436_1000531212 | 96 |
| 833 | 3300006914 | Ga0075436_100243577 | Ga0075436_1002435773 | 96 |
| 834 | 3300006914 | Ga0075436_101311785 | Ga0075436_1013117852 | 96 |
| 835 | 3300006931 | Ga0097620_100225140 | Ga0097620_1002251404 | 96 |
| 836 | 3300006931 | Ga0097620_100416056 | Ga0097620_1004160561 | 96 |
| 837 | 3300006931 | Ga0097620_100653863 | Ga0097620_1006538632 | 96 |
| 838 | 3300006931 | Ga0097620_101091665 | Ga0097620_1010916652 | 96 |
| 839 | 3300006931 | Ga0097620_102701815 | Ga0097620_1027018151 | 96 |
| 840 | 3300007788 | Ga0099795_10002056 | Ga0099795_100020568 | 96 |
| 841 | 3300007788 | Ga0099795_10357496 | Ga0099795_103574962 | 96 |
| 842 | 3300009092 | Ga0105250_10202203 | Ga0105250_102022032 | 96 |
| 843 | 3300009093 | Ga0105240_10118855 | Ga0105240_101188555 | 96 |
| 844 | 3300009093 | Ga0105240_10261448 | Ga0105240_102614482 | 96 |
| 845 | 3300009093 | Ga0105240_10313482 | Ga0105240_103134824 | 96 |
| 846 | 3300009093 | Ga0105240_10455243 | Ga0105240_104552432 | 96 |
| 847 | 3300009093 | Ga0105240_10546606 | Ga0105240_105466063 | 96 |
| 848 | 3300009093 | Ga0105240_10644980 | Ga0105240_106449803 | 96 |
| 849 | 3300009093 | Ga0105240_10775048 | Ga0105240_107750482 | 96 |
| 850 | 3300009093 | Ga0105240_10950412 | Ga0105240_109504123 | 96 |
| 851 | 3300009093 | Ga0105240_11671845 | Ga0105240_116718452 | 96 |
| 852 | 3300009093 | Ga0105240_12026371 | Ga0105240_120263712 | 96 |
| 853 | 3300009093 | Ga0105240_12217837 | Ga0105240_122178371 | 96 |
| 854 | 3300009093 | Ga0105240_12584970 | Ga0105240_125849701 | 96 |
| 855 | 3300009094 | Ga0111539_10065259 | Ga0111539_100652597 | 96 |
| 856 | 3300009094 | Ga0111539_10872514 | Ga0111539_108725142 | 96 |
| 857 | 3300009094 | Ga0111539_12489409 | Ga0111539_124894092 | 96 |
| 858 | 3300009094 | Ga0111539_13375196 | Ga0111539_133751962 | 96 |
| 859 | 3300009098 | Ga0105245_10289754 | Ga0105245_102897543 | 96 |
| 860 | 3300009098 | Ga0105245_11142459 | Ga0105245_111424592 | 96 |
| 861 | 3300009098 | Ga0105245_11300387 | Ga0105245_113003871 | 96 |
| 862 | 3300009098 | Ga0105245_12283177 | Ga0105245_122831772 | 96 |
| 863 | 3300009101 | Ga0105247_10189096 | Ga0105247_101890963 | 96 |
| 864 | 3300009101 | Ga0105247_10574377 | Ga0105247_105743772 | 96 |
| 865 | 3300009101 | Ga0105247_10618604 | Ga0105247_106186042 | 96 |
| 866 | 3300009101 | Ga0105247_11454536 | Ga0105247_114545361 | 96 |
| 867 | 3300009147 | Ga0114129_10210172 | Ga0114129_102101725 | 96 |
| 868 | 3300009147 | Ga0114129_10227354 | Ga0114129_102273543 | 96 |
| 869 | 3300009147 | Ga0114129_11135926 | Ga0114129_111359262 | 96 |
| 870 | 3300009147 | Ga0114129_12150191 | Ga0114129_121501912 | 96 |
| 871 | 3300009148 | Ga0105243_10014127 | Ga0105243_100141278 | 96 |
| 872 | 3300009148 | Ga0105243_10014172 | Ga0105243_100141728 | 96 |
| 873 | 3300009148 | Ga0105243_10865852 | Ga0105243_108658522 | 96 |
| 874 | 3300009148 | Ga0105243_11173214 | Ga0105243_111732142 | 96 |
| 875 | 3300009174 | Ga0105241_10113021 | Ga0105241_101130212 | 96 |
| 876 | 3300009174 | Ga0105241_10253442 | Ga0105241_102534421 | 96 |
| 877 | 3300009174 | Ga0105241_10267822 | Ga0105241_102678223 | 96 |
| 878 | 3300009174 | Ga0105241_10349871 | Ga0105241_103498713 | 96 |
| 879 | 3300009174 | Ga0105241_10773262 | Ga0105241_107732622 | 96 |
| 880 | 3300009174 | Ga0105241_10836780 | Ga0105241_108367802 | 96 |
| 881 | 3300009174 | Ga0105241_10926408 | Ga0105241_109264082 | 96 |
| 882 | 3300009174 | Ga0105241_11541385 | Ga0105241_115413851 | 96 |
| 883 | 3300009174 | Ga0105241_11924604 | Ga0105241_119246042 | 96 |
| 884 | 3300009176 | Ga0105242_10123893 | Ga0105242_101238932 | 96 |
| 885 | 3300009176 | Ga0105242_10256228 | Ga0105242_102562283 | 96 |
| 886 | 3300009176 | Ga0105242_10362506 | Ga0105242_103625062 | 96 |
| 887 | 3300009177 | Ga0105248_10063706 | Ga0105248_100637065 | 96 |
| 888 | 3300009177 | Ga0105248_10289075 | Ga0105248_102890752 | 96 |
| 889 | 3300009177 | Ga0105248_10451887 | Ga0105248_104518873 | 96 |
| 890 | 3300009177 | Ga0105248_10775680 | Ga0105248_107756801 | 96 |
| 891 | 3300009177 | Ga0105248_10787840 | Ga0105248_107878402 | 96 |
| 892 | 3300009177 | Ga0105248_12462277 | Ga0105248_124622772 | 96 |
| 893 | 3300009545 | Ga0105237_10016531 | Ga0105237_100165315 | 96 |
| 894 | 3300009545 | Ga0105237_10080860 | Ga0105237_100808606 | 96 |
| 895 | 3300009545 | Ga0105237_10155476 | Ga0105237_101554763 | 96 |
| 896 | 3300009545 | Ga0105237_10373062 | Ga0105237_103730624 | 96 |
| 897 | 3300009545 | Ga0105237_10526050 | Ga0105237_105260503 | 96 |
| 898 | 3300009551 | Ga0105238_10012597 | Ga0105238_1001259712 | 96 |
| 899 | 3300009551 | Ga0105238_10179895 | Ga0105238_101798954 | 96 |
| 900 | 3300009551 | Ga0105238_10215115 | Ga0105238_102151152 | 96 |
| 901 | 3300009551 | Ga0105238_10244606 | Ga0105238_102446063 | 96 |
| 902 | 3300009551 | Ga0105238_10315021 | Ga0105238_103150212 | 96 |
| 903 | 3300009551 | Ga0105238_10343086 | Ga0105238_103430863 | 96 |
| 904 | 3300009551 | Ga0105238_10561589 | Ga0105238_105615892 | 96 |
| 905 | 3300009551 | Ga0105238_10764574 | Ga0105238_107645742 | 96 |
| 906 | 3300009551 | Ga0105238_10806031 | Ga0105238_108060312 | 96 |
| 907 | 3300009551 | Ga0105238_11168422 | Ga0105238_111684222 | 96 |
| 908 | 3300009551 | Ga0105238_11204016 | Ga0105238_112040162 | 96 |
| 909 | 3300009551 | Ga0105238_11512957 | Ga0105238_115129572 | 96 |
| 910 | 3300009551 | Ga0105238_13063038 | Ga0105238_130630382 | 96 |
| 911 | 3300009553 | Ga0105249_10048120 | Ga0105249_100481204 | 96 |
| 912 | 3300009553 | Ga0105249_10064902 | Ga0105249_100649022 | 96 |
| 913 | 3300009553 | Ga0105249_10141467 | Ga0105249_101414673 | 96 |
| 914 | 3300009553 | Ga0105249_11396288 | Ga0105249_113962882 | 96 |
| 915 | 3300009553 | Ga0105249_12281628 | Ga0105249_122816282 | 96 |
| 916 | 3300010159 | Ga0099796_10124832 | Ga0099796_101248322 | 96 |
| 917 | 3300010375 | Ga0105239_10066260 | Ga0105239_100662602 | 96 |
| 918 | 3300010375 | Ga0105239_10138338 | Ga0105239_101383386 | 96 |
| 919 | 3300010375 | Ga0105239_10327892 | Ga0105239_103278922 | 96 |
| 920 | 3300010375 | Ga0105239_10592553 | Ga0105239_105925532 | 96 |
| 921 | 3300010375 | Ga0105239_10691783 | Ga0105239_106917832 | 96 |
| 922 | 3300010375 | Ga0105239_10759035 | Ga0105239_107590352 | 96 |
| 923 | 3300010375 | Ga0105239_11628158 | Ga0105239_116281582 | 96 |
| 924 | 3300010375 | Ga0105239_11904501 | Ga0105239_119045011 | 96 |
| 925 | 3300011119 | Ga0105246_10004854 | Ga0105246_100048544 | 96 |
| 926 | 3300011119 | Ga0105246_10062954 | Ga0105246_100629542 | 96 |
| 927 | 3300011119 | Ga0105246_10753088 | Ga0105246_107530882 | 96 |
| 928 | 3300011119 | Ga0105246_10854873 | Ga0105246_108548732 | 96 |
| 929 | 3300011119 | Ga0105246_11590571 | Ga0105246_115905711 | 96 |
| 930 | 3300011119 | Ga0105246_11914791 | Ga0105246_119147911 | 96 |
| 931 | 3300011119 | Ga0105246_12405411 | Ga0105246_124054111 | 96 |
| 932 | 3300012476 | Ga0157344_1004729 | Ga0157344_10047292 | 96 |
| 933 | 3300012480 | Ga0157346_1012317 | Ga0157346_10123171 | 96 |
| 934 | 3300012483 | Ga0157337_1010414 | Ga0157337_10104142 | 96 |
| 935 | 3300012485 | Ga0157325_1035635 | Ga0157325_10356351 | 96 |
| 936 | 3300012498 | Ga0157345_1022859 | Ga0157345_10228591 | 96 |
| 937 | 3300012500 | Ga0157314_1002718 | Ga0157314_10027182 | 96 |
| 938 | 3300012502 | Ga0157347_1010178 | Ga0157347_10101783 | 96 |
| 939 | 3300012503 | Ga0157313_1022476 | Ga0157313_10224761 | 96 |
| 940 | 3300012505 | Ga0157339_1025151 | Ga0157339_10251511 | 96 |
| 941 | 3300012506 | Ga0157324_1005414 | Ga0157324_10054142 | 96 |
| 942 | 3300012507 | Ga0157342_1002329 | Ga0157342_10023293 | 96 |
| 943 | 3300012508 | Ga0157315_1003570 | Ga0157315_10035702 | 96 |
| 944 | 3300012510 | Ga0157316_1002477 | Ga0157316_10024772 | 96 |
| 945 | 3300012515 | Ga0157338_1046649 | Ga0157338_10466492 | 96 |
| 946 | 3300013100 | Ga0157373_10204225 | Ga0157373_102042252 | 96 |
| 947 | 3300013100 | Ga0157373_10361875 | Ga0157373_103618752 | 96 |
| 948 | 3300013100 | Ga0157373_10435233 | Ga0157373_104352332 | 96 |
| 949 | 3300013100 | Ga0157373_10523795 | Ga0157373_105237952 | 96 |
| 950 | 3300013100 | Ga0157373_11371771 | Ga0157373_113717711 | 96 |
| 951 | 3300013102 | Ga0157371_10360525 | Ga0157371_103605252 | 96 |
| 952 | 3300013102 | Ga0157371_10634665 | Ga0157371_106346651 | 96 |
| 953 | 3300013102 | Ga0157371_10954468 | Ga0157371_109544681 | 96 |
| 954 | 3300013102 | Ga0157371_11054853 | Ga0157371_110548532 | 96 |
| 955 | 3300013104 | Ga0157370_10083851 | Ga0157370_100838515 | 96 |
| 956 | 3300013104 | Ga0157370_10324532 | Ga0157370_103245322 | 96 |
| 957 | 3300013104 | Ga0157370_11162771 | Ga0157370_111627712 | 96 |
| 958 | 3300013104 | Ga0157370_11398251 | Ga0157370_113982512 | 96 |
| 959 | 3300013105 | Ga0157369_10087882 | Ga0157369_100878827 | 96 |
| 960 | 3300013105 | Ga0157369_10135701 | Ga0157369_101357015 | 96 |
| 961 | 3300013105 | Ga0157369_10578454 | Ga0157369_105784542 | 96 |
| 962 | 3300013105 | Ga0157369_10707966 | Ga0157369_107079662 | 96 |
| 963 | 3300013105 | Ga0157369_10828958 | Ga0157369_108289582 | 96 |
| 964 | 3300013105 | Ga0157369_11315190 | Ga0157369_113151902 | 96 |
| 965 | 3300013105 | Ga0157369_11368116 | Ga0157369_113681162 | 96 |
| 966 | 3300013296 | Ga0157374_10133488 | Ga0157374_101334884 | 96 |
| 967 | 3300013296 | Ga0157374_10332353 | Ga0157374_103323533 | 96 |
| 968 | 3300013296 | Ga0157374_10382101 | Ga0157374_103821011 | 96 |
| 969 | 3300013296 | Ga0157374_10956313 | Ga0157374_109563132 | 96 |
| 970 | 3300013297 | Ga0157378_10115850 | Ga0157378_101158502 | 96 |
| 971 | 3300013297 | Ga0157378_10537404 | Ga0157378_105374043 | 96 |
| 972 | 3300013297 | Ga0157378_10775844 | Ga0157378_107758442 | 96 |
| 973 | 3300013297 | Ga0157378_13021990 | Ga0157378_130219902 | 96 |
| 974 | 3300013306 | Ga0163162_10632920 | Ga0163162_106329203 | 96 |
| 975 | 3300013306 | Ga0163162_10780723 | Ga0163162_107807233 | 96 |
| 976 | 3300013306 | Ga0163162_12249586 | Ga0163162_122495862 | 96 |
| 977 | 3300013306 | Ga0163162_13124403 | Ga0163162_131244032 | 96 |
| 978 | 3300013307 | Ga0157372_10327295 | Ga0157372_103272953 | 96 |
| 979 | 3300013307 | Ga0157372_10583662 | Ga0157372_105836623 | 96 |
| 980 | 3300013307 | Ga0157372_10622267 | Ga0157372_106222672 | 96 |
| 981 | 3300013307 | Ga0157372_11198800 | Ga0157372_111988002 | 96 |
| 982 | 3300013307 | Ga0157372_12846566 | Ga0157372_128465661 | 96 |
| 983 | 3300013308 | Ga0157375_10476831 | Ga0157375_104768312 | 96 |
| 984 | 3300013308 | Ga0157375_10952587 | Ga0157375_109525872 | 96 |
| 985 | 3300013308 | Ga0157375_11360480 | Ga0157375_113604802 | 96 |
| 986 | 3300013308 | Ga0157375_11760277 | Ga0157375_117602772 | 96 |
| 987 | 3300014325 | Ga0163163_10008003 | Ga0163163_100080036 | 96 |
| 988 | 3300014325 | Ga0163163_10050622 | Ga0163163_100506228 | 96 |
| 989 | 3300014325 | Ga0163163_10155427 | Ga0163163_101554275 | 96 |
| 990 | 3300014325 | Ga0163163_10483398 | Ga0163163_104833982 | 96 |
| 991 | 3300014325 | Ga0163163_10640651 | Ga0163163_106406512 | 96 |
| 992 | 3300014325 | Ga0163163_10893135 | Ga0163163_108931352 | 96 |
| 993 | 3300014325 | Ga0163163_11109392 | Ga0163163_111093922 | 96 |
| 994 | 3300014325 | Ga0163163_11666641 | Ga0163163_116666412 | 96 |
| 995 | 3300014325 | Ga0163163_12335132 | Ga0163163_123351322 | 96 |
| 996 | 3300014325 | Ga0163163_12874742 | Ga0163163_128747421 | 96 |
| 997 | 3300014326 | Ga0157380_10069944 | Ga0157380_100699445 | 96 |
| 998 | 3300014326 | Ga0157380_10450958 | Ga0157380_104509583 | 96 |
| 999 | 3300014326 | Ga0157380_10545240 | Ga0157380_105452402 | 96 |
| 1000 | 3300014326 | Ga0157380_10806218 | Ga0157380_108062182 | 96 |
| 1001 | 3300014326 | Ga0157380_10916393 | Ga0157380_109163932 | 96 |
| 1002 | 3300014497 | Ga0182008_10126397 | Ga0182008_101263971 | 96 |
| 1003 | 3300014497 | Ga0182008_10213644 | Ga0182008_102136441 | 96 |
| 1004 | 3300014497 | Ga0182008_10247911 | Ga0182008_102479113 | 96 |
| 1005 | 3300014745 | Ga0157377_10476575 | Ga0157377_104765752 | 96 |
| 1006 | 3300014968 | Ga0157379_10052289 | Ga0157379_100522892 | 96 |
| 1007 | 3300014968 | Ga0157379_10181186 | Ga0157379_101811864 | 96 |
| 1008 | 3300014968 | Ga0157379_10232957 | Ga0157379_102329574 | 96 |
| 1009 | 3300014968 | Ga0157379_10384430 | Ga0157379_103844303 | 96 |
| 1010 | 3300014968 | Ga0157379_10761071 | Ga0157379_107610712 | 96 |
| 1011 | 3300014968 | Ga0157379_11349508 | Ga0157379_113495082 | 96 |
| 1012 | 3300014969 | Ga0157376_10040837 | Ga0157376_100408378 | 96 |
| 1013 | 3300014969 | Ga0157376_10239568 | Ga0157376_102395684 | 96 |
| 1014 | 3300014969 | Ga0157376_10303079 | Ga0157376_103030792 | 96 |
| 1015 | 3300014969 | Ga0157376_10559227 | Ga0157376_105592272 | 96 |
| 1016 | 3300014969 | Ga0157376_10864631 | Ga0157376_108646312 | 96 |
| 1017 | 3300014969 | Ga0157376_11078476 | Ga0157376_110784762 | 96 |
| 1018 | 3300014969 | Ga0157376_11552520 | Ga0157376_115525201 | 96 |
| 1019 | 3300014969 | Ga0157376_12145208 | Ga0157376_121452082 | 96 |
| 1020 | 3300015262 | Ga0182007_10214516 | Ga0182007_102145162 | 96 |
| 1021 | 3300017792 | Ga0163161_10260428 | Ga0163161_102604283 | 96 |
| 1022 | 3300017792 | Ga0163161_12061192 | Ga0163161_120611921 | 96 |
| 1023 | 3300020069 | Ga0197907_10834854 | Ga0197907_108348542 | 96 |
| 1024 | 3300020069 | Ga0197907_10879882 | Ga0197907_108798821 | 96 |
| 1025 | 3300020069 | Ga0197907_11284989 | Ga0197907_112849892 | 96 |
| 1026 | 3300020078 | Ga0206352_10592541 | Ga0206352_105925411 | 96 |
| 1027 | 3300020078 | Ga0206352_10990522 | Ga0206352_109905222 | 96 |
| 1028 | 3300020080 | Ga0206350_11455779 | Ga0206350_114557792 | 96 |
| 1029 | 3300020082 | Ga0206353_10563244 | Ga0206353_105632447 | 96 |
| 1030 | 3300021358 | Ga0213873_10005735 | Ga0213873_100057353 | 96 |
| 1031 | 3300021358 | Ga0213873_10019508 | Ga0213873_100195082 | 96 |
| 1032 | 3300021358 | Ga0213873_10038734 | Ga0213873_100387341 | 96 |
| 1033 | 3300021361 | Ga0213872_10012804 | Ga0213872_100128047 | 96 |
| 1034 | 3300021361 | Ga0213872_10021018 | Ga0213872_100210184 | 96 |
| 1035 | 3300021361 | Ga0213872_10093098 | Ga0213872_100930982 | 96 |
| 1036 | 3300021361 | Ga0213872_10112292 | Ga0213872_101122922 | 96 |
| 1037 | 3300021361 | Ga0213872_10201651 | Ga0213872_102016512 | 96 |
| 1038 | 3300021377 | Ga0213874_10005081 | Ga0213874_100050814 | 96 |
| 1039 | 3300021377 | Ga0213874_10186857 | Ga0213874_101868572 | 96 |
| 1040 | 3300021384 | Ga0213876_10026215 | Ga0213876_100262153 | 96 |
| 1041 | 3300021384 | Ga0213876_10027585 | Ga0213876_100275852 | 96 |
| 1042 | 3300021384 | Ga0213876_10207718 | Ga0213876_102077181 | 96 |
| 1043 | 3300021388 | Ga0213875_10007338 | Ga0213875_1000733812 | 96 |
| 1044 | 3300021388 | Ga0213875_10017153 | Ga0213875_100171537 | 96 |
| 1045 | 3300021388 | Ga0213875_10023977 | Ga0213875_100239777 | 96 |
| 1046 | 3300021388 | Ga0213875_10042663 | Ga0213875_100426632 | 96 |
| 1047 | 3300021388 | Ga0213875_10042775 | Ga0213875_100427754 | 96 |
| 1048 | 3300021388 | Ga0213875_10120516 | Ga0213875_101205161 | 96 |
| 1049 | 3300021388 | Ga0213875_10163627 | Ga0213875_101636272 | 96 |
| 1050 | 3300021441 | Ga0213871_10003980 | Ga0213871_100039804 | 96 |
| 1051 | 3300021441 | Ga0213871_10012935 | Ga0213871_100129354 | 96 |
| 1052 | 3300021441 | Ga0213871_10312436 | Ga0213871_103124361 | 96 |
| 1053 | 3300022467 | Ga0224712_10039629 | Ga0224712_100396292 | 96 |
| 1054 | 3300022467 | Ga0224712_10064921 | Ga0224712_100649213 | 96 |
| 1055 | 3300022467 | Ga0224712_10119230 | Ga0224712_101192302 | 96 |
| 1056 | 3300025231 | Ga0207427_108978 | Ga0207427_1089782 | 96 |
| 1057 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013740 | 96 |
| 1058 | 3300025261 | Ga0209233_1003903 | Ga0209233_10039035 | 96 |
| 1059 | 3300025261 | Ga0209233_1011776 | Ga0209233_10117765 | 96 |
| 1060 | 3300025291 | Ga0209675_1020773 | Ga0209675_10207733 | 96 |
| 1061 | 3300025292 | Ga0209676_1000092 | Ga0209676_100009216 | 96 |
| 1062 | 3300025292 | Ga0209676_1004347 | Ga0209676_10043478 | 96 |
| 1063 | 3300025298 | Ga0209050_1007859 | Ga0209050_100785911 | 96 |
| 1064 | 3300025298 | Ga0209050_1010525 | Ga0209050_10105258 | 96 |
| 1065 | 3300025298 | Ga0209050_1041263 | Ga0209050_10412632 | 96 |
| 1066 | 3300025299 | Ga0209256_1018456 | Ga0209256_10184565 | 96 |
| 1067 | 3300025299 | Ga0209256_1057678 | Ga0209256_10576781 | 96 |
| 1068 | 3300025303 | Ga0209051_1021790 | Ga0209051_10217903 | 96 |
| 1069 | 3300025304 | Ga0209257_1005546 | Ga0209257_10055468 | 96 |
| 1070 | 3300025304 | Ga0209257_1044807 | Ga0209257_10448071 | 96 |
| 1071 | 3300025321 | Ga0207656_10084736 | Ga0207656_100847362 | 96 |
| 1072 | 3300025893 | Ga0207682_10050681 | Ga0207682_100506813 | 96 |
| 1073 | 3300025893 | Ga0207682_10279036 | Ga0207682_102790362 | 96 |
| 1074 | 3300025898 | Ga0207692_10010942 | Ga0207692_100109424 | 96 |
| 1075 | 3300025898 | Ga0207692_10182677 | Ga0207692_101826772 | 96 |
| 1076 | 3300025898 | Ga0207692_10385626 | Ga0207692_103856262 | 96 |
| 1077 | 3300025899 | Ga0207642_10017630 | Ga0207642_100176305 | 96 |
| 1078 | 3300025899 | Ga0207642_10088287 | Ga0207642_100882873 | 96 |
| 1079 | 3300025899 | Ga0207642_10242080 | Ga0207642_102420802 | 96 |
| 1080 | 3300025900 | Ga0207710_10052978 | Ga0207710_100529783 | 96 |
| 1081 | 3300025900 | Ga0207710_10303804 | Ga0207710_103038042 | 96 |
| 1082 | 3300025901 | Ga0207688_10166712 | Ga0207688_101667123 | 96 |
| 1083 | 3300025903 | Ga0207680_10002564 | Ga0207680_1000256410 | 96 |
| 1084 | 3300025903 | Ga0207680_10136372 | Ga0207680_101363723 | 96 |
| 1085 | 3300025904 | Ga0207647_10038225 | Ga0207647_100382252 | 96 |
| 1086 | 3300025904 | Ga0207647_10310841 | Ga0207647_103108412 | 96 |
| 1087 | 3300025906 | Ga0207699_10008830 | Ga0207699_100088309 | 96 |
| 1088 | 3300025906 | Ga0207699_10425897 | Ga0207699_104258972 | 96 |
| 1089 | 3300025906 | Ga0207699_10885593 | Ga0207699_108855931 | 96 |
| 1090 | 3300025906 | Ga0207699_11013020 | Ga0207699_110130201 | 96 |
| 1091 | 3300025906 | Ga0207699_11075577 | Ga0207699_110755772 | 96 |
| 1092 | 3300025907 | Ga0207645_10011392 | Ga0207645_100113929 | 96 |
| 1093 | 3300025907 | Ga0207645_10279815 | Ga0207645_102798152 | 96 |
| 1094 | 3300025907 | Ga0207645_10602094 | Ga0207645_106020942 | 96 |
| 1095 | 3300025907 | Ga0207645_10630619 | Ga0207645_106306192 | 96 |
| 1096 | 3300025908 | Ga0207643_10030805 | Ga0207643_100308053 | 96 |
| 1097 | 3300025908 | Ga0207643_10032595 | Ga0207643_100325955 | 96 |
| 1098 | 3300025908 | Ga0207643_10974748 | Ga0207643_109747482 | 96 |
| 1099 | 3300025909 | Ga0207705_10004720 | Ga0207705_1000472016 | 96 |
| 1100 | 3300025909 | Ga0207705_10101468 | Ga0207705_101014685 | 96 |
| 1101 | 3300025909 | Ga0207705_10837392 | Ga0207705_108373922 | 96 |
| 1102 | 3300025910 | Ga0207684_10122169 | Ga0207684_101221692 | 96 |
| 1103 | 3300025910 | Ga0207684_10354217 | Ga0207684_103542173 | 96 |
| 1104 | 3300025910 | Ga0207684_11107359 | Ga0207684_111073592 | 96 |
| 1105 | 3300025911 | Ga0207654_10063489 | Ga0207654_100634892 | 96 |
| 1106 | 3300025911 | Ga0207654_10065182 | Ga0207654_100651825 | 96 |
| 1107 | 3300025911 | Ga0207654_10199940 | Ga0207654_101999404 | 96 |
| 1108 | 3300025911 | Ga0207654_10278345 | Ga0207654_102783453 | 96 |
| 1109 | 3300025911 | Ga0207654_11447529 | Ga0207654_114475292 | 96 |
| 1110 | 3300025912 | Ga0207707_10017730 | Ga0207707_100177307 | 96 |
| 1111 | 3300025912 | Ga0207707_10156792 | Ga0207707_101567923 | 96 |
| 1112 | 3300025912 | Ga0207707_10358526 | Ga0207707_103585262 | 96 |
| 1113 | 3300025912 | Ga0207707_10391698 | Ga0207707_103916982 | 96 |
| 1114 | 3300025912 | Ga0207707_10445172 | Ga0207707_104451722 | 96 |
| 1115 | 3300025912 | Ga0207707_10539056 | Ga0207707_105390563 | 96 |
| 1116 | 3300025912 | Ga0207707_10574219 | Ga0207707_105742191 | 96 |
| 1117 | 3300025912 | Ga0207707_10630210 | Ga0207707_106302102 | 96 |
| 1118 | 3300025913 | Ga0207695_10163712 | Ga0207695_101637124 | 96 |
| 1119 | 3300025913 | Ga0207695_10178743 | Ga0207695_101787434 | 96 |
| 1120 | 3300025913 | Ga0207695_10284139 | Ga0207695_102841394 | 96 |
| 1121 | 3300025913 | Ga0207695_10384742 | Ga0207695_103847423 | 96 |
| 1122 | 3300025913 | Ga0207695_10396467 | Ga0207695_103964672 | 96 |
| 1123 | 3300025913 | Ga0207695_10808022 | Ga0207695_108080222 | 96 |
| 1124 | 3300025913 | Ga0207695_11259296 | Ga0207695_112592962 | 96 |
| 1125 | 3300025913 | Ga0207695_11442632 | Ga0207695_114426322 | 96 |
| 1126 | 3300025914 | Ga0207671_10066436 | Ga0207671_100664364 | 96 |
| 1127 | 3300025914 | Ga0207671_10158422 | Ga0207671_101584223 | 96 |
| 1128 | 3300025914 | Ga0207671_10354632 | Ga0207671_103546322 | 96 |
| 1129 | 3300025914 | Ga0207671_10480940 | Ga0207671_104809402 | 96 |
| 1130 | 3300025914 | Ga0207671_10621689 | Ga0207671_106216892 | 96 |
| 1131 | 3300025915 | Ga0207693_10024385 | Ga0207693_100243857 | 96 |
| 1132 | 3300025915 | Ga0207693_10216375 | Ga0207693_102163752 | 96 |
| 1133 | 3300025915 | Ga0207693_10312398 | Ga0207693_103123982 | 96 |
| 1134 | 3300025915 | Ga0207693_11474147 | Ga0207693_114741471 | 96 |
| 1135 | 3300025916 | Ga0207663_10350984 | Ga0207663_103509841 | 96 |
| 1136 | 3300025916 | Ga0207663_10573058 | Ga0207663_105730582 | 96 |
| 1137 | 3300025916 | Ga0207663_10914653 | Ga0207663_109146532 | 96 |
| 1138 | 3300025916 | Ga0207663_11278020 | Ga0207663_112780202 | 96 |
| 1139 | 3300025917 | Ga0207660_10003004 | Ga0207660_100030049 | 96 |
| 1140 | 3300025917 | Ga0207660_10043689 | Ga0207660_100436894 | 96 |
| 1141 | 3300025917 | Ga0207660_10153020 | Ga0207660_101530202 | 96 |
| 1142 | 3300025917 | Ga0207660_10243075 | Ga0207660_102430752 | 96 |
| 1143 | 3300025917 | Ga0207660_10371451 | Ga0207660_103714513 | 96 |
| 1144 | 3300025917 | Ga0207660_10700122 | Ga0207660_107001222 | 96 |
| 1145 | 3300025917 | Ga0207660_11152826 | Ga0207660_111528262 | 96 |
| 1146 | 3300025919 | Ga0207657_10037137 | Ga0207657_100371378 | 96 |
| 1147 | 3300025919 | Ga0207657_10063406 | Ga0207657_100634062 | 96 |
| 1148 | 3300025919 | Ga0207657_10423466 | Ga0207657_104234662 | 96 |
| 1149 | 3300025920 | Ga0207649_10000194 | Ga0207649_1000019456 | 96 |
| 1150 | 3300025920 | Ga0207649_10176862 | Ga0207649_101768623 | 96 |
| 1151 | 3300025920 | Ga0207649_10251578 | Ga0207649_102515783 | 96 |
| 1152 | 3300025920 | Ga0207649_10255186 | Ga0207649_102551862 | 96 |
| 1153 | 3300025920 | Ga0207649_10476632 | Ga0207649_104766322 | 96 |
| 1154 | 3300025920 | Ga0207649_10568649 | Ga0207649_105686492 | 96 |
| 1155 | 3300025921 | Ga0207652_10108322 | Ga0207652_101083222 | 96 |
| 1156 | 3300025921 | Ga0207652_10150019 | Ga0207652_101500191 | 96 |
| 1157 | 3300025921 | Ga0207652_10206951 | Ga0207652_102069513 | 96 |
| 1158 | 3300025921 | Ga0207652_10454365 | Ga0207652_104543653 | 96 |
| 1159 | 3300025921 | Ga0207652_10708442 | Ga0207652_107084422 | 96 |
| 1160 | 3300025921 | Ga0207652_10716193 | Ga0207652_107161932 | 96 |
| 1161 | 3300025921 | Ga0207652_11243291 | Ga0207652_112432912 | 96 |
| 1162 | 3300025921 | Ga0207652_11545672 | Ga0207652_115456722 | 96 |
| 1163 | 3300025922 | Ga0207646_10680554 | Ga0207646_106805541 | 96 |
| 1164 | 3300025923 | Ga0207681_10026657 | Ga0207681_100266574 | 96 |
| 1165 | 3300025923 | Ga0207681_10142714 | Ga0207681_101427142 | 96 |
| 1166 | 3300025923 | Ga0207681_10284058 | Ga0207681_102840583 | 96 |
| 1167 | 3300025924 | Ga0207694_10022428 | Ga0207694_100224282 | 96 |
| 1168 | 3300025924 | Ga0207694_10042706 | Ga0207694_100427063 | 96 |
| 1169 | 3300025924 | Ga0207694_10221393 | Ga0207694_102213932 | 96 |
| 1170 | 3300025924 | Ga0207694_10592428 | Ga0207694_105924282 | 96 |
| 1171 | 3300025924 | Ga0207694_11360236 | Ga0207694_113602361 | 96 |
| 1172 | 3300025924 | Ga0207694_11390346 | Ga0207694_113903462 | 96 |
| 1173 | 3300025924 | Ga0207694_11424682 | Ga0207694_114246822 | 96 |
| 1174 | 3300025924 | Ga0207694_11523464 | Ga0207694_115234641 | 96 |
| 1175 | 3300025924 | Ga0207694_11894025 | Ga0207694_118940251 | 96 |
| 1176 | 3300025925 | Ga0207650_10171098 | Ga0207650_101710982 | 96 |
| 1177 | 3300025925 | Ga0207650_10425877 | Ga0207650_104258772 | 96 |
| 1178 | 3300025925 | Ga0207650_10540337 | Ga0207650_105403371 | 96 |
| 1179 | 3300025925 | Ga0207650_10781595 | Ga0207650_107815951 | 96 |
| 1180 | 3300025925 | Ga0207650_11071988 | Ga0207650_110719881 | 96 |
| 1181 | 3300025926 | Ga0207659_10166081 | Ga0207659_101660814 | 96 |
| 1182 | 3300025926 | Ga0207659_10367555 | Ga0207659_103675552 | 96 |
| 1183 | 3300025927 | Ga0207687_10085895 | Ga0207687_100858955 | 96 |
| 1184 | 3300025927 | Ga0207687_10215504 | Ga0207687_102155042 | 96 |
| 1185 | 3300025927 | Ga0207687_10311953 | Ga0207687_103119533 | 96 |
| 1186 | 3300025927 | Ga0207687_10402010 | Ga0207687_104020101 | 96 |
| 1187 | 3300025927 | Ga0207687_11544316 | Ga0207687_115443161 | 96 |
| 1188 | 3300025928 | Ga0207700_10020136 | Ga0207700_1002013610 | 96 |
| 1189 | 3300025928 | Ga0207700_10121231 | Ga0207700_101212313 | 96 |
| 1190 | 3300025928 | Ga0207700_10145860 | Ga0207700_101458601 | 96 |
| 1191 | 3300025928 | Ga0207700_10322910 | Ga0207700_103229102 | 96 |
| 1192 | 3300025928 | Ga0207700_11114427 | Ga0207700_111144271 | 96 |
| 1193 | 3300025929 | Ga0207664_10015881 | Ga0207664_1001588110 | 96 |
| 1194 | 3300025929 | Ga0207664_11000656 | Ga0207664_110006562 | 96 |
| 1195 | 3300025929 | Ga0207664_11926278 | Ga0207664_119262782 | 96 |
| 1196 | 3300025931 | Ga0207644_10400322 | Ga0207644_104003221 | 96 |
| 1197 | 3300025931 | Ga0207644_11071391 | Ga0207644_110713912 | 96 |
| 1198 | 3300025932 | Ga0207690_10029346 | Ga0207690_100293466 | 96 |
| 1199 | 3300025932 | Ga0207690_10332331 | Ga0207690_103323313 | 96 |
| 1200 | 3300025932 | Ga0207690_11299527 | Ga0207690_112995272 | 96 |
| 1201 | 3300025934 | Ga0207686_10137320 | Ga0207686_101373203 | 96 |
| 1202 | 3300025934 | Ga0207686_10380969 | Ga0207686_103809692 | 96 |
| 1203 | 3300025934 | Ga0207686_10602867 | Ga0207686_106028672 | 96 |
| 1204 | 3300025934 | Ga0207686_10807746 | Ga0207686_108077462 | 96 |
| 1205 | 3300025935 | Ga0207709_10018685 | Ga0207709_100186854 | 96 |
| 1206 | 3300025935 | Ga0207709_10125051 | Ga0207709_101250514 | 96 |
| 1207 | 3300025936 | Ga0207670_10028318 | Ga0207670_100283186 | 96 |
| 1208 | 3300025936 | Ga0207670_10566270 | Ga0207670_105662702 | 96 |
| 1209 | 3300025936 | Ga0207670_10850450 | Ga0207670_108504502 | 96 |
| 1210 | 3300025937 | Ga0207669_10093454 | Ga0207669_100934544 | 96 |
| 1211 | 3300025937 | Ga0207669_10171086 | Ga0207669_101710862 | 96 |
| 1212 | 3300025937 | Ga0207669_10438509 | Ga0207669_104385091 | 96 |
| 1213 | 3300025937 | Ga0207669_10621926 | Ga0207669_106219262 | 96 |
| 1214 | 3300025937 | Ga0207669_10955462 | Ga0207669_109554622 | 96 |
| 1215 | 3300025938 | Ga0207704_10068198 | Ga0207704_100681986 | 96 |
| 1216 | 3300025938 | Ga0207704_10600811 | Ga0207704_106008112 | 96 |
| 1217 | 3300025938 | Ga0207704_10647320 | Ga0207704_106473202 | 96 |
| 1218 | 3300025939 | Ga0207665_10096951 | Ga0207665_100969514 | 96 |
| 1219 | 3300025939 | Ga0207665_10159215 | Ga0207665_101592152 | 96 |
| 1220 | 3300025939 | Ga0207665_10473408 | Ga0207665_104734082 | 96 |
| 1221 | 3300025941 | Ga0207711_10145656 | Ga0207711_101456565 | 96 |
| 1222 | 3300025941 | Ga0207711_10316184 | Ga0207711_103161843 | 96 |
| 1223 | 3300025941 | Ga0207711_10349566 | Ga0207711_103495663 | 96 |
| 1224 | 3300025941 | Ga0207711_10807876 | Ga0207711_108078762 | 96 |
| 1225 | 3300025941 | Ga0207711_11629537 | Ga0207711_116295371 | 96 |
| 1226 | 3300025941 | Ga0207711_11655553 | Ga0207711_116555532 | 96 |
| 1227 | 3300025942 | Ga0207689_10101680 | Ga0207689_101016805 | 96 |
| 1228 | 3300025942 | Ga0207689_10362866 | Ga0207689_103628662 | 96 |
| 1229 | 3300025942 | Ga0207689_11736626 | Ga0207689_117366261 | 96 |
| 1230 | 3300025944 | Ga0207661_10144696 | Ga0207661_101446962 | 96 |
| 1231 | 3300025944 | Ga0207661_10219381 | Ga0207661_102193813 | 96 |
| 1232 | 3300025944 | Ga0207661_10344571 | Ga0207661_103445712 | 96 |
| 1233 | 3300025944 | Ga0207661_10367957 | Ga0207661_103679572 | 96 |
| 1234 | 3300025944 | Ga0207661_10475832 | Ga0207661_104758322 | 96 |
| 1235 | 3300025944 | Ga0207661_11323273 | Ga0207661_113232732 | 96 |
| 1236 | 3300025945 | Ga0207679_10316118 | Ga0207679_103161182 | 96 |
| 1237 | 3300025945 | Ga0207679_10328620 | Ga0207679_103286201 | 96 |
| 1238 | 3300025945 | Ga0207679_11781860 | Ga0207679_117818602 | 96 |
| 1239 | 3300025945 | Ga0207679_11808868 | Ga0207679_118088682 | 96 |
| 1240 | 3300025949 | Ga0207667_10032409 | Ga0207667_1003240912 | 96 |
| 1241 | 3300025949 | Ga0207667_10128005 | Ga0207667_101280052 | 96 |
| 1242 | 3300025949 | Ga0207667_10190159 | Ga0207667_101901593 | 96 |
| 1243 | 3300025949 | Ga0207667_10769303 | Ga0207667_107693032 | 96 |
| 1244 | 3300025949 | Ga0207667_10776395 | Ga0207667_107763952 | 96 |
| 1245 | 3300025949 | Ga0207667_10884612 | Ga0207667_108846122 | 96 |
| 1246 | 3300025949 | Ga0207667_10988496 | Ga0207667_109884962 | 96 |
| 1247 | 3300025949 | Ga0207667_11353364 | Ga0207667_113533642 | 96 |
| 1248 | 3300025960 | Ga0207651_10169073 | Ga0207651_101690732 | 96 |
| 1249 | 3300025960 | Ga0207651_10532437 | Ga0207651_105324372 | 96 |
| 1250 | 3300025960 | Ga0207651_10865417 | Ga0207651_108654172 | 96 |
| 1251 | 3300025960 | Ga0207651_10968028 | Ga0207651_109680282 | 96 |
| 1252 | 3300025961 | Ga0207712_10027952 | Ga0207712_100279522 | 96 |
| 1253 | 3300025961 | Ga0207712_10029987 | Ga0207712_100299876 | 96 |
| 1254 | 3300025961 | Ga0207712_10392655 | Ga0207712_103926552 | 96 |
| 1255 | 3300025961 | Ga0207712_10409159 | Ga0207712_104091592 | 96 |
| 1256 | 3300025961 | Ga0207712_11434537 | Ga0207712_114345372 | 96 |
| 1257 | 3300025972 | Ga0207668_10076092 | Ga0207668_100760922 | 96 |
| 1258 | 3300025972 | Ga0207668_10753316 | Ga0207668_107533162 | 96 |
| 1259 | 3300025972 | Ga0207668_10860902 | Ga0207668_108609022 | 96 |
| 1260 | 3300025972 | Ga0207668_11101471 | Ga0207668_111014712 | 96 |
| 1261 | 3300025981 | Ga0207640_10274539 | Ga0207640_102745393 | 96 |
| 1262 | 3300025981 | Ga0207640_10778413 | Ga0207640_107784132 | 96 |
| 1263 | 3300025986 | Ga0207658_10058513 | Ga0207658_100585132 | 96 |
| 1264 | 3300025986 | Ga0207658_10167494 | Ga0207658_101674942 | 96 |
| 1265 | 3300025986 | Ga0207658_10708259 | Ga0207658_107082592 | 96 |
| 1266 | 3300025986 | Ga0207658_11350037 | Ga0207658_113500372 | 96 |
| 1267 | 3300025986 | Ga0207658_11552969 | Ga0207658_115529691 | 96 |
| 1268 | 3300025986 | Ga0207658_11823000 | Ga0207658_118230001 | 96 |
| 1269 | 3300026023 | Ga0207677_10368238 | Ga0207677_103682382 | 96 |
| 1270 | 3300026023 | Ga0207677_10731759 | Ga0207677_107317592 | 96 |
| 1271 | 3300026023 | Ga0207677_10809695 | Ga0207677_108096952 | 96 |
| 1272 | 3300026035 | Ga0207703_10027678 | Ga0207703_100276782 | 96 |
| 1273 | 3300026035 | Ga0207703_10097052 | Ga0207703_100970521 | 96 |
| 1274 | 3300026035 | Ga0207703_10761871 | Ga0207703_107618712 | 96 |
| 1275 | 3300026035 | Ga0207703_11793975 | Ga0207703_117939752 | 96 |
| 1276 | 3300026041 | Ga0207639_10060119 | Ga0207639_100601195 | 96 |
| 1277 | 3300026041 | Ga0207639_10114112 | Ga0207639_101141124 | 96 |
| 1278 | 3300026041 | Ga0207639_10147933 | Ga0207639_101479335 | 96 |
| 1279 | 3300026041 | Ga0207639_10369626 | Ga0207639_103696263 | 96 |
| 1280 | 3300026041 | Ga0207639_10752376 | Ga0207639_107523763 | 96 |
| 1281 | 3300026041 | Ga0207639_10846791 | Ga0207639_108467912 | 96 |
| 1282 | 3300026041 | Ga0207639_11656380 | Ga0207639_116563802 | 96 |
| 1283 | 3300026067 | Ga0207678_10000118 | Ga0207678_1000011844 | 96 |
| 1284 | 3300026075 | Ga0207708_10346128 | Ga0207708_103461282 | 96 |
| 1285 | 3300026075 | Ga0207708_10770664 | Ga0207708_107706642 | 96 |
| 1286 | 3300026078 | Ga0207702_10226977 | Ga0207702_102269774 | 96 |
| 1287 | 3300026078 | Ga0207702_10897278 | Ga0207702_108972782 | 96 |
| 1288 | 3300026078 | Ga0207702_10950716 | Ga0207702_109507162 | 96 |
| 1289 | 3300026078 | Ga0207702_11129747 | Ga0207702_111297472 | 96 |
| 1290 | 3300026078 | Ga0207702_11445335 | Ga0207702_114453351 | 96 |
| 1291 | 3300026088 | Ga0207641_10035109 | Ga0207641_100351096 | 96 |
| 1292 | 3300026088 | Ga0207641_10215049 | Ga0207641_102150494 | 96 |
| 1293 | 3300026088 | Ga0207641_10636383 | Ga0207641_106363831 | 96 |
| 1294 | 3300026088 | Ga0207641_10792941 | Ga0207641_107929413 | 96 |
| 1295 | 3300026088 | Ga0207641_11176651 | Ga0207641_111766511 | 96 |
| 1296 | 3300026089 | Ga0207648_10154508 | Ga0207648_101545084 | 96 |
| 1297 | 3300026089 | Ga0207648_10238236 | Ga0207648_102382363 | 96 |
| 1298 | 3300026089 | Ga0207648_10421221 | Ga0207648_104212212 | 96 |
| 1299 | 3300026089 | Ga0207648_11260003 | Ga0207648_112600032 | 96 |
| 1300 | 3300026095 | Ga0207676_10275805 | Ga0207676_102758053 | 96 |
| 1301 | 3300026095 | Ga0207676_10405870 | Ga0207676_104058702 | 96 |
| 1302 | 3300026095 | Ga0207676_10530481 | Ga0207676_105304813 | 96 |
| 1303 | 3300026095 | Ga0207676_10996869 | Ga0207676_109968691 | 96 |
| 1304 | 3300026095 | Ga0207676_11190143 | Ga0207676_111901432 | 96 |
| 1305 | 3300026116 | Ga0207674_10135964 | Ga0207674_101359645 | 96 |
| 1306 | 3300026116 | Ga0207674_10345588 | Ga0207674_103455883 | 96 |
| 1307 | 3300026116 | Ga0207674_10511916 | Ga0207674_105119161 | 96 |
| 1308 | 3300026116 | Ga0207674_10772138 | Ga0207674_107721382 | 96 |
| 1309 | 3300026118 | Ga0207675_100163578 | Ga0207675_1001635783 | 96 |
| 1310 | 3300026118 | Ga0207675_100486730 | Ga0207675_1004867302 | 96 |
| 1311 | 3300026118 | Ga0207675_100615881 | Ga0207675_1006158813 | 96 |
| 1312 | 3300026121 | Ga0207683_10018489 | Ga0207683_100184899 | 96 |
| 1313 | 3300026121 | Ga0207683_10026403 | Ga0207683_100264038 | 96 |
| 1314 | 3300026121 | Ga0207683_10103171 | Ga0207683_101031713 | 96 |
| 1315 | 3300026121 | Ga0207683_10237421 | Ga0207683_102374213 | 96 |
| 1316 | 3300026121 | Ga0207683_10263843 | Ga0207683_102638433 | 96 |
| 1317 | 3300026121 | Ga0207683_10380731 | Ga0207683_103807312 | 96 |
| 1318 | 3300026142 | Ga0207698_10074815 | Ga0207698_100748155 | 96 |
| 1319 | 3300026142 | Ga0207698_10127754 | Ga0207698_101277544 | 96 |
| 1320 | 3300026142 | Ga0207698_10144541 | Ga0207698_101445414 | 96 |
| 1321 | 3300026142 | Ga0207698_10668335 | Ga0207698_106683352 | 96 |
| 1322 | 3300027471 | Ga0209995_1004561 | Ga0209995_10045612 | 96 |
| 1323 | 3300027512 | Ga0209179_1000116 | Ga0209179_100011613 | 96 |
| 1324 | 3300027665 | Ga0209983_1006615 | Ga0209983_10066156 | 96 |
| 1325 | 3300027695 | Ga0209966_1000641 | Ga0209966_100064111 | 96 |
| 1326 | 3300027907 | Ga0207428_10000169 | Ga0207428_1000016974 | 96 |
| 1327 | 3300027907 | Ga0207428_10030716 | Ga0207428_100307164 | 96 |
| 1328 | 3300027907 | Ga0207428_10885962 | Ga0207428_108859622 | 96 |
| 1329 | 3300028379 | Ga0268266_10000557 | Ga0268266_1000055716 | 96 |
| 1330 | 3300028379 | Ga0268266_10005613 | Ga0268266_1000561317 | 96 |
| 1331 | 3300028379 | Ga0268266_10055515 | Ga0268266_100555152 | 96 |
| 1332 | 3300028379 | Ga0268266_10076582 | Ga0268266_100765827 | 96 |
| 1333 | 3300028379 | Ga0268266_10092509 | Ga0268266_100925095 | 96 |
| 1334 | 3300028379 | Ga0268266_10095842 | Ga0268266_100958422 | 96 |
| 1335 | 3300028379 | Ga0268266_10155348 | Ga0268266_101553484 | 96 |
| 1336 | 3300028379 | Ga0268266_10166733 | Ga0268266_101667332 | 96 |
| 1337 | 3300028379 | Ga0268266_10439319 | Ga0268266_104393193 | 96 |
| 1338 | 3300028379 | Ga0268266_10854206 | Ga0268266_108542062 | 96 |
| 1339 | 3300028379 | Ga0268266_11351711 | Ga0268266_113517112 | 96 |
| 1340 | 3300028379 | Ga0268266_11571301 | Ga0268266_115713011 | 96 |
| 1341 | 3300028379 | Ga0268266_11720622 | Ga0268266_117206221 | 96 |
| 1342 | 3300028379 | Ga0268266_12070157 | Ga0268266_120701571 | 96 |
| 1343 | 3300028380 | Ga0268265_10010282 | Ga0268265_100102825 | 96 |
| 1344 | 3300028380 | Ga0268265_10035295 | Ga0268265_100352955 | 96 |
| 1345 | 3300028380 | Ga0268265_10272456 | Ga0268265_102724564 | 96 |
| 1346 | 3300028380 | Ga0268265_11170634 | Ga0268265_111706341 | 96 |
| 1347 | 3300028380 | Ga0268265_11214200 | Ga0268265_112142001 | 96 |
| 1348 | 3300028380 | Ga0268265_11592757 | Ga0268265_115927572 | 96 |
| 1349 | 3300028381 | Ga0268264_10525570 | Ga0268264_105255702 | 96 |
| 1350 | 3300028381 | Ga0268264_11786672 | Ga0268264_117866721 | 96 |
| 1351 | 3300028556 | Ga0265337_1029032 | Ga0265337_10290323 | 96 |
| 1352 | 3300028794 | Ga0307515_10072629 | Ga0307515_100726297 | 96 |
| 1353 | 3300028800 | Ga0265338_10002896 | Ga0265338_1000289631 | 96 |
| 1354 | 3300028800 | Ga0265338_10008853 | Ga0265338_1000885316 | 96 |
| 1355 | 3300028800 | Ga0265338_10252984 | Ga0265338_102529842 | 96 |
| 1356 | 3300029957 | Ga0265324_10010483 | Ga0265324_100104838 | 96 |
| 1357 | 3300029957 | Ga0265324_10067274 | Ga0265324_100672743 | 96 |
| 1358 | 3300030522 | Ga0307512_10143919 | Ga0307512_101439191 | 96 |
| 1359 | 3300030836 | Ga0265767_105512 | Ga0265767_1055122 | 96 |
| 1360 | 3300030863 | Ga0265766_1006157 | Ga0265766_10061572 | 96 |
| 1361 | 3300030882 | Ga0265764_109258 | Ga0265764_1092581 | 96 |
| 1362 | 3300030889 | Ga0265761_109076 | Ga0265761_1090761 | 96 |
| 1363 | 3300031090 | Ga0265760_10212807 | Ga0265760_102128071 | 96 |
| 1364 | 3300031240 | Ga0265320_10022900 | Ga0265320_100229005 | 96 |
| 1365 | 3300031242 | Ga0265329_10324821 | Ga0265329_103248212 | 96 |
| 1366 | 3300031247 | Ga0265340_10042240 | Ga0265340_100422403 | 96 |
| 1367 | 3300031250 | Ga0265331_10000543 | Ga0265331_1000054338 | 96 |
| 1368 | 3300031250 | Ga0265331_10003502 | Ga0265331_1000350216 | 96 |
| 1369 | 3300031250 | Ga0265331_10013838 | Ga0265331_100138385 | 96 |
| 1370 | 3300031250 | Ga0265331_10016732 | Ga0265331_100167328 | 96 |
| 1371 | 3300031250 | Ga0265331_10171878 | Ga0265331_101718783 | 96 |
| 1372 | 3300031250 | Ga0265331_10249395 | Ga0265331_102493952 | 96 |
| 1373 | 3300031251 | Ga0265327_10000392 | Ga0265327_10000392122 | 96 |
| 1374 | 3300031251 | Ga0265327_10001257 | Ga0265327_1000125733 | 96 |
| 1375 | 3300031251 | Ga0265327_10082992 | Ga0265327_100829922 | 96 |
| 1376 | 3300031251 | Ga0265327_10188601 | Ga0265327_101886012 | 96 |
| 1377 | 3300031251 | Ga0265327_10357150 | Ga0265327_103571502 | 96 |
| 1378 | 3300031344 | Ga0265316_10023098 | Ga0265316_100230985 | 96 |
| 1379 | 3300031344 | Ga0265316_10228372 | Ga0265316_102283723 | 96 |
| 1380 | 3300031456 | Ga0307513_10545964 | Ga0307513_105459641 | 96 |
| 1381 | 3300031548 | Ga0307408_100343964 | Ga0307408_1003439643 | 96 |
| 1382 | 3300031548 | Ga0307408_100857199 | Ga0307408_1008571992 | 96 |
| 1383 | 3300031595 | Ga0265313_10004521 | Ga0265313_1000452115 | 96 |
| 1384 | 3300031616 | Ga0307508_10130442 | Ga0307508_101304423 | 96 |
| 1385 | 3300031616 | Ga0307508_10851291 | Ga0307508_108512911 | 96 |
| 1386 | 3300031711 | Ga0265314_10016595 | Ga0265314_100165956 | 96 |
| 1387 | 3300031711 | Ga0265314_10023749 | Ga0265314_1002374910 | 96 |
| 1388 | 3300031711 | Ga0265314_10056619 | Ga0265314_100566194 | 96 |
| 1389 | 3300031711 | Ga0265314_10107669 | Ga0265314_101076692 | 96 |
| 1390 | 3300031711 | Ga0265314_10179813 | Ga0265314_101798132 | 96 |
| 1391 | 3300031711 | Ga0265314_10648649 | Ga0265314_106486492 | 96 |
| 1392 | 3300031730 | Ga0307516_10069198 | Ga0307516_100691984 | 96 |
| 1393 | 3300031730 | Ga0307516_10128092 | Ga0307516_101280923 | 96 |
| 1394 | 3300031730 | Ga0307516_10239808 | Ga0307516_102398083 | 96 |
| 1395 | 3300031730 | Ga0307516_10646932 | Ga0307516_106469321 | 96 |
| 1396 | 3300031731 | Ga0307405_10794865 | Ga0307405_107948652 | 96 |
| 1397 | 3300031731 | Ga0307405_11447559 | Ga0307405_114475591 | 96 |
| 1398 | 3300031824 | Ga0307413_10024003 | Ga0307413_100240038 | 96 |
| 1399 | 3300031852 | Ga0307410_10015925 | Ga0307410_100159256 | 96 |
| 1400 | 3300031852 | Ga0307410_11938915 | Ga0307410_119389151 | 96 |
| 1401 | 3300031901 | Ga0307406_10576971 | Ga0307406_105769712 | 96 |
| 1402 | 3300031901 | Ga0307406_10863544 | Ga0307406_108635442 | 96 |
| 1403 | 3300031903 | Ga0307407_10020831 | Ga0307407_100208315 | 96 |
| 1404 | 3300031903 | Ga0307407_10154073 | Ga0307407_101540731 | 96 |
| 1405 | 3300031903 | Ga0307407_11490343 | Ga0307407_114903431 | 96 |
| 1406 | 3300031903 | Ga0307407_11593366 | Ga0307407_115933661 | 96 |
| 1407 | 3300031911 | Ga0307412_10319743 | Ga0307412_103197433 | 96 |
| 1408 | 3300031911 | Ga0307412_11991834 | Ga0307412_119918341 | 96 |
| 1409 | 3300031995 | Ga0307409_100305410 | Ga0307409_1003054103 | 96 |
| 1410 | 3300031995 | Ga0307409_100803285 | Ga0307409_1008032852 | 96 |
| 1411 | 3300032002 | Ga0307416_100088575 | Ga0307416_1000885753 | 96 |
| 1412 | 3300032002 | Ga0307416_101046865 | Ga0307416_1010468652 | 96 |
| 1413 | 3300032002 | Ga0307416_102437823 | Ga0307416_1024378231 | 96 |
| 1414 | 3300032005 | Ga0307411_10038579 | Ga0307411_100385797 | 96 |
| 1415 | 3300032005 | Ga0307411_10758494 | Ga0307411_107584942 | 96 |
| 1416 | 3300032005 | Ga0307411_11477840 | Ga0307411_114778402 | 96 |
| 1417 | 3300032005 | Ga0307411_11740186 | Ga0307411_117401861 | 96 |
| 1418 | 3300032126 | Ga0307415_100734163 | Ga0307415_1007341633 | 96 |
| 1419 | 3300032126 | Ga0307415_100893816 | Ga0307415_1008938162 | 96 |
| 1420 | 3300032168 | Ga0316593_10011301 | Ga0316593_100113013 | 96 |
| 1421 | 3300032168 | Ga0316593_10039890 | Ga0316593_100398901 | 96 |
| 1422 | 3300032168 | Ga0316593_10039922 | Ga0316593_100399221 | 96 |
| 1423 | 3300033180 | Ga0307510_10135648 | Ga0307510_101356484 | 96 |
| 1424 | 3300033180 | Ga0307510_10628395 | Ga0307510_106283951 | 96 |
| 1425 | 3300033528 | Ga0316588_1031798 | Ga0316588_10317982 | 96 |
| 1426 | 3300034816 | Ga0373930_0000191 | Ga0373930_0000191_2968_3273 | 96 |
| 1427 | 3300034816 | Ga0373930_0013501 | Ga0373930_0013501_715_1020 | 96 |
| 1428 | 3300034817 | Ga0373948_0002325 | Ga0373948_0002325_481_786 | 96 |
| 1429 | 3300034818 | Ga0373950_0000155 | Ga0373950_0000155_9257_9562 | 96 |
| 1430 | 3300034819 | Ga0373958_0002981 | Ga0373958_0002981_2012_2317 | 96 |
| 1431 | 3300034820 | Ga0373959_0001384 | Ga0373959_0001384_1520_1825 | 96 |
| 1432 | 3300034957 | Ga0373938_0000013 | Ga0373938_0000013_3161_3466 | 96 |
| 1433 | 3300035084 | Ga0373928_0000255 | Ga0373928_0000255_8459_8764 | 96 |
| 1434 | 3300035085 | Ga0373929_0003185 | Ga0373929_0003185_677_982 | 96 |
| 1435 | 3300035086 | Ga0373934_0275744 | Ga0373934_0275744_36_341 | 96 |
| 1436 | 3300035088 | Ga0373940_0001317 | Ga0373940_0001317_4031_4336 | 96 |
| 1437 | 3300035090 | Ga0373949_0001716 | Ga0373949_0001716_659_964 | 96 |
| 1438 | 3300035091 | Ga0373951_0000552 | Ga0373951_0000552_4652_4957 | 96 |
| 1439 | 3300035092 | Ga0373952_0000182 | Ga0373952_0000182_2002_2307 | 96 |
| 1440 | 3300035111 | Ga0373923_0002759 | Ga0373923_0002759_2299_2604 | 96 |
| 1441 | 3300035111 | Ga0373923_0040828 | Ga0373923_0040828_394_699 | 96 |
| 1442 | 3300035111 | Ga0373923_0096666 | Ga0373923_0096666_704_1009 | 96 |
| 1443 | 3300035112 | Ga0373932_0000252 | Ga0373932_0000252_1416_1721 | 96 |
| 1444 | 3300035112 | Ga0373932_0230488 | Ga0373932_0230488_183_488 | 96 |
| 1445 | 3300035113 | Ga0373936_0033903 | Ga0373936_0033903_741_1046 | 96 |
| 1446 | 3300035113 | Ga0373936_0276834 | Ga0373936_0276834_69_374 | 96 |
| 1447 | 3300035113 | Ga0373936_0277884 | Ga0373936_0277884_254_559 | 96 |
| 1448 | 3300035113 | Ga0373936_0447114 | Ga0373936_0447114_166_471 | 96 |
| 1449 | 3300035114 | Ga0373939_0006119 | Ga0373939_0006119_1929_2234 | 96 |
| 1450 | 3300035115 | Ga0373941_0036248 | Ga0373941_0036248_889_1194 | 96 |
| 1451 | 3300035115 | Ga0373941_0101183 | Ga0373941_0101183_513_818 | 96 |
| 1452 | 3300035115 | Ga0373941_0322843 | Ga0373941_0322843_161_466 | 96 |
| 1453 | 3300035116 | Ga0373945_0018664 | Ga0373945_0018664_245_550 | 96 |
| 1454 | 3300035116 | Ga0373945_0459882 | Ga0373945_0459882_184_489 | 96 |
| 1455 | 3300035117 | Ga0373953_0269230 | Ga0373953_0269230_46_351 | 96 |
| 1456 | 3300035117 | Ga0373953_0573873 | Ga0373953_0573873_91_396 | 96 |
| 1457 | 3300035118 | Ga0373954_0022106 | Ga0373954_0022106_1223_1528 | 96 |
| 1458 | 3300035118 | Ga0373954_0340621 | Ga0373954_0340621_259_564 | 96 |
| 1459 | 3300035118 | Ga0373954_0386414 | Ga0373954_0386414_206_511 | 96 |
| 1460 | 3300035119 | Ga0373956_0053480 | Ga0373956_0053480_473_778 | 96 |
| 1461 | 3300035120 | Ga0373957_0013550 | Ga0373957_0013550_766_1071 | 96 |
| 1462 | 3300035121 | Ga0373960_0000068 | Ga0373960_0000068_9465_9770 | 96 |
| 1463 | 3300035121 | Ga0373960_0074297 | Ga0373960_0074297_599_904 | 96 |
| 1464 | 3300035121 | Ga0373960_0091460 | Ga0373960_0091460_286_591 | 96 |
| 1465 | 3300035170 | Ga0373943_0058840 | Ga0373943_0058840_1535_1840 | 96 |
| 1466 | 3300035170 | Ga0373943_0063345 | Ga0373943_0063345_813_1118 | 96 |
| 1467 | 3300035170 | Ga0373943_0263265 | Ga0373943_0263265_548_853 | 96 |
| 1468 | 3300035170 | Ga0373943_0292669 | Ga0373943_0292669_307_612 | 96 |
| 1469 | 3300035171 | Ga0373946_0194612 | Ga0373946_0194612_536_841 | 96 |
| 1470 | 3300035171 | Ga0373946_0370831 | Ga0373946_0370831_25_330 | 96 |
| 1471 | 3300035172 | Ga0373955_0028306 | Ga0373955_0028306_1927_2232 | 96 |
| 1472 | 3300035172 | Ga0373955_0125577 | Ga0373955_0125577_177_482 | 96 |
| 1473 | 3300035172 | Ga0373955_0163547 | Ga0373955_0163547_638_943 | 96 |
| 1474 | 3300035207 | Ga0373942_0001815 | Ga0373942_0001815_3159_3464 | 96 |
| 1475 | 3300035241 | Ga0373961_0003115 | Ga0373961_0003115_3833_4138 | 96 |
| 1476 | 3300035242 | Ga0373962_0000112 | Ga0373962_0000112_10803_11108 | 96 |
| 1477 | 3300035242 | Ga0373962_0409820 | Ga0373962_0409820_88_393 | 96 |
| 1478 | 3300035691 | Ga0373931_0001634 | Ga0373931_0001634_3709_4014 | 96 |
| 1479 | 3300035691 | Ga0373931_0121321 | Ga0373931_0121321_946_1251 | 96 |
| 1480 | 3300035691 | Ga0373931_0508275 | Ga0373931_0508275_373_678 | 96 |
| 1481 | 3300035691 | Ga0373931_0573337 | Ga0373931_0573337_169_474 | 96 |
| 1482 | 3300035692 | Ga0373935_0004282 | Ga0373935_0004282_6155_6460 | 96 |
| 1483 | 3300035692 | Ga0373935_0027495 | Ga0373935_0027495_1348_1653 | 96 |
| 1484 | 3300035692 | Ga0373935_0069246 | Ga0373935_0069246_1195_1500 | 96 |
| 1485 | 3300035692 | Ga0373935_0133269 | Ga0373935_0133269_390_695 | 96 |
| 1486 | 3300035692 | Ga0373935_0360337 | Ga0373935_0360337_709_1014 | 96 |
| 1487 | 3300035692 | Ga0373935_1295526 | Ga0373935_1295526_124_429 | 96 |
| 1488 | 3300035695 | Ga0373927_0148977 | Ga0373927_0148977_112_417 | 96 |
| 1489 | 3300035695 | Ga0373927_0174637 | Ga0373927_0174637_722_1027 | 96 |
| 1490 | 3300035695 | Ga0373927_0196004 | Ga0373927_0196004_693_998 | 96 |
| 1491 | 3300035695 | Ga0373927_0238366 | Ga0373927_0238366_337_642 | 96 |
| 1492 | 3300035695 | Ga0373927_0248463 | Ga0373927_0248463_830_1135 | 96 |
| 1493 | 3300035695 | Ga0373927_0382694 | Ga0373927_0382694_313_618 | 96 |
| 1494 | 3300035724 | Ga0373933_0013505 | Ga0373933_0013505_2157_2462 | 96 |
| 1495 | 3300035724 | Ga0373933_0117754 | Ga0373933_0117754_252_557 | 96 |
| 1496 | 3300035724 | Ga0373933_0288470 | Ga0373933_0288470_290_595 | 96 |
| 1497 | 3300035724 | Ga0373933_0855275 | Ga0373933_0855275_46_351 | 96 |
| 1498 | 3300035725 | Ga0373947_0064868 | Ga0373947_0064868_372_677 | 96 |
| 1499 | 3300035725 | Ga0373947_0065025 | Ga0373947_0065025_1273_1578 | 96 |
| 1500 | 3300035725 | Ga0373947_0076251 | Ga0373947_0076251_1622_1927 | 96 |
| 1501 | 3300035725 | Ga0373947_0084575 | Ga0373947_0084575_94_399 | 96 |
| 1502 | 3300035725 | Ga0373947_0185690 | Ga0373947_0185690_907_1212 | 96 |
| 1503 | 3300035725 | Ga0373947_0531279 | Ga0373947_0531279_357_662 | 96 |
| 1504 | 3300036401 | Ga0373937_0000922 | Ga0373937_0000922_14149_14454 | 96 |
| 1505 | 3300036401 | Ga0373937_0008630 | Ga0373937_0008630_8274_8579 | 96 |
| 1506 | 3300036401 | Ga0373937_0032792 | Ga0373937_0032792_3857_4162 | 96 |
| 1507 | 3300036401 | Ga0373937_0062577 | Ga0373937_0062577_2537_2842 | 96 |
| 1508 | 3300036401 | Ga0373937_0083755 | Ga0373937_0083755_2518_2823 | 96 |
| 1509 | 3300036401 | Ga0373937_0178272 | Ga0373937_0178272_1084_1389 | 96 |
| 1510 | 3300036401 | Ga0373937_1094240 | Ga0373937_1094240_271_576 | 96 |
| 1511 | 3300036457 | Ga0265778_001977 | Ga0265778_001977_128_433 | 96 |
| 1512 | 3300036457 | Ga0265778_031317 | Ga0265778_031317_105_410 | 96 |
| 1513 | 3300037068 | Ga0373925_0008231 | Ga0373925_0008231_1024_1329 | 96 |
| 1514 | 3300037068 | Ga0373925_0040367 | Ga0373925_0040367_2582_2887 | 96 |
| 1515 | 3300037068 | Ga0373925_0041086 | Ga0373925_0041086_753_1058 | 96 |
| 1516 | 3300037068 | Ga0373925_0194637 | Ga0373925_0194637_1012_1317 | 96 |
| 1517 | 3300037312 | Ga0395899_0066694 | Ga0395899_0066694_1913_2218 | 96 |
| 1518 | 3300037312 | Ga0395899_0081254 | Ga0395899_0081254_359_664 | 96 |
| 1519 | 3300037312 | Ga0395899_0105847 | Ga0395899_0105847_980_1285 | 96 |
| 1520 | 3300037418 | Ga0395900_0021199 | Ga0395900_0021199_473_778 | 96 |
| 1521 | 3300037418 | Ga0395900_0451558 | Ga0395900_0451558_665_970 | 96 |
| 1522 | 3300037418 | Ga0395900_0452931 | Ga0395900_0452931_349_654 | 96 |
| 1523 | 3300037418 | Ga0395900_0597435 | Ga0395900_0597435_122_427 | 96 |
| 1524 | 3300037418 | Ga0395900_1408335 | Ga0395900_1408335_248_553 | 96 |
| 1525 | 3300037466 | Ga0395898_0079037 | Ga0395898_0079037_728_1033 | 96 |
| 1526 | 3300037466 | Ga0395898_0126504 | Ga0395898_0126504_502_807 | 96 |
| 1527 | 3300037466 | Ga0395898_0371181 | Ga0395898_0371181_609_914 | 96 |
| 1528 | 3300037466 | Ga0395898_0490950 | Ga0395898_0490950_62_367 | 96 |
| 1529 | 3300037466 | Ga0395898_1107123 | Ga0395898_1107123_283_588 | 96 |
| 1530 | 3300037466 | Ga0395898_1190711 | Ga0395898_1190711_96_401 | 96 |
| 1531 | 3300037466 | Ga0395898_1637903 | Ga0395898_1637903_133_438 | 96 |
| 1532 | 3300037471 | Ga0395905_0500202 | Ga0395905_0500202_415_720 | 96 |
| 1533 | 3300037471 | Ga0395905_1284528 | Ga0395905_1284528_244_549 | 96 |
| 1534 | 3300037853 | Ga0436364_0043783 | Ga0436364_0043783_343_648 | 96 |
| 1535 | 3300037853 | Ga0436364_0229979 | Ga0436364_0229979_277_582 | 96 |
| 1536 | 3300037853 | Ga0436364_0268578 | Ga0436364_0268578_2490_2795 | 96 |
| 1537 | 3300037853 | Ga0436364_0333490 | Ga0436364_0333490_126_431 | 96 |
| 1538 | 3300037853 | Ga0436364_0460289 | Ga0436364_0460289_20_325 | 96 |
| 1539 | 3300037853 | Ga0436364_0539801 | Ga0436364_0539801_156_461 | 96 |
| 1540 | 3300037853 | Ga0436364_0554982 | Ga0436364_0554982_540_845 | 96 |
| 1541 | 3300037853 | Ga0436364_0586291 | Ga0436364_0586291_6842_7147 | 96 |
| 1542 | 3300037853 | Ga0436364_0764338 | Ga0436364_0764338_26540_26845 | 96 |
| 1543 | 3300037853 | Ga0436364_1062354 | Ga0436364_1062354_5110_5415 | 96 |
| 1544 | 3300037853 | Ga0436364_1442444 | Ga0436364_1442444_2164_2469 | 96 |
| 1545 | 3300037853 | Ga0436364_1552061 | Ga0436364_1552061_210_515 | 96 |
| 1546 | 3300038443 | Ga0395901_0097542 | Ga0395901_0097542_1432_1737 | 96 |
| 1547 | 3300038443 | Ga0395901_0148983 | Ga0395901_0148983_913_1218 | 96 |
| 1548 | 3300038443 | Ga0395901_0177540 | Ga0395901_0177540_469_774 | 96 |
| 1549 | 3300038443 | Ga0395901_0213059 | Ga0395901_0213059_810_1115 | 96 |
| 1550 | 3300038443 | Ga0395901_0865522 | Ga0395901_0865522_508_813 | 96 |
| 1551 | 3300038443 | Ga0395901_0910439 | Ga0395901_0910439_350_655 | 96 |
| 1552 | 3300038443 | Ga0395901_1229977 | Ga0395901_1229977_394_699 | 96 |
| 1553 | 3300038443 | Ga0395901_2014754 | Ga0395901_2014754_31_336 | 96 |
| 1554 | 3300038698 | Ga0242419_011998 | Ga0242419_011998_271_576 | 96 |
| 1555 | 3300038996 | Ga0242420_001271 | Ga0242420_001271_353_658 | 96 |
| 1556 | 3300039437 | Ga0436365_0507021 | Ga0436365_0507021_250_555 | 96 |
| 1557 | 3300039437 | Ga0436365_0678411 | Ga0436365_0678411_48_353 | 96 |
| 1558 | 3300039437 | Ga0436365_1050783 | Ga0436365_1050783_1794_2099 | 96 |
| 1559 | 3300039437 | Ga0436365_1075680 | Ga0436365_1075680_530_835 | 96 |
| 1560 | 3300039437 | Ga0436365_1215018 | Ga0436365_1215018_2818_3123 | 96 |
| 1561 | 3300039437 | Ga0436365_1623855 | Ga0436365_1623855_24_329 | 96 |
| 1562 | 3300039437 | Ga0436365_1790914 | Ga0436365_1790914_746_1051 | 96 |
| 1563 | 3300039437 | Ga0436365_1902383 | Ga0436365_1902383_313_618 | 96 |
| 1564 | 3300039438 | Ga0436360_0232519 | Ga0436360_0232519_186_491 | 96 |
| 1565 | 3300039438 | Ga0436360_0248409 | Ga0436360_0248409_484_789 | 96 |
| 1566 | 3300039438 | Ga0436360_0259420 | Ga0436360_0259420_286_591 | 96 |
| 1567 | 3300039438 | Ga0436360_0272188 | Ga0436360_0272188_285_590 | 96 |
| 1568 | 3300039438 | Ga0436360_0360048 | Ga0436360_0360048_1672_1977 | 96 |
| 1569 | 3300039438 | Ga0436360_0493064 | Ga0436360_0493064_79_384 | 96 |
| 1570 | 3300039438 | Ga0436360_0527459 | Ga0436360_0527459_237_542 | 96 |
| 1571 | 3300039438 | Ga0436360_0663233 | Ga0436360_0663233_27_332 | 96 |
| 1572 | 3300039438 | Ga0436360_0765106 | Ga0436360_0765106_46_351 | 96 |
| 1573 | 3300039438 | Ga0436360_0846287 | Ga0436360_0846287_908_1213 | 96 |
| 1574 | 3300039438 | Ga0436360_1065206 | Ga0436360_1065206_206_511 | 96 |
| 1575 | 3300039438 | Ga0436360_1169610 | Ga0436360_1169610_184_489 | 96 |
| 1576 | 3300039438 | Ga0436360_1205890 | Ga0436360_1205890_111_416 | 96 |
| 1577 | 3300039438 | Ga0436360_1229176 | Ga0436360_1229176_3303_3608 | 96 |
| 1578 | 3300039438 | Ga0436360_1302627 | Ga0436360_1302627_332_637 | 96 |
| 1579 | 3300039447 | Ga0436361_0016113 | Ga0436361_0016113_1899_2204 | 96 |
| 1580 | 3300039447 | Ga0436361_0045826 | Ga0436361_0045826_92_397 | 96 |
| 1581 | 3300039447 | Ga0436361_0057420 | Ga0436361_0057420_178_483 | 96 |
| 1582 | 3300039447 | Ga0436361_0291526 | Ga0436361_0291526_683_988 | 96 |
| 1583 | 3300039447 | Ga0436361_0299606 | Ga0436361_0299606_683_988 | 96 |
| 1584 | 3300039447 | Ga0436361_0518587 | Ga0436361_0518587_151_456 | 96 |
| 1585 | 3300039447 | Ga0436361_0585521 | Ga0436361_0585521_87_392 | 96 |
| 1586 | 3300039447 | Ga0436361_0598899 | Ga0436361_0598899_187_492 | 96 |
| 1587 | 3300039447 | Ga0436361_0627073 | Ga0436361_0627073_522_827 | 96 |
| 1588 | 3300039447 | Ga0436361_0663751 | Ga0436361_0663751_51_356 | 96 |
| 1589 | 3300039447 | Ga0436361_0765661 | Ga0436361_0765661_455_760 | 96 |
| 1590 | 3300039447 | Ga0436361_0783925 | Ga0436361_0783925_811_1116 | 96 |
| 1591 | 3300039447 | Ga0436361_0878406 | Ga0436361_0878406_1273_1578 | 96 |
| 1592 | 3300039447 | Ga0436361_1000576 | Ga0436361_1000576_201_506 | 96 |
| 1593 | 3300039447 | Ga0436361_1164878 | Ga0436361_1164878_6318_6623 | 96 |
| 1594 | 3300039447 | Ga0436361_1167977 | Ga0436361_1167977_442_747 | 96 |
| 1595 | 3300039450 | Ga0436363_0247885 | Ga0436363_0247885_159_464 | 96 |
| 1596 | 3300039450 | Ga0436363_0315020 | Ga0436363_0315020_1915_2220 | 96 |
| 1597 | 3300039450 | Ga0436363_0548499 | Ga0436363_0548499_70_375 | 96 |
| 1598 | 3300039450 | Ga0436363_0687461 | Ga0436363_0687461_183_488 | 96 |
| 1599 | 3300039450 | Ga0436363_0799449 | Ga0436363_0799449_326_631 | 96 |
| 1600 | 3300039450 | Ga0436363_0819400 | Ga0436363_0819400_276_581 | 96 |
| 1601 | 3300039450 | Ga0436363_1206715 | Ga0436363_1206715_208_513 | 96 |
| 1602 | 3300039450 | Ga0436363_1250759 | Ga0436363_1250759_916_1221 | 96 |
| 1603 | 3300039450 | Ga0436363_1566193 | Ga0436363_1566193_257_562 | 96 |
| 1604 | 3300039453 | Ga0436362_0830432 | Ga0436362_0830432_291_596 | 96 |
| 1605 | 3300039453 | Ga0436362_0967331 | Ga0436362_0967331_1283_1588 | 96 |
| 1606 | 3300039453 | Ga0436362_1174560 | Ga0436362_1174560_35_340 | 96 |
| 1607 | 3300039453 | Ga0436362_1218939 | Ga0436362_1218939_249_554 | 96 |
| 1608 | 3300041406 | Ga0439439_0146717 | Ga0439439_0146717_46_351 | 96 |
| 1609 | 3300041411 | Ga0439466_0098324 | Ga0439466_0098324_366_671 | 96 |
| 1610 | 3300041451 | Ga0451791_0161050 | Ga0451791_0161050_392_697 | 96 |
| 1611 | 3300041452 | Ga0451793_0993829 | Ga0451793_0993829_409_714 | 96 |
| 1612 | 3300041456 | Ga0451795_1275112 | Ga0451795_1275112_337_642 | 96 |
| 1613 | 3300041486 | Ga0451807_0922472 | Ga0451807_0922472_150_455 | 96 |
| 1614 | 3300041511 | Ga0451855_1875439 | Ga0451855_1875439_406_711 | 96 |
| 1615 | 3300041512 | Ga0451853_1497689 | Ga0451853_1497689_297_602 | 96 |
| 1616 | 3300041512 | Ga0451853_2532658 | Ga0451853_2532658_324_629 | 96 |
| 1617 | 3300042001 | Ga0439441_019729 | Ga0439441_019729_266_571 | 96 |
| 1618 | 3300042002 | Ga0439442_044068 | Ga0439442_044068_446_751 | 96 |
| 1619 | 3300042004 | Ga0439445_0048451 | Ga0439445_0048451_334_639 | 96 |
| 1620 | 3300042006 | Ga0439432_195556 | Ga0439432_195556_13_318 | 96 |
| 1621 | 3300042008 | Ga0439450_057268 | Ga0439450_057268_427_732 | 96 |
| 1622 | 3300042008 | Ga0439450_169890 | Ga0439450_169890_197_502 | 96 |
| 1623 | 3300042010 | Ga0439452_043594 | Ga0439452_043594_350_655 | 96 |
| 1624 | 3300042014 | Ga0439457_106639 | Ga0439457_106639_19_324 | 96 |
| 1625 | 3300042436 | Ga0439435_0180555 | Ga0439435_0180555_269_574 | 96 |
| 1626 | 3300042461 | Ga0439460_0270366 | Ga0439460_0270366_15_320 | 96 |
| 1627 | 3300042876 | Ga0451577_0018151 | Ga0451577_0018151_314_619 | 96 |
| 1628 | 3300042876 | Ga0451577_0112731 | Ga0451577_0112731_367_672 | 96 |
| 1629 | 3300042876 | Ga0451577_1517393 | Ga0451577_1517393_22_327 | 96 |
| 1630 | 3300042993 | Ga0439440_0209909 | Ga0439440_0209909_48_353 | 96 |
| 1631 | 3300044673 | Ga0453683_0555259 | Ga0453683_0555259_134_439 | 96 |
| 1632 | 3300044673 | Ga0453683_1185856 | Ga0453683_1185856_119_424 | 96 |
| 1633 | 3300044684 | Ga0466966_0064041 | Ga0466966_0064041_1556_1861 | 96 |
| 1634 | 3300044684 | Ga0466966_0717170 | Ga0466966_0717170_178_483 | 96 |
| 1635 | 3300044693 | Ga0466961_0078638 | Ga0466961_0078638_180_485 | 96 |
| 1636 | 3300044693 | Ga0466961_0245939 | Ga0466961_0245939_301_606 | 96 |
| 1637 | 3300044693 | Ga0466961_0499899 | Ga0466961_0499899_33_338 | 96 |
| 1638 | 3300044693 | Ga0466961_0696513 | Ga0466961_0696513_31_336 | 96 |
| 1639 | 3300044694 | Ga0466963_0129768 | Ga0466963_0129768_779_1084 | 96 |
| 1640 | 3300044694 | Ga0466963_0346764 | Ga0466963_0346764_15_320 | 96 |
| 1641 | 3300044694 | Ga0466963_0349140 | Ga0466963_0349140_22_327 | 96 |
| 1642 | 3300044694 | Ga0466963_0984772 | Ga0466963_0984772_213_518 | 96 |
| 1643 | 3300044712 | Ga0453684_0000204 | Ga0453684_0000204_6544_6849 | 96 |
| 1644 | 3300044712 | Ga0453684_0001066 | Ga0453684_0001066_6515_6820 | 96 |
| 1645 | 3300044712 | Ga0453684_0005256 | Ga0453684_0005256_19533_19838 | 96 |
| 1646 | 3300044712 | Ga0453684_0157702 | Ga0453684_0157702_1307_1612 | 96 |
| 1647 | 3300044712 | Ga0453684_0890768 | Ga0453684_0890768_450_755 | 96 |
| 1648 | 3300044719 | Ga0466971_0166418 | Ga0466971_0166418_522_827 | 96 |
| 1649 | 3300044719 | Ga0466971_0497659 | Ga0466971_0497659_105_410 | 96 |
| 1650 | 3300044735 | Ga0466968_0184221 | Ga0466968_0184221_192_497 | 96 |
| 1651 | 3300044735 | Ga0466968_0299516 | Ga0466968_0299516_153_458 | 96 |
| 1652 | 3300044765 | Ga0466970_0432624 | Ga0466970_0432624_84_389 | 96 |
| 1653 | 3300044765 | Ga0466970_0466093 | Ga0466970_0466093_78_383 | 96 |
| 1654 | 3300044842 | Ga0466957_0059645 | Ga0466957_0059645_1387_1692 | 96 |
| 1655 | 3300044842 | Ga0466957_0082727 | Ga0466957_0082727_661_966 | 96 |
| 1656 | 3300044842 | Ga0466957_0496615 | Ga0466957_0496615_216_521 | 96 |
| 1657 | 3300044901 | Ga0466960_0498635 | Ga0466960_0498635_287_592 | 96 |
| 1658 | 3300045049 | Ga0466959_0646070 | Ga0466959_0646070_330_635 | 96 |
| 1659 | 3300045051 | Ga0451576_0003979 | Ga0451576_0003979_12587_12892 | 96 |
| 1660 | 3300045051 | Ga0451576_0110602 | Ga0451576_0110602_2197_2502 | 96 |
| 1661 | 3300045051 | Ga0451576_0205880 | Ga0451576_0205880_85_390 | 96 |
| 1662 | 3300045051 | Ga0451576_0646454 | Ga0451576_0646454_76_381 | 96 |
| 1663 | 3300045051 | Ga0451576_0878951 | Ga0451576_0878951_451_756 | 96 |
| 1664 | 3300045051 | Ga0451576_1158947 | Ga0451576_1158947_451_756 | 96 |
| 1665 | 3300045051 | Ga0451576_2048742 | Ga0451576_2048742_53_358 | 96 |
| 1666 | 3300045836 | Ga0466958_0191476 | Ga0466958_0191476_64_369 | 96 |
| 1667 | 3300045836 | Ga0466958_0816289 | Ga0466958_0816289_135_440 | 96 |
| 1668 | 3300045836 | Ga0466958_0977573 | Ga0466958_0977573_43_348 | 96 |
| 1669 | 3300045836 | Ga0466958_1153413 | Ga0466958_1153413_37_342 | 96 |
| 1670 | 3300045976 | Ga0466967_0126564 | Ga0466967_0126564_1043_1348 | 96 |
| 1671 | 3300045976 | Ga0466967_0448230 | Ga0466967_0448230_745_1050 | 96 |
| 1672 | 3300045976 | Ga0466967_0465705 | Ga0466967_0465705_673_978 | 96 |
| 1673 | 3300045976 | Ga0466967_0506163 | Ga0466967_0506163_18_323 | 96 |
| 1674 | 3300045976 | Ga0466967_1106467 | Ga0466967_1106467_313_618 | 96 |
| 1675 | 3300045976 | Ga0466967_1112442 | Ga0466967_1112442_387_692 | 96 |
| 1676 | 3300045976 | Ga0466967_2598278 | Ga0466967_2598278_185_490 | 96 |
| 1677 | 3300046452 | Ga0495617_131390 | Ga0495617_131390_387_692 | 96 |
| 1678 | 3300046452 | Ga0495617_220206 | Ga0495617_220206_153_458 | 96 |
| 1679 | 3300046454 | Ga0495592_0016148 | Ga0495592_0016148_1481_1786 | 96 |
| 1680 | 3300046455 | Ga0495603_0175103 | Ga0495603_0175103_24_329 | 96 |
| 1681 | 3300046459 | Ga0495629_0099980 | Ga0495629_0099980_732_1037 | 96 |
| 1682 | 3300046459 | Ga0495629_0120625 | Ga0495629_0120625_1304_1609 | 96 |
| 1683 | 3300046459 | Ga0495629_0216828 | Ga0495629_0216828_370_675 | 96 |
| 1684 | 3300046459 | Ga0495629_0442119 | Ga0495629_0442119_378_683 | 96 |
| 1685 | 3300046460 | Ga0495638_0108205 | Ga0495638_0108205_1209_1514 | 96 |
| 1686 | 3300046460 | Ga0495638_0392608 | Ga0495638_0392608_25_330 | 96 |
| 1687 | 3300046461 | Ga0495641_0559236 | Ga0495641_0559236_100_405 | 96 |
| 1688 | 3300046462 | Ga0495651_0013876 | Ga0495651_0013876_2667_2972 | 96 |
| 1689 | 3300046462 | Ga0495651_0070762 | Ga0495651_0070762_680_985 | 96 |
| 1690 | 3300046463 | Ga0495653_0133128 | Ga0495653_0133128_1406_1711 | 96 |
| 1691 | 3300046472 | Ga0495580_0875620 | Ga0495580_0875620_138_443 | 96 |
| 1692 | 3300046473 | Ga0495582_0409812 | Ga0495582_0409812_271_576 | 96 |
| 1693 | 3300046475 | Ga0495639_0518269 | Ga0495639_0518269_69_374 | 96 |
| 1694 | 3300046476 | Ga0495662_0338972 | Ga0495662_0338972_256_561 | 96 |
| 1695 | 3300046477 | Ga0495664_0014347 | Ga0495664_0014347_2441_2746 | 96 |
| 1696 | 3300046477 | Ga0495664_0272048 | Ga0495664_0272048_480_785 | 96 |
| 1697 | 3300046477 | Ga0495664_0454051 | Ga0495664_0454051_235_540 | 96 |
| 1698 | 3300046492 | Ga0495585_0180347 | Ga0495585_0180347_653_958 | 96 |
| 1699 | 3300046499 | Ga0495594_0085650 | Ga0495594_0085650_200_505 | 96 |
| 1700 | 3300046499 | Ga0495594_0127254 | Ga0495594_0127254_617_922 | 96 |
| 1701 | 3300046499 | Ga0495594_0751173 | Ga0495594_0751173_227_532 | 96 |
| 1702 | 3300046506 | Ga0495583_0274926 | Ga0495583_0274926_45_350 | 96 |
| 1703 | 3300046507 | Ga0495606_0055740 | Ga0495606_0055740_391_696 | 96 |
| 1704 | 3300046507 | Ga0495606_0248930 | Ga0495606_0248930_122_427 | 96 |
| 1705 | 3300046507 | Ga0495606_0467327 | Ga0495606_0467327_81_386 | 96 |
| 1706 | 3300046511 | Ga0495608_0005788 | Ga0495608_0005788_3997_4302 | 96 |
| 1707 | 3300046511 | Ga0495608_0312524 | Ga0495608_0312524_239_544 | 96 |
| 1708 | 3300046514 | Ga0495618_0352959 | Ga0495618_0352959_549_854 | 96 |
| 1709 | 3300046515 | Ga0495620_0178792 | Ga0495620_0178792_149_454 | 96 |
| 1710 | 3300046516 | Ga0495628_0110696 | Ga0495628_0110696_845_1150 | 96 |
| 1711 | 3300046516 | Ga0495628_0518092 | Ga0495628_0518092_473_778 | 96 |
| 1712 | 3300046516 | Ga0495628_1168676 | Ga0495628_1168676_47_352 | 96 |
| 1713 | 3300046517 | Ga0495630_0444399 | Ga0495630_0444399_207_512 | 96 |
| 1714 | 3300046517 | Ga0495630_0556229 | Ga0495630_0556229_298_603 | 96 |
| 1715 | 3300046518 | Ga0495631_0083702 | Ga0495631_0083702_889_1194 | 96 |
| 1716 | 3300046519 | Ga0495632_0088938 | Ga0495632_0088938_234_542 | 96 |
| 1717 | 3300046519 | Ga0495632_0223197 | Ga0495632_0223197_34_339 | 96 |
| 1718 | 3300046528 | Ga0495642_0031203 | Ga0495642_0031203_119_424 | 96 |
| 1719 | 3300046528 | Ga0495642_0111550 | Ga0495642_0111550_243_548 | 96 |
| 1720 | 3300046529 | Ga0495652_0104031 | Ga0495652_0104031_22_327 | 96 |
| 1721 | 3300046529 | Ga0495652_0361215 | Ga0495652_0361215_308_613 | 96 |
| 1722 | 3300046530 | Ga0495654_0052557 | Ga0495654_0052557_263_568 | 96 |
| 1723 | 3300046531 | Ga0495665_0328206 | Ga0495665_0328206_259_564 | 96 |
| 1724 | 3300046533 | Ga0495640_0170914 | Ga0495640_0170914_406_711 | 96 |
| 1725 | 3300046533 | Ga0495640_0361145 | Ga0495640_0361145_461_766 | 96 |
| 1726 | 3300046536 | Ga0495587_0006550 | Ga0495587_0006550_2486_2791 | 96 |
| 1727 | 3300046538 | Ga0495609_0084812 | Ga0495609_0084812_152_457 | 96 |
| 1728 | 3300046539 | Ga0495621_0007305 | Ga0495621_0007305_1094_1399 | 96 |
| 1729 | 3300046543 | Ga0495645_0006077 | Ga0495645_0006077_1022_1327 | 96 |
| 1730 | 3300046543 | Ga0495645_0496277 | Ga0495645_0496277_61_366 | 96 |
| 1731 | 3300046557 | Ga0495622_0005205 | Ga0495622_0005205_1312_1617 | 96 |
| 1732 | 3300046559 | Ga0495667_0013738 | Ga0495667_0013738_3596_3901 | 96 |
| 1733 | 3300046559 | Ga0495667_0192168 | Ga0495667_0192168_519_824 | 96 |
| 1734 | 3300046615 | Ga0495656_0058964 | Ga0495656_0058964_864_1169 | 96 |
| 1735 | 3300046616 | Ga0495668_0112847 | Ga0495668_0112847_657_962 | 96 |
| 1736 | 3300046642 | Ga0495634_0245950 | Ga0495634_0245950_55_360 | 96 |
| 1737 | 3300046642 | Ga0495634_0650807 | Ga0495634_0650807_94_399 | 96 |
| 1738 | 3300046648 | Ga0495611_0118236 | Ga0495611_0118236_795_1100 | 96 |
| 1739 | 3300046660 | Ga0495625_0674147 | Ga0495625_0674147_161_466 | 96 |
| 1740 | 3300046663 | Ga0495635_0081895 | Ga0495635_0081895_1758_2063 | 96 |
| 1741 | 3300046663 | Ga0495635_0159637 | Ga0495635_0159637_98_403 | 96 |
| 1742 | 3300046663 | Ga0495635_0318696 | Ga0495635_0318696_587_892 | 96 |
| 1743 | 3300046663 | Ga0495635_0377371 | Ga0495635_0377371_373_678 | 96 |
| 1744 | 3300046665 | Ga0495661_0193074 | Ga0495661_0193074_508_813 | 96 |
| 1745 | 3300046674 | Ga0495588_0565181 | Ga0495588_0565181_15_320 | 96 |
| 1746 | 3300046675 | Ga0495657_0089597 | Ga0495657_0089597_76_381 | 96 |
| 1747 | 3300046675 | Ga0495657_0195618 | Ga0495657_0195618_843_1148 | 96 |
| 1748 | 3300046678 | Ga0495599_0090673 | Ga0495599_0090673_1065_1370 | 96 |
| 1749 | 3300046678 | Ga0495599_0282643 | Ga0495599_0282643_50_355 | 96 |
| 1750 | 3300046679 | Ga0495623_0261596 | Ga0495623_0261596_479_784 | 96 |
| 1751 | 3300046680 | Ga0495646_0013300 | Ga0495646_0013300_4232_4537 | 96 |
| 1752 | 3300046680 | Ga0495646_0476338 | Ga0495646_0476338_54_359 | 96 |
| 1753 | 3300046681 | Ga0495647_0230568 | Ga0495647_0230568_169_474 | 96 |
| 1754 | 3300046681 | Ga0495647_0347880 | Ga0495647_0347880_190_495 | 96 |
| 1755 | 3300046683 | Ga0495658_0077899 | Ga0495658_0077899_704_1009 | 96 |
| 1756 | 3300046683 | Ga0495658_0105408 | Ga0495658_0105408_555_860 | 96 |
| 1757 | 3300046684 | Ga0495669_0056516 | Ga0495669_0056516_693_998 | 96 |
| 1758 | 3300046689 | Ga0495613_0288951 | Ga0495613_0288951_494_799 | 96 |
| 1759 | 3300046689 | Ga0495613_0609588 | Ga0495613_0609588_203_508 | 96 |
| 1760 | 3300046690 | Ga0495624_0254893 | Ga0495624_0254893_271_576 | 96 |
| 1761 | 3300046692 | Ga0495671_0322087 | Ga0495671_0322087_66_371 | 96 |
| 1762 | 3300046692 | Ga0495671_0630277 | Ga0495671_0630277_94_399 | 96 |
| 1763 | 3300046694 | Ga0495649_0200501 | Ga0495649_0200501_387_692 | 96 |
| 1764 | 3300046694 | Ga0495649_0484305 | Ga0495649_0484305_260_565 | 96 |
| 1765 | 3300046694 | Ga0495649_0521266 | Ga0495649_0521266_212_517 | 96 |
| 1766 | 3300046694 | Ga0495649_0648876 | Ga0495649_0648876_178_483 | 96 |
| 1767 | 3300046794 | Ga0495589_0252897 | Ga0495589_0252897_167_472 | 96 |
| 1768 | 3300046794 | Ga0495589_0345895 | Ga0495589_0345895_178_483 | 96 |
| 1769 | 3300046809 | Ga0495600_0171410 | Ga0495600_0171410_1007_1312 | 96 |
| 1770 | 3300047315 | Ga0495581_0222805 | Ga0495581_0222805_411_716 | 96 |
| 1771 | 3300047317 | Ga0495604_0064902 | Ga0495604_0064902_1830_2135 | 96 |
| 1772 | 3300047317 | Ga0495604_0599186 | Ga0495604_0599186_339_644 | 96 |
| 1773 | 3300047318 | Ga0495636_0145114 | Ga0495636_0145114_134_439 | 96 |
| 1774 | 3300047319 | Ga0495674_0022196 | Ga0495674_0022196_2384_2689 | 96 |
| 1775 | 3300047319 | Ga0495674_0152655 | Ga0495674_0152655_805_1110 | 96 |
| 1776 | 3300047319 | Ga0495674_0317586 | Ga0495674_0317586_875_1180 | 96 |
| 1777 | 3300047319 | Ga0495674_0484119 | Ga0495674_0484119_665_970 | 96 |
| 1778 | 3300047319 | Ga0495674_0486149 | Ga0495674_0486149_371_676 | 96 |
| 1779 | 3300047320 | Ga0495672_0010923 | Ga0495672_0010923_2735_3040 | 96 |
| 1780 | 3300047320 | Ga0495672_0097960 | Ga0495672_0097960_292_597 | 96 |
| 1781 | 3300047320 | Ga0495672_0241498 | Ga0495672_0241498_546_851 | 96 |
| 1782 | 3300047320 | Ga0495672_0382104 | Ga0495672_0382104_58_363 | 96 |
| 1783 | 3300047321 | Ga0495676_0701455 | Ga0495676_0701455_228_533 | 96 |
| 1784 | 3300047321 | Ga0495676_0863456 | Ga0495676_0863456_236_541 | 96 |
| 1785 | 3300047322 | Ga0495680_0079504 | Ga0495680_0079504_633_938 | 96 |
| 1786 | 3300047323 | Ga0495683_0023644 | Ga0495683_0023644_1605_1910 | 96 |
| 1787 | 3300047444 | Ga0495675_0034301 | Ga0495675_0034301_1720_2025 | 96 |
| 1788 | 3300047444 | Ga0495675_0125394 | Ga0495675_0125394_984_1289 | 96 |
| 1789 | 3300047444 | Ga0495675_0300096 | Ga0495675_0300096_428_733 | 96 |
| 1790 | 3300047444 | Ga0495675_0465897 | Ga0495675_0465897_376_681 | 96 |
| 1791 | 3300047471 | Ga0495684_0122366 | Ga0495684_0122366_1555_1860 | 96 |
| 1792 | 3300047471 | Ga0495684_0228897 | Ga0495684_0228897_220_525 | 96 |
| 1793 | 3300047471 | Ga0495684_0393069 | Ga0495684_0393069_167_472 | 96 |
| 1794 | 3300047471 | Ga0495684_0394642 | Ga0495684_0394642_331_636 | 96 |
| 1795 | 3300047471 | Ga0495684_0549839 | Ga0495684_0549839_78_383 | 96 |
| 1796 | 3300047472 | Ga0495686_0173970 | Ga0495686_0173970_926_1231 | 96 |
| 1797 | 3300047472 | Ga0495686_0389719 | Ga0495686_0389719_414_719 | 96 |
| 1798 | 3300047673 | Ga0495593_0711071 | Ga0495593_0711071_69_374 | 96 |
| 1799 | 3300048088 | Ga0495602_0000485 | Ga0495602_0000485_21064_21369 | 96 |
| 1800 | 3300048088 | Ga0495602_0331316 | Ga0495602_0331316_726_1031 | 96 |
| 1801 | 3300048088 | Ga0495602_0496778 | Ga0495602_0496778_533_838 | 96 |
| 1802 | 3300048090 | Ga0495615_0123520 | Ga0495615_0123520_264_569 | 96 |
| 1803 | 3300048091 | Ga0495626_0026549 | Ga0495626_0026549_1018_1323 | 96 |
| 1804 | 3300048091 | Ga0495626_0394216 | Ga0495626_0394216_162_467 | 96 |
| 1805 | 3300048903 | Ga0496100_0028163 | Ga0496100_0028163_2578_2883 | 96 |
| 1806 | 3300048903 | Ga0496100_0531081 | Ga0496100_0531081_458_763 | 96 |
| 1807 | 3300048904 | Ga0496101_0187660 | Ga0496101_0187660_748_1053 | 96 |
| 1808 | 3300048904 | Ga0496101_0385578 | Ga0496101_0385578_494_799 | 96 |
| 1809 | 3300048905 | Ga0496102_0021900 | Ga0496102_0021900_2865_3170 | 96 |
| 1810 | 3300048905 | Ga0496102_0089827 | Ga0496102_0089827_1226_1531 | 96 |
| 1811 | 3300048906 | Ga0496103_0005971 | Ga0496103_0005971_2699_3004 | 96 |
| 1812 | 3300048907 | Ga0496104_0017664 | Ga0496104_0017664_1561_1866 | 96 |
| 1813 | 3300048907 | Ga0496104_1095783 | Ga0496104_1095783_56_361 | 96 |
| 1814 | 3300048909 | Ga0496106_0004608 | Ga0496106_0004608_7499_7804 | 96 |
| 1815 | 3300048909 | Ga0496106_0127126 | Ga0496106_0127126_34_339 | 96 |
| 1816 | 3300048909 | Ga0496106_0617607 | Ga0496106_0617607_194_499 | 96 |
| 1817 | 3300048910 | Ga0496107_0008725 | Ga0496107_0008725_3308_3613 | 96 |
| 1818 | 3300048910 | Ga0496107_0041203 | Ga0496107_0041203_2968_3273 | 96 |
| 1819 | 3300048911 | Ga0496108_0731634 | Ga0496108_0731634_418_723 | 96 |
| 1820 | 3300048911 | Ga0496108_1099120 | Ga0496108_1099120_43_348 | 96 |
| 1821 | 3300048912 | Ga0496109_0334424 | Ga0496109_0334424_714_1019 | 96 |
| 1822 | 3300048913 | Ga0496110_0508118 | Ga0496110_0508118_279_584 | 96 |
| 1823 | 3300048913 | Ga0496110_0610112 | Ga0496110_0610112_79_384 | 96 |
| 1824 | 3300048914 | Ga0496111_0603211 | Ga0496111_0603211_439_744 | 96 |
| 1825 | 3300048914 | Ga0496111_0725350 | Ga0496111_0725350_85_390 | 96 |
| 1826 | 3300048915 | Ga0496112_0415216 | Ga0496112_0415216_522_827 | 96 |
| 1827 | 3300048916 | Ga0496113_0642497 | Ga0496113_0642497_501_806 | 96 |
| 1828 | 3300048916 | Ga0496113_0784735 | Ga0496113_0784735_420_725 | 96 |
| 1829 | 3300048917 | Ga0496114_0024865 | Ga0496114_0024865_3721_4026 | 96 |
| 1830 | 3300048918 | Ga0496115_0001671 | Ga0496115_0001671_6260_6565 | 96 |
| 1831 | 3300048918 | Ga0496115_0552779 | Ga0496115_0552779_450_755 | 96 |
| 1832 | 3300048918 | Ga0496115_1197618 | Ga0496115_1197618_146_451 | 96 |
| 1833 | 3300048923 | Ga0496120_0132303 | Ga0496120_0132303_207_512 | 96 |
| 1834 | 3300048923 | Ga0496120_0283637 | Ga0496120_0283637_296_601 | 96 |
| 1835 | 3300048924 | Ga0496121_0386560 | Ga0496121_0386560_169_474 | 96 |
| 1836 | 3300048929 | Ga0496126_0123506 | Ga0496126_0123506_138_443 | 96 |
| 1837 | 3300049127 | Ga0501306_011195 | Ga0501306_011195_546_851 | 96 |
| 1838 | 3300049127 | Ga0501306_011303 | Ga0501306_011303_726_1031 | 96 |
| 1839 | 3300049128 | Ga0501308_004474 | Ga0501308_004474_64_369 | 96 |
| 1840 | 3300049128 | Ga0501308_088930 | Ga0501308_088930_111_416 | 96 |
| 1841 | 3300049130 | Ga0501310_022382 | Ga0501310_022382_47_352 | 96 |
| 1842 | 3300049160 | Ga0501304_027739 | Ga0501304_027739_42_347 | 96 |
| 1843 | 3300049161 | Ga0501305_012393 | Ga0501305_012393_534_839 | 96 |
| 1844 | 3300049162 | Ga0501307_007377 | Ga0501307_007377_317_622 | 96 |
| 1845 | 3300049162 | Ga0501307_033780 | Ga0501307_033780_250_555 | 96 |
| 1846 | 3300049527 | Ga0501311_017110 | Ga0501311_017110_170_475 | 96 |
| 1847 | 3300049527 | Ga0501311_027428 | Ga0501311_027428_58_363 | 96 |
| 1848 | 3300049527 | Ga0501311_051585 | Ga0501311_051585_165_470 | 96 |
| 1849 | 3300049528 | Ga0501312_012174 | Ga0501312_012174_632_937 | 96 |
| 1850 | 3300049528 | Ga0501312_013150 | Ga0501312_013150_360_665 | 96 |
| 1851 | 3300049529 | Ga0501313_013109 | Ga0501313_013109_333_638 | 96 |
| 1852 | 3300049529 | Ga0501313_051720 | Ga0501313_051720_239_544 | 96 |
| 1853 | 3300049531 | Ga0501315_002668 | Ga0501315_002668_522_827 | 96 |
| 1854 | 3300049531 | Ga0501315_079589 | Ga0501315_079589_47_352 | 96 |
| 1855 | 3300049532 | Ga0501316_003868 | Ga0501316_003868_580_885 | 96 |
| 1856 | 3300049533 | Ga0501317_001666 | Ga0501317_001666_28_333 | 96 |
| 1857 | 3300049533 | Ga0501317_009684 | Ga0501317_009684_448_753 | 96 |
| 1858 | 3300049533 | Ga0501317_015990 | Ga0501317_015990_250_555 | 96 |
| 1859 | 3300049533 | Ga0501317_023822 | Ga0501317_023822_144_449 | 96 |
| 1860 | 3300049533 | Ga0501317_029983 | Ga0501317_029983_456_761 | 96 |
| 1861 | 3300049534 | Ga0501318_002881 | Ga0501318_002881_1068_1373 | 96 |
| 1862 | 3300049534 | Ga0501318_003003 | Ga0501318_003003_536_841 | 96 |
| 1863 | 3300049534 | Ga0501318_005635 | Ga0501318_005635_450_755 | 96 |
| 1864 | 3300049534 | Ga0501318_016453 | Ga0501318_016453_482_787 | 96 |
| 1865 | 3300049534 | Ga0501318_024801 | Ga0501318_024801_23_328 | 96 |
| 1866 | 3300049534 | Ga0501318_045469 | Ga0501318_045469_134_439 | 96 |
| 1867 | 3300049534 | Ga0501318_073419 | Ga0501318_073419_29_334 | 96 |
| 1868 | 3300049536 | Ga0501320_055674 | Ga0501320_055674_66_371 | 96 |
| 1869 | 3300049537 | Ga0501321_006571 | Ga0501321_006571_358_663 | 96 |
| 1870 | 3300049540 | Ga0501324_002934 | Ga0501324_002934_886_1191 | 96 |
| 1871 | 3300049540 | Ga0501324_025654 | Ga0501324_025654_242_547 | 96 |
| 1872 | 3300049568 | Ga0501031_0131538 | Ga0501031_0131538_514_819 | 96 |
| 1873 | 3300049568 | Ga0501031_0318414 | Ga0501031_0318414_519_824 | 96 |
| 1874 | 3300049569 | Ga0501032_0019862 | Ga0501032_0019862_2910_3215 | 96 |
| 1875 | 3300049569 | Ga0501032_0076360 | Ga0501032_0076360_239_544 | 96 |
| 1876 | 3300049569 | Ga0501032_0104516 | Ga0501032_0104516_947_1252 | 96 |
| 1877 | 3300049569 | Ga0501032_0893540 | Ga0501032_0893540_47_352 | 96 |
| 1878 | 3300049570 | Ga0501033_0005260 | Ga0501033_0005260_5840_6145 | 96 |
| 1879 | 3300049570 | Ga0501033_0012240 | Ga0501033_0012240_1422_1727 | 96 |
| 1880 | 3300049570 | Ga0501033_0020706 | Ga0501033_0020706_1694_1999 | 96 |
| 1881 | 3300049570 | Ga0501033_0106944 | Ga0501033_0106944_1479_1784 | 96 |
| 1882 | 3300049570 | Ga0501033_0975686 | Ga0501033_0975686_69_374 | 96 |
| 1883 | 3300049571 | Ga0501034_0056638 | Ga0501034_0056638_3550_3855 | 96 |
| 1884 | 3300049571 | Ga0501034_0171459 | Ga0501034_0171459_1046_1351 | 96 |
| 1885 | 3300049571 | Ga0501034_0188771 | Ga0501034_0188771_959_1264 | 96 |
| 1886 | 3300049571 | Ga0501034_0198693 | Ga0501034_0198693_24_329 | 96 |
| 1887 | 3300049571 | Ga0501034_0347968 | Ga0501034_0347968_964_1269 | 96 |
| 1888 | 3300049571 | Ga0501034_0479868 | Ga0501034_0479868_649_954 | 96 |
| 1889 | 3300049571 | Ga0501034_0493116 | Ga0501034_0493116_117_422 | 96 |
| 1890 | 3300049571 | Ga0501034_0640364 | Ga0501034_0640364_187_492 | 96 |
| 1891 | 3300049571 | Ga0501034_0876666 | Ga0501034_0876666_144_449 | 96 |
| 1892 | 3300049571 | Ga0501034_0948957 | Ga0501034_0948957_341_646 | 96 |
| 1893 | 3300049572 | Ga0501036_0075956 | Ga0501036_0075956_991_1308 | 96 |
| 1894 | 3300049572 | Ga0501036_0249878 | Ga0501036_0249878_892_1197 | 96 |
| 1895 | 3300049572 | Ga0501036_0308062 | Ga0501036_0308062_918_1223 | 96 |
| 1896 | 3300049572 | Ga0501036_0380494 | Ga0501036_0380494_414_719 | 96 |
| 1897 | 3300049572 | Ga0501036_0415122 | Ga0501036_0415122_400_705 | 96 |
| 1898 | 3300049572 | Ga0501036_0565163 | Ga0501036_0565163_104_409 | 96 |
| 1899 | 3300049572 | Ga0501036_0629985 | Ga0501036_0629985_338_643 | 96 |
| 1900 | 3300049572 | Ga0501036_0741396 | Ga0501036_0741396_77_382 | 96 |
| 1901 | 3300049572 | Ga0501036_1169245 | Ga0501036_1169245_242_547 | 96 |
| 1902 | 3300049573 | Ga0501037_0013050 | Ga0501037_0013050_2780_3085 | 96 |
| 1903 | 3300049573 | Ga0501037_0098875 | Ga0501037_0098875_1560_1865 | 96 |
| 1904 | 3300049573 | Ga0501037_0108796 | Ga0501037_0108796_1521_1826 | 96 |
| 1905 | 3300049573 | Ga0501037_0123771 | Ga0501037_0123771_1417_1722 | 96 |
| 1906 | 3300049573 | Ga0501037_0259993 | Ga0501037_0259993_305_610 | 96 |
| 1907 | 3300049573 | Ga0501037_0502501 | Ga0501037_0502501_338_643 | 96 |
| 1908 | 3300049573 | Ga0501037_0958892 | Ga0501037_0958892_110_415 | 96 |
| 1909 | 3300049574 | Ga0501038_0096205 | Ga0501038_0096205_1422_1727 | 96 |
| 1910 | 3300049574 | Ga0501038_0408010 | Ga0501038_0408010_21_326 | 96 |
| 1911 | 3300049574 | Ga0501038_0933239 | Ga0501038_0933239_144_449 | 96 |
| 1912 | 3300049574 | Ga0501038_1381271 | Ga0501038_1381271_61_366 | 96 |
| 1913 | 3300049575 | Ga0501039_0098169 | Ga0501039_0098169_1742_2047 | 96 |
| 1914 | 3300049575 | Ga0501039_0133948 | Ga0501039_0133948_457_762 | 96 |
| 1915 | 3300049575 | Ga0501039_0309306 | Ga0501039_0309306_662_979 | 96 |
| 1916 | 3300049575 | Ga0501039_0582557 | Ga0501039_0582557_202_507 | 96 |
| 1917 | 3300049575 | Ga0501039_0759757 | Ga0501039_0759757_323_628 | 96 |
| 1918 | 3300049575 | Ga0501039_1006196 | Ga0501039_1006196_199_504 | 96 |
| 1919 | 3300049576 | Ga0501040_0065678 | Ga0501040_0065678_1948_2253 | 96 |
| 1920 | 3300049577 | Ga0501041_0383436 | Ga0501041_0383436_319_624 | 96 |
| 1921 | 3300049578 | Ga0501042_0135548 | Ga0501042_0135548_187_504 | 96 |
| 1922 | 3300049578 | Ga0501042_1363722 | Ga0501042_1363722_87_392 | 96 |
| 1923 | 3300049579 | Ga0501043_0014584 | Ga0501043_0014584_5393_5698 | 96 |
| 1924 | 3300049579 | Ga0501043_0045694 | Ga0501043_0045694_1426_1731 | 96 |
| 1925 | 3300049579 | Ga0501043_0147562 | Ga0501043_0147562_691_996 | 96 |
| 1926 | 3300049579 | Ga0501043_0179217 | Ga0501043_0179217_835_1140 | 96 |
| 1927 | 3300049579 | Ga0501043_0372880 | Ga0501043_0372880_633_938 | 96 |
| 1928 | 3300049579 | Ga0501043_0611113 | Ga0501043_0611113_317_622 | 96 |
| 1929 | 3300049580 | Ga0501046_0011762 | Ga0501046_0011762_6259_6564 | 96 |
| 1930 | 3300049580 | Ga0501046_0099104 | Ga0501046_0099104_790_1095 | 96 |
| 1931 | 3300049580 | Ga0501046_0239452 | Ga0501046_0239452_273_578 | 96 |
| 1932 | 3300049580 | Ga0501046_0432622 | Ga0501046_0432622_189_494 | 96 |
| 1933 | 3300049581 | Ga0501047_0002319 | Ga0501047_0002319_10773_11078 | 96 |
| 1934 | 3300049581 | Ga0501047_0042378 | Ga0501047_0042378_3460_3765 | 96 |
| 1935 | 3300049581 | Ga0501047_0059259 | Ga0501047_0059259_821_1126 | 96 |
| 1936 | 3300049581 | Ga0501047_0138742 | Ga0501047_0138742_543_848 | 96 |
| 1937 | 3300049581 | Ga0501047_0154945 | Ga0501047_0154945_398_703 | 96 |
| 1938 | 3300049581 | Ga0501047_0180149 | Ga0501047_0180149_511_816 | 96 |
| 1939 | 3300049581 | Ga0501047_0267505 | Ga0501047_0267505_334_639 | 96 |
| 1940 | 3300049581 | Ga0501047_0285627 | Ga0501047_0285627_648_953 | 96 |
| 1941 | 3300049581 | Ga0501047_0757844 | Ga0501047_0757844_338_643 | 96 |
| 1942 | 3300049582 | Ga0501048_0051367 | Ga0501048_0051367_2505_2810 | 96 |
| 1943 | 3300049582 | Ga0501048_0088154 | Ga0501048_0088154_1874_2179 | 96 |
| 1944 | 3300049582 | Ga0501048_0101952 | Ga0501048_0101952_1693_1998 | 96 |
| 1945 | 3300049582 | Ga0501048_0155341 | Ga0501048_0155341_144_449 | 96 |
| 1946 | 3300049582 | Ga0501048_0239734 | Ga0501048_0239734_935_1252 | 96 |
| 1947 | 3300049582 | Ga0501048_0556179 | Ga0501048_0556179_42_347 | 96 |
| 1948 | 3300049582 | Ga0501048_0627839 | Ga0501048_0627839_375_680 | 96 |
| 1949 | 3300049583 | Ga0501067_0108900 | Ga0501067_0108900_228_533 | 96 |
| 1950 | 3300049583 | Ga0501067_0162644 | Ga0501067_0162644_339_644 | 96 |
| 1951 | 3300049583 | Ga0501067_0179124 | Ga0501067_0179124_745_1050 | 96 |
| 1952 | 3300049584 | Ga0501068_0036227 | Ga0501068_0036227_557_862 | 96 |
| 1953 | 3300049584 | Ga0501068_0243618 | Ga0501068_0243618_580_885 | 96 |
| 1954 | 3300049584 | Ga0501068_0337764 | Ga0501068_0337764_514_819 | 96 |
| 1955 | 3300049584 | Ga0501068_0435800 | Ga0501068_0435800_124_429 | 96 |
| 1956 | 3300049584 | Ga0501068_0803807 | Ga0501068_0803807_46_351 | 96 |
| 1957 | 3300049584 | Ga0501068_0905982 | Ga0501068_0905982_225_530 | 96 |
| 1958 | 3300049584 | Ga0501068_0923954 | Ga0501068_0923954_210_515 | 96 |
| 1959 | 3300049585 | Ga0501069_0058742 | Ga0501069_0058742_883_1188 | 96 |
| 1960 | 3300049585 | Ga0501069_0079151 | Ga0501069_0079151_1421_1726 | 96 |
| 1961 | 3300049585 | Ga0501069_0459450 | Ga0501069_0459450_31_336 | 96 |
| 1962 | 3300049585 | Ga0501069_0640660 | Ga0501069_0640660_106_411 | 96 |
| 1963 | 3300049586 | Ga0501070_0199363 | Ga0501070_0199363_37_342 | 96 |
| 1964 | 3300049586 | Ga0501070_0517666 | Ga0501070_0517666_487_792 | 96 |
| 1965 | 3300049586 | Ga0501070_0859167 | Ga0501070_0859167_273_578 | 96 |
| 1966 | 3300049587 | Ga0501071_0057831 | Ga0501071_0057831_1573_1878 | 96 |
| 1967 | 3300049587 | Ga0501071_0252161 | Ga0501071_0252161_41_346 | 96 |
| 1968 | 3300049587 | Ga0501071_0296191 | Ga0501071_0296191_389_694 | 96 |
| 1969 | 3300049587 | Ga0501071_0303954 | Ga0501071_0303954_144_449 | 96 |
| 1970 | 3300049587 | Ga0501071_0577330 | Ga0501071_0577330_523_840 | 96 |
| 1971 | 3300049587 | Ga0501071_0651782 | Ga0501071_0651782_290_595 | 96 |
| 1972 | 3300049587 | Ga0501071_0817517 | Ga0501071_0817517_255_560 | 96 |
| 1973 | 3300049587 | Ga0501071_1128412 | Ga0501071_1128412_250_555 | 96 |
| 1974 | 3300049588 | Ga0501072_0052932 | Ga0501072_0052932_359_664 | 96 |
| 1975 | 3300049588 | Ga0501072_0131259 | Ga0501072_0131259_1441_1746 | 96 |
| 1976 | 3300049588 | Ga0501072_0770225 | Ga0501072_0770225_40_345 | 96 |
| 1977 | 3300049588 | Ga0501072_0846029 | Ga0501072_0846029_37_342 | 96 |
| 1978 | 3300049589 | Ga0501073_0021555 | Ga0501073_0021555_2530_2835 | 96 |
| 1979 | 3300049589 | Ga0501073_0061078 | Ga0501073_0061078_1063_1368 | 96 |
| 1980 | 3300049589 | Ga0501073_0168051 | Ga0501073_0168051_1070_1375 | 96 |
| 1981 | 3300049589 | Ga0501073_0313950 | Ga0501073_0313950_144_449 | 96 |
| 1982 | 3300049589 | Ga0501073_0432746 | Ga0501073_0432746_490_795 | 96 |
| 1983 | 3300049589 | Ga0501073_0489000 | Ga0501073_0489000_432_737 | 96 |
| 1984 | 3300049589 | Ga0501073_0918746 | Ga0501073_0918746_42_347 | 96 |
| 1985 | 3300049589 | Ga0501073_1204701 | Ga0501073_1204701_24_329 | 96 |
| 1986 | 3300049590 | Ga0501074_0079197 | Ga0501074_0079197_158_463 | 96 |
| 1987 | 3300049590 | Ga0501074_0565600 | Ga0501074_0565600_393_698 | 96 |
| 1988 | 3300049591 | Ga0501075_0063131 | Ga0501075_0063131_1036_1341 | 96 |
| 1989 | 3300049591 | Ga0501075_0173674 | Ga0501075_0173674_487_792 | 96 |
| 1990 | 3300049592 | Ga0501076_0013544 | Ga0501076_0013544_2790_3095 | 96 |
| 1991 | 3300049592 | Ga0501076_0247028 | Ga0501076_0247028_346_651 | 96 |
| 1992 | 3300049593 | Ga0501077_0165265 | Ga0501077_0165265_979_1284 | 96 |
| 1993 | 3300049593 | Ga0501077_0196471 | Ga0501077_0196471_340_645 | 96 |
| 1994 | 3300049593 | Ga0501077_0389959 | Ga0501077_0389959_376_681 | 96 |
| 1995 | 3300049593 | Ga0501077_0978032 | Ga0501077_0978032_43_348 | 96 |
| 1996 | 3300049741 | Ga0501079_0108926 | Ga0501079_0108926_1457_1762 | 96 |
| 1997 | 3300049741 | Ga0501079_0721469 | Ga0501079_0721469_220_525 | 96 |
| 1998 | 3300049742 | Ga0501080_0071546 | Ga0501080_0071546_1564_1869 | 96 |
| 1999 | 3300049742 | Ga0501080_0098262 | Ga0501080_0098262_1895_2200 | 96 |
| 2000 | 3300049742 | Ga0501080_0113812 | Ga0501080_0113812_1162_1467 | 96 |
| 2001 | 3300049742 | Ga0501080_0170095 | Ga0501080_0170095_198_503 | 96 |
| 2002 | 3300049742 | Ga0501080_0313821 | Ga0501080_0313821_774_1079 | 96 |
| 2003 | 3300049742 | Ga0501080_0329025 | Ga0501080_0329025_860_1165 | 96 |
| 2004 | 3300049742 | Ga0501080_0332884 | Ga0501080_0332884_989_1294 | 96 |
| 2005 | 3300049742 | Ga0501080_0799651 | Ga0501080_0799651_112_417 | 96 |
| 2006 | 3300049742 | Ga0501080_0870879 | Ga0501080_0870879_144_449 | 96 |
| 2007 | 3300049742 | Ga0501080_1120692 | Ga0501080_1120692_210_515 | 96 |
| 2008 | 3300049742 | Ga0501080_1134541 | Ga0501080_1134541_227_532 | 96 |
| 2009 | 3300049742 | Ga0501080_1221465 | Ga0501080_1221465_322_627 | 96 |
| 2010 | 3300049742 | Ga0501080_1305695 | Ga0501080_1305695_10_315 | 96 |
| 2011 | 3300049742 | Ga0501080_1457080 | Ga0501080_1457080_42_347 | 96 |
| 2012 | 3300049742 | Ga0501080_1787282 | Ga0501080_1787282_26_331 | 96 |
| 2013 | 3300049743 | Ga0501081_0009109 | Ga0501081_0009109_3198_3503 | 96 |
| 2014 | 3300049743 | Ga0501081_0018650 | Ga0501081_0018650_143_448 | 96 |
| 2015 | 3300049743 | Ga0501081_0771951 | Ga0501081_0771951_230_535 | 96 |
| 2016 | 3300049744 | Ga0501083_0082701 | Ga0501083_0082701_1122_1427 | 96 |
| 2017 | 3300049744 | Ga0501083_0109534 | Ga0501083_0109534_1307_1612 | 96 |
| 2018 | 3300049744 | Ga0501083_0154246 | Ga0501083_0154246_323_628 | 96 |
| 2019 | 3300049744 | Ga0501083_0190488 | Ga0501083_0190488_273_578 | 96 |
| 2020 | 3300049744 | Ga0501083_0232547 | Ga0501083_0232547_750_1055 | 96 |
| 2021 | 3300049822 | Ga0501035_0048543 | Ga0501035_0048543_1599_1904 | 96 |
| 2022 | 3300049822 | Ga0501035_0438103 | Ga0501035_0438103_762_1067 | 96 |
| 2023 | 3300049822 | Ga0501035_0510636 | Ga0501035_0510636_325_630 | 96 |
| 2024 | 3300049822 | Ga0501035_0555601 | Ga0501035_0555601_247_552 | 96 |
| 2025 | 3300049822 | Ga0501035_0622580 | Ga0501035_0622580_144_449 | 96 |
| 2026 | 3300049822 | Ga0501035_0754471 | Ga0501035_0754471_89_394 | 96 |
| 2027 | 3300049822 | Ga0501035_0880720 | Ga0501035_0880720_98_403 | 96 |
| 2028 | 3300049822 | Ga0501035_0896113 | Ga0501035_0896113_160_465 | 96 |
| 2029 | 3300049823 | Ga0501044_0015755 | Ga0501044_0015755_3512_3817 | 96 |
| 2030 | 3300049823 | Ga0501044_0032628 | Ga0501044_0032628_1280_1585 | 96 |
| 2031 | 3300049823 | Ga0501044_0044540 | Ga0501044_0044540_1714_2019 | 96 |
| 2032 | 3300049823 | Ga0501044_0050289 | Ga0501044_0050289_939_1244 | 96 |
| 2033 | 3300049823 | Ga0501044_0081352 | Ga0501044_0081352_169_474 | 96 |
| 2034 | 3300049823 | Ga0501044_0112831 | Ga0501044_0112831_1535_1840 | 96 |
| 2035 | 3300049823 | Ga0501044_0150030 | Ga0501044_0150030_483_788 | 96 |
| 2036 | 3300049823 | Ga0501044_0337074 | Ga0501044_0337074_144_449 | 96 |
| 2037 | 3300049823 | Ga0501044_0381983 | Ga0501044_0381983_842_1147 | 96 |
| 2038 | 3300049823 | Ga0501044_0411454 | Ga0501044_0411454_595_900 | 96 |
| 2039 | 3300049823 | Ga0501044_0531262 | Ga0501044_0531262_433_738 | 96 |
| 2040 | 3300049823 | Ga0501044_0584065 | Ga0501044_0584065_38_343 | 96 |
| 2041 | 3300049824 | Ga0501045_0038945 | Ga0501045_0038945_350_655 | 96 |
| 2042 | 3300049824 | Ga0501045_0216057 | Ga0501045_0216057_364_669 | 96 |
| 2043 | 3300049824 | Ga0501045_0373205 | Ga0501045_0373205_466_771 | 96 |
| 2044 | 3300050489 | nmdc:mga03683_214353_c1 | nmdc:mga03683_214353_c1_471_776 | 96 |
| 2045 | 3300050489 | nmdc:mga03683_436293_c1 | nmdc:mga03683_436293_c1_41_346 | 96 |
| 2046 | 3300050489 | nmdc:mga03683_81488_c1 | nmdc:mga03683_81488_c1_964_1269 | 96 |
| 2047 | 3300050489 | nmdc:mga03683_94213_c1 | nmdc:mga03683_94213_c1_591_896 | 96 |
| 2048 | 3300050490 | nmdc:mga03n38_522045_c1 | nmdc:mga03n38_522045_c1_212_517 | 96 |
| 2049 | 3300050490 | nmdc:mga03n38_593050_c1 | nmdc:mga03n38_593050_c1_173_478 | 96 |
| 2050 | 3300050491 | nmdc:mga00v17_250152_c1 | nmdc:mga00v17_250152_c1_294_599 | 96 |
| 2051 | 3300050491 | nmdc:mga00v17_720986_c1 | nmdc:mga00v17_720986_c1_217_522 | 96 |
| 2052 | 3300050492 | nmdc:mga0yw44_553277_c1 | nmdc:mga0yw44_553277_c1_308_613 | 96 |
| 2053 | 3300050492 | nmdc:mga0yw44_752128_c1 | nmdc:mga0yw44_752128_c1_107_412 | 96 |
| 2054 | 3300050493 | nmdc:mga0k408_14041_c1 | nmdc:mga0k408_14041_c1_762_1067 | 96 |
| 2055 | 3300050493 | nmdc:mga0k408_148475_c1 | nmdc:mga0k408_148475_c1_768_1073 | 96 |
| 2056 | 3300050493 | nmdc:mga0k408_240476_c1 | nmdc:mga0k408_240476_c1_158_463 | 96 |
| 2057 | 3300050493 | nmdc:mga0k408_408156_c1 | nmdc:mga0k408_408156_c1_117_422 | 96 |
| 2058 | 3300050493 | nmdc:mga0k408_775120_c1 | nmdc:mga0k408_775120_c1_83_388 | 96 |
| 2059 | 3300050494 | nmdc:mga06z11_395022_c1 | nmdc:mga06z11_395022_c1_301_606 | 96 |
| 2060 | 3300050494 | nmdc:mga06z11_631274_c1 | nmdc:mga06z11_631274_c1_310_615 | 96 |
| 2061 | 3300050495 | nmdc:mga04h51_531736_c1 | nmdc:mga04h51_531736_c1_182_487 | 96 |
| 2062 | 3300050496 | nmdc:mga07m45_247664_c1 | nmdc:mga07m45_247664_c1_432_737 | 96 |
| 2063 | 3300050507 | nmdc:mga05p37_1877201_c1 | nmdc:mga05p37_1877201_c1_73_378 | 96 |
| 2064 | 3300050507 | nmdc:mga05p37_208661_c1 | nmdc:mga05p37_208661_c1_687_992 | 96 |
| 2065 | 3300050507 | nmdc:mga05p37_703200_c1 | nmdc:mga05p37_703200_c1_752_1057 | 96 |
| 2066 | 3300050508 | nmdc:mga09592_1445486_c1 | nmdc:mga09592_1445486_c1_103_408 | 96 |
| 2067 | 3300050508 | nmdc:mga09592_274466_c1 | nmdc:mga09592_274466_c1_428_733 | 96 |
| 2068 | 3300050510 | nmdc:mga06r32_1721329_c1 | nmdc:mga06r32_1721329_c1_154_459 | 96 |
| 2069 | 3300050511 | nmdc:mga08y16_1093548_c1 | nmdc:mga08y16_1093548_c1_266_571 | 96 |
| 2070 | 3300050511 | nmdc:mga08y16_205_c1 | nmdc:mga08y16_205_c1_6950_7255 | 96 |
| 2071 | 3300050511 | nmdc:mga08y16_3117_c1 | nmdc:mga08y16_3117_c1_4894_5199 | 96 |
| 2072 | 3300050512 | nmdc:mga0n895_287400_c1 | nmdc:mga0n895_287400_c1_569_874 | 96 |
| 2073 | 3300050512 | nmdc:mga0n895_445621_c1 | nmdc:mga0n895_445621_c1_712_1017 | 96 |
| 2074 | 3300050512 | nmdc:mga0n895_455742_c1 | nmdc:mga0n895_455742_c1_484_789 | 96 |
| 2075 | 3300050512 | nmdc:mga0n895_611333_c1 | nmdc:mga0n895_611333_c1_314_619 | 96 |
| 2076 | 3300050513 | nmdc:mga0rr50_1624502_c1 | nmdc:mga0rr50_1624502_c1_145_450 | 96 |
| 2077 | 3300050514 | nmdc:mga08x19_309104_c1 | nmdc:mga08x19_309104_c1_165_470 | 96 |
| 2078 | 3300050514 | nmdc:mga08x19_437170_c1 | nmdc:mga08x19_437170_c1_57_362 | 96 |
| 2079 | 3300050514 | nmdc:mga08x19_541883_c1 | nmdc:mga08x19_541883_c1_54_359 | 96 |
| 2080 | 3300050514 | nmdc:mga08x19_691923_c1 | nmdc:mga08x19_691923_c1_335_640 | 96 |
| 2081 | 3300050515 | nmdc:mga0a205_206624_c1 | nmdc:mga0a205_206624_c1_1160_1465 | 96 |
| 2082 | 3300050515 | nmdc:mga0a205_399680_c1 | nmdc:mga0a205_399680_c1_536_841 | 96 |
| 2083 | 3300050515 | nmdc:mga0a205_858010_c1 | nmdc:mga0a205_858010_c1_125_430 | 96 |
| 2084 | 3300050516 | nmdc:mga0sz30_5573_c1 | nmdc:mga0sz30_5573_c1_1304_1609 | 96 |
| 2085 | 3300053077 | Ga0495601_0057176 | Ga0495601_0057176_1657_1962 | 96 |
| 2086 | 3300053077 | Ga0495601_0613037 | Ga0495601_0613037_359_664 | 96 |
| 2087 | 3300053077 | Ga0495601_0833131 | Ga0495601_0833131_188_493 | 96 |
| 2088 | 3300053077 | Ga0495601_0977994 | Ga0495601_0977994_127_432 | 96 |
| 2089 | 3300053078 | Ga0495612_0001954 | Ga0495612_0001954_3665_3970 | 96 |
| 2090 | 3300053080 | Ga0500635_0079760 | Ga0500635_0079760_364_669 | 96 |
| 2091 | 3300053080 | Ga0500635_0089208 | Ga0500635_0089208_311_616 | 96 |
| 2092 | 3300053085 | Ga0495619_0075345 | Ga0495619_0075345_1849_2154 | 96 |
| 2093 | 3300053086 | Ga0500578_0149619 | Ga0500578_0149619_108_413 | 96 |
| 2094 | 3300053087 | Ga0500643_022828 | Ga0500643_022828_191_496 | 96 |
| 2095 | 3300053087 | Ga0500643_132082 | Ga0500643_132082_354_659 | 96 |
| 2096 | 3300053087 | Ga0500643_135613 | Ga0500643_135613_247_552 | 96 |
| 2097 | 3300053088 | Ga0500644_0009620 | Ga0500644_0009620_1553_1858 | 96 |
| 2098 | 3300053088 | Ga0500644_0034020 | Ga0500644_0034020_1085_1390 | 96 |
| 2099 | 3300053088 | Ga0500644_0168401 | Ga0500644_0168401_158_463 | 96 |
| 2100 | 3300053088 | Ga0500644_0336959 | Ga0500644_0336959_202_507 | 96 |
| 2101 | 3300053090 | Ga0500646_0036995 | Ga0500646_0036995_765_1070 | 96 |
| 2102 | 3300053090 | Ga0500646_0042165 | Ga0500646_0042165_812_1117 | 96 |
| 2103 | 3300053093 | Ga0500651_0353068 | Ga0500651_0353068_266_571 | 96 |
| 2104 | 3300053096 | Ga0500641_0000684 | Ga0500641_0000684_3185_3490 | 96 |
| 2105 | 3300053098 | Ga0500650_0068634 | Ga0500650_0068634_598_903 | 96 |
| 2106 | 3300053098 | Ga0500650_0080533 | Ga0500650_0080533_365_670 | 96 |
| 2107 | 3300053099 | Ga0500654_077292 | Ga0500654_077292_425_730 | 96 |
| 2108 | 3300053103 | Ga0500555_041782 | Ga0500555_041782_186_491 | 96 |
| 2109 | 3300053104 | Ga0500556_0288197 | Ga0500556_0288197_182_487 | 96 |
| 2110 | 3300053105 | Ga0500557_157332 | Ga0500557_157332_351_656 | 96 |
| 2111 | 3300053116 | Ga0500592_053054 | Ga0500592_053054_338_643 | 96 |
| 2112 | 3300053118 | Ga0500594_0019853 | Ga0500594_0019853_615_920 | 96 |
| 2113 | 3300053119 | Ga0500595_001661 | Ga0500595_001661_1033_1338 | 96 |
| 2114 | 3300053119 | Ga0500595_089684 | Ga0500595_089684_237_542 | 96 |
| 2115 | 3300053119 | Ga0500595_101232 | Ga0500595_101232_77_382 | 96 |
| 2116 | 3300053120 | Ga0500597_212073 | Ga0500597_212073_273_578 | 96 |
| 2117 | 3300053126 | Ga0500621_124217 | Ga0500621_124217_662_967 | 96 |
| 2118 | 3300053130 | Ga0500642_0001424 | Ga0500642_0001424_1257_1562 | 96 |
| 2119 | 3300053130 | Ga0500642_0230453 | Ga0500642_0230453_59_364 | 96 |
| 2120 | 3300053134 | Ga0500658_0046521 | Ga0500658_0046521_677_982 | 96 |
| 2121 | 3300053136 | Ga0500559_0164356 | Ga0500559_0164356_198_503 | 96 |
| 2122 | 3300053136 | Ga0500559_0370957 | Ga0500559_0370957_288_593 | 96 |
| 2123 | 3300053139 | Ga0500568_0029142 | Ga0500568_0029142_732_1037 | 96 |
| 2124 | 3300053142 | Ga0500577_0059353 | Ga0500577_0059353_403_708 | 96 |
| 2125 | 3300053142 | Ga0500577_0216954 | Ga0500577_0216954_331_636 | 96 |
| 2126 | 3300053146 | Ga0500588_0003321 | Ga0500588_0003321_902_1207 | 96 |
| 2127 | 3300053146 | Ga0500588_0133973 | Ga0500588_0133973_230_535 | 96 |
| 2128 | 3300053146 | Ga0500588_0202995 | Ga0500588_0202995_397_702 | 96 |
| 2129 | 3300053151 | Ga0500604_0016509 | Ga0500604_0016509_94_399 | 96 |
| 2130 | 3300053151 | Ga0500604_0033041 | Ga0500604_0033041_796_1101 | 96 |
| 2131 | 3300053153 | Ga0500616_0002871 | Ga0500616_0002871_6956_7261 | 96 |
| 2132 | 3300053154 | Ga0500619_222275 | Ga0500619_222275_224_529 | 96 |
| 2133 | 3300053156 | Ga0500622_0047353 | Ga0500622_0047353_223_528 | 96 |
| 2134 | 3300053156 | Ga0500622_0129144 | Ga0500622_0129144_813_1118 | 96 |
| 2135 | 3300053160 | Ga0500633_0148704 | Ga0500633_0148704_34_339 | 96 |
| 2136 | 3300053177 | Ga0500636_0445628 | Ga0500636_0445628_81_386 | 96 |
| 2137 | 3300053731 | Ga0500609_001079 | Ga0500609_001079_554_859 | 96 |
| 2138 | 3300053731 | Ga0500609_002556 | Ga0500609_002556_1871_2176 | 96 |
| 2139 | 3300053732 | Ga0500656_006057 | Ga0500656_006057_229_534 | 96 |
| 2140 | 3300053739 | Ga0500587_026309 | Ga0500587_026309_229_534 | 96 |
| 2141 | 3300054114 | Ga0501084_0062068 | Ga0501084_0062068_621_926 | 96 |
| 2142 | 3300054114 | Ga0501084_0066631 | Ga0501084_0066631_1807_2112 | 96 |
| 2143 | 3300054114 | Ga0501084_0208090 | Ga0501084_0208090_160_465 | 96 |
| 2144 | 3300054114 | Ga0501084_0230662 | Ga0501084_0230662_1197_1502 | 96 |
| 2145 | 3300054114 | Ga0501084_0464415 | Ga0501084_0464415_607_912 | 96 |
| 2146 | 3300054114 | Ga0501084_0804493 | Ga0501084_0804493_271_576 | 96 |
| 2147 | 3300054114 | Ga0501084_1121746 | Ga0501084_1121746_176_481 | 96 |
| 2148 | 3300054114 | Ga0501084_1130221 | Ga0501084_1130221_298_603 | 96 |
| 2149 | 3300054114 | Ga0501084_1360722 | Ga0501084_1360722_77_382 | 96 |
| 2150 | 3300059421 | Ga0590071_006547 | Ga0590071_006547_728_1033 | 96 |
| 2151 | 3300059423 | Ga0590074_078193 | Ga0590074_078193_210_515 | 96 |
| 2152 | 3300059424 | Ga0590075_010263 | Ga0590075_010263_557_862 | 96 |
| 2153 | 3300059426 | Ga0590077_016365 | Ga0590077_016365_61_366 | 96 |
| 2154 | 3300059477 | Ga0587084_059576 | Ga0587084_059576_301_606 | 96 |
| 2155 | 3300059491 | Ga0587070_072652 | Ga0587070_072652_383_688 | 96 |
| 2156 | 3300059492 | Ga0587073_0087772 | Ga0587073_0087772_71_376 | 96 |
| 2157 | 3300059503 | Ga0587080_052290 | Ga0587080_052290_421_726 | 96 |
| 2158 | 3300059504 | Ga0587082_008975 | Ga0587082_008975_483_788 | 96 |
| 2159 | 3300059505 | Ga0587083_0072825 | Ga0587083_0072825_442_747 | 96 |
| 2160 | 3300059604 | Ga0587098_052953 | Ga0587098_052953_184_489 | 96 |
| 2161 | 3300059645 | Ga0587076_084925 | Ga0587076_084925_251_556 | 96 |
| 2162 | 3300059647 | Ga0587079_127439 | Ga0587079_127439_144_449 | 96 |
| 2163 | 3300059655 | Ga0587114_026899 | Ga0587114_026899_99_404 | 96 |
| 2164 | 3300060247 | Ga0587096_07987 | Ga0587096_07987_137_442 | 96 |
| 2165 | 3300060346 | Ga0587111_0001675 | Ga0587111_0001675_924_1229 | 96 |
| 2166 | 3300060346 | Ga0587111_0074243 | Ga0587111_0074243_332_637 | 96 |
| 2167 | 3300060353 | Ga0501082_0016308 | Ga0501082_0016308_3261_3566 | 96 |
| 2168 | 3300060353 | Ga0501082_0069701 | Ga0501082_0069701_816_1121 | 96 |
| 2169 | 3300060353 | Ga0501082_0091200 | Ga0501082_0091200_2106_2411 | 96 |
| 2170 | 3300060353 | Ga0501082_0119945 | Ga0501082_0119945_490_795 | 96 |
| 2171 | 3300060353 | Ga0501082_0120716 | Ga0501082_0120716_468_773 | 96 |
| 2172 | 3300060353 | Ga0501082_0208204 | Ga0501082_0208204_944_1249 | 96 |
| 2173 | 3300060353 | Ga0501082_0214341 | Ga0501082_0214341_353_658 | 96 |
| 2174 | 3300060353 | Ga0501082_0356957 | Ga0501082_0356957_671_976 | 96 |
| 2175 | 3300060353 | Ga0501082_0522514 | Ga0501082_0522514_661_966 | 96 |
| 2176 | 3300060353 | Ga0501082_1161788 | Ga0501082_1161788_157_462 | 96 |
| 2177 | 3300061719 | Ga0466962_0043530 | Ga0466962_0043530_556_861 | 96 |
| 2178 | 3300061734 | Ga0530510_0015198 | Ga0530510_0015198_2578_2883 | 96 |
| 2179 | 3300061734 | Ga0530510_0480852 | Ga0530510_0480852_416_721 | 96 |
| 2180 | 3300061734 | Ga0530510_1071595 | Ga0530510_1071595_259_576 | 96 |
| 2181 | iso_pu_bacteria | 641228493 | 641337349 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pf2-assembly1.cif.gz_B | crystal structure of amino acids 1220-1276 of human beta cardiac myosin fused to gp7 and eb1 | 0.9811 | 19 | 44 |
| 4tx3-assembly1.cif.gz_A | complex of the x-domain and oxyb from teicoplanin biosynthesis | 0.9031 | 14 | 44 |
| 6fsh-assembly3.cif.gz_C | crystal structure of hybrid p450 oxybtei(bc/fgvan) | 0.8679 | 14 | 44 |
| 3tuf-assembly1.cif.gz_A | structure of the spoiiq-spoiiiah pore forming complex. | 0.8671 | 11 | 44 |
| 6fsh-assembly2.cif.gz_B | crystal structure of hybrid p450 oxybtei(bc/fgvan) | 0.8651 | 14 | 44 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q556G4_163_296_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 1.009 | 20 | 42 | 1.25.10.10 |
| af_K7K3I6_14_100_3.30.260.10 | Alpha Beta;2-Layer Sandwich;GROEL; domain 2;TCP-1-like chaperonin intermediate domain | 0.9681 | 19 | 43 | 3.30.260.10 |
| af_O94545_7_983_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.9583 | 19 | 43 | 1.25.10.10 |
| af_P05690_325_646_1.25.10.20 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Vitellinogen, superhelical | 0.9571 | 19 | 43 | 1.25.10.20 |
| af_A0A1D6DUH0_104_283_1.25.40.530 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain | 0.9414 | 16 | 44 | 1.25.40.530 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8A6W3U2-F1-model_v4 | Ribosomal protein S14 | 0.8446 | 12 | 96 |
GO:0005739
GO:0005840 |
| AF-A0A081CMI9-F1-model_v4 | Transcription initiation factor TFIID subunit 9 | 0.8379 | 12 | 95 |
GO:0000124
GO:0003713 GO:0003735 GO:0005669 GO:0005840 GO:0006412 GO:0016251 GO:0046982 GO:0051123 GO:1990904 |
| AF-A0A0D6EIY8-F1-model_v4 | SPOSA6832_01560-mRNA-1:cds | 0.8343 | 10 | 96 |
GO:0003735
GO:0005763 GO:0006412 |
| AF-A0A8A9WR53-F1-model_v4 | Ribosomal protein S14 | 0.8327 | 14 | 96 |
GO:0005739
GO:0005840 GO:0016020 |
| AF-A0A7M3RX07-F1-model_v4 | deleted | 0.831 | 11 | 66 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar