F496503

General Info

Members Datasets Scaffolds Average Seq Length
2171 665 2108 313

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10007622|JGI25151J46595_100076222
Length 380
Sequence MDGHACCRTGPRQPVPNQRQRALTNSRAALKTLGGHFXPALYRMIRXSSGTGLPVPHSPGCRVQANPIISIQQLSKTYASGFQALKSVSLDIRRGEILALLGPNGAGKTTLISIICGIVRPSSGTVTADGHDIVRDYRAARAKIGLVPQELSTDAFETVWSTVSFSRGLYGKAPNPAYIEKVLRDLSLWDKKDSKIMSLSGGMKRRVLIAKALSHEPTILFLDEPSAGVDVELRKGMWQMVRELQSSGVTIILTTHYIEEAEEMADRIGVINKGELILVEDKTVLMRKLGKKQLSLQLQTPLQSIPAALAGLPLELSGEGHTLVYTFDSQTEETGIAALLKRLAELGIDFKDLHSSESSLEDIFVSLVHADXPAAHKEAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2519103095 Burkholderia sp. KJ006 Isolate Nodule
6 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
7 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
8 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
11 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
14 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
15 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
16 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
17 2643221569 Achromobacter sp. Root565 Isolate Unclassified
18 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
19 2643221594 Achromobacter sp. Root170 Isolate Unclassified
20 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
21 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
22 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
23 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
24 2773857925 Microvirga vignae BR3299 Isolate Unclassified
25 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
26 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
27 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
28 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
29 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
30 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
31 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
32 2818991452 Burkholderia cepacia 561 Isolate Unclassified
33 2818991457 Xanthomonas translucens 569 Isolate Unclassified
34 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
35 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
36 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
37 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
38 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
39 2904564687 Burkholderia sp. 571 Isolate Unclassified
40 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
41 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
42 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
43 2928163908 Burkholderia sp. 567 Isolate Unclassified
44 2928170801 Burkholderia sp. 572 Isolate Unclassified
45 2928536128 Burkholderia sola 565 Isolate Unclassified
46 2928963466 Dyella japonica 1073 Isolate Unclassified
47 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
48 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
49 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
50 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
51 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
52 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
53 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
54 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
55 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
56 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
57 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
58 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
59 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
60 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
61 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
66 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
67 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
71 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
72 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
73 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
74 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
75 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
76 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
77 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
83 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
84 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
85 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
91 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
92 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
93 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
94 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
95 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
109 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
110 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
111 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
112 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
116 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
117 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
118 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
119 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
120 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
121 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
122 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
125 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
126 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
127 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
133 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
134 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
135 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
136 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
137 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
138 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
141 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
142 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
143 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
146 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
147 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
148 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
149 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
150 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
153 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
154 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
155 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
158 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
159 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
160 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
161 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
162 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
164 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
165 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
168 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
169 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
170 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
171 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
172 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
173 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
174 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
175 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
176 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
177 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
178 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
179 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
180 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
183 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
184 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
185 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
198 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
209 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
210 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
211 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
212 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
213 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
214 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
215 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
216 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
217 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
218 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
219 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
221 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
227 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
228 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
229 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
230 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
231 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
237 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
238 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
240 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
241 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
242 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
245 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
246 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
247 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
251 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
256 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
259 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
336 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
337 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
338 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
339 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
343 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
344 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
345 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
346 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
347 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
348 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
349 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
351 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
352 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
353 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
354 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
355 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
356 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
357 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
358 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
359 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
360 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
361 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
362 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
363 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
364 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
365 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
366 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
367 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
368 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
369 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
370 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
371 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
372 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
373 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
374 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
375 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
376 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
377 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
378 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
379 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
380 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
381 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
382 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
383 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
384 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
385 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
386 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
387 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
388 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
389 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
390 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
391 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
392 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
393 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
394 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
395 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
396 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
397 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
398 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
399 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
400 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
401 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
402 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
403 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
404 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
405 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
406 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
407 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
408 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
409 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
410 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
411 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
412 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
413 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
414 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
415 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
416 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
417 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
418 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
419 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
420 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
421 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
422 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
423 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
424 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
425 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
426 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
427 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
428 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
429 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
430 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
431 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
432 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
433 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
434 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
435 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
436 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
437 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
438 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
439 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
440 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
441 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
442 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
443 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
444 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
445 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
446 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
447 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
448 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
449 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
450 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
451 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
452 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
453 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
454 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
457 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
458 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
459 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
460 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
461 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
462 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
463 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
464 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
465 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
466 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
467 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
468 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
469 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
470 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
471 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
472 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
473 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
474 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
475 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
476 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
477 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
478 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
479 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
480 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
481 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
482 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
483 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
484 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
485 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
486 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
487 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
488 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
489 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
490 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
491 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
492 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
493 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
494 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
495 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
496 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
497 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
498 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
499 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
500 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
501 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
502 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
503 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
504 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
505 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
506 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
507 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
508 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
509 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
510 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
511 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
512 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
513 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
514 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
515 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
516 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
517 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
518 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
519 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
520 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
521 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
522 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
523 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
524 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
525 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
526 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
527 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
528 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
529 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
530 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
531 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
532 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
533 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
534 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
535 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
536 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
537 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
538 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
539 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
540 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
541 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
542 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
543 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
544 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
545 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
546 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
547 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
548 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
549 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
550 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
551 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
552 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
553 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
554 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
555 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
556 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
557 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
558 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
559 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
560 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
571 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
572 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
576 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
577 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
578 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
579 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
580 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
581 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
582 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
583 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
584 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
585 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
586 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
587 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
588 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
589 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
590 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
594 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
595 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
596 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
597 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
598 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
599 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
600 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
601 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
602 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
603 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
604 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
605 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
606 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
607 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
608 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
609 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
610 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
611 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
612 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
613 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
614 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
615 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
616 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
617 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
618 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
619 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
620 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
621 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
622 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
623 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
624 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
625 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
626 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
627 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
628 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
629 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
630 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
631 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
632 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
633 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
634 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
635 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
636 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
637 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
638 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
639 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
640 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
641 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
642 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
643 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
644 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
645 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
646 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
647 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
648 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
649 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
650 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
651 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
652 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
653 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
654 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
655 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
656 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
657 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
658 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
659 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
660 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
661 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
662 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
663 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
664 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
665 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.32
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.75
Nodule 0.09
Rhizoplane 3.68
Rhizosphere 78.63
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_719950 2162886007 Bacteria 4655
2 JGI24736J21556_1003706 3300001904 Bacteria 2638
3 JGI24736J21556_1018176 3300001904 Bacteria 1113
4 JGI24741J21665_1000800 3300001915 Bacteria 9447
5 JGI24741J21665_1000867 3300001915 Bacteria 9119
6 JGI24741J21665_1000873 3300001915 Bacteria 9094
7 JGI24741J21665_1002927 3300001915 Bacteria 4265
8 JGI24740J21852_10000833 3300001979 Bacteria 13603
9 JGI24740J21852_10002444 3300001979 Bacteria 8426
10 JGI24740J21852_10003279 3300001979 Bacteria 7138
11 JGI24740J21852_10011531 3300001979 Bacteria 3363
12 JGI24740J21852_10050988 3300001979 Bacteria 1187
13 JGI24739J22299_10003761 3300001989 Bacteria 5795
14 JGI24739J22299_10003964 3300001989 Bacteria 5663
15 JGI24737J22298_10004736 3300001990 Bacteria 4723
16 JGI24743J22301_10001171 3300001991 Bacteria 3531
17 JGI24735J21928_10001752 3300002067 Bacteria 7650
18 JGI24735J21928_10005070 3300002067 Bacteria 4385
19 JGI24738J21930_10002476 3300002075 Bacteria 4824
20 JGI24749J21850_1001805 3300002076 Bacteria 3029
21 JGI24033J26618_1001172 3300002155 Bacteria 2557
22 JGI24034J26672_10005980 3300002239 Bacteria 1752
23 JGI25155J39150_1000057 3300002704 Bacteria 72575
24 JGI25156J39149_1000073 3300002705 Bacteria 77465
25 JGI25156J39149_1000673 3300002705 Bacteria 18434
26 JGI25156J39149_1002242 3300002705 Bacteria 7137
27 JGI25162J39368_1000468 3300002737 Bacteria 31159
28 JGI25162J39368_1000971 3300002737 Bacteria 18268
29 JGI25162J39368_1001279 3300002737 Bacteria 14280
30 JGI25154J39366_1000097 3300002738 Bacteria 77399
31 JGI25154J39366_1001421 3300002738 Bacteria 8532
32 JGI25157J39369_1000075 3300002741 Bacteria 88169
33 JGI25157J39369_1000089 3300002741 Bacteria 77465
34 JGI25157J39369_1000469 3300002741 Bacteria 25434
35 JGI25157J39369_1000772 3300002741 Bacteria 16587
36 JGI25164J39214_1000193 3300002772 Bacteria 52696
37 JGI25164J39214_1000242 3300002772 Bacteria 41726
38 JGI25159J45721_1001136 3300002987 Bacteria 11378
39 JGI25159J45721_1005739 3300002987 Bacteria 3843
40 JGI25151J46595_10004543 3300003187 Bacteria 7320
41 JGI25151J46595_10007622 3300003187 Bacteria 5284
42 JGI25151J46595_10029108 3300003187 Bacteria 2192
43 JGI25406J46586_10025745 3300003203 Bacteria 2279
44 JGI25165J46597_1000335 3300003214 Bacteria 55465
45 JGI25165J46597_1002530 3300003214 Bacteria 5737
46 JGI25160J50197_1000076 3300003354 Bacteria 102318
47 JGI26145J50221_1001413 3300003371 Bacteria 1901
48 JGI25161J50226_1000058 3300003374 Bacteria 102318
49 Ga0055539_1002563 3300003752 Bacteria 2728
50 Ga0055533_1000011 3300003756 Bacteria 467893
51 Ga0055533_1005444 3300003756 Bacteria 2041
52 Ga0055525_1000089 3300003759 Bacteria 142096
53 Ga0055525_1001594 3300003759 Bacteria 3649
54 Ga0055527_1000084 3300003760 Bacteria 74303
55 Ga0055527_1000206 3300003760 Bacteria 38636
56 Ga0055535_1000426 3300003761 Bacteria 39469
57 Ga0055535_1000639 3300003761 Bacteria 27945
58 Ga0055535_1000728 3300003761 Bacteria 24896
59 Ga0055542_1000057 3300003762 Bacteria 162955
60 Ga0055542_1000107 3300003762 Bacteria 111897
61 Ga0055542_1000195 3300003762 Bacteria 74303
62 Ga0055542_1000455 3300003762 Bacteria 38636
63 Ga0055529_1000460 3300003763 Bacteria 39464
64 Ga0055529_1000881 3300003763 Bacteria 17123
65 Ga0055526_1005666 3300003771 Bacteria 7092
66 Ga0055526_1005854 3300003771 Bacteria 6901
67 Ga0055537_1000730 3300003773 Bacteria 16851
68 Ga0055537_1014657 3300003773 Bacteria 1412
69 Ga0055524_1001067 3300003775 Bacteria 16851
70 Ga0055524_1003977 3300003775 Bacteria 6985
71 Ga0055536_1000621 3300003781 Bacteria 24132
72 Ga0055536_1001793 3300003781 Bacteria 12647
73 Ga0055536_1008264 3300003781 Bacteria 4505
74 Ga0055536_1008702 3300003781 Bacteria 4314
75 Ga0055534_1002014 3300003784 Bacteria 7386
76 Ga0055528_1006463 3300003790 Bacteria 5317
77 Ga0055530_10002477 3300003791 Bacteria 11838
78 Ga0055530_10006463 3300003791 Bacteria 5227
79 Ga0055530_10009456 3300003791 Bacteria 3744
80 Ga0055530_10014991 3300003791 Bacteria 2555
81 Ga0055540_1001926 3300003792 Bacteria 11591
82 Ga0055540_1005515 3300003792 Bacteria 5292
83 Ga0055531_10000450 3300003794 Bacteria 38240
84 Ga0055531_10002822 3300003794 Bacteria 11385
85 Ga0055531_10008906 3300003794 Bacteria 5208
86 Ga0055531_10010909 3300003794 Bacteria 4455
87 Ga0055531_10013622 3300003794 Bacteria 3732
88 Ga0055531_10040125 3300003794 Bacteria 1378
89 Ga0055531_10041520 3300003794 Bacteria 1330
90 Ga0058692_1000142 3300003856 Bacteria 45378
91 Ga0058692_1015531 3300003856 Bacteria 1713
92 Ga0055543_1002375 3300004625 Bacteria 6288
93 Ga0065165_1000949 3300005262 Bacteria 36709
94 Ga0065165_1004485 3300005262 Bacteria 8602
95 Ga0065165_1023570 3300005262 Bacteria 2083
96 Ga0065165_1037799 3300005262 Bacteria 1460
97 Ga0065165_1040512 3300005262 Bacteria 1389
98 Ga0065712_10084506 3300005290 Bacteria 2758
99 Ga0065715_10023686 3300005293 Bacteria 2211
100 Ga0065715_10118965 3300005293 Bacteria 2300
101 Ga0065715_10181169 3300005293 Bacteria 1475
102 Ga0065707_10118060 3300005295 Bacteria 2195
103 Ga0070658_10001353 3300005327 Bacteria 20935
104 Ga0070658_10003530 3300005327 Bacteria 12834
105 Ga0070658_10005606 3300005327 Bacteria 10181
106 Ga0070658_10011570 3300005327 Bacteria 7077
107 Ga0070658_10058004 3300005327 Bacteria 3150
108 Ga0070658_10070760 3300005327 Bacteria 2857
109 Ga0070658_10091592 3300005327 Bacteria 2505
110 Ga0070658_10117242 3300005327 Bacteria 2210
111 Ga0070658_10136788 3300005327 Bacteria 2045
112 Ga0070676_10015962 3300005328 Bacteria 4146
113 Ga0070676_10044461 3300005328 Bacteria 2585
114 Ga0070683_100007585 3300005329 Bacteria 9175
115 Ga0070683_100024660 3300005329 Bacteria 5390
116 Ga0070683_100037375 3300005329 Bacteria 4445
117 Ga0070683_100045251 3300005329 Bacteria 4062
118 Ga0070683_100064518 3300005329 Bacteria 3409
119 Ga0070690_100011275 3300005330 Bacteria 5225
120 Ga0070690_100015791 3300005330 Bacteria 4512
121 Ga0070690_100044508 3300005330 Bacteria 2818
122 Ga0070670_100000002 3300005331 Bacteria 568775
123 Ga0070670_100080375 3300005331 Bacteria 2802
124 Ga0070670_100101779 3300005331 Bacteria 2473
125 Ga0070670_100102372 3300005331 Bacteria 2466
126 Ga0070670_100102443 3300005331 Bacteria 2465
127 Ga0070670_100416273 3300005331 Bacteria 1188
128 Ga0070677_10008613 3300005333 Bacteria 3438
129 Ga0070677_10014193 3300005333 Bacteria 2799
130 Ga0068869_100025426 3300005334 Bacteria 4111
131 Ga0068869_100036648 3300005334 Bacteria 3483
132 Ga0068869_100049779 3300005334 Bacteria 3034
133 Ga0068869_100274068 3300005334 Bacteria 1355
134 Ga0070666_10122162 3300005335 Bacteria 1806
135 Ga0070680_100004287 3300005336 Bacteria 10716
136 Ga0070680_100008203 3300005336 Bacteria 7983
137 Ga0070680_100035878 3300005336 Bacteria 4004
138 Ga0070680_100055851 3300005336 Bacteria 3227
139 Ga0070680_100065166 3300005336 Bacteria 2986
140 Ga0070680_100128398 3300005336 Bacteria 2119
141 Ga0070680_100197564 3300005336 Bacteria 1696
142 Ga0070680_100204475 3300005336 Bacteria 1665
143 Ga0070680_100249745 3300005336 Bacteria 1500
144 Ga0070680_100286698 3300005336 Bacteria 1395
145 Ga0070682_100003586 3300005337 Bacteria 8594
146 Ga0070682_100057489 3300005337 Bacteria 2450
147 Ga0070682_100068347 3300005337 Bacteria 2266
148 Ga0070682_100080136 3300005337 Bacteria 2110
149 Ga0070682_100087362 3300005337 Bacteria 2032
150 Ga0070682_100221678 3300005337 Bacteria 1346
151 Ga0068868_100028093 3300005338 Bacteria 4297
152 Ga0068868_100062772 3300005338 Bacteria 2946
153 Ga0070660_100000006 3300005339 Bacteria 166714
154 Ga0070660_100000378 3300005339 Bacteria 29634
155 Ga0070660_100004561 3300005339 Bacteria 9577
156 Ga0070660_100005115 3300005339 Bacteria 9059
157 Ga0070660_100025856 3300005339 Bacteria 4366
158 Ga0070660_100031954 3300005339 Bacteria 3958
159 Ga0070660_100036722 3300005339 Bacteria 3712
160 Ga0070660_100046895 3300005339 Bacteria 3313
161 Ga0070660_100047116 3300005339 Bacteria 3306
162 Ga0070660_100048131 3300005339 Bacteria 3273
163 Ga0070689_100000001 3300005340 Bacteria 1334580
164 Ga0070689_100000908 3300005340 Bacteria 18492
165 Ga0070689_100034696 3300005340 Bacteria 3849
166 Ga0070689_100078629 3300005340 Bacteria 2586
167 Ga0070689_100349627 3300005340 Bacteria 1240
168 Ga0070691_10000225 3300005341 Bacteria 19202
169 Ga0070691_10037443 3300005341 Bacteria 2289
170 Ga0070687_100054025 3300005343 Bacteria 2091
171 Ga0070661_100000697 3300005344 Bacteria 24630
172 Ga0070661_100002483 3300005344 Bacteria 12641
173 Ga0070661_100006538 3300005344 Bacteria 8043
174 Ga0070661_100007312 3300005344 Bacteria 7616
175 Ga0070661_100007351 3300005344 Bacteria 7594
176 Ga0070661_100008194 3300005344 Bacteria 7209
177 Ga0070661_100017270 3300005344 Bacteria 5117
178 Ga0070661_100093035 3300005344 Bacteria 2234
179 Ga0070661_100094016 3300005344 Bacteria 2221
180 Ga0070661_100143156 3300005344 Bacteria 1803
181 Ga0070661_100163917 3300005344 Bacteria 1684
182 Ga0070661_100178757 3300005344 Bacteria 1614
183 Ga0070692_10022026 3300005345 Bacteria 3108
184 Ga0070692_10209677 3300005345 Bacteria 1146
185 Ga0070668_100020914 3300005347 Bacteria 4943
186 Ga0070668_100026755 3300005347 Bacteria 4379
187 Ga0070668_100101492 3300005347 Bacteria 2280
188 Ga0070669_100002974 3300005353 Bacteria 12215
189 Ga0070669_100025109 3300005353 Bacteria 4279
190 Ga0070669_100072519 3300005353 Bacteria 2549
191 Ga0070669_100110163 3300005353 Bacteria 2088
192 Ga0070669_100131910 3300005353 Bacteria 1918
193 Ga0070675_100027074 3300005354 Bacteria 4605
194 Ga0070675_100060456 3300005354 Bacteria 3128
195 Ga0070675_100152298 3300005354 Bacteria 1983
196 Ga0070675_100170806 3300005354 Bacteria 1875
197 Ga0070671_100000047 3300005355 Bacteria 84234
198 Ga0070671_100001263 3300005355 Bacteria 18957
199 Ga0070671_100018028 3300005355 Bacteria 5729
200 Ga0070671_100042151 3300005355 Bacteria 3794
201 Ga0070671_100092608 3300005355 Bacteria 2532
202 Ga0070671_100166376 3300005355 Bacteria 1864
203 Ga0070671_100304197 3300005355 Bacteria 1358
204 Ga0070671_100304496 3300005355 Bacteria 1357
205 Ga0070673_100001025 3300005364 Bacteria 15814
206 Ga0070673_100038215 3300005364 Bacteria 3664
207 Ga0070673_100133891 3300005364 Bacteria 2083
208 Ga0070673_100178224 3300005364 Bacteria 1818
209 Ga0070673_100240206 3300005364 Bacteria 1575
210 Ga0070688_100029825 3300005365 Bacteria 3269
211 Ga0070688_100126319 3300005365 Bacteria 1719
212 Ga0070688_100141474 3300005365 Bacteria 1635
213 Ga0070659_100000082 3300005366 Bacteria 71707
214 Ga0070659_100001873 3300005366 Bacteria 15080
215 Ga0070659_100003652 3300005366 Bacteria 10964
216 Ga0070659_100013172 3300005366 Bacteria 6151
217 Ga0070659_100026087 3300005366 Bacteria 4494
218 Ga0070659_100029716 3300005366 Bacteria 4224
219 Ga0070659_100044848 3300005366 Bacteria 3463
220 Ga0070659_100050838 3300005366 Bacteria 3258
221 Ga0070659_100082379 3300005366 Bacteria 2570
222 Ga0070659_100083949 3300005366 Bacteria 2546
223 Ga0070659_100209363 3300005366 Bacteria 1607
224 Ga0070659_100348957 3300005366 Bacteria 1241
225 Ga0070667_100000018 3300005367 Bacteria 226033
226 Ga0070667_100000136 3300005367 Bacteria 93545
227 Ga0070667_100001189 3300005367 Bacteria 23666
228 Ga0070667_100002630 3300005367 Bacteria 15546
229 Ga0070667_100152524 3300005367 Bacteria 2030
230 Ga0070667_100287926 3300005367 Bacteria 1476
231 Ga0070667_100332894 3300005367 Bacteria 1372
232 Ga0070709_10002390 3300005434 Bacteria 10167
233 Ga0070709_10011717 3300005434 Bacteria 4896
234 Ga0070714_100000079 3300005435 Bacteria 82899
235 Ga0070714_100001813 3300005435 Bacteria 15525
236 Ga0070714_100003909 3300005435 Bacteria 11196
237 Ga0070714_100005545 3300005435 Bacteria 9640
238 Ga0070714_100016187 3300005435 Bacteria 6016
239 Ga0070714_100032402 3300005435 Bacteria 4362
240 Ga0070714_100106704 3300005435 Bacteria 2475
241 Ga0070713_100027496 3300005436 Bacteria 4478
242 Ga0070713_100027807 3300005436 Bacteria 4458
243 Ga0070711_100022012 3300005439 Bacteria 4127
244 Ga0070711_100113121 3300005439 Bacteria 1996
245 Ga0070705_100008150 3300005440 Bacteria 5181
246 Ga0070705_100066153 3300005440 Bacteria 2167
247 Ga0070700_100009824 3300005441 Bacteria 5262
248 Ga0070700_100040823 3300005441 Bacteria 2842
249 Ga0070700_100050672 3300005441 Bacteria 2581
250 Ga0070708_100090787 3300005445 Bacteria 2781
251 Ga0070663_100000069 3300005455 Bacteria 44710
252 Ga0070663_100000204 3300005455 Bacteria 29549
253 Ga0070663_100002048 3300005455 Bacteria 11266
254 Ga0070663_100010569 3300005455 Bacteria 5757
255 Ga0070663_100011864 3300005455 Bacteria 5491
256 Ga0070663_100017483 3300005455 Bacteria 4681
257 Ga0070663_100056714 3300005455 Bacteria 2808
258 Ga0070663_100070594 3300005455 Bacteria 2540
259 Ga0070663_100087373 3300005455 Bacteria 2304
260 Ga0070663_100124726 3300005455 Bacteria 1949
261 Ga0070663_100156761 3300005455 Bacteria 1750
262 Ga0070663_100165351 3300005455 Bacteria 1706
263 Ga0070663_100206060 3300005455 Bacteria 1537
264 Ga0070663_100373390 3300005455 Bacteria 1160
265 Ga0070678_100004415 3300005456 Bacteria 7975
266 Ga0070678_100035451 3300005456 Bacteria 3483
267 Ga0070678_100072802 3300005456 Bacteria 2577
268 Ga0070678_100092613 3300005456 Bacteria 2322
269 Ga0070678_100294093 3300005456 Bacteria 1378
270 Ga0070662_100000546 3300005457 Bacteria 22896
271 Ga0070662_100038980 3300005457 Bacteria 3378
272 Ga0070662_100103515 3300005457 Bacteria 2159
273 Ga0070681_10000186 3300005458 Bacteria 47903
274 Ga0070681_10001722 3300005458 Bacteria 19584
275 Ga0070681_10001805 3300005458 Bacteria 19258
276 Ga0070681_10016914 3300005458 Bacteria 7286
277 Ga0070681_10028888 3300005458 Bacteria 5572
278 Ga0070681_10209235 3300005458 Bacteria 1867
279 Ga0070681_10313016 3300005458 Bacteria 1479
280 Ga0070685_10000011 3300005466 Bacteria 137723
281 Ga0070685_10005572 3300005466 Bacteria 6389
282 Ga0070685_10012813 3300005466 Bacteria 4410
283 Ga0070685_10037523 3300005466 Bacteria 2745
284 Ga0070685_10202572 3300005466 Bacteria 1291
285 Ga0070706_100075356 3300005467 Bacteria 3122
286 Ga0070698_100002222 3300005471 Bacteria 21479
287 Ga0070699_100006475 3300005518 Bacteria 10199
288 Ga0070699_100093465 3300005518 Bacteria 2631
289 Ga0070679_100000168 3300005530 Bacteria 52996
290 Ga0070679_100000209 3300005530 Bacteria 47903
291 Ga0070679_100006033 3300005530 Bacteria 11275
292 Ga0070679_100015243 3300005530 Bacteria 7385
293 Ga0070679_100017095 3300005530 Bacteria 7012
294 Ga0070679_100046964 3300005530 Bacteria 4305
295 Ga0070679_100098164 3300005530 Bacteria 2917
296 Ga0070679_100222455 3300005530 Bacteria 1848
297 Ga0070679_100245652 3300005530 Bacteria 1747
298 Ga0070679_100246614 3300005530 Bacteria 1743
299 Ga0070679_100321364 3300005530 Bacteria 1497
300 Ga0070684_100004281 3300005535 Bacteria 10823
301 Ga0070684_100013549 3300005535 Bacteria 6579
302 Ga0070684_100020604 3300005535 Bacteria 5468
303 Ga0070684_100051000 3300005535 Bacteria 3595
304 Ga0068853_100002701 3300005539 Bacteria 13378
305 Ga0068853_100008568 3300005539 Bacteria 8219
306 Ga0068853_100018661 3300005539 Bacteria 5743
307 Ga0068853_100025749 3300005539 Bacteria 4937
308 Ga0068853_100067167 3300005539 Bacteria 3114
309 Ga0068853_100116026 3300005539 Bacteria 2384
310 Ga0068853_100143380 3300005539 Bacteria 2145
311 Ga0068853_100156669 3300005539 Bacteria 2052
312 Ga0068853_100212350 3300005539 Bacteria 1764
313 Ga0068853_100295223 3300005539 Bacteria 1497
314 Ga0070672_100021972 3300005543 Bacteria 4678
315 Ga0070672_100043703 3300005543 Bacteria 3457
316 Ga0070672_100142343 3300005543 Bacteria 1979
317 Ga0070672_100297086 3300005543 Bacteria 1368
318 Ga0070686_100030021 3300005544 Bacteria 3313
319 Ga0070695_100008874 3300005545 Bacteria 5971
320 Ga0070696_100001072 3300005546 Bacteria 17656
321 Ga0070696_100003297 3300005546 Bacteria 10775
322 Ga0070696_100030889 3300005546 Bacteria 3669
323 Ga0070696_100055603 3300005546 Bacteria 2760
324 Ga0070696_100064029 3300005546 Bacteria 2576
325 Ga0070693_100034600 3300005547 Bacteria 2796
326 Ga0070693_100036637 3300005547 Bacteria 2729
327 Ga0070693_100082785 3300005547 Bacteria 1916
328 Ga0070665_100003964 3300005548 Bacteria 15604
329 Ga0070665_100007774 3300005548 Bacteria 10890
330 Ga0070665_100019771 3300005548 Bacteria 6760
331 Ga0070665_100025711 3300005548 Bacteria 5930
332 Ga0070665_100057362 3300005548 Bacteria 3903
333 Ga0068855_100000036 3300005563 Bacteria 162849
334 Ga0068855_100000480 3300005563 Bacteria 49187
335 Ga0068855_100001533 3300005563 Bacteria 29006
336 Ga0068855_100004530 3300005563 Bacteria 16970
337 Ga0068855_100007664 3300005563 Bacteria 13053
338 Ga0068855_100026190 3300005563 Bacteria 6976
339 Ga0068855_100026592 3300005563 Bacteria 6923
340 Ga0068855_100030225 3300005563 Bacteria 6480
341 Ga0068855_100050548 3300005563 Bacteria 4898
342 Ga0068855_100102087 3300005563 Bacteria 3301
343 Ga0068855_100109262 3300005563 Bacteria 3176
344 Ga0068855_100136938 3300005563 Bacteria 2793
345 Ga0068855_100171276 3300005563 Bacteria 2459
346 Ga0068855_100197425 3300005563 Bacteria 2267
347 Ga0068855_100399817 3300005563 Bacteria 1506
348 Ga0070664_100000152 3300005564 Bacteria 47795
349 Ga0070664_100002216 3300005564 Bacteria 15624
350 Ga0070664_100002766 3300005564 Bacteria 14158
351 Ga0070664_100004863 3300005564 Bacteria 10760
352 Ga0070664_100031462 3300005564 Bacteria 4434
353 Ga0070664_100037535 3300005564 Bacteria 4074
354 Ga0070664_100065976 3300005564 Bacteria 3090
355 Ga0070664_100192630 3300005564 Bacteria 1817
356 Ga0070664_100335752 3300005564 Bacteria 1372
357 Ga0068857_100011649 3300005577 Bacteria 7649
358 Ga0068857_100018647 3300005577 Bacteria 6090
359 Ga0068857_100020611 3300005577 Bacteria 5801
360 Ga0068857_100023989 3300005577 Bacteria 5369
361 Ga0068857_100080701 3300005577 Bacteria 2905
362 Ga0068857_100090959 3300005577 Bacteria 2731
363 Ga0068857_100125818 3300005577 Bacteria 2309
364 Ga0068857_100560876 3300005577 Bacteria 1077
365 Ga0068854_100000190 3300005578 Bacteria 41376
366 Ga0068854_100005665 3300005578 Bacteria 7892
367 Ga0068854_100007267 3300005578 Bacteria 7073
368 Ga0068854_100014610 3300005578 Bacteria 5180
369 Ga0068854_100014693 3300005578 Bacteria 5166
370 Ga0068854_100019713 3300005578 Bacteria 4550
371 Ga0068854_100089482 3300005578 Bacteria 2288
372 Ga0068854_100129743 3300005578 Bacteria 1924
373 Ga0068854_100132664 3300005578 Bacteria 1903
374 Ga0068856_100000409 3300005614 Bacteria 47269
375 Ga0068856_100000871 3300005614 Bacteria 32354
376 Ga0068856_100004156 3300005614 Bacteria 14466
377 Ga0068856_100004503 3300005614 Bacteria 13854
378 Ga0068856_100020224 3300005614 Bacteria 6465
379 Ga0068856_100062649 3300005614 Bacteria 3674
380 Ga0068856_100067352 3300005614 Bacteria 3538
381 Ga0068856_100077891 3300005614 Bacteria 3286
382 Ga0068856_100149033 3300005614 Bacteria 2348
383 Ga0068856_100282905 3300005614 Bacteria 1675
384 Ga0068856_100343183 3300005614 Bacteria 1512
385 Ga0068856_100375518 3300005614 Bacteria 1441
386 Ga0068856_100460519 3300005614 Bacteria 1292
387 Ga0070702_100026916 3300005615 Bacteria 3097
388 Ga0070702_100038356 3300005615 Bacteria 2667
389 Ga0070702_100207622 3300005615 Bacteria 1301
390 Ga0068852_100006255 3300005616 Bacteria 8589
391 Ga0068852_100012065 3300005616 Bacteria 6542
392 Ga0068852_100015026 3300005616 Bacteria 5985
393 Ga0068852_100023687 3300005616 Bacteria 4946
394 Ga0068852_100035141 3300005616 Bacteria 4176
395 Ga0068852_100048219 3300005616 Bacteria 3639
396 Ga0068852_100052885 3300005616 Bacteria 3493
397 Ga0068852_100122524 3300005616 Bacteria 2383
398 Ga0068852_100318374 3300005616 Bacteria 1510
399 Ga0068859_100003324 3300005617 Bacteria 16345
400 Ga0068859_100013908 3300005617 Bacteria 8073
401 Ga0068859_100018022 3300005617 Bacteria 7096
402 Ga0068859_100034393 3300005617 Bacteria 5086
403 Ga0068859_100091461 3300005617 Bacteria 3093
404 Ga0068864_100000003 3300005618 Bacteria 568775
405 Ga0068864_100015374 3300005618 Bacteria 6363
406 Ga0068864_100022493 3300005618 Bacteria 5286
407 Ga0068864_100029374 3300005618 Bacteria 4655
408 Ga0068864_100032138 3300005618 Bacteria 4457
409 Ga0068864_100038634 3300005618 Bacteria 4077
410 Ga0068864_100051693 3300005618 Bacteria 3541
411 Ga0068864_100065129 3300005618 Bacteria 3161
412 Ga0068864_100065381 3300005618 Bacteria 3155
413 Ga0068864_100072359 3300005618 Bacteria 3004
414 Ga0068864_100130939 3300005618 Bacteria 2253
415 Ga0068864_100139768 3300005618 Bacteria 2184
416 Ga0068864_100168939 3300005618 Bacteria 1993
417 Ga0068866_10004226 3300005718 Bacteria 5897
418 Ga0068861_100008881 3300005719 Bacteria 6926
419 Ga0068861_100022627 3300005719 Bacteria 4531
420 Ga0068861_100022771 3300005719 Bacteria 4517
421 Ga0068861_100069845 3300005719 Bacteria 2718
422 Ga0068851_10003350 3300005834 Bacteria 7127
423 Ga0068851_10010852 3300005834 Bacteria 4259
424 Ga0068851_10016754 3300005834 Bacteria 3510
425 Ga0068851_10025248 3300005834 Bacteria 2914
426 Ga0068851_10120751 3300005834 Bacteria 1408
427 Ga0068863_100000676 3300005841 Bacteria 34484
428 Ga0068863_100015016 3300005841 Bacteria 7439
429 Ga0068863_100018221 3300005841 Bacteria 6723
430 Ga0068863_100020554 3300005841 Bacteria 6311
431 Ga0068863_100043692 3300005841 Bacteria 4253
432 Ga0068863_100047277 3300005841 Bacteria 4082
433 Ga0068863_100089543 3300005841 Bacteria 2918
434 Ga0068863_100105072 3300005841 Bacteria 2686
435 Ga0068863_100177808 3300005841 Bacteria 2042
436 Ga0068858_100007507 3300005842 Bacteria 10537
437 Ga0068858_100183499 3300005842 Bacteria 1976
438 Ga0068860_100004338 3300005843 Bacteria 14500
439 Ga0068860_100005019 3300005843 Bacteria 13473
440 Ga0068860_100032807 3300005843 Bacteria 4988
441 Ga0068860_100034112 3300005843 Bacteria 4881
442 Ga0068860_100048959 3300005843 Bacteria 4028
443 Ga0068860_100074436 3300005843 Bacteria 3230
444 Ga0068862_100000550 3300005844 Bacteria 39321
445 Ga0068862_100001116 3300005844 Bacteria 25466
446 Ga0068862_100024262 3300005844 Bacteria 5088
447 Ga0068862_100028576 3300005844 Bacteria 4698
448 Ga0068862_100048865 3300005844 Bacteria 3613
449 Ga0068862_100531222 3300005844 Bacteria 1121
450 Ga0081455_10000066 3300005937 Bacteria 115221
451 Ga0081455_10001237 3300005937 Bacteria 31932
452 Ga0081539_10001910 3300005985 Bacteria 32284
453 Ga0070717_10002720 3300006028 Bacteria 12482
454 Ga0070717_10003857 3300006028 Bacteria 10783
455 Ga0070717_10048918 3300006028 Bacteria 3470
456 Ga0070717_10472666 3300006028 Bacteria 1131
457 Ga0075365_10060459 3300006038 Bacteria 2528
458 Ga0075363_100011681 3300006048 Bacteria 4213
459 Ga0075363_100147866 3300006048 Bacteria 1325
460 Ga0075364_10026765 3300006051 Bacteria 3682
461 Ga0070716_100073708 3300006173 Bacteria 2015
462 Ga0070716_100147098 3300006173 Bacteria 1510
463 Ga0075369_10052301 3300006186 Bacteria 1771
464 Ga0075366_10012523 3300006195 Bacteria 4812
465 Ga0075366_10099029 3300006195 Bacteria 1749
466 Ga0075366_10101296 3300006195 Bacteria 1728
467 Ga0097621_100005667 3300006237 Bacteria 8814
468 Ga0097621_100029431 3300006237 Bacteria 4337
469 Ga0097621_100038404 3300006237 Bacteria 3842
470 Ga0097621_100054938 3300006237 Bacteria 3250
471 Ga0097621_100213191 3300006237 Bacteria 1680
472 Ga0097621_100219439 3300006237 Bacteria 1656
473 Ga0097621_100490550 3300006237 Bacteria 1112
474 Ga0075370_10004592 3300006353 Bacteria 6734
475 Ga0075370_10008051 3300006353 Bacteria 5408
476 Ga0075370_10026557 3300006353 Bacteria 3208
477 Ga0075370_10090032 3300006353 Bacteria 1770
478 Ga0075370_10110310 3300006353 Bacteria 1597
479 Ga0068871_100000930 3300006358 Bacteria 19543
480 Ga0068871_100053826 3300006358 Bacteria 3263
481 Ga0068871_100054239 3300006358 Bacteria 3251
482 Ga0068871_100148555 3300006358 Bacteria 1997
483 Ga0068871_100169330 3300006358 Bacteria 1871
484 Ga0068871_100201616 3300006358 Bacteria 1718
485 Ga0075428_100317283 3300006844 Bacteria 1675
486 Ga0075430_100006474 3300006846 Bacteria 9869
487 Ga0075430_100028405 3300006846 Bacteria 4753
488 Ga0075430_100274356 3300006846 Bacteria 1395
489 Ga0075431_100019689 3300006847 Bacteria 6886
490 Ga0075431_100032826 3300006847 Bacteria 5350
491 Ga0075431_100057239 3300006847 Bacteria 4020
492 Ga0075433_10023918 3300006852 Bacteria 5149
493 Ga0075434_100438413 3300006871 Bacteria 1327
494 Ga0075429_100168055 3300006880 Bacteria 1921
495 Ga0068865_100038247 3300006881 Bacteria 3246
496 Ga0068865_100087868 3300006881 Bacteria 2247
497 Ga0075436_100038337 3300006914 Bacteria 3307
498 Ga0097620_100003324 3300006931 Bacteria 16345
499 Ga0097620_100013909 3300006931 Bacteria 8073
500 Ga0097620_100018020 3300006931 Bacteria 7096
501 Ga0097620_100034393 3300006931 Bacteria 5086
502 Ga0097620_100091464 3300006931 Bacteria 3093
503 Ga0079104_1016454 3300006946 Bacteria 2162
504 Ga0075435_100062520 3300007076 Bacteria 3021
505 Ga0075435_100240315 3300007076 Bacteria 1540
506 Ga0099794_10007575 3300007265 Bacteria 4466
507 Ga0099795_10000375 3300007788 Bacteria 8070
508 Ga0105240_10001797 3300009093 Bacteria 36111
509 Ga0105240_10004421 3300009093 Bacteria 21431
510 Ga0105240_10023500 3300009093 Bacteria 8149
511 Ga0105240_10028258 3300009093 Bacteria 7327
512 Ga0105240_10039469 3300009093 Bacteria 6046
513 Ga0105240_10068076 3300009093 Bacteria 4411
514 Ga0105240_10140267 3300009093 Bacteria 2890
515 Ga0105240_10195986 3300009093 Bacteria 2372
516 Ga0105240_10263066 3300009093 Bacteria 1989
517 Ga0105240_10306918 3300009093 Bacteria 1814
518 Ga0105240_10656185 3300009093 Bacteria 1149
519 Ga0111539_10057264 3300009094 Bacteria 4629
520 Ga0105245_10015709 3300009098 Bacteria 6601
521 Ga0105245_10272104 3300009098 Bacteria 1652
522 Ga0105247_10055366 3300009101 Bacteria 2448
523 Ga0114129_10010131 3300009147 Bacteria 13436
524 Ga0114129_10028488 3300009147 Bacteria 7914
525 Ga0114129_10110971 3300009147 Bacteria 3785
526 Ga0114129_10199985 3300009147 Bacteria 2707
527 Ga0114129_10596294 3300009147 Bacteria 1432
528 Ga0105243_10098111 3300009148 Bacteria 2426
529 Ga0105243_10142412 3300009148 Bacteria 2047
530 Ga0105241_10016286 3300009174 Bacteria 5448
531 Ga0105241_10023539 3300009174 Bacteria 4568
532 Ga0105241_10214386 3300009174 Bacteria 1615
533 Ga0105241_10290255 3300009174 Bacteria 1400
534 Ga0105242_10140285 3300009176 Bacteria 2096
535 Ga0105248_10001300 3300009177 Bacteria 27811
536 Ga0105248_10003092 3300009177 Bacteria 18448
537 Ga0105248_10011726 3300009177 Bacteria 9665
538 Ga0105248_10038844 3300009177 Bacteria 5329
539 Ga0105248_10075626 3300009177 Bacteria 3785
540 Ga0105248_10145097 3300009177 Bacteria 2678
541 Ga0105248_10224022 3300009177 Bacteria 2117
542 Ga0105248_10253051 3300009177 Bacteria 1982
543 Ga0105248_10295518 3300009177 Bacteria 1824
544 Ga0105248_10399827 3300009177 Bacteria 1547
545 Ga0105248_10436412 3300009177 Bacteria 1475
546 Ga0105237_10020873 3300009545 Bacteria 6744
547 Ga0105237_10046769 3300009545 Bacteria 4352
548 Ga0105237_10060291 3300009545 Bacteria 3796
549 Ga0105237_10061882 3300009545 Bacteria 3741
550 Ga0105237_10113145 3300009545 Bacteria 2706
551 Ga0105237_10248072 3300009545 Bacteria 1782
552 Ga0105237_10396390 3300009545 Bacteria 1385
553 Ga0105237_10422306 3300009545 Bacteria 1339
554 Ga0105238_10000864 3300009551 Bacteria 31302
555 Ga0105238_10003335 3300009551 Bacteria 16027
556 Ga0105238_10010092 3300009551 Bacteria 9469
557 Ga0105238_10057176 3300009551 Bacteria 3911
558 Ga0105238_10071848 3300009551 Bacteria 3457
559 Ga0105238_10078033 3300009551 Bacteria 3303
560 Ga0105238_10141550 3300009551 Bacteria 2382
561 Ga0105238_10141928 3300009551 Bacteria 2378
562 Ga0105238_10154215 3300009551 Bacteria 2272
563 Ga0105238_10161842 3300009551 Bacteria 2214
564 Ga0105238_10208849 3300009551 Bacteria 1928
565 Ga0105238_10239149 3300009551 Bacteria 1793
566 Ga0105238_10362978 3300009551 Bacteria 1438
567 Ga0105249_10000195 3300009553 Bacteria 69709
568 Ga0105249_10021588 3300009553 Bacteria 5764
569 Ga0105249_10028673 3300009553 Bacteria 5024
570 Ga0105249_10078976 3300009553 Bacteria 3054
571 Ga0099796_10000691 3300010159 Bacteria 5949
572 Ga0105239_10029266 3300010375 Bacteria 6057
573 Ga0105239_10048993 3300010375 Bacteria 4632
574 Ga0105239_10067091 3300010375 Bacteria 3941
575 Ga0105239_10082305 3300010375 Bacteria 3544
576 Ga0105239_10090653 3300010375 Bacteria 3373
577 Ga0105239_10096260 3300010375 Bacteria 3271
578 Ga0105239_10122764 3300010375 Bacteria 2886
579 Ga0105246_10043591 3300011119 Bacteria 3045
580 Ga0105246_10243297 3300011119 Bacteria 1424
581 Ga0157373_10011386 3300013100 Bacteria 6541
582 Ga0157373_10012292 3300013100 Bacteria 6294
583 Ga0157373_10022939 3300013100 Bacteria 4526
584 Ga0157373_10036718 3300013100 Bacteria 3514
585 Ga0157373_10062337 3300013100 Bacteria 2641
586 Ga0157373_10084911 3300013100 Bacteria 2231
587 Ga0157373_10113382 3300013100 Bacteria 1905
588 Ga0157373_10129460 3300013100 Bacteria 1775
589 Ga0157373_10158310 3300013100 Bacteria 1593
590 Ga0157371_10001396 3300013102 Bacteria 25235
591 Ga0157371_10083526 3300013102 Bacteria 2261
592 Ga0157371_10092881 3300013102 Bacteria 2138
593 Ga0157371_10093688 3300013102 Bacteria 2128
594 Ga0157371_10120715 3300013102 Bacteria 1863
595 Ga0157371_10125727 3300013102 Bacteria 1823
596 Ga0157370_10000793 3300013104 Bacteria 39742
597 Ga0157370_10006992 3300013104 Bacteria 12321
598 Ga0157370_10007658 3300013104 Bacteria 11722
599 Ga0157370_10017138 3300013104 Bacteria 7314
600 Ga0157370_10112349 3300013104 Bacteria 2546
601 Ga0157370_10128016 3300013104 Bacteria 2370
602 Ga0157370_10145186 3300013104 Bacteria 2210
603 Ga0157370_10179950 3300013104 Bacteria 1965
604 Ga0157370_10181923 3300013104 Bacteria 1953
605 Ga0157370_10285818 3300013104 Bacteria 1524
606 Ga0157370_10323000 3300013104 Bacteria 1423
607 Ga0157370_10383065 3300013104 Bacteria 1295
608 Ga0157369_10000185 3300013105 Bacteria 86285
609 Ga0157369_10004153 3300013105 Bacteria 17157
610 Ga0157369_10008454 3300013105 Bacteria 11806
611 Ga0157369_10040968 3300013105 Bacteria 5055
612 Ga0157369_10065759 3300013105 Bacteria 3902
613 Ga0157369_10135362 3300013105 Bacteria 2609
614 Ga0157369_10509066 3300013105 Bacteria 1245
615 Ga0157374_10019967 3300013296 Bacteria 5940
616 Ga0157374_10034227 3300013296 Bacteria 4638
617 Ga0157374_10080136 3300013296 Bacteria 3096
618 Ga0157374_10086107 3300013296 Bacteria 2989
619 Ga0157374_10090083 3300013296 Bacteria 2924
620 Ga0157374_10107629 3300013296 Bacteria 2679
621 Ga0157374_10137624 3300013296 Bacteria 2369
622 Ga0157374_10175451 3300013296 Bacteria 2092
623 Ga0157374_10401366 3300013296 Bacteria 1368
624 Ga0157378_10034473 3300013297 Bacteria 4476
625 Ga0157378_10214988 3300013297 Bacteria 1825
626 Ga0157378_10341662 3300013297 Bacteria 1460
627 Ga0163162_10000021 3300013306 Bacteria 214873
628 Ga0163162_10081285 3300013306 Bacteria 3311
629 Ga0163162_10815076 3300013306 Bacteria 1050
630 Ga0157372_10002671 3300013307 Bacteria 19288
631 Ga0157372_10024015 3300013307 Bacteria 6614
632 Ga0157372_10025492 3300013307 Bacteria 6430
633 Ga0157372_10026197 3300013307 Bacteria 6344
634 Ga0157372_10059284 3300013307 Bacteria 4281
635 Ga0157372_10101095 3300013307 Bacteria 3291
636 Ga0157372_10104398 3300013307 Bacteria 3239
637 Ga0157372_10120965 3300013307 Bacteria 3007
638 Ga0157372_10142936 3300013307 Bacteria 2759
639 Ga0157372_10193241 3300013307 Bacteria 2357
640 Ga0157372_10201177 3300013307 Bacteria 2307
641 Ga0157372_10232360 3300013307 Bacteria 2138
642 Ga0157372_10252443 3300013307 Bacteria 2047
643 Ga0157372_10280912 3300013307 Bacteria 1936
644 Ga0157372_10454398 3300013307 Bacteria 1493
645 Ga0157375_10002586 3300013308 Bacteria 15714
646 Ga0157375_10007788 3300013308 Bacteria 9371
647 Ga0157375_10019559 3300013308 Bacteria 6163
648 Ga0157375_10036322 3300013308 Bacteria 4713
649 Ga0157375_10054977 3300013308 Bacteria 3923
650 Ga0157375_10078869 3300013308 Bacteria 3327
651 Ga0157375_10173230 3300013308 Bacteria 2306
652 Ga0163163_10000132 3300014325 Bacteria 76574
653 Ga0163163_10001449 3300014325 Bacteria 20042
654 Ga0163163_10036340 3300014325 Bacteria 4784
655 Ga0163163_10130413 3300014325 Bacteria 2554
656 Ga0163163_10228447 3300014325 Bacteria 1910
657 Ga0163163_10400697 3300014325 Bacteria 1430
658 Ga0163163_10458181 3300014325 Bacteria 1335
659 Ga0157380_10000114 3300014326 Bacteria 44326
660 Ga0157380_10040570 3300014326 Bacteria 3626
661 Ga0182008_10008704 3300014497 Bacteria 5520
662 Ga0182008_10008890 3300014497 Bacteria 5449
663 Ga0157377_10057967 3300014745 Bacteria 2204
664 Ga0157379_10000505 3300014968 Bacteria 31681
665 Ga0157379_10009200 3300014968 Bacteria 8602
666 Ga0157379_10017855 3300014968 Bacteria 6250
667 Ga0157379_10224730 3300014968 Bacteria 1701
668 Ga0157376_10002600 3300014969 Bacteria 12261
669 Ga0157376_10030928 3300014969 Bacteria 4280
670 Ga0157376_10042383 3300014969 Bacteria 3731
671 Ga0157376_10100800 3300014969 Bacteria 2522
672 Ga0157376_10129041 3300014969 Bacteria 2253
673 Ga0157376_10240571 3300014969 Bacteria 1686
674 Ga0157376_10571598 3300014969 Bacteria 1121
675 Ga0182006_1000161 3300015261 Bacteria 71421
676 Ga0182006_1022511 3300015261 Bacteria 2619
677 Ga0182007_10009993 3300015262 Bacteria 3779
678 Ga0182007_10031769 3300015262 Bacteria 1796
679 Ga0182005_1004688 3300015265 Bacteria 4370
680 Ga0182005_1004909 3300015265 Bacteria 4240
681 Ga0183368_1003 3300015687 Bacteria 1276390
682 Ga0163161_10046242 3300017792 Bacteria 3140
683 Ga0163161_10131379 3300017792 Bacteria 1889
684 Ga0163161_10188067 3300017792 Bacteria 1586
685 Ga0206356_10235604 3300020070 Bacteria 4662
686 Ga0206351_10193420 3300020077 Bacteria 1538
687 Ga0206354_10341756 3300020081 Bacteria 6982
688 Ga0206353_10095998 3300020082 Bacteria 1425
689 Ga0154015_1244858 3300020610 Bacteria 5504
690 Ga0154015_1402022 3300020610 Bacteria 3567
691 Ga0213873_10024325 3300021358 Bacteria 1453
692 Ga0213874_10033033 3300021377 Bacteria 1506
693 Ga0213876_10011988 3300021384 Bacteria 4618
694 Ga0213876_10023781 3300021384 Bacteria 3235
695 Ga0209435_100008 3300025206 Bacteria 503644
696 Ga0209436_110535 3300025208 Bacteria 1685
697 Ga0209566_100231 3300025225 Bacteria 54215
698 Ga0209674_100003 3300025226 Bacteria 2196646
699 Ga0209674_100086 3300025226 Bacteria 187776
700 Ga0209674_100488 3300025226 Bacteria 16850
701 Ga0209674_100751 3300025226 Bacteria 10993
702 Ga0209672_100020 3300025228 Bacteria 429003
703 Ga0209672_100029 3300025228 Bacteria 339298
704 Ga0209672_100049 3300025228 Bacteria 238787
705 Ga0209672_100066 3300025228 Bacteria 189828
706 Ga0209147_100024 3300025229 Bacteria 429003
707 Ga0209147_100084 3300025229 Bacteria 189828
708 Ga0209563_100010 3300025230 Bacteria 1337457
709 Ga0209563_100051 3300025230 Bacteria 340545
710 Ga0207427_100117 3300025231 Bacteria 102251
711 Ga0207427_100178 3300025231 Bacteria 67956
712 Ga0207427_101735 3300025231 Bacteria 7170
713 Ga0207427_102934 3300025231 Bacteria 4003
714 Ga0209437_100240 3300025233 Bacteria 89740
715 Ga0209437_100304 3300025233 Bacteria 67955
716 Ga0209437_100482 3300025233 Bacteria 30012
717 Ga0209437_101084 3300025233 Bacteria 8725
718 Ga0209258_100053 3300025242 Bacteria 339233
719 Ga0209258_100084 3300025242 Bacteria 244783
720 Ga0209258_100087 3300025242 Bacteria 238787
721 Ga0209258_100117 3300025242 Bacteria 189828
722 Ga0209258_100144 3300025242 Bacteria 163814
723 Ga0209258_100647 3300025242 Bacteria 25954
724 Ga0209258_102270 3300025242 Bacteria 5161
725 Ga0207425_1010948 3300025245 Bacteria 2187
726 Ga0209646_1000029 3300025246 Bacteria 386414
727 Ga0209646_1000066 3300025246 Bacteria 244823
728 Ga0209026_1000016 3300025250 Bacteria 386457
729 Ga0209026_1000027 3300025250 Bacteria 351282
730 Ga0209026_1000074 3300025250 Bacteria 203820
731 Ga0209026_1000093 3300025250 Bacteria 170393
732 Ga0209026_1001064 3300025250 Bacteria 13335
733 Ga0209677_100044 3300025253 Bacteria 215799
734 Ga0209677_100128 3300025253 Bacteria 76547
735 Ga0209677_101339 3300025253 Bacteria 10829
736 Ga0209677_102377 3300025253 Bacteria 7181
737 Ga0209148_1000009 3300025254 Bacteria 1395625
738 Ga0209148_1000055 3300025254 Bacteria 367500
739 Ga0209148_1000096 3300025254 Bacteria 238787
740 Ga0209148_1000114 3300025254 Bacteria 192073
741 Ga0209148_1000141 3300025254 Bacteria 163821
742 Ga0209148_1000148 3300025254 Bacteria 159642
743 Ga0209148_1001683 3300025254 Bacteria 9898
744 Ga0209759_1000016 3300025256 Bacteria 386414
745 Ga0209759_1000110 3300025256 Bacteria 144917
746 Ga0209759_1000387 3300025256 Bacteria 55041
747 Ga0209759_1006844 3300025256 Bacteria 3771
748 Ga0209759_1008612 3300025256 Bacteria 3163
749 Ga0209129_1009361 3300025258 Bacteria 2593
750 Ga0209233_1000083 3300025261 Bacteria 336016
751 Ga0209233_1000287 3300025261 Bacteria 67956
752 Ga0209233_1000417 3300025261 Bacteria 32180
753 Ga0209565_1000041 3300025263 Bacteria 251081
754 Ga0209565_1000597 3300025263 Bacteria 24336
755 Ga0209565_1003353 3300025263 Bacteria 5227
756 Ga0209565_1008241 3300025263 Bacteria 2744
757 Ga0209455_1000060 3300025272 Bacteria 339298
758 Ga0209455_1000088 3300025272 Bacteria 238787
759 Ga0209455_1000110 3300025272 Bacteria 189828
760 Ga0209455_1003953 3300025272 Bacteria 5034
761 Ga0209673_1000057 3300025273 Bacteria 270150
762 Ga0209673_1001316 3300025273 Bacteria 25092
763 Ga0209673_1002473 3300025273 Bacteria 12777
764 Ga0209130_1000014 3300025284 Bacteria 412039
765 Ga0209130_1003456 3300025284 Bacteria 6687
766 Ga0209130_1005797 3300025284 Bacteria 4179
767 Ga0209675_1000783 3300025291 Bacteria 21160
768 Ga0209675_1010551 3300025291 Bacteria 3142
769 Ga0209675_1012756 3300025291 Bacteria 2682
770 Ga0209676_1000013 3300025292 Bacteria 816080
771 Ga0209676_1000153 3300025292 Bacteria 166393
772 Ga0209676_1000414 3300025292 Bacteria 76877
773 Ga0209676_1000928 3300025292 Bacteria 36206
774 Ga0209676_1000971 3300025292 Bacteria 34521
775 Ga0209676_1001166 3300025292 Bacteria 28483
776 Ga0209676_1002764 3300025292 Bacteria 11730
777 Ga0209676_1005511 3300025292 Bacteria 6581
778 Ga0209025_1000819 3300025294 Bacteria 49669
779 Ga0209025_1003991 3300025294 Bacteria 13248
780 Ga0209025_1013203 3300025294 Bacteria 5213
781 Ga0209564_1001403 3300025295 Bacteria 24959
782 Ga0209564_1002122 3300025295 Bacteria 16818
783 Ga0209564_1004135 3300025295 Bacteria 9106
784 Ga0209564_1005783 3300025295 Bacteria 6903
785 Ga0209564_1013128 3300025295 Bacteria 3545
786 Ga0209564_1017578 3300025295 Bacteria 2778
787 Ga0209758_1004353 3300025297 Bacteria 11861
788 Ga0209758_1004543 3300025297 Bacteria 11461
789 Ga0209758_1010044 3300025297 Bacteria 5742
790 Ga0209758_1032092 3300025297 Bacteria 2140
791 Ga0209050_1000008 3300025298 Bacteria 1144179
792 Ga0209050_1001001 3300025298 Bacteria 35419
793 Ga0209050_1001040 3300025298 Bacteria 34383
794 Ga0209050_1002812 3300025298 Bacteria 13901
795 Ga0209050_1005563 3300025298 Bacteria 7842
796 Ga0209050_1006477 3300025298 Bacteria 6914
797 Ga0209050_1012340 3300025298 Bacteria 3929
798 Ga0209050_1013887 3300025298 Bacteria 3528
799 Ga0209256_1000039 3300025299 Bacteria 372337
800 Ga0209256_1000670 3300025299 Bacteria 46303
801 Ga0209256_1001995 3300025299 Bacteria 18294
802 Ga0209256_1010505 3300025299 Bacteria 3862
803 Ga0209256_1010741 3300025299 Bacteria 3780
804 Ga0209256_1013905 3300025299 Bacteria 2948
805 Ga0207426_1000174 3300025302 Bacteria 160877
806 Ga0207426_1002190 3300025302 Bacteria 13181
807 Ga0209051_1000005 3300025303 Bacteria 1142353
808 Ga0209051_1000354 3300025303 Bacteria 68119
809 Ga0209051_1001411 3300025303 Bacteria 20636
810 Ga0209051_1011234 3300025303 Bacteria 4441
811 Ga0209051_1017460 3300025303 Bacteria 3205
812 Ga0209257_1000031 3300025304 Bacteria 688770
813 Ga0209257_1000184 3300025304 Bacteria 156438
814 Ga0209257_1000186 3300025304 Bacteria 154365
815 Ga0209257_1000616 3300025304 Bacteria 57900
816 Ga0209257_1000916 3300025304 Bacteria 41029
817 Ga0209257_1001656 3300025304 Bacteria 25301
818 Ga0209257_1002298 3300025304 Bacteria 19395
819 Ga0209257_1002620 3300025304 Bacteria 17370
820 Ga0209257_1008929 3300025304 Bacteria 5515
821 Ga0209257_1015048 3300025304 Bacteria 3258
822 Ga0207697_10000097 3300025315 Bacteria 39643
823 Ga0207697_10010256 3300025315 Bacteria 4012
824 Ga0207697_10028013 3300025315 Bacteria 2303
825 Ga0207656_10001616 3300025321 Bacteria 7495
826 Ga0207656_10020861 3300025321 Bacteria 2609
827 Ga0207656_10029893 3300025321 Bacteria 2247
828 Ga0207656_10089236 3300025321 Bacteria 1397
829 Ga0207682_10000606 3300025893 Bacteria 16672
830 Ga0207682_10009513 3300025893 Bacteria 3835
831 Ga0207688_10000116 3300025901 Bacteria 32495
832 Ga0207680_10017501 3300025903 Bacteria 3788
833 Ga0207647_10001462 3300025904 Bacteria 18164
834 Ga0207647_10001869 3300025904 Bacteria 16121
835 Ga0207647_10006674 3300025904 Bacteria 8386
836 Ga0207647_10008408 3300025904 Bacteria 7401
837 Ga0207647_10015485 3300025904 Bacteria 5225
838 Ga0207647_10050884 3300025904 Bacteria 2563
839 Ga0207647_10064672 3300025904 Bacteria 2222
840 Ga0207699_10007949 3300025906 Bacteria 5205
841 Ga0207645_10000751 3300025907 Bacteria 26990
842 Ga0207645_10049349 3300025907 Bacteria 2687
843 Ga0207643_10000178 3300025908 Bacteria 43423
844 Ga0207643_10073745 3300025908 Bacteria 1968
845 Ga0207705_10000003 3300025909 Bacteria 709270
846 Ga0207705_10000131 3300025909 Bacteria 81639
847 Ga0207705_10000146 3300025909 Bacteria 75353
848 Ga0207705_10003397 3300025909 Bacteria 12105
849 Ga0207705_10003406 3300025909 Bacteria 12091
850 Ga0207705_10003729 3300025909 Bacteria 11600
851 Ga0207705_10005607 3300025909 Bacteria 9379
852 Ga0207705_10007205 3300025909 Bacteria 8191
853 Ga0207705_10008024 3300025909 Bacteria 7740
854 Ga0207705_10008884 3300025909 Bacteria 7323
855 Ga0207705_10020214 3300025909 Bacteria 4763
856 Ga0207705_10033292 3300025909 Bacteria 3681
857 Ga0207705_10061477 3300025909 Bacteria 2713
858 Ga0207705_10075461 3300025909 Bacteria 2449
859 Ga0207705_10097427 3300025909 Bacteria 2160
860 Ga0207654_10012458 3300025911 Bacteria 4357
861 Ga0207654_10107726 3300025911 Bacteria 1728
862 Ga0207654_10192013 3300025911 Bacteria 1339
863 Ga0207707_10000168 3300025912 Bacteria 68834
864 Ga0207707_10000215 3300025912 Bacteria 61846
865 Ga0207707_10006842 3300025912 Bacteria 9942
866 Ga0207707_10006998 3300025912 Bacteria 9840
867 Ga0207707_10014027 3300025912 Bacteria 6986
868 Ga0207707_10014706 3300025912 Bacteria 6819
869 Ga0207707_10033686 3300025912 Bacteria 4482
870 Ga0207707_10036106 3300025912 Bacteria 4322
871 Ga0207707_10078805 3300025912 Bacteria 2877
872 Ga0207707_10110001 3300025912 Bacteria 2408
873 Ga0207707_10170473 3300025912 Bacteria 1902
874 Ga0207707_10238315 3300025912 Bacteria 1582
875 Ga0207695_10001113 3300025913 Bacteria 46732
876 Ga0207695_10001799 3300025913 Bacteria 33835
877 Ga0207695_10006878 3300025913 Bacteria 14637
878 Ga0207695_10015367 3300025913 Bacteria 9013
879 Ga0207695_10022510 3300025913 Bacteria 7151
880 Ga0207695_10027319 3300025913 Bacteria 6357
881 Ga0207695_10030192 3300025913 Bacteria 5971
882 Ga0207695_10035912 3300025913 Bacteria 5365
883 Ga0207695_10148734 3300025913 Bacteria 2283
884 Ga0207695_10159823 3300025913 Bacteria 2185
885 Ga0207695_10163005 3300025913 Bacteria 2160
886 Ga0207695_10165850 3300025913 Bacteria 2137
887 Ga0207695_10166453 3300025913 Bacteria 2132
888 Ga0207671_10021180 3300025914 Bacteria 4938
889 Ga0207671_10136168 3300025914 Bacteria 1888
890 Ga0207671_10213308 3300025914 Bacteria 1511
891 Ga0207671_10217718 3300025914 Bacteria 1495
892 Ga0207693_10067411 3300025915 Bacteria 2802
893 Ga0207693_10206708 3300025915 Bacteria 1543
894 Ga0207660_10000227 3300025917 Bacteria 36209
895 Ga0207660_10002134 3300025917 Bacteria 13125
896 Ga0207660_10003818 3300025917 Bacteria 9817
897 Ga0207660_10004969 3300025917 Bacteria 8668
898 Ga0207660_10005823 3300025917 Bacteria 7997
899 Ga0207660_10017556 3300025917 Bacteria 4756
900 Ga0207660_10083176 3300025917 Bacteria 2356
901 Ga0207660_10117507 3300025917 Bacteria 2010
902 Ga0207660_10139263 3300025917 Bacteria 1854
903 Ga0207662_10015909 3300025918 Bacteria 4238
904 Ga0207657_10000003 3300025919 Bacteria 263148
905 Ga0207657_10001611 3300025919 Bacteria 24269
906 Ga0207657_10001988 3300025919 Bacteria 22083
907 Ga0207657_10005362 3300025919 Bacteria 13431
908 Ga0207657_10006429 3300025919 Bacteria 12187
909 Ga0207657_10006601 3300025919 Bacteria 12014
910 Ga0207657_10007281 3300025919 Bacteria 11357
911 Ga0207657_10008053 3300025919 Bacteria 10745
912 Ga0207657_10009315 3300025919 Bacteria 9889
913 Ga0207657_10009409 3300025919 Bacteria 9822
914 Ga0207657_10011673 3300025919 Bacteria 8707
915 Ga0207657_10015108 3300025919 Bacteria 7499
916 Ga0207657_10043281 3300025919 Bacteria 3968
917 Ga0207657_10119040 3300025919 Bacteria 2174
918 Ga0207657_10169956 3300025919 Bacteria 1767
919 Ga0207657_10174880 3300025919 Bacteria 1738
920 Ga0207657_10182020 3300025919 Bacteria 1698
921 Ga0207657_10342971 3300025919 Bacteria 1179
922 Ga0207649_10000589 3300025920 Bacteria 24693
923 Ga0207649_10001798 3300025920 Bacteria 12268
924 Ga0207649_10003120 3300025920 Bacteria 9093
925 Ga0207649_10022398 3300025920 Bacteria 3649
926 Ga0207649_10029248 3300025920 Bacteria 3253
927 Ga0207649_10030793 3300025920 Bacteria 3182
928 Ga0207649_10054677 3300025920 Bacteria 2485
929 Ga0207649_10056667 3300025920 Bacteria 2448
930 Ga0207649_10060806 3300025920 Bacteria 2375
931 Ga0207649_10173575 3300025920 Bacteria 1503
932 Ga0207652_10000158 3300025921 Bacteria 73781
933 Ga0207652_10000282 3300025921 Bacteria 52954
934 Ga0207652_10000956 3300025921 Bacteria 27067
935 Ga0207652_10004584 3300025921 Bacteria 11210
936 Ga0207652_10005330 3300025921 Bacteria 10426
937 Ga0207652_10007449 3300025921 Bacteria 8819
938 Ga0207652_10012340 3300025921 Bacteria 6903
939 Ga0207652_10028196 3300025921 Bacteria 4683
940 Ga0207652_10061330 3300025921 Bacteria 3247
941 Ga0207652_10094510 3300025921 Bacteria 2632
942 Ga0207652_10129621 3300025921 Bacteria 2249
943 Ga0207652_10247259 3300025921 Bacteria 1608
944 Ga0207652_10277873 3300025921 Bacteria 1511
945 Ga0207681_10007817 3300025923 Bacteria 6550
946 Ga0207681_10022395 3300025923 Bacteria 4030
947 Ga0207681_10045690 3300025923 Bacteria 2942
948 Ga0207681_10050848 3300025923 Bacteria 2805
949 Ga0207681_10084941 3300025923 Bacteria 2245
950 Ga0207681_10136124 3300025923 Bacteria 1823
951 Ga0207681_10137195 3300025923 Bacteria 1817
952 Ga0207694_10002683 3300025924 Bacteria 14405
953 Ga0207694_10005613 3300025924 Bacteria 9616
954 Ga0207694_10008293 3300025924 Bacteria 7854
955 Ga0207694_10024724 3300025924 Bacteria 4563
956 Ga0207694_10062475 3300025924 Bacteria 2900
957 Ga0207694_10138033 3300025924 Bacteria 1959
958 Ga0207694_10175408 3300025924 Bacteria 1737
959 Ga0207694_10195737 3300025924 Bacteria 1643
960 Ga0207694_10203323 3300025924 Bacteria 1612
961 Ga0207650_10000003 3300025925 Bacteria 1123235
962 Ga0207650_10002909 3300025925 Bacteria 11821
963 Ga0207650_10008403 3300025925 Bacteria 7047
964 Ga0207650_10032987 3300025925 Bacteria 3748
965 Ga0207650_10033415 3300025925 Bacteria 3725
966 Ga0207650_10055555 3300025925 Bacteria 2939
967 Ga0207650_10105568 3300025925 Bacteria 2175
968 Ga0207650_10185133 3300025925 Bacteria 1661
969 Ga0207650_10318920 3300025925 Bacteria 1272
970 Ga0207650_10413278 3300025925 Bacteria 1118
971 Ga0207659_10004458 3300025926 Bacteria 8474
972 Ga0207659_10017662 3300025926 Bacteria 4662
973 Ga0207659_10202659 3300025926 Bacteria 1586
974 Ga0207687_10000298 3300025927 Bacteria 33998
975 Ga0207687_10061436 3300025927 Bacteria 2654
976 Ga0207700_10030366 3300025928 Bacteria 3827
977 Ga0207700_10033041 3300025928 Bacteria 3699
978 Ga0207700_10059559 3300025928 Bacteria 2888
979 Ga0207700_10154748 3300025928 Bacteria 1898
980 Ga0207700_10232598 3300025928 Bacteria 1568
981 Ga0207700_10499686 3300025928 Bacteria 1076
982 Ga0207664_10000036 3300025929 Bacteria 173396
983 Ga0207664_10001394 3300025929 Bacteria 15882
984 Ga0207664_10011395 3300025929 Bacteria 6318
985 Ga0207664_10015374 3300025929 Bacteria 5552
986 Ga0207664_10029328 3300025929 Bacteria 4190
987 Ga0207664_10051411 3300025929 Bacteria 3253
988 Ga0207664_10260182 3300025929 Bacteria 1517
989 Ga0207644_10000055 3300025931 Bacteria 84281
990 Ga0207644_10000272 3300025931 Bacteria 34285
991 Ga0207644_10003350 3300025931 Bacteria 10337
992 Ga0207644_10050006 3300025931 Bacteria 2995
993 Ga0207644_10081484 3300025931 Bacteria 2391
994 Ga0207644_10095215 3300025931 Bacteria 2226
995 Ga0207644_10117940 3300025931 Bacteria 2016
996 Ga0207644_10216232 3300025931 Bacteria 1517
997 Ga0207644_10233212 3300025931 Bacteria 1463
998 Ga0207690_10000007 3300025932 Bacteria 388533
999 Ga0207690_10000839 3300025932 Bacteria 19670
1000 Ga0207690_10000957 3300025932 Bacteria 18474
1001 Ga0207690_10001891 3300025932 Bacteria 12848
1002 Ga0207690_10002067 3300025932 Bacteria 12299
1003 Ga0207690_10002972 3300025932 Bacteria 10206
1004 Ga0207690_10004750 3300025932 Bacteria 8019
1005 Ga0207690_10016359 3300025932 Bacteria 4510
1006 Ga0207690_10041918 3300025932 Bacteria 3003
1007 Ga0207690_10121720 3300025932 Bacteria 1897
1008 Ga0207690_10197854 3300025932 Bacteria 1524
1009 Ga0207690_10372173 3300025932 Bacteria 1133
1010 Ga0207706_10000267 3300025933 Bacteria 56832
1011 Ga0207706_10004822 3300025933 Bacteria 12636
1012 Ga0207706_10007955 3300025933 Bacteria 9789
1013 Ga0207706_10022681 3300025933 Bacteria 5635
1014 Ga0207706_10117762 3300025933 Bacteria 2336
1015 Ga0207706_10267750 3300025933 Bacteria 1491
1016 Ga0207709_10002291 3300025935 Bacteria 12149
1017 Ga0207709_10101806 3300025935 Bacteria 1900
1018 Ga0207709_10372408 3300025935 Bacteria 1084
1019 Ga0207670_10000036 3300025936 Bacteria 106829
1020 Ga0207670_10017186 3300025936 Bacteria 4368
1021 Ga0207670_10028630 3300025936 Bacteria 3540
1022 Ga0207670_10033733 3300025936 Bacteria 3301
1023 Ga0207670_10037814 3300025936 Bacteria 3148
1024 Ga0207669_10061952 3300025937 Bacteria 2301
1025 Ga0207669_10083924 3300025937 Bacteria 2050
1026 Ga0207704_10125238 3300025938 Bacteria 1768
1027 Ga0207665_10056330 3300025939 Bacteria 2653
1028 Ga0207665_10073092 3300025939 Bacteria 2344
1029 Ga0207691_10010387 3300025940 Bacteria 8932
1030 Ga0207691_10011417 3300025940 Bacteria 8523
1031 Ga0207691_10013709 3300025940 Bacteria 7745
1032 Ga0207691_10019796 3300025940 Bacteria 6366
1033 Ga0207691_10020605 3300025940 Bacteria 6234
1034 Ga0207691_10045931 3300025940 Bacteria 4015
1035 Ga0207691_10052482 3300025940 Bacteria 3724
1036 Ga0207691_10131637 3300025940 Bacteria 2209
1037 Ga0207711_10000855 3300025941 Bacteria 29447
1038 Ga0207711_10000945 3300025941 Bacteria 27919
1039 Ga0207711_10013434 3300025941 Bacteria 6802
1040 Ga0207711_10013551 3300025941 Bacteria 6770
1041 Ga0207711_10022316 3300025941 Bacteria 5292
1042 Ga0207711_10070317 3300025941 Bacteria 3035
1043 Ga0207711_10287045 3300025941 Bacteria 1516
1044 Ga0207689_10000289 3300025942 Bacteria 45719
1045 Ga0207689_10046883 3300025942 Bacteria 3570
1046 Ga0207689_10118439 3300025942 Bacteria 2178
1047 Ga0207689_10265165 3300025942 Bacteria 1421
1048 Ga0207661_10009656 3300025944 Bacteria 6928
1049 Ga0207661_10030731 3300025944 Bacteria 4140
1050 Ga0207661_10143425 3300025944 Bacteria 2058
1051 Ga0207661_10313935 3300025944 Bacteria 1408
1052 Ga0207679_10000467 3300025945 Bacteria 28304
1053 Ga0207679_10004621 3300025945 Bacteria 8574
1054 Ga0207679_10007563 3300025945 Bacteria 6897
1055 Ga0207679_10023274 3300025945 Bacteria 4232
1056 Ga0207679_10034382 3300025945 Bacteria 3575
1057 Ga0207679_10043417 3300025945 Bacteria 3237
1058 Ga0207679_10088413 3300025945 Bacteria 2389
1059 Ga0207679_10182615 3300025945 Bacteria 1737
1060 Ga0207667_10000007 3300025949 Bacteria 630590
1061 Ga0207667_10000586 3300025949 Bacteria 47384
1062 Ga0207667_10001159 3300025949 Bacteria 33115
1063 Ga0207667_10001393 3300025949 Bacteria 30322
1064 Ga0207667_10003714 3300025949 Bacteria 18825
1065 Ga0207667_10005210 3300025949 Bacteria 15866
1066 Ga0207667_10014484 3300025949 Bacteria 8988
1067 Ga0207667_10016531 3300025949 Bacteria 8334
1068 Ga0207667_10020707 3300025949 Bacteria 7309
1069 Ga0207667_10022920 3300025949 Bacteria 6883
1070 Ga0207667_10023090 3300025949 Bacteria 6853
1071 Ga0207667_10032515 3300025949 Bacteria 5620
1072 Ga0207667_10058758 3300025949 Bacteria 4032
1073 Ga0207667_10091006 3300025949 Bacteria 3152
1074 Ga0207667_10099628 3300025949 Bacteria 2998
1075 Ga0207667_10104865 3300025949 Bacteria 2916
1076 Ga0207667_10114164 3300025949 Bacteria 2784
1077 Ga0207667_10118201 3300025949 Bacteria 2732
1078 Ga0207667_10288238 3300025949 Bacteria 1678
1079 Ga0207667_10350065 3300025949 Bacteria 1507
1080 Ga0207667_10408828 3300025949 Bacteria 1382
1081 Ga0207651_10001867 3300025960 Bacteria 9849
1082 Ga0207651_10031395 3300025960 Bacteria 3395
1083 Ga0207651_10039497 3300025960 Bacteria 3113
1084 Ga0207651_10056704 3300025960 Bacteria 2697
1085 Ga0207651_10087761 3300025960 Bacteria 2265
1086 Ga0207651_10090027 3300025960 Bacteria 2242
1087 Ga0207712_10003682 3300025961 Bacteria 9667
1088 Ga0207712_10074461 3300025961 Bacteria 2452
1089 Ga0207712_10096205 3300025961 Bacteria 2191
1090 Ga0207668_10039433 3300025972 Bacteria 3179
1091 Ga0207668_10059489 3300025972 Bacteria 2677
1092 Ga0207668_10240923 3300025972 Bacteria 1463
1093 Ga0207640_10000291 3300025981 Bacteria 33599
1094 Ga0207640_10002225 3300025981 Bacteria 10440
1095 Ga0207640_10003065 3300025981 Bacteria 9004
1096 Ga0207640_10004131 3300025981 Bacteria 7839
1097 Ga0207640_10004350 3300025981 Bacteria 7673
1098 Ga0207640_10006559 3300025981 Bacteria 6390
1099 Ga0207640_10006932 3300025981 Bacteria 6233
1100 Ga0207640_10017678 3300025981 Bacteria 4176
1101 Ga0207640_10101615 3300025981 Bacteria 2018
1102 Ga0207640_10132263 3300025981 Bacteria 1805
1103 Ga0207658_10000004 3300025986 Bacteria 569357
1104 Ga0207658_10000640 3300025986 Bacteria 30799
1105 Ga0207658_10002188 3300025986 Bacteria 14529
1106 Ga0207658_10025984 3300025986 Bacteria 4102
1107 Ga0207658_10190401 3300025986 Bacteria 1705
1108 Ga0207658_10192318 3300025986 Bacteria 1697
1109 Ga0207658_10276021 3300025986 Bacteria 1439
1110 Ga0207677_10053833 3300026023 Bacteria 2742
1111 Ga0207677_10070786 3300026023 Bacteria 2459
1112 Ga0207677_10120548 3300026023 Bacteria 1972
1113 Ga0207677_10177041 3300026023 Bacteria 1674
1114 Ga0207703_10131295 3300026035 Bacteria 2163
1115 Ga0207639_10003451 3300026041 Bacteria 10637
1116 Ga0207639_10003476 3300026041 Bacteria 10601
1117 Ga0207639_10009437 3300026041 Bacteria 6733
1118 Ga0207639_10030575 3300026041 Bacteria 3950
1119 Ga0207639_10065211 3300026041 Bacteria 2826
1120 Ga0207639_10070898 3300026041 Bacteria 2724
1121 Ga0207639_10074999 3300026041 Bacteria 2658
1122 Ga0207639_10171253 3300026041 Bacteria 1839
1123 Ga0207639_10171553 3300026041 Bacteria 1837
1124 Ga0207639_10181683 3300026041 Bacteria 1790
1125 Ga0207639_10246362 3300026041 Bacteria 1556
1126 Ga0207639_10301140 3300026041 Bacteria 1417
1127 Ga0207678_10000160 3300026067 Bacteria 55960
1128 Ga0207678_10001430 3300026067 Bacteria 21888
1129 Ga0207678_10001471 3300026067 Bacteria 21592
1130 Ga0207678_10001480 3300026067 Bacteria 21540
1131 Ga0207678_10001640 3300026067 Bacteria 20513
1132 Ga0207678_10001768 3300026067 Bacteria 19781
1133 Ga0207678_10004079 3300026067 Bacteria 13138
1134 Ga0207678_10005267 3300026067 Bacteria 11583
1135 Ga0207678_10006377 3300026067 Bacteria 10473
1136 Ga0207678_10007045 3300026067 Bacteria 9983
1137 Ga0207678_10027423 3300026067 Bacteria 4968
1138 Ga0207678_10048833 3300026067 Bacteria 3657
1139 Ga0207678_10092102 3300026067 Bacteria 2591
1140 Ga0207678_10149634 3300026067 Bacteria 1993
1141 Ga0207678_10232695 3300026067 Bacteria 1578
1142 Ga0207678_10238032 3300026067 Bacteria 1559
1143 Ga0207678_10353405 3300026067 Bacteria 1267
1144 Ga0207708_10000668 3300026075 Bacteria 26303
1145 Ga0207708_10017052 3300026075 Bacteria 5466
1146 Ga0207708_10041195 3300026075 Bacteria 3521
1147 Ga0207708_10119680 3300026075 Bacteria 2051
1148 Ga0207702_10000128 3300026078 Bacteria 89386
1149 Ga0207702_10000244 3300026078 Bacteria 63493
1150 Ga0207702_10000432 3300026078 Bacteria 47878
1151 Ga0207702_10001083 3300026078 Bacteria 27889
1152 Ga0207702_10001776 3300026078 Bacteria 21223
1153 Ga0207702_10002471 3300026078 Bacteria 17479
1154 Ga0207702_10002683 3300026078 Bacteria 16707
1155 Ga0207702_10004484 3300026078 Bacteria 12390
1156 Ga0207702_10008817 3300026078 Bacteria 8502
1157 Ga0207702_10020180 3300026078 Bacteria 5519
1158 Ga0207702_10026919 3300026078 Bacteria 4775
1159 Ga0207702_10142809 3300026078 Bacteria 2168
1160 Ga0207702_10144806 3300026078 Bacteria 2155
1161 Ga0207702_10290341 3300026078 Bacteria 1549
1162 Ga0207702_10311971 3300026078 Bacteria 1496
1163 Ga0207641_10012760 3300026088 Bacteria 6887
1164 Ga0207641_10025413 3300026088 Bacteria 4883
1165 Ga0207641_10029638 3300026088 Bacteria 4526
1166 Ga0207641_10041063 3300026088 Bacteria 3876
1167 Ga0207641_10052892 3300026088 Bacteria 3440
1168 Ga0207641_10055781 3300026088 Bacteria 3355
1169 Ga0207641_10077897 3300026088 Bacteria 2870
1170 Ga0207641_10118221 3300026088 Bacteria 2361
1171 Ga0207641_10134443 3300026088 Bacteria 2224
1172 Ga0207641_10203206 3300026088 Bacteria 1828
1173 Ga0207641_10347728 3300026088 Bacteria 1412
1174 Ga0207648_10002794 3300026089 Bacteria 18520
1175 Ga0207648_10028635 3300026089 Bacteria 4938
1176 Ga0207648_10040163 3300026089 Bacteria 4112
1177 Ga0207648_10083374 3300026089 Bacteria 2788
1178 Ga0207648_10202405 3300026089 Bacteria 1761
1179 Ga0207648_10244865 3300026089 Bacteria 1597
1180 Ga0207648_10312090 3300026089 Bacteria 1412
1181 Ga0207648_10378584 3300026089 Bacteria 1279
1182 Ga0207676_10000003 3300026095 Bacteria 1123235
1183 Ga0207676_10002722 3300026095 Bacteria 12578
1184 Ga0207676_10017485 3300026095 Bacteria 5197
1185 Ga0207676_10048100 3300026095 Bacteria 3309
1186 Ga0207676_10105712 3300026095 Bacteria 2344
1187 Ga0207676_10115176 3300026095 Bacteria 2256
1188 Ga0207676_10207077 3300026095 Bacteria 1737
1189 Ga0207676_10211234 3300026095 Bacteria 1722
1190 Ga0207676_10273043 3300026095 Bacteria 1532
1191 Ga0207674_10000039 3300026116 Bacteria 131096
1192 Ga0207674_10003404 3300026116 Bacteria 19500
1193 Ga0207674_10004794 3300026116 Bacteria 16214
1194 Ga0207674_10005001 3300026116 Bacteria 15848
1195 Ga0207674_10005506 3300026116 Bacteria 15034
1196 Ga0207674_10007751 3300026116 Bacteria 12493
1197 Ga0207674_10008565 3300026116 Bacteria 11793
1198 Ga0207674_10011756 3300026116 Bacteria 9821
1199 Ga0207674_10041750 3300026116 Bacteria 4742
1200 Ga0207674_10051162 3300026116 Bacteria 4216
1201 Ga0207674_10088975 3300026116 Bacteria 3080
1202 Ga0207674_10154524 3300026116 Bacteria 2250
1203 Ga0207675_100003529 3300026118 Bacteria 15257
1204 Ga0207675_100007814 3300026118 Bacteria 10092
1205 Ga0207675_100037403 3300026118 Bacteria 4527
1206 Ga0207675_100045722 3300026118 Bacteria 4090
1207 Ga0207675_100056446 3300026118 Bacteria 3663
1208 Ga0207675_100153901 3300026118 Bacteria 2190
1209 Ga0207675_100161405 3300026118 Bacteria 2138
1210 Ga0207675_100185942 3300026118 Bacteria 1991
1211 Ga0207675_100231854 3300026118 Bacteria 1781
1212 Ga0207683_10003397 3300026121 Bacteria 13869
1213 Ga0207683_10004053 3300026121 Bacteria 12661
1214 Ga0207683_10016296 3300026121 Bacteria 6325
1215 Ga0207683_10028344 3300026121 Bacteria 4842
1216 Ga0207683_10028751 3300026121 Bacteria 4808
1217 Ga0207683_10043033 3300026121 Bacteria 3944
1218 Ga0207683_10145620 3300026121 Bacteria 2136
1219 Ga0207683_10303500 3300026121 Bacteria 1461
1220 Ga0207683_10391103 3300026121 Bacteria 1278
1221 Ga0207698_10000511 3300026142 Bacteria 22568
1222 Ga0207698_10000772 3300026142 Bacteria 18637
1223 Ga0207698_10002291 3300026142 Bacteria 11337
1224 Ga0207698_10005977 3300026142 Bacteria 7563
1225 Ga0207698_10007308 3300026142 Bacteria 6923
1226 Ga0207698_10011617 3300026142 Bacteria 5719
1227 Ga0207698_10014360 3300026142 Bacteria 5262
1228 Ga0207698_10038140 3300026142 Bacteria 3547
1229 Ga0207698_10044515 3300026142 Bacteria 3336
1230 Ga0207698_10165669 3300026142 Bacteria 1939
1231 Ga0207698_10271249 3300026142 Bacteria 1564
1232 Ga0209371_1000402 3300027312 Bacteria 45205
1233 Ga0209969_1002467 3300027360 Bacteria 2558
1234 Ga0209969_1004138 3300027360 Bacteria 2030
1235 Ga0209984_1006643 3300027424 Bacteria 1423
1236 Ga0210000_1002839 3300027462 Bacteria 2473
1237 Ga0209179_1001067 3300027512 Bacteria 3176
1238 Ga0209968_1004405 3300027526 Bacteria 2113
1239 Ga0209999_1000831 3300027543 Bacteria 5109
1240 Ga0209999_1024095 3300027543 Bacteria 1122
1241 Ga0209982_1002696 3300027552 Bacteria 2499
1242 Ga0209970_1007495 3300027614 Bacteria 1789
1243 Ga0210002_1009435 3300027617 Bacteria 1489
1244 Ga0209983_1029795 3300027665 Bacteria 1161
1245 Ga0209588_1013741 3300027671 Bacteria 2473
1246 Ga0209971_1001096 3300027682 Bacteria 6876
1247 Ga0209971_1001702 3300027682 Bacteria 5417
1248 Ga0209971_1005689 3300027682 Bacteria 2956
1249 Ga0209966_1002408 3300027695 Bacteria 3120
1250 Ga0209974_10002606 3300027876 Bacteria 6548
1251 Ga0209974_10009957 3300027876 Bacteria 3215
1252 Ga0209974_10014357 3300027876 Bacteria 2636
1253 Ga0209974_10014761 3300027876 Bacteria 2595
1254 Ga0207428_10051032 3300027907 Bacteria 3307
1255 Ga0265354_1001901 3300028016 Bacteria 2777
1256 Ga0265356_1000958 3300028017 Bacteria 4619
1257 Ga0265357_1001777 3300028023 Bacteria 1651
1258 Ga0268266_10002350 3300028379 Bacteria 20457
1259 Ga0268266_10006760 3300028379 Bacteria 10456
1260 Ga0268266_10021331 3300028379 Bacteria 5519
1261 Ga0268266_10030898 3300028379 Bacteria 4548
1262 Ga0268266_10081031 3300028379 Bacteria 2829
1263 Ga0268266_10364862 3300028379 Bacteria 1360
1264 Ga0268265_10000166 3300028380 Bacteria 80256
1265 Ga0268265_10004150 3300028380 Bacteria 10158
1266 Ga0268265_10115159 3300028380 Bacteria 2203
1267 Ga0268264_10000016 3300028381 Bacteria 502537
1268 Ga0268264_10030656 3300028381 Bacteria 4408
1269 Ga0268264_10036457 3300028381 Bacteria 4052
1270 Ga0268264_10111651 3300028381 Bacteria 2395
1271 Ga0268264_10150826 3300028381 Bacteria 2084
1272 Ga0265334_10033440 3300028573 Bacteria 2047
1273 Ga0265336_10000008 3300028666 Bacteria 336082
1274 Ga0307517_10036337 3300028786 Bacteria 5544
1275 Ga0307517_10201167 3300028786 Bacteria 1245
1276 Ga0307515_10073692 3300028794 Bacteria 4583
1277 Ga0307515_10131399 3300028794 Bacteria 2755
1278 Ga0265338_10000147 3300028800 Bacteria 129297
1279 Ga0265338_10015253 3300028800 Bacteria 8463
1280 Ga0265338_10168423 3300028800 Bacteria 1683
1281 Ga0268256_1000749 3300030500 Bacteria 23804
1282 Ga0307511_10173324 3300030521 Bacteria 1180
1283 Ga0265760_10000671 3300031090 Bacteria 9729
1284 Ga0265340_10010905 3300031247 Bacteria 4848
1285 Ga0265327_10000546 3300031251 Bacteria 64262
1286 Ga0265327_10022058 3300031251 Bacteria 3822
1287 Ga0265316_10032066 3300031344 Bacteria 4292
1288 Ga0307513_10000013 3300031456 Bacteria 325682
1289 Ga0307513_10000037 3300031456 Bacteria 175364
1290 Ga0307513_10006109 3300031456 Bacteria 15809
1291 Ga0307513_10009214 3300031456 Bacteria 12495
1292 Ga0307513_10009485 3300031456 Bacteria 12308
1293 Ga0307513_10025641 3300031456 Bacteria 6823
1294 Ga0307513_10031639 3300031456 Bacteria 5988
1295 Ga0307513_10126660 3300031456 Bacteria 2508
1296 Ga0307513_10146530 3300031456 Bacteria 2278
1297 Ga0307509_10040026 3300031507 Bacteria 5100
1298 Ga0307509_10067018 3300031507 Bacteria 3763
1299 Ga0307509_10102599 3300031507 Bacteria 2892
1300 Ga0307509_10175361 3300031507 Bacteria 2017
1301 Ga0307408_100016400 3300031548 Bacteria 4944
1302 Ga0307408_100078785 3300031548 Bacteria 2457
1303 Ga0307408_100084695 3300031548 Bacteria 2378
1304 Ga0307408_100090577 3300031548 Bacteria 2308
1305 Ga0307408_100098516 3300031548 Bacteria 2222
1306 Ga0265313_10062816 3300031595 Bacteria 1734
1307 Ga0307508_10010305 3300031616 Bacteria 8551
1308 Ga0307508_10034874 3300031616 Bacteria 4534
1309 Ga0316575_10016265 3300031665 Bacteria 2813
1310 Ga0316575_10089516 3300031665 Bacteria 1246
1311 Ga0265342_10000896 3300031712 Bacteria 29642
1312 Ga0316576_10010553 3300031727 Bacteria 6008
1313 Ga0316576_10125990 3300031727 Bacteria 1925
1314 Ga0316576_10183694 3300031727 Bacteria 1577
1315 Ga0316578_10101146 3300031728 Bacteria 1728
1316 Ga0307516_10011653 3300031730 Bacteria 9540
1317 Ga0307405_10114597 3300031731 Bacteria 1832
1318 Ga0307405_10144803 3300031731 Bacteria 1662
1319 Ga0316577_10035089 3300031733 Bacteria 2803
1320 Ga0316577_10065256 3300031733 Bacteria 2032
1321 Ga0307413_10000338 3300031824 Bacteria 14792
1322 Ga0307413_10004322 3300031824 Bacteria 6165
1323 Ga0307413_10010229 3300031824 Bacteria 4536
1324 Ga0307413_10020874 3300031824 Bacteria 3494
1325 Ga0307413_10065277 3300031824 Bacteria 2266
1326 Ga0307413_10070999 3300031824 Bacteria 2192
1327 Ga0307413_10216233 3300031824 Bacteria 1396
1328 Ga0307410_10033725 3300031852 Bacteria 3307
1329 Ga0307410_10036495 3300031852 Bacteria 3201
1330 Ga0307410_10046331 3300031852 Bacteria 2900
1331 Ga0307410_10053878 3300031852 Bacteria 2724
1332 Ga0307410_10106896 3300031852 Bacteria 2017
1333 Ga0307410_10119677 3300031852 Bacteria 1918
1334 Ga0307410_10152060 3300031852 Bacteria 1724
1335 Ga0307406_10003967 3300031901 Bacteria 8043
1336 Ga0307406_10009035 3300031901 Bacteria 5573
1337 Ga0307406_10022167 3300031901 Bacteria 3766
1338 Ga0307406_10039119 3300031901 Bacteria 2940
1339 Ga0307406_10040688 3300031901 Bacteria 2891
1340 Ga0307406_10045880 3300031901 Bacteria 2747
1341 Ga0307406_10125922 3300031901 Bacteria 1790
1342 Ga0307407_10033693 3300031903 Bacteria 2797
1343 Ga0307407_10047631 3300031903 Bacteria 2434
1344 Ga0307412_10000445 3300031911 Bacteria 25038
1345 Ga0307412_10003289 3300031911 Bacteria 8965
1346 Ga0307412_10006797 3300031911 Bacteria 6488
1347 Ga0307412_10114727 3300031911 Bacteria 1929
1348 Ga0307412_10149165 3300031911 Bacteria 1723
1349 Ga0307412_10152871 3300031911 Bacteria 1705
1350 Ga0307412_10274744 3300031911 Bacteria 1320
1351 Ga0307412_10291024 3300031911 Bacteria 1286
1352 Ga0307409_100002862 3300031995 Bacteria 9137
1353 Ga0307409_100003524 3300031995 Bacteria 8531
1354 Ga0307409_100028252 3300031995 Bacteria 3992
1355 Ga0307409_100060791 3300031995 Bacteria 2948
1356 Ga0307409_100132612 3300031995 Bacteria 2132
1357 Ga0307409_100302238 3300031995 Bacteria 1489
1358 Ga0307416_100009355 3300032002 Bacteria 6410
1359 Ga0307416_100043067 3300032002 Bacteria 3531
1360 Ga0307416_100129481 3300032002 Bacteria 2268
1361 Ga0307416_100201961 3300032002 Bacteria 1887
1362 Ga0307416_100336778 3300032002 Bacteria 1519
1363 Ga0307416_100572901 3300032002 Bacteria 1205
1364 Ga0307414_10003324 3300032004 Bacteria 8582
1365 Ga0307414_10034680 3300032004 Bacteria 3349
1366 Ga0307414_10039804 3300032004 Bacteria 3169
1367 Ga0307414_10040002 3300032004 Bacteria 3163
1368 Ga0307414_10067337 3300032004 Bacteria 2565
1369 Ga0307414_10072543 3300032004 Bacteria 2487
1370 Ga0307414_10078692 3300032004 Bacteria 2404
1371 Ga0307414_10081381 3300032004 Bacteria 2371
1372 Ga0307414_10086675 3300032004 Bacteria 2311
1373 Ga0307414_10342435 3300032004 Bacteria 1280
1374 Ga0307414_10408430 3300032004 Bacteria 1181
1375 Ga0307411_10001485 3300032005 Bacteria 9629
1376 Ga0307411_10003060 3300032005 Bacteria 7641
1377 Ga0307411_10004620 3300032005 Bacteria 6628
1378 Ga0307411_10040251 3300032005 Bacteria 2963
1379 Ga0307411_10104301 3300032005 Bacteria 2013
1380 Ga0307415_100003431 3300032126 Bacteria 8062
1381 Ga0307415_100068728 3300032126 Bacteria 2481
1382 Ga0307415_100190061 3300032126 Bacteria 1619
1383 Ga0307415_100304614 3300032126 Bacteria 1321
1384 Ga0307415_100315497 3300032126 Bacteria 1301
1385 Ga0307415_100378283 3300032126 Bacteria 1201
1386 Ga0316583_10005720 3300032133 Bacteria 4469
1387 Ga0316585_10000970 3300032137 Bacteria 7377
1388 Ga0316585_10008103 3300032137 Bacteria 3042
1389 Ga0316580_10021814 3300032139 Bacteria 1976
1390 Ga0307507_10035501 3300033179 Bacteria 5121
1391 Ga0307507_10069877 3300033179 Bacteria 3191
1392 Ga0373934_0008204 3300035086 Bacteria 3889
1393 Ga0373934_0052308 3300035086 Bacteria 1619
1394 Ga0373944_0021727 3300035089 Bacteria 1860
1395 Ga0373923_0000056 3300035111 Bacteria 17507
1396 Ga0373936_0000074 3300035113 Bacteria 39201
1397 Ga0373936_0015945 3300035113 Bacteria 2883
1398 Ga0373939_0023803 3300035114 Bacteria 1700
1399 Ga0373953_0005940 3300035117 Bacteria 3995
1400 Ga0373953_0124420 3300035117 Bacteria 1097
1401 Ga0373954_0007256 3300035118 Bacteria 4842
1402 Ga0373954_0015620 3300035118 Bacteria 3395
1403 Ga0373954_0021985 3300035118 Bacteria 2891
1404 Ga0373956_0005453 3300035119 Bacteria 5094
1405 Ga0373956_0088997 3300035119 Bacteria 1423
1406 Ga0373957_0008067 3300035120 Bacteria 3397
1407 Ga0373957_0014212 3300035120 Bacteria 2718
1408 Ga0373957_0021645 3300035120 Bacteria 2284
1409 Ga0373957_0027152 3300035120 Bacteria 2077
1410 Ga0373946_0058209 3300035171 Bacteria 1636
1411 Ga0373955_0001249 3300035172 Bacteria 10804
1412 Ga0373955_0005370 3300035172 Bacteria 5753
1413 Ga0373955_0042797 3300035172 Bacteria 2433
1414 Ga0373955_0063169 3300035172 Bacteria 2050
1415 Ga0373961_0000126 3300035241 Bacteria 39091
1416 Ga0373962_0007891 3300035242 Bacteria 2612
1417 Ga0316574_0001239 3300035398 Bacteria 11904
1418 Ga0316574_0005525 3300035398 Bacteria 6750
1419 Ga0316574_0026641 3300035398 Bacteria 3478
1420 Ga0316574_0099027 3300035398 Bacteria 1865
1421 Ga0316574_0139144 3300035398 Bacteria 1564
1422 Ga0316574_0286433 3300035398 Bacteria 1049
1423 Ga0373924_0032456 3300035410 Bacteria 2104
1424 Ga0373931_0015899 3300035691 Bacteria 3696
1425 Ga0373935_0131967 3300035692 Bacteria 1679
1426 Ga0373935_0143274 3300035692 Bacteria 1616
1427 Ga0373927_0000615 3300035695 Bacteria 27027
1428 Ga0373927_0002114 3300035695 Bacteria 14645
1429 Ga0373927_0058213 3300035695 Bacteria 2499
1430 Ga0373933_0035998 3300035724 Bacteria 2894
1431 Ga0373933_0194331 3300035724 Bacteria 1297
1432 Ga0373947_0044769 3300035725 Bacteria 2647
1433 Ga0373947_0074317 3300035725 Bacteria 2091
1434 Ga0373937_0009412 3300036401 Bacteria 8492
1435 Ga0373937_0065983 3300036401 Bacteria 3332
1436 Ga0373937_0076730 3300036401 Bacteria 3087
1437 Ga0373937_0198343 3300036401 Bacteria 1886
1438 Ga0373937_0441480 3300036401 Bacteria 1235
1439 Ga0316582_0000277 3300036647 Bacteria 17504
1440 Ga0316582_0023018 3300036647 Bacteria 3707
1441 Ga0316582_0059868 3300036647 Bacteria 2440
1442 Ga0316582_0063495 3300036647 Bacteria 2373
1443 Ga0316584_0001500 3300036712 Bacteria 14048
1444 Ga0316584_0011002 3300036712 Bacteria 6342
1445 Ga0316584_0030295 3300036712 Bacteria 3997
1446 Ga0316584_0036370 3300036712 Bacteria 3653
1447 Ga0316584_0053546 3300036712 Bacteria 3020
1448 Ga0316584_0102259 3300036712 Bacteria 2146
1449 Ga0316584_0138468 3300036712 Bacteria 1816
1450 Ga0373925_0000278 3300037068 Bacteria 53402
1451 Ga0373925_0011317 3300037068 Bacteria 6474
1452 Ga0373925_0276282 3300037068 Bacteria 1352
1453 Ga0395899_0000261 3300037312 Bacteria 69173
1454 Ga0395899_0000309 3300037312 Bacteria 62448
1455 Ga0395899_0014151 3300037312 Bacteria 6088
1456 Ga0395899_0015844 3300037312 Bacteria 5747
1457 Ga0395899_0040051 3300037312 Bacteria 3505
1458 Ga0395899_0041062 3300037312 Bacteria 3457
1459 Ga0395899_0053950 3300037312 Bacteria 2975
1460 Ga0395899_0080294 3300037312 Bacteria 2374
1461 Ga0395899_0081700 3300037312 Bacteria 2351
1462 Ga0395899_0100636 3300037312 Bacteria 2087
1463 Ga0395899_0149996 3300037312 Bacteria 1653
1464 Ga0395899_0162039 3300037312 Bacteria 1579
1465 Ga0395899_0217919 3300037312 Bacteria 1323
1466 Ga0395900_0000036 3300037418 Bacteria 250619
1467 Ga0395900_0000421 3300037418 Bacteria 61155
1468 Ga0395900_0000463 3300037418 Bacteria 58345
1469 Ga0395900_0002071 3300037418 Bacteria 22508
1470 Ga0395900_0004593 3300037418 Bacteria 14573
1471 Ga0395900_0005687 3300037418 Bacteria 13035
1472 Ga0395900_0013849 3300037418 Bacteria 8230
1473 Ga0395900_0022152 3300037418 Bacteria 6499
1474 Ga0395900_0030670 3300037418 Bacteria 5521
1475 Ga0395900_0043088 3300037418 Bacteria 4650
1476 Ga0395900_0045251 3300037418 Bacteria 4533
1477 Ga0395900_0081366 3300037418 Bacteria 3327
1478 Ga0395900_0112961 3300037418 Bacteria 2789
1479 Ga0395900_0139380 3300037418 Bacteria 2484
1480 Ga0395900_0145385 3300037418 Bacteria 2424
1481 Ga0395900_0146395 3300037418 Bacteria 2415
1482 Ga0395900_0152379 3300037418 Bacteria 2361
1483 Ga0395900_0158473 3300037418 Bacteria 2310
1484 Ga0395900_0167565 3300037418 Bacteria 2238
1485 Ga0395900_0168010 3300037418 Bacteria 2234
1486 Ga0395900_0175775 3300037418 Bacteria 2178
1487 Ga0395900_0176108 3300037418 Bacteria 2175
1488 Ga0395900_0184034 3300037418 Bacteria 2121
1489 Ga0395900_0269389 3300037418 Bacteria 1698
1490 Ga0395900_0319660 3300037418 Bacteria 1533
1491 Ga0395900_0605659 3300037418 Bacteria 1036
1492 Ga0395898_0000305 3300037466 Bacteria 116565
1493 Ga0395898_0000485 3300037466 Bacteria 78871
1494 Ga0395898_0011241 3300037466 Bacteria 9315
1495 Ga0395898_0011477 3300037466 Bacteria 9200
1496 Ga0395898_0014192 3300037466 Bacteria 8192
1497 Ga0395898_0016672 3300037466 Bacteria 7510
1498 Ga0395898_0019437 3300037466 Bacteria 6913
1499 Ga0395898_0020422 3300037466 Bacteria 6726
1500 Ga0395898_0034473 3300037466 Bacteria 5044
1501 Ga0395898_0035939 3300037466 Bacteria 4923
1502 Ga0395898_0037985 3300037466 Bacteria 4774
1503 Ga0395898_0042918 3300037466 Bacteria 4460
1504 Ga0395898_0076987 3300037466 Bacteria 3220
1505 Ga0395898_0107552 3300037466 Bacteria 2674
1506 Ga0395898_0171768 3300037466 Bacteria 2072
1507 Ga0395898_0188804 3300037466 Bacteria 1969
1508 Ga0395898_0220915 3300037466 Bacteria 1807
1509 Ga0395898_0221856 3300037466 Bacteria 1803
1510 Ga0395898_0253128 3300037466 Bacteria 1679
1511 Ga0395905_0018294 3300037471 Bacteria 6651
1512 Ga0395905_0018671 3300037471 Bacteria 6577
1513 Ga0395905_0034234 3300037471 Bacteria 4769
1514 Ga0395905_0048902 3300037471 Bacteria 3962
1515 Ga0395905_0059563 3300037471 Bacteria 3569
1516 Ga0395905_0092636 3300037471 Bacteria 2834
1517 Ga0395905_0095282 3300037471 Bacteria 2793
1518 Ga0395905_0134658 3300037471 Bacteria 2324
1519 Ga0395905_0154853 3300037471 Bacteria 2155
1520 Ga0395905_0194649 3300037471 Bacteria 1901
1521 Ga0395905_0296101 3300037471 Bacteria 1505
1522 Ga0395905_0299238 3300037471 Bacteria 1496
1523 Ga0316581_0019015 3300037588 Bacteria 2000
1524 Ga0316581_0024562 3300037588 Bacteria 1788
1525 Ga0395901_0000036 3300038443 Bacteria 214274
1526 Ga0395901_0000188 3300038443 Bacteria 78908
1527 Ga0395901_0000604 3300038443 Bacteria 41808
1528 Ga0395901_0000913 3300038443 Bacteria 32275
1529 Ga0395901_0001198 3300038443 Bacteria 27598
1530 Ga0395901_0002697 3300038443 Bacteria 17888
1531 Ga0395901_0003975 3300038443 Bacteria 14871
1532 Ga0395901_0009119 3300038443 Bacteria 10047
1533 Ga0395901_0015319 3300038443 Bacteria 7803
1534 Ga0395901_0023104 3300038443 Bacteria 6373
1535 Ga0395901_0030354 3300038443 Bacteria 5568
1536 Ga0395901_0054449 3300038443 Bacteria 4158
1537 Ga0395901_0055205 3300038443 Bacteria 4130
1538 Ga0395901_0090263 3300038443 Bacteria 3207
1539 Ga0395901_0116576 3300038443 Bacteria 2805
1540 Ga0395901_0119581 3300038443 Bacteria 2768
1541 Ga0395901_0120156 3300038443 Bacteria 2761
1542 Ga0395901_0131771 3300038443 Bacteria 2627
1543 Ga0395901_0149284 3300038443 Bacteria 2456
1544 Ga0395901_0169395 3300038443 Bacteria 2291
1545 Ga0395901_0177660 3300038443 Bacteria 2232
1546 Ga0395901_0182239 3300038443 Bacteria 2203
1547 Ga0395901_0449665 3300038443 Bacteria 1318
1548 Ga0395901_0481965 3300038443 Bacteria 1265
1549 Ga0395901_0519707 3300038443 Bacteria 1209
1550 Ga0395901_0620186 3300038443 Bacteria 1088
1551 Ga0237819_00728 3300038705 Bacteria 10584
1552 Ga0237816_02003 3300039145 Bacteria 1604
1553 Ga0436365_0871778 3300039437 Bacteria 8451
1554 Ga0436360_0701846 3300039438 Bacteria 5048
1555 Ga0436360_1373761 3300039438 Bacteria 4302
1556 Ga0436361_1117061 3300039447 Bacteria 1170
1557 Ga0436361_1214005 3300039447 Bacteria 5642
1558 Ga0436363_1223925 3300039450 Bacteria 1002
1559 Ga0436363_1399761 3300039450 Bacteria 8237
1560 Ga0439436_0000023 3300041404 Bacteria 58899
1561 Ga0439436_0012204 3300041404 Bacteria 2607
1562 Ga0439436_0033111 3300041404 Bacteria 1497
1563 Ga0439439_0043679 3300041406 Bacteria 1166
1564 Ga0439465_0033940 3300041413 Bacteria 1632
1565 Ga0451787_571574 3300041441 Bacteria 1217
1566 Ga0451789_0461212 3300041443 Bacteria 1484
1567 Ga0451807_0322861 3300041486 Bacteria 8947
1568 Ga0451807_2136315 3300041486 Bacteria 4400
1569 Ga0451853_0162710 3300041512 Bacteria 8567
1570 Ga0439441_021491 3300042001 Bacteria 1192
1571 Ga0439443_006540 3300042003 Bacteria 1596
1572 Ga0439432_018244 3300042006 Bacteria 2346
1573 Ga0439432_044976 3300042006 Bacteria 1390
1574 Ga0439455_0003442 3300042012 Bacteria 3024
1575 Ga0439457_018740 3300042014 Bacteria 1538
1576 Ga0439462_0026691 3300042015 Bacteria 1523
1577 Ga0450911_000006 3300042115 Bacteria 222143
1578 Ga0450913_000424 3300042117 Bacteria 1752
1579 Ga0450898_006509 3300042134 Bacteria 1796
1580 Ga0450904_000100 3300042139 Bacteria 19264
1581 Ga0439446_0027405 3300042156 Bacteria 1635
1582 Ga0450908_000069 3300042184 Bacteria 20399
1583 Ga0451577_0000256 3300042876 Bacteria 104951
1584 Ga0466969_0000992 3300044656 Bacteria 15335
1585 Ga0466969_0016933 3300044656 Bacteria 3809
1586 Ga0466969_0055710 3300044656 Bacteria 1933
1587 Ga0466969_0105306 3300044656 Bacteria 1324
1588 Ga0466982_0000109 3300044672 Bacteria 20352
1589 Ga0453683_0002195 3300044673 Bacteria 15518
1590 Ga0453683_0067547 3300044673 Bacteria 2235
1591 Ga0466966_0000004 3300044684 Bacteria 223594
1592 Ga0466966_0002380 3300044684 Bacteria 12282
1593 Ga0466966_0066226 3300044684 Bacteria 2270
1594 Ga0466966_0077247 3300044684 Bacteria 2078
1595 Ga0466966_0104783 3300044684 Bacteria 1746
1596 Ga0466961_0000220 3300044693 Bacteria 38742
1597 Ga0466961_0000978 3300044693 Bacteria 17723
1598 Ga0466961_0004586 3300044693 Bacteria 8676
1599 Ga0466961_0132258 3300044693 Bacteria 1563
1600 Ga0466963_0001670 3300044694 Bacteria 12091
1601 Ga0466963_0025535 3300044694 Bacteria 3769
1602 Ga0466963_0034194 3300044694 Bacteria 3306
1603 Ga0466963_0106828 3300044694 Bacteria 1919
1604 Ga0466964_0012863 3300044706 Bacteria 3170
1605 Ga0453684_0000842 3300044712 Bacteria 103487
1606 Ga0453684_0005726 3300044712 Bacteria 24318
1607 Ga0453684_0229822 3300044712 Bacteria 2142
1608 Ga0466971_0002396 3300044719 Bacteria 7915
1609 Ga0466970_0001613 3300044765 Bacteria 10869
1610 Ga0466970_0001995 3300044765 Bacteria 9873
1611 Ga0466970_0021702 3300044765 Bacteria 3346
1612 Ga0466957_0018706 3300044842 Bacteria 4070
1613 Ga0466957_0029399 3300044842 Bacteria 3277
1614 Ga0466957_0082242 3300044842 Bacteria 2007
1615 Ga0466957_0140031 3300044842 Bacteria 1558
1616 Ga0466960_0063911 3300044901 Bacteria 1813
1617 Ga0466960_0224388 3300044901 Bacteria 1035
1618 Ga0466959_0000847 3300045049 Bacteria 18071
1619 Ga0466959_0000978 3300045049 Bacteria 16998
1620 Ga0466959_0009479 3300045049 Bacteria 6927
1621 Ga0466959_0141147 3300045049 Bacteria 1702
1622 Ga0466959_0248444 3300045049 Bacteria 1227
1623 Ga0466958_0004196 3300045836 Bacteria 7576
1624 Ga0466958_0082202 3300045836 Bacteria 1984
1625 Ga0466958_0114592 3300045836 Bacteria 1684
1626 Ga0466967_0016847 3300045976 Bacteria 5779
1627 Ga0466967_0023353 3300045976 Bacteria 5066
1628 Ga0466967_0043468 3300045976 Bacteria 3890
1629 Ga0466967_0316416 3300045976 Bacteria 1504
1630 Ga0495592_0004872 3300046454 Bacteria 9878
1631 Ga0495603_0000388 3300046455 Bacteria 24093
1632 Ga0495603_0040809 3300046455 Bacteria 2777
1633 Ga0495590_0001068 3300046457 Bacteria 12077
1634 Ga0495590_0006992 3300046457 Bacteria 4375
1635 Ga0495590_0019091 3300046457 Bacteria 2447
1636 Ga0495590_0093949 3300046457 Bacteria 1062
1637 Ga0495590_0113147 3300046457 Bacteria 969
1638 Ga0495591_002511 3300046458 Bacteria 10141
1639 Ga0495629_0003174 3300046459 Bacteria 12452
1640 Ga0495638_0000728 3300046460 Bacteria 35408
1641 Ga0495638_0001464 3300046460 Bacteria 21323
1642 Ga0495638_0005121 3300046460 Bacteria 9815
1643 Ga0495638_0007439 3300046460 Bacteria 7850
1644 Ga0495638_0040718 3300046460 Bacteria 2943
1645 Ga0495638_0102411 3300046460 Bacteria 1711
1646 Ga0495641_0008790 3300046461 Bacteria 6092
1647 Ga0495641_0026207 3300046461 Bacteria 2848
1648 Ga0495653_0004188 3300046463 Bacteria 11677
1649 Ga0495650_0000024 3300046471 Bacteria 496674
1650 Ga0495650_0077945 3300046471 Bacteria 1284
1651 Ga0495580_0016401 3300046472 Bacteria 5558
1652 Ga0495580_0041640 3300046472 Bacteria 3275
1653 Ga0495582_0001097 3300046473 Bacteria 15190
1654 Ga0495582_0013960 3300046473 Bacteria 4425
1655 Ga0495605_0000271 3300046474 Bacteria 58816
1656 Ga0495639_0008348 3300046475 Bacteria 4443
1657 Ga0495585_0000027 3300046492 Bacteria 147955
1658 Ga0495585_0085265 3300046492 Bacteria 1707
1659 Ga0495594_0000118 3300046499 Bacteria 37004
1660 Ga0495596_0000007 3300046500 Bacteria 151548
1661 Ga0495596_0045858 3300046500 Bacteria 1718
1662 Ga0495607_0015636 3300046501 Bacteria 4914
1663 Ga0495583_0000005 3300046506 Bacteria 636894
1664 Ga0495583_0000149 3300046506 Bacteria 117980
1665 Ga0495583_0000249 3300046506 Bacteria 89010
1666 Ga0495606_0002446 3300046507 Bacteria 21590
1667 Ga0495608_0107355 3300046511 Bacteria 1796
1668 Ga0495610_0000465 3300046512 Bacteria 41856
1669 Ga0495610_0001255 3300046512 Bacteria 22785
1670 Ga0495610_0001341 3300046512 Bacteria 21846
1671 Ga0495610_0011263 3300046512 Bacteria 5480
1672 Ga0495610_0033321 3300046512 Bacteria 2665
1673 Ga0495616_0016634 3300046513 Bacteria 4067
1674 Ga0495616_0019285 3300046513 Bacteria 3723
1675 Ga0495620_0016023 3300046515 Bacteria 3772
1676 Ga0495628_0013802 3300046516 Bacteria 6788
1677 Ga0495630_0012679 3300046517 Bacteria 6125
1678 Ga0495631_0012499 3300046518 Bacteria 4144
1679 Ga0495631_0014835 3300046518 Bacteria 3750
1680 Ga0495632_0004886 3300046519 Bacteria 8985
1681 Ga0495632_0019802 3300046519 Bacteria 3658
1682 Ga0495632_0065291 3300046519 Bacteria 1758
1683 Ga0495637_0008788 3300046520 Bacteria 4946
1684 Ga0495637_0099481 3300046520 Bacteria 1138
1685 Ga0495643_0015990 3300046522 Bacteria 4417
1686 Ga0495644_0111145 3300046523 Bacteria 1040
1687 Ga0495648_0000029 3300046524 Bacteria 223499
1688 Ga0495648_0100364 3300046524 Bacteria 1599
1689 Ga0495663_0000379 3300046525 Bacteria 16472
1690 Ga0495666_0006889 3300046526 Bacteria 5708
1691 Ga0495652_0103151 3300046529 Bacteria 2309
1692 Ga0495654_0000226 3300046530 Bacteria 52630
1693 Ga0495665_0044109 3300046531 Bacteria 2370
1694 Ga0495640_0006086 3300046533 Bacteria 9569
1695 Ga0495586_0117398 3300046535 Bacteria 1484
1696 Ga0495587_0014439 3300046536 Bacteria 4954
1697 Ga0495587_0191616 3300046536 Bacteria 1157
1698 Ga0495609_0000052 3300046538 Bacteria 150695
1699 Ga0495621_0013656 3300046539 Bacteria 2556
1700 Ga0495597_0017049 3300046542 Bacteria 3423
1701 Ga0495622_0004272 3300046557 Bacteria 6648
1702 Ga0495633_0000162 3300046558 Bacteria 87434
1703 Ga0495667_0008613 3300046559 Bacteria 6923
1704 Ga0495667_0020228 3300046559 Bacteria 4491
1705 Ga0495668_0000141 3300046616 Bacteria 108840
1706 Ga0495668_0007336 3300046616 Bacteria 7065
1707 Ga0495668_0011331 3300046616 Bacteria 5347
1708 Ga0495668_0058761 3300046616 Bacteria 2122
1709 Ga0495634_0002446 3300046642 Bacteria 15427
1710 Ga0495611_0000565 3300046648 Bacteria 21341
1711 Ga0495625_0000398 3300046660 Bacteria 66474
1712 Ga0495625_0010691 3300046660 Bacteria 7562
1713 Ga0495625_0015161 3300046660 Bacteria 6116
1714 Ga0495625_0036300 3300046660 Bacteria 3624
1715 Ga0495625_0042417 3300046660 Bacteria 3306
1716 Ga0495625_0111871 3300046660 Bacteria 1866
1717 Ga0495625_0116865 3300046660 Bacteria 1819
1718 Ga0495625_0130092 3300046660 Bacteria 1706
1719 Ga0495635_0025209 3300046663 Bacteria 4142
1720 Ga0495588_0057082 3300046674 Bacteria 2016
1721 Ga0495657_0022358 3300046675 Bacteria 4531
1722 Ga0495657_0089723 3300046675 Bacteria 1974
1723 Ga0495599_0018838 3300046678 Bacteria 4302
1724 Ga0495599_0023815 3300046678 Bacteria 3828
1725 Ga0495623_0039267 3300046679 Bacteria 3026
1726 Ga0495647_0000113 3300046681 Bacteria 20397
1727 Ga0495647_0007512 3300046681 Bacteria 3656
1728 Ga0495658_0002474 3300046683 Bacteria 9302
1729 Ga0495658_0013350 3300046683 Bacteria 4179
1730 Ga0495613_0008625 3300046689 Bacteria 7562
1731 Ga0495613_0029688 3300046689 Bacteria 4064
1732 Ga0495670_0001410 3300046691 Bacteria 11784
1733 Ga0495671_0011736 3300046692 Bacteria 4805
1734 Ga0495649_0000165 3300046694 Bacteria 57643
1735 Ga0495649_0000396 3300046694 Bacteria 37744
1736 Ga0495649_0010627 3300046694 Bacteria 5423
1737 Ga0495649_0021738 3300046694 Bacteria 3594
1738 Ga0495589_0024889 3300046794 Bacteria 3040
1739 Ga0495600_0009720 3300046809 Bacteria 5944
1740 Ga0495600_0025908 3300046809 Bacteria 3782
1741 Ga0495660_0005715 3300046810 Bacteria 7426
1742 Ga0495581_0090757 3300047315 Bacteria 1772
1743 Ga0495604_0003696 3300047317 Bacteria 12188
1744 Ga0495636_0002340 3300047318 Bacteria 7283
1745 Ga0495636_0018436 3300047318 Bacteria 2800
1746 Ga0495636_0035560 3300047318 Bacteria 2052
1747 Ga0495674_0065303 3300047319 Bacteria 3161
1748 Ga0495672_0011303 3300047320 Bacteria 6309
1749 Ga0495672_0128180 3300047320 Bacteria 1338
1750 Ga0495676_0170342 3300047321 Bacteria 1533
1751 Ga0495680_0042645 3300047322 Bacteria 3599
1752 Ga0495680_0087469 3300047322 Bacteria 2343
1753 Ga0495680_0361099 3300047322 Bacteria 1009
1754 Ga0495683_0000002 3300047323 Bacteria 638279
1755 Ga0495683_0077491 3300047323 Bacteria 1625
1756 Ga0495683_0142506 3300047323 Bacteria 1122
1757 Ga0495675_0090651 3300047444 Bacteria 1919
1758 Ga0495679_000035 3300047446 Bacteria 164777
1759 Ga0495679_000056 3300047446 Bacteria 111387
1760 Ga0495679_003586 3300047446 Bacteria 7410
1761 Ga0495685_046996 3300047447 Bacteria 1468
1762 Ga0495673_0000342 3300047469 Bacteria 58945
1763 Ga0495673_0002882 3300047469 Bacteria 11693
1764 Ga0495681_0079948 3300047470 Bacteria 1461
1765 Ga0495684_0078492 3300047471 Bacteria 2506
1766 Ga0495684_0094860 3300047471 Bacteria 2258
1767 Ga0495686_0001836 3300047472 Bacteria 21329
1768 Ga0495686_0001859 3300047472 Bacteria 21181
1769 Ga0495593_0000987 3300047673 Bacteria 16704
1770 Ga0495602_0014733 3300048088 Bacteria 7929
1771 Ga0495602_0044383 3300048088 Bacteria 4033
1772 Ga0495602_0374641 3300048088 Bacteria 1021
1773 Ga0495614_0042029 3300048089 Bacteria 1960
1774 Ga0496100_0102199 3300048903 Bacteria 1977
1775 Ga0496100_0216104 3300048903 Bacteria 1405
1776 Ga0496101_0015659 3300048904 Bacteria 5116
1777 Ga0496101_0017706 3300048904 Bacteria 4832
1778 Ga0496101_0022049 3300048904 Bacteria 4381
1779 Ga0496101_0024655 3300048904 Bacteria 4165
1780 Ga0496101_0279814 3300048904 Bacteria 1304
1781 Ga0496102_0039951 3300048905 Bacteria 4242
1782 Ga0496102_0047630 3300048905 Bacteria 3897
1783 Ga0496102_0083221 3300048905 Bacteria 2952
1784 Ga0496102_0250431 3300048905 Bacteria 1670
1785 Ga0496103_0040376 3300048906 Bacteria 2867
1786 Ga0496103_0079880 3300048906 Bacteria 2056
1787 Ga0496103_0129682 3300048906 Bacteria 1610
1788 Ga0496104_0032285 3300048907 Bacteria 4873
1789 Ga0496104_0034981 3300048907 Bacteria 4688
1790 Ga0496104_0055115 3300048907 Bacteria 3759
1791 Ga0496104_0097848 3300048907 Bacteria 2808
1792 Ga0496104_0186776 3300048907 Bacteria 1983
1793 Ga0496105_0009632 3300048908 Bacteria 7560
1794 Ga0496105_0019536 3300048908 Bacteria 5467
1795 Ga0496105_0292398 3300048908 Bacteria 1311
1796 Ga0496106_0047561 3300048909 Bacteria 3229
1797 Ga0496106_0063844 3300048909 Bacteria 2800
1798 Ga0496106_0271146 3300048909 Bacteria 1359
1799 Ga0496106_0287665 3300048909 Bacteria 1317
1800 Ga0496107_0000214 3300048910 Bacteria 30453
1801 Ga0496107_0019860 3300048910 Bacteria 4744
1802 Ga0496107_0077760 3300048910 Bacteria 2417
1803 Ga0496107_0183845 3300048910 Bacteria 1552
1804 Ga0496107_0186394 3300048910 Bacteria 1541
1805 Ga0496108_0003688 3300048911 Bacteria 12288
1806 Ga0496108_0016259 3300048911 Bacteria 6066
1807 Ga0496108_0027517 3300048911 Bacteria 4696
1808 Ga0496108_0126533 3300048911 Bacteria 2194
1809 Ga0496108_0185152 3300048911 Bacteria 1804
1810 Ga0496108_0384164 3300048911 Bacteria 1226
1811 Ga0496109_0001865 3300048912 Bacteria 17465
1812 Ga0496109_0048552 3300048912 Bacteria 3862
1813 Ga0496109_0087095 3300048912 Bacteria 2884
1814 Ga0496109_0091181 3300048912 Bacteria 2818
1815 Ga0496109_0186498 3300048912 Bacteria 1949
1816 Ga0496109_0188056 3300048912 Bacteria 1940
1817 Ga0496109_0206078 3300048912 Bacteria 1849
1818 Ga0496109_0212961 3300048912 Bacteria 1817
1819 Ga0496110_0012559 3300048913 Bacteria 6967
1820 Ga0496110_0074788 3300048913 Bacteria 3009
1821 Ga0496110_0077735 3300048913 Bacteria 2953
1822 Ga0496110_0150420 3300048913 Bacteria 2108
1823 Ga0496110_0156563 3300048913 Bacteria 2064
1824 Ga0496110_0457692 3300048913 Bacteria 1163
1825 Ga0496111_0011770 3300048914 Bacteria 5906
1826 Ga0496111_0022773 3300048914 Bacteria 4390
1827 Ga0496111_0239824 3300048914 Bacteria 1346
1828 Ga0496112_0003292 3300048915 Bacteria 13337
1829 Ga0496112_0027176 3300048915 Bacteria 5517
1830 Ga0496112_0072298 3300048915 Bacteria 3409
1831 Ga0496112_0175465 3300048915 Bacteria 2108
1832 Ga0496112_0190432 3300048915 Bacteria 2013
1833 Ga0496112_0453340 3300048915 Bacteria 1220
1834 Ga0496113_0424119 3300048916 Bacteria 1068
1835 Ga0496114_0006303 3300048917 Bacteria 9336
1836 Ga0496114_0098484 3300048917 Bacteria 2493
1837 Ga0496114_0136746 3300048917 Bacteria 2119
1838 Ga0496114_0160550 3300048917 Bacteria 1954
1839 Ga0496114_0221649 3300048917 Bacteria 1660
1840 Ga0496114_0352639 3300048917 Bacteria 1301
1841 Ga0496115_0006041 3300048918 Bacteria 8841
1842 Ga0496115_0169765 3300048918 Bacteria 1804
1843 Ga0496115_0197088 3300048918 Bacteria 1664
1844 Ga0496115_0271290 3300048918 Bacteria 1394
1845 Ga0496116_0028883 3300048919 Bacteria 4009
1846 Ga0496116_0038439 3300048919 Bacteria 3323
1847 Ga0496117_0016132 3300048920 Bacteria 6318
1848 Ga0496117_0040086 3300048920 Bacteria 3450
1849 Ga0496117_0054532 3300048920 Bacteria 2800
1850 Ga0496118_0001967 3300048921 Bacteria 29146
1851 Ga0496118_0003890 3300048921 Bacteria 18327
1852 Ga0496118_0029873 3300048921 Bacteria 4561
1853 Ga0496118_0119622 3300048921 Bacteria 1721
1854 Ga0496119_0000733 3300048922 Bacteria 44239
1855 Ga0496119_0005178 3300048922 Bacteria 12605
1856 Ga0496119_0011034 3300048922 Bacteria 7534
1857 Ga0496119_0012759 3300048922 Bacteria 6785
1858 Ga0496120_0000671 3300048923 Bacteria 50340
1859 Ga0496120_0015992 3300048923 Bacteria 4921
1860 Ga0496121_0000021 3300048924 Bacteria 478544
1861 Ga0496121_0000042 3300048924 Bacteria 342304
1862 Ga0496121_0000145 3300048924 Bacteria 156655
1863 Ga0496121_0033279 3300048924 Bacteria 4669
1864 Ga0496121_0099155 3300048924 Bacteria 2252
1865 Ga0496122_0000029 3300048925 Bacteria 336396
1866 Ga0496122_0000749 3300048925 Bacteria 63273
1867 Ga0496122_0013321 3300048925 Bacteria 8059
1868 Ga0496122_0098434 3300048925 Bacteria 1964
1869 Ga0496123_0000216 3300048926 Bacteria 117098
1870 Ga0496123_0000566 3300048926 Bacteria 63317
1871 Ga0496123_0000974 3300048926 Bacteria 44176
1872 Ga0496123_0006678 3300048926 Bacteria 11119
1873 Ga0496123_0041704 3300048926 Bacteria 3177
1874 Ga0496124_0000681 3300048927 Bacteria 55817
1875 Ga0496124_0088371 3300048927 Bacteria 2533
1876 Ga0496124_0147417 3300048927 Bacteria 1850
1877 Ga0496125_0001102 3300048928 Bacteria 41526
1878 Ga0496125_0001807 3300048928 Bacteria 29544
1879 Ga0496125_0018499 3300048928 Bacteria 6617
1880 Ga0496125_0029699 3300048928 Bacteria 4907
1881 Ga0496126_0021905 3300048929 Bacteria 6232
1882 Ga0496126_0073787 3300048929 Bacteria 3032
1883 Ga0496126_0305946 3300048929 Bacteria 1310
1884 Ga0495678_003651 3300049459 Bacteria 9339
1885 Ga0495682_0022008 3300049460 Bacteria 2387
1886 Ga0501031_0003304 3300049568 Bacteria 10348
1887 Ga0501031_0036277 3300049568 Bacteria 3216
1888 Ga0501032_0002277 3300049569 Bacteria 15078
1889 Ga0501033_0016780 3300049570 Bacteria 5538
1890 Ga0501033_0020882 3300049570 Bacteria 4943
1891 Ga0501033_0060379 3300049570 Bacteria 2797
1892 Ga0501033_0072968 3300049570 Bacteria 2520
1893 Ga0501034_0003528 3300049571 Bacteria 17767
1894 Ga0501034_0013919 3300049571 Bacteria 8282
1895 Ga0501034_0026913 3300049571 Bacteria 5851
1896 Ga0501034_0043094 3300049571 Bacteria 4568
1897 Ga0501034_0046443 3300049571 Bacteria 4388
1898 Ga0501034_0056312 3300049571 Bacteria 3956
1899 Ga0501034_0382079 3300049571 Bacteria 1333
1900 Ga0501036_0087742 3300049572 Bacteria 2629
1901 Ga0501036_0113245 3300049572 Bacteria 2293
1902 Ga0501036_0129900 3300049572 Bacteria 2127
1903 Ga0501036_0140941 3300049572 Bacteria 2035
1904 Ga0501037_0046554 3300049573 Bacteria 3180
1905 Ga0501038_0000654 3300049574 Bacteria 30791
1906 Ga0501038_0009310 3300049574 Bacteria 9010
1907 Ga0501038_0023889 3300049574 Bacteria 5459
1908 Ga0501038_0087373 3300049574 Bacteria 2618
1909 Ga0501039_0235261 3300049575 Bacteria 1440
1910 Ga0501039_0265879 3300049575 Bacteria 1348
1911 Ga0501040_0001815 3300049576 Bacteria 13724
1912 Ga0501041_0000192 3300049577 Bacteria 27903
1913 Ga0501042_0000054 3300049578 Bacteria 40211
1914 Ga0501042_0000271 3300049578 Bacteria 25300
1915 Ga0501042_0120352 3300049578 Bacteria 1890
1916 Ga0501043_0034251 3300049579 Bacteria 3995
1917 Ga0501043_0085298 3300049579 Bacteria 2481
1918 Ga0501043_0112989 3300049579 Bacteria 2133
1919 Ga0501046_0000108 3300049580 Bacteria 87513
1920 Ga0501046_0015253 3300049580 Bacteria 6462
1921 Ga0501047_0002839 3300049581 Bacteria 16426
1922 Ga0501047_0013253 3300049581 Bacteria 7808
1923 Ga0501047_0017768 3300049581 Bacteria 6814
1924 Ga0501047_0019890 3300049581 Bacteria 6444
1925 Ga0501047_0021564 3300049581 Bacteria 6187
1926 Ga0501047_0043063 3300049581 Bacteria 4362
1927 Ga0501047_0060215 3300049581 Bacteria 3665
1928 Ga0501047_0122096 3300049581 Bacteria 2486
1929 Ga0501047_0176192 3300049581 Bacteria 2005
1930 Ga0501047_0181887 3300049581 Bacteria 1969
1931 Ga0501048_0034331 3300049582 Bacteria 3660
1932 Ga0501067_0043101 3300049583 Bacteria 2506
1933 Ga0501067_0114492 3300049583 Bacteria 1500
1934 Ga0501069_0101362 3300049585 Bacteria 1634
1935 Ga0501069_0185100 3300049585 Bacteria 1204
1936 Ga0501069_0217959 3300049585 Bacteria 1108
1937 Ga0501070_0000102 3300049586 Bacteria 74839
1938 Ga0501070_0023819 3300049586 Bacteria 5131
1939 Ga0501070_0044639 3300049586 Bacteria 3686
1940 Ga0501070_0051997 3300049586 Bacteria 3400
1941 Ga0501070_0058239 3300049586 Bacteria 3202
1942 Ga0501070_0173712 3300049586 Bacteria 1774
1943 Ga0501070_0352055 3300049586 Bacteria 1195
1944 Ga0501070_0423843 3300049586 Bacteria 1074
1945 Ga0501071_0016296 3300049587 Bacteria 5110
1946 Ga0501071_0018432 3300049587 Bacteria 4832
1947 Ga0501071_0139032 3300049587 Bacteria 1808
1948 Ga0501072_0000655 3300049588 Bacteria 24933
1949 Ga0501073_0008965 3300049589 Bacteria 7389
1950 Ga0501073_0013754 3300049589 Bacteria 5886
1951 Ga0501073_0018310 3300049589 Bacteria 5061
1952 Ga0501073_0051133 3300049589 Bacteria 2895
1953 Ga0501074_0002305 3300049590 Bacteria 13281
1954 Ga0501074_0033737 3300049590 Bacteria 3710
1955 Ga0501074_0063087 3300049590 Bacteria 2669
1956 Ga0501075_0032811 3300049591 Bacteria 3860
1957 Ga0501075_0036165 3300049591 Bacteria 3686
1958 Ga0501075_0049268 3300049591 Bacteria 3166
1959 Ga0501076_0000057 3300049592 Bacteria 55044
1960 Ga0501076_0100931 3300049592 Bacteria 2325
1961 Ga0501077_0000637 3300049593 Bacteria 21303
1962 Ga0501077_0013351 3300049593 Bacteria 5151
1963 Ga0501239_000595 3300049672 Bacteria 2848
1964 Ga0501079_0000283 3300049741 Bacteria 31327
1965 Ga0501079_0041115 3300049741 Bacteria 3568
1966 Ga0501079_0145936 3300049741 Bacteria 1844
1967 Ga0501080_0000480 3300049742 Bacteria 31084
1968 Ga0501080_0015766 3300049742 Bacteria 6970
1969 Ga0501080_0016767 3300049742 Bacteria 6766
1970 Ga0501080_0022903 3300049742 Bacteria 5790
1971 Ga0501080_0029568 3300049742 Bacteria 5101
1972 Ga0501080_0034741 3300049742 Bacteria 4707
1973 Ga0501080_0051306 3300049742 Bacteria 3838
1974 Ga0501080_0132429 3300049742 Bacteria 2308
1975 Ga0501080_0207020 3300049742 Bacteria 1799
1976 Ga0501080_0364050 3300049742 Bacteria 1304
1977 Ga0501081_0000123 3300049743 Bacteria 33954
1978 Ga0501083_0014104 3300049744 Bacteria 5588
1979 Ga0501083_0020544 3300049744 Bacteria 4593
1980 Ga0501083_0044708 3300049744 Bacteria 2997
1981 Ga0501083_0069462 3300049744 Bacteria 2344
1982 Ga0501083_0149667 3300049744 Bacteria 1528
1983 Ga0501035_0003292 3300049822 Bacteria 15485
1984 Ga0501035_0003439 3300049822 Bacteria 15151
1985 Ga0501035_0019304 3300049822 Bacteria 6273
1986 Ga0501035_0057698 3300049822 Bacteria 3461
1987 Ga0501035_0059231 3300049822 Bacteria 3410
1988 Ga0501035_0069916 3300049822 Bacteria 3110
1989 Ga0501035_0078600 3300049822 Bacteria 2914
1990 Ga0501035_0090106 3300049822 Bacteria 2700
1991 Ga0501035_0099716 3300049822 Bacteria 2549
1992 Ga0501035_0269396 3300049822 Bacteria 1442
1993 Ga0501035_0383847 3300049822 Bacteria 1171
1994 Ga0501044_0002339 3300049823 Bacteria 21617
1995 Ga0501044_0024481 3300049823 Bacteria 6406
1996 Ga0501044_0045879 3300049823 Bacteria 4526
1997 Ga0501044_0053284 3300049823 Bacteria 4162
1998 Ga0501044_0085608 3300049823 Bacteria 3185
1999 Ga0501044_0092573 3300049823 Bacteria 3049
2000 Ga0501044_0094691 3300049823 Bacteria 3010
2001 Ga0501044_0189704 3300049823 Bacteria 2019
2002 Ga0501045_0002226 3300049824 Bacteria 13171
2003 Ga0501226_000012 3300049853 Bacteria 175419
2004 nmdc:mga03683_72905_c1 3300050489 Bacteria 1471
2005 nmdc:mga00v17_36848_c2 3300050491 Bacteria 1902
2006 nmdc:mga0yw44_222117_c1 3300050492 Bacteria 1252
2007 nmdc:mga0k408_259977_c1 3300050493 Bacteria 1037
2008 nmdc:mga0k408_34917_c1 3300050493 Bacteria 2881
2009 nmdc:mga0k408_45210_c1 3300050493 Bacteria 2540
2010 nmdc:mga07m45_119838_c1 3300050496 Bacteria 1519
2011 nmdc:mga07m45_85713_c1 3300050496 Bacteria 1801
2012 nmdc:mga05p37_155916_c1 3300050507 Bacteria 2791
2013 nmdc:mga05p37_52817_c1 3300050507 Bacteria 4997
2014 nmdc:mga05p37_716_c1 3300050507 Bacteria 36551
2015 nmdc:mga09592_39528_c1 3300050508 Bacteria 3963
2016 nmdc:mga0qj67_3310_c1 3300050509 Bacteria 11610
2017 nmdc:mga0qj67_36852_c1 3300050509 Bacteria 3829
2018 nmdc:mga0qj67_8357_c1 3300050509 Bacteria 7675
2019 nmdc:mga06r32_106735_c1 3300050510 Bacteria 2752
2020 nmdc:mga06r32_45534_c1 3300050510 Bacteria 4183
2021 nmdc:mga06r32_7880_c1 3300050510 Bacteria 9573
2022 nmdc:mga08y16_50166_c1 3300050511 Bacteria 4367
2023 nmdc:mga08y16_67396_c1 3300050511 Bacteria 3734
2024 nmdc:mga0n895_214105_c1 3300050512 Bacteria 1957
2025 nmdc:mga0rr50_222830_c1 3300050513 Bacteria 1558
2026 nmdc:mga0rr50_300447_c1 3300050513 Bacteria 1343
2027 nmdc:mga08x19_26318_c1 3300050514 Bacteria 3629
2028 nmdc:mga0a205_139417_c1 3300050515 Bacteria 2325
2029 nmdc:mga0a205_8602_c1 3300050515 Bacteria 9288
2030 Ga0495601_0002701 3300053077 Bacteria 10069
2031 Ga0495601_0051546 3300053077 Bacteria 2597
2032 Ga0495601_0169115 3300053077 Bacteria 1429
2033 Ga0495601_0260732 3300053077 Bacteria 1131
2034 Ga0495612_0025055 3300053078 Bacteria 2396
2035 Ga0500635_0000140 3300053080 Bacteria 41240
2036 Ga0500635_0043193 3300053080 Bacteria 1515
2037 Ga0495655_0000320 3300053083 Bacteria 8521
2038 Ga0495595_0007105 3300053084 Bacteria 4576
2039 Ga0495595_0008305 3300053084 Bacteria 4262
2040 Ga0495619_0002898 3300053085 Bacteria 11141
2041 Ga0495619_0015975 3300053085 Bacteria 4751
2042 Ga0495619_0077528 3300053085 Bacteria 2232
2043 Ga0500578_0000102 3300053086 Bacteria 99108
2044 Ga0500578_0213203 3300053086 Bacteria 1177
2045 Ga0500643_001069 3300053087 Bacteria 16551
2046 Ga0500643_001428 3300053087 Bacteria 13776
2047 Ga0500643_002015 3300053087 Bacteria 10931
2048 Ga0500643_037967 3300053087 Bacteria 1430
2049 Ga0500644_0000290 3300053088 Bacteria 27182
2050 Ga0500644_0006534 3300053088 Bacteria 2994
2051 Ga0500644_0073460 3300053088 Bacteria 1239
2052 Ga0500647_0003059 3300053091 Bacteria 6418
2053 Ga0500651_0000984 3300053093 Bacteria 14035
2054 Ga0500651_0013402 3300053093 Bacteria 4996
2055 Ga0500566_0004593 3300053094 Bacteria 8226
2056 Ga0500640_000515 3300053095 Bacteria 9693
2057 Ga0500555_006631 3300053103 Bacteria 3290
2058 Ga0500556_0000200 3300053104 Bacteria 49207
2059 Ga0500556_0001879 3300053104 Bacteria 7539
2060 Ga0500562_000497 3300053108 Bacteria 9556
2061 Ga0500572_000529 3300053111 Bacteria 12963
2062 Ga0500593_001627 3300053117 Bacteria 8090
2063 Ga0500594_0002267 3300053118 Bacteria 4165
2064 Ga0500597_000028 3300053120 Bacteria 31391
2065 Ga0500608_000158 3300053122 Bacteria 28168
2066 Ga0500614_004049 3300053123 Bacteria 3121
2067 Ga0500614_005413 3300053123 Bacteria 2679
2068 Ga0500618_000120 3300053125 Bacteria 64103
2069 Ga0500628_000537 3300053129 Bacteria 6931
2070 Ga0500642_0064213 3300053130 Bacteria 1657
2071 Ga0500642_0083140 3300053130 Bacteria 1473
2072 Ga0500658_0021557 3300053134 Bacteria 2442
2073 Ga0500559_0000403 3300053136 Bacteria 31068
2074 Ga0500559_0005605 3300053136 Bacteria 5755
2075 Ga0500559_0021028 3300053136 Bacteria 2762
2076 Ga0500559_0021554 3300053136 Bacteria 2731
2077 Ga0500564_000115 3300053138 Bacteria 20253
2078 Ga0500564_000291 3300053138 Bacteria 13918
2079 Ga0500568_0016301 3300053139 Bacteria 3307
2080 Ga0500568_0025658 3300053139 Bacteria 2483
2081 Ga0500573_0044788 3300053140 Bacteria 2551
2082 Ga0500616_0052065 3300053153 Bacteria 2154
2083 Ga0500622_0000674 3300053156 Bacteria 30184
2084 Ga0500622_0004041 3300053156 Bacteria 9441
2085 Ga0500622_0020591 3300053156 Bacteria 3502
2086 Ga0500622_0074155 3300053156 Bacteria 1715
2087 Ga0500624_000075 3300053157 Bacteria 56822
2088 Ga0500636_0000055 3300053177 Bacteria 54438
2089 Ga0500637_0000681 3300053178 Bacteria 13513
2090 Ga0500637_0053754 3300053178 Bacteria 2299
2091 Ga0500567_001143 3300053723 Bacteria 10405
2092 Ga0500625_000012 3300053729 Bacteria 127269
2093 Ga0500625_009792 3300053729 Bacteria 4287
2094 Ga0500645_000250 3300053730 Bacteria 40018
2095 Ga0500645_001003 3300053730 Bacteria 15923
2096 Ga0500645_008241 3300053730 Bacteria 3573
2097 Ga0500645_008698 3300053730 Bacteria 3446
2098 Ga0500609_001387 3300053731 Bacteria 3552
2099 Ga0500587_001238 3300053739 Bacteria 3556
2100 Ga0501084_0001450 3300054114 Bacteria 18818
2101 Ga0501084_0012475 3300054114 Bacteria 7041
2102 Ga0501082_0005168 3300060353 Bacteria 11354
2103 Ga0501082_0006095 3300060353 Bacteria 10465
2104 Ga0501082_0033315 3300060353 Bacteria 4445
2105 Ga0466962_0000555 3300061719 Bacteria 16376
2106 Ga0466962_0005147 3300061719 Bacteria 6290
2107 Ga0530510_0000267 3300061734 Bacteria 32744
2108 Ga0530510_0121791 3300061734 Bacteria 1915

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0087742 Ga0501036_0087742_1262_2254 288
2 3300031507 Ga0307509_10067018 Ga0307509_100670184 292
3 3300005367 Ga0070667_100000136 Ga0070667_10000013638 293
4 3300005455 Ga0070663_100000204 Ga0070663_1000002047 293
5 3300009177 Ga0105248_10001300 Ga0105248_1000130027 293
6 3300009545 Ga0105237_10020873 Ga0105237_100208734 293
7 3300025914 Ga0207671_10213308 Ga0207671_102133082 293
8 3300025941 Ga0207711_10000945 Ga0207711_1000094526 293
9 3300025986 Ga0207658_10000640 Ga0207658_1000064013 293
10 3300026041 Ga0207639_10171553 Ga0207639_101715532 293
11 3300026067 Ga0207678_10000160 Ga0207678_100001607 293
12 3300031665 Ga0316575_10016265 Ga0316575_100162652 293
13 3300005539 Ga0068853_100008568 Ga0068853_1000085688 295
14 3300009553 Ga0105249_10000195 Ga0105249_1000019558 295
15 3300010375 Ga0105239_10122764 Ga0105239_101227642 295
16 3300025961 Ga0207712_10003682 Ga0207712_100036827 295
17 3300048921 Ga0496118_0001967 Ga0496118_0001967_9014_9988 295
18 3300048925 Ga0496122_0000749 Ga0496122_0000749_49923_50948 295
19 3300048926 Ga0496123_0000566 Ga0496123_0000566_12033_13058 295
20 3300053120 Ga0500597_000028 Ga0500597_000028_22801_23964 296
21 3300025941 Ga0207711_10287045 Ga0207711_102870452 298
22 3300047472 Ga0495686_0001859 Ga0495686_0001859_9576_10601 299
23 3300005330 Ga0070690_100015791 Ga0070690_1000157913 300
24 3300005563 Ga0068855_100007664 Ga0068855_1000076647 302
25 3300009545 Ga0105237_10113145 Ga0105237_101131452 302
26 3300013296 Ga0157374_10086107 Ga0157374_100861072 302
27 3300025949 Ga0207667_10099628 Ga0207667_100996283 302
28 3300035117 Ga0373953_0124420 Ga0373953_0124420_40_960 302
29 3300049742 Ga0501080_0000480 Ga0501080_0000480_23799_24716 302
30 3300049744 Ga0501083_0020544 Ga0501083_0020544_1561_2478 302
31 3300060353 Ga0501082_0033315 Ga0501082_0033315_2021_2938 302
32 iso_pu_bacteria 2643221663 2644353395 302
33 iso_pu_bacteria 8002392321 8002394536 302
34 3300005439 Ga0070711_100022012 Ga0070711_1000220123 303
35 3300005841 Ga0068863_100177808 Ga0068863_1001778082 303
36 3300005937 Ga0081455_10000066 Ga0081455_10000066120 303
37 3300006846 Ga0075430_100274356 Ga0075430_1002743562 303
38 3300006847 Ga0075431_100032826 Ga0075431_1000328263 303
39 3300006871 Ga0075434_100438413 Ga0075434_1004384132 303
40 3300007265 Ga0099794_10007575 Ga0099794_100075755 303
41 3300007788 Ga0099795_10000375 Ga0099795_100003754 303
42 3300009093 Ga0105240_10263066 Ga0105240_102630662 303
43 3300009147 Ga0114129_10110971 Ga0114129_101109714 303
44 3300009174 Ga0105241_10023539 Ga0105241_100235392 303
45 3300010159 Ga0099796_10000691 Ga0099796_100006915 303
46 3300014969 Ga0157376_10571598 Ga0157376_105715981 303
47 3300025911 Ga0207654_10012458 Ga0207654_100124585 303
48 3300025915 Ga0207693_10206708 Ga0207693_102067082 303
49 3300025928 Ga0207700_10232598 Ga0207700_102325982 303
50 3300025931 Ga0207644_10216232 Ga0207644_102162322 303
51 3300027512 Ga0209179_1001067 Ga0209179_10010673 303
52 3300027671 Ga0209588_1013741 Ga0209588_10137413 303
53 3300027695 Ga0209966_1002408 Ga0209966_10024084 303
54 3300028016 Ga0265354_1001901 Ga0265354_10019014 303
55 3300028017 Ga0265356_1000958 Ga0265356_10009583 303
56 3300028023 Ga0265357_1001777 Ga0265357_10017772 303
57 3300028800 Ga0265338_10000147 Ga0265338_10000147110 303
58 3300031090 Ga0265760_10000671 Ga0265760_100006718 303
59 3300031733 Ga0316577_10035089 Ga0316577_100350893 303
60 3300031733 Ga0316577_10065256 Ga0316577_100652563 303
61 3300032126 Ga0307415_100315497 Ga0307415_1003154971 303
62 3300032137 Ga0316585_10008103 Ga0316585_100081033 303
63 3300032139 Ga0316580_10021814 Ga0316580_100218143 303
64 3300035398 Ga0316574_0005525 Ga0316574_0005525_4091_5017 303
65 3300035398 Ga0316574_0099027 Ga0316574_0099027_595_1518 303
66 3300035398 Ga0316574_0286433 Ga0316574_0286433_46_969 303
67 3300036647 Ga0316582_0063495 Ga0316582_0063495_1243_2166 303
68 3300036712 Ga0316584_0001500 Ga0316584_0001500_10782_11705 303
69 3300036712 Ga0316584_0036370 Ga0316584_0036370_2032_2955 303
70 3300036712 Ga0316584_0102259 Ga0316584_0102259_829_1752 303
71 3300037418 Ga0395900_0167565 Ga0395900_0167565_629_1573 303
72 3300037588 Ga0316581_0024562 Ga0316581_0024562_553_1476 303
73 3300039447 Ga0436361_1214005 Ga0436361_1214005_2236_3153 303
74 3300042117 Ga0450913_000424 Ga0450913_000424_392_1315 303
75 3300046458 Ga0495591_002511 Ga0495591_002511_3276_4196 303
76 3300046474 Ga0495605_0000271 Ga0495605_0000271_11418_12338 303
77 3300046492 Ga0495585_0000027 Ga0495585_0000027_131829_132749 303
78 3300046500 Ga0495596_0000007 Ga0495596_0000007_9455_10375 303
79 3300046501 Ga0495607_0015636 Ga0495607_0015636_3389_4309 303
80 3300046506 Ga0495583_0000249 Ga0495583_0000249_45731_46651 303
81 3300046512 Ga0495610_0011263 Ga0495610_0011263_3868_4788 303
82 3300046518 Ga0495631_0012499 Ga0495631_0012499_353_1273 303
83 3300046520 Ga0495637_0099481 Ga0495637_0099481_84_1004 303
84 3300046538 Ga0495609_0000052 Ga0495609_0000052_71667_72587 303
85 3300046648 Ga0495611_0000565 Ga0495611_0000565_1289_2209 303
86 3300046691 Ga0495670_0001410 Ga0495670_0001410_4751_5671 303
87 3300047323 Ga0495683_0000002 Ga0495683_0000002_129036_129956 303
88 3300047446 Ga0495679_000035 Ga0495679_000035_23073_23993 303
89 3300047446 Ga0495679_000056 Ga0495679_000056_45732_46652 303
90 3300047469 Ga0495673_0002882 Ga0495673_0002882_1183_2121 303
91 3300048904 Ga0496101_0024655 Ga0496101_0024655_725_1642 303
92 3300048905 Ga0496102_0083221 Ga0496102_0083221_260_1177 303
93 3300048906 Ga0496103_0079880 Ga0496103_0079880_1048_1965 303
94 3300048907 Ga0496104_0034981 Ga0496104_0034981_2897_3814 303
95 3300048907 Ga0496104_0097848 Ga0496104_0097848_1041_1964 303
96 3300048908 Ga0496105_0009632 Ga0496105_0009632_5807_6730 303
97 3300048909 Ga0496106_0287665 Ga0496106_0287665_225_1142 303
98 3300048910 Ga0496107_0183845 Ga0496107_0183845_586_1509 303
99 3300048911 Ga0496108_0027517 Ga0496108_0027517_889_1806 303
100 3300048911 Ga0496108_0185152 Ga0496108_0185152_221_1138 303
101 3300048912 Ga0496109_0087095 Ga0496109_0087095_959_1876 303
102 3300048913 Ga0496110_0074788 Ga0496110_0074788_774_1691 303
103 3300048914 Ga0496111_0011770 Ga0496111_0011770_2660_3577 303
104 3300048914 Ga0496111_0239824 Ga0496111_0239824_360_1277 303
105 3300048915 Ga0496112_0190432 Ga0496112_0190432_1033_1950 303
106 3300048916 Ga0496113_0424119 Ga0496113_0424119_100_1017 303
107 3300048917 Ga0496114_0006303 Ga0496114_0006303_5287_6210 303
108 3300048918 Ga0496115_0006041 Ga0496115_0006041_2876_3799 303
109 3300049571 Ga0501034_0382079 Ga0501034_0382079_199_1137 303
110 3300049581 Ga0501047_0181887 Ga0501047_0181887_769_1689 303
111 3300049672 Ga0501239_000595 Ga0501239_000595_92_1090 303
112 3300049822 Ga0501035_0003439 Ga0501035_0003439_1511_2440 303
113 3300050507 nmdc:mga05p37_52817_c1 nmdc:mga05p37_52817_c1_2676_3599 303
114 3300050508 nmdc:mga09592_39528_c1 nmdc:mga09592_39528_c1_1754_2677 303
115 3300050509 nmdc:mga0qj67_36852_c1 nmdc:mga0qj67_36852_c1_620_1543 303
116 3300050510 nmdc:mga06r32_45534_c1 nmdc:mga06r32_45534_c1_1550_2473 303
117 3300053077 Ga0495601_0169115 Ga0495601_0169115_223_1146 303
118 3300053153 Ga0500616_0052065 Ga0500616_0052065_408_1340 303
119 3300003856 Ga0058692_1000142 Ga0058692_10001425 304
120 3300005327 Ga0070658_10058004 Ga0070658_100580042 304
121 3300005336 Ga0070680_100286698 Ga0070680_1002866982 304
122 3300005338 Ga0068868_100062772 Ga0068868_1000627723 304
123 3300005339 Ga0070660_100048131 Ga0070660_1000481312 304
124 3300005340 Ga0070689_100034696 Ga0070689_1000346964 304
125 3300005364 Ga0070673_100038215 Ga0070673_1000382151 304
126 3300005367 Ga0070667_100332894 Ga0070667_1003328942 304
127 3300005535 Ga0070684_100051000 Ga0070684_1000510003 304
128 3300005539 Ga0068853_100295223 Ga0068853_1002952232 304
129 3300005563 Ga0068855_100050548 Ga0068855_1000505483 304
130 3300005564 Ga0070664_100065976 Ga0070664_1000659762 304
131 3300005577 Ga0068857_100011649 Ga0068857_1000116496 304
132 3300005578 Ga0068854_100129743 Ga0068854_1001297432 304
133 3300005614 Ga0068856_100077891 Ga0068856_1000778913 304
134 3300005614 Ga0068856_100375518 Ga0068856_1003755182 304
135 3300005616 Ga0068852_100006255 Ga0068852_1000062555 304
136 3300005618 Ga0068864_100139768 Ga0068864_1001397682 304
137 3300006195 Ga0075366_10012523 Ga0075366_100125233 304
138 3300006237 Ga0097621_100490550 Ga0097621_1004905502 304
139 3300006358 Ga0068871_100053826 Ga0068871_1000538262 304
140 3300006846 Ga0075430_100006474 Ga0075430_10000647411 304
141 3300006847 Ga0075431_100019689 Ga0075431_1000196895 304
142 3300009174 Ga0105241_10016286 Ga0105241_100162866 304
143 3300009551 Ga0105238_10141928 Ga0105238_101419282 304
144 3300009553 Ga0105249_10021588 Ga0105249_100215886 304
145 3300010375 Ga0105239_10067091 Ga0105239_100670913 304
146 3300025919 Ga0207657_10007281 Ga0207657_1000728110 304
147 3300025921 Ga0207652_10247259 Ga0207652_102472592 304
148 3300025931 Ga0207644_10081484 Ga0207644_100814842 304
149 3300025932 Ga0207690_10372173 Ga0207690_103721731 304
150 3300025936 Ga0207670_10037814 Ga0207670_100378142 304
151 3300025961 Ga0207712_10096205 Ga0207712_100962052 304
152 3300026023 Ga0207677_10070786 Ga0207677_100707862 304
153 3300026078 Ga0207702_10142809 Ga0207702_101428092 304
154 3300026088 Ga0207641_10077897 Ga0207641_100778972 304
155 3300026089 Ga0207648_10083374 Ga0207648_100833742 304
156 3300026089 Ga0207648_10378584 Ga0207648_103785842 304
157 3300026116 Ga0207674_10004794 Ga0207674_1000479415 304
158 3300028794 Ga0307515_10131399 Ga0307515_101313991 304
159 3300028800 Ga0265338_10015253 Ga0265338_100152533 304
160 3300031251 Ga0265327_10000546 Ga0265327_1000054651 304
161 3300031665 Ga0316575_10089516 Ga0316575_100895162 304
162 3300031727 Ga0316576_10125990 Ga0316576_101259903 304
163 3300031727 Ga0316576_10183694 Ga0316576_101836942 304
164 3300031728 Ga0316578_10101146 Ga0316578_101011462 304
165 3300031731 Ga0307405_10144803 Ga0307405_101448032 304
166 3300031911 Ga0307412_10006797 Ga0307412_100067972 304
167 3300032002 Ga0307416_100572901 Ga0307416_1005729012 304
168 3300032133 Ga0316583_10005720 Ga0316583_100057205 304
169 3300032137 Ga0316585_10000970 Ga0316585_100009704 304
170 3300035114 Ga0373939_0023803 Ga0373939_0023803_585_1517 304
171 3300035398 Ga0316574_0001239 Ga0316574_0001239_3365_4291 304
172 3300035398 Ga0316574_0026641 Ga0316574_0026641_83_1009 304
173 3300035695 Ga0373927_0058213 Ga0373927_0058213_1233_2162 304
174 3300036647 Ga0316582_0000277 Ga0316582_0000277_10389_11315 304
175 3300036647 Ga0316582_0023018 Ga0316582_0023018_35_961 304
176 3300036647 Ga0316582_0059868 Ga0316582_0059868_933_1859 304
177 3300036712 Ga0316584_0011002 Ga0316584_0011002_4211_5137 304
178 3300036712 Ga0316584_0053546 Ga0316584_0053546_1833_2759 304
179 3300036712 Ga0316584_0138468 Ga0316584_0138468_487_1413 304
180 3300037312 Ga0395899_0100636 Ga0395899_0100636_702_1628 304
181 3300037418 Ga0395900_0146395 Ga0395900_0146395_578_1504 304
182 3300037466 Ga0395898_0171768 Ga0395898_0171768_1125_2051 304
183 3300037588 Ga0316581_0019015 Ga0316581_0019015_50_976 304
184 3300042001 Ga0439441_021491 Ga0439441_021491_107_1054 304
185 3300046455 Ga0495603_0040809 Ga0495603_0040809_900_1832 304
186 3300046457 Ga0495590_0019091 Ga0495590_0019091_638_1570 304
187 3300046557 Ga0495622_0004272 Ga0495622_0004272_3163_4095 304
188 3300046694 Ga0495649_0021738 Ga0495649_0021738_2622_3554 304
189 3300047320 Ga0495672_0011303 Ga0495672_0011303_1169_2101 304
190 3300047323 Ga0495683_0142506 Ga0495683_0142506_177_1109 304
191 3300048912 Ga0496109_0186498 Ga0496109_0186498_701_1627 304
192 3300049822 Ga0501035_0090106 Ga0501035_0090106_1725_2645 304
193 3300049823 Ga0501044_0189704 Ga0501044_0189704_426_1355 304
194 3300050493 nmdc:mga0k408_45210_c1 nmdc:mga0k408_45210_c1_507_1433 304
195 3300050509 nmdc:mga0qj67_3310_c1 nmdc:mga0qj67_3310_c1_2156_3079 304
196 3300053091 Ga0500647_0003059 Ga0500647_0003059_4872_5798 304
197 3300053103 Ga0500555_006631 Ga0500555_006631_2285_3205 304
198 3300053139 Ga0500568_0025658 Ga0500568_0025658_543_1466 304
199 3300053178 Ga0500637_0053754 Ga0500637_0053754_682_1614 304
200 iso_pu_bacteria 2728369097 2729148598 304
201 3300002067 JGI24735J21928_10005070 JGI24735J21928_100050705 305
202 3300003371 JGI26145J50221_1001413 JGI26145J50221_10014131 305
203 3300005295 Ga0065707_10118060 Ga0065707_101180601 305
204 3300005327 Ga0070658_10091592 Ga0070658_100915923 305
205 3300005329 Ga0070683_100045251 Ga0070683_1000452513 305
206 3300005331 Ga0070670_100080375 Ga0070670_1000803751 305
207 3300005331 Ga0070670_100102372 Ga0070670_1001023723 305
208 3300005336 Ga0070680_100035878 Ga0070680_1000358783 305
209 3300005337 Ga0070682_100068347 Ga0070682_1000683473 305
210 3300005337 Ga0070682_100087362 Ga0070682_1000873622 305
211 3300005339 Ga0070660_100047116 Ga0070660_1000471163 305
212 3300005341 Ga0070691_10000225 Ga0070691_1000022517 305
213 3300005344 Ga0070661_100008194 Ga0070661_1000081946 305
214 3300005354 Ga0070675_100170806 Ga0070675_1001708062 305
215 3300005355 Ga0070671_100092608 Ga0070671_1000926083 305
216 3300005355 Ga0070671_100166376 Ga0070671_1001663761 305
217 3300005366 Ga0070659_100026087 Ga0070659_1000260874 305
218 3300005366 Ga0070659_100348957 Ga0070659_1003489572 305
219 3300005367 Ga0070667_100001189 Ga0070667_10000118911 305
220 3300005435 Ga0070714_100032402 Ga0070714_1000324024 305
221 3300005435 Ga0070714_100106704 Ga0070714_1001067042 305
222 3300005455 Ga0070663_100124726 Ga0070663_1001247262 305
223 3300005457 Ga0070662_100103515 Ga0070662_1001035153 305
224 3300005467 Ga0070706_100075356 Ga0070706_1000753562 305
225 3300005530 Ga0070679_100246614 Ga0070679_1002466142 305
226 3300005530 Ga0070679_100321364 Ga0070679_1003213642 305
227 3300005535 Ga0070684_100004281 Ga0070684_1000042818 305
228 3300005539 Ga0068853_100067167 Ga0068853_1000671673 305
229 3300005539 Ga0068853_100116026 Ga0068853_1001160264 305
230 3300005564 Ga0070664_100004863 Ga0070664_1000048633 305
231 3300005577 Ga0068857_100023989 Ga0068857_1000239894 305
232 3300005577 Ga0068857_100090959 Ga0068857_1000909592 305
233 3300005578 Ga0068854_100014693 Ga0068854_1000146934 305
234 3300005614 Ga0068856_100067352 Ga0068856_1000673524 305
235 3300005616 Ga0068852_100012065 Ga0068852_1000120653 305
236 3300005616 Ga0068852_100318374 Ga0068852_1003183742 305
237 3300005617 Ga0068859_100034393 Ga0068859_1000343935 305
238 3300005618 Ga0068864_100032138 Ga0068864_1000321382 305
239 3300005618 Ga0068864_100130939 Ga0068864_1001309391 305
240 3300005618 Ga0068864_100168939 Ga0068864_1001689392 305
241 3300005841 Ga0068863_100020554 Ga0068863_1000205548 305
242 3300005844 Ga0068862_100024262 Ga0068862_1000242623 305
243 3300006048 Ga0075363_100011681 Ga0075363_1000116813 305
244 3300006195 Ga0075366_10099029 Ga0075366_100990292 305
245 3300006353 Ga0075370_10004592 Ga0075370_100045925 305
246 3300006353 Ga0075370_10090032 Ga0075370_100900322 305
247 3300006358 Ga0068871_100169330 Ga0068871_1001693302 305
248 3300006844 Ga0075428_100317283 Ga0075428_1003172832 305
249 3300006846 Ga0075430_100028405 Ga0075430_1000284055 305
250 3300006847 Ga0075431_100057239 Ga0075431_1000572393 305
251 3300006852 Ga0075433_10023918 Ga0075433_100239184 305
252 3300006880 Ga0075429_100168055 Ga0075429_1001680552 305
253 3300006914 Ga0075436_100038337 Ga0075436_1000383372 305
254 3300006931 Ga0097620_100034393 Ga0097620_1000343933 305
255 3300009093 Ga0105240_10028258 Ga0105240_100282582 305
256 3300009093 Ga0105240_10068076 Ga0105240_100680764 305
257 3300009098 Ga0105245_10015709 Ga0105245_100157098 305
258 3300009147 Ga0114129_10010131 Ga0114129_100101314 305
259 3300009147 Ga0114129_10028488 Ga0114129_100284885 305
260 3300009147 Ga0114129_10199985 Ga0114129_101999852 305
261 3300009147 Ga0114129_10596294 Ga0114129_105962942 305
262 3300009177 Ga0105248_10038844 Ga0105248_100388442 305
263 3300009545 Ga0105237_10060291 Ga0105237_100602913 305
264 3300009545 Ga0105237_10248072 Ga0105237_102480722 305
265 3300009551 Ga0105238_10003335 Ga0105238_1000333519 305
266 3300010375 Ga0105239_10090653 Ga0105239_100906534 305
267 3300011119 Ga0105246_10043591 Ga0105246_100435911 305
268 3300013100 Ga0157373_10012292 Ga0157373_100122923 305
269 3300013104 Ga0157370_10145186 Ga0157370_101451862 305
270 3300013104 Ga0157370_10181923 Ga0157370_101819232 305
271 3300013104 Ga0157370_10383065 Ga0157370_103830652 305
272 3300013105 Ga0157369_10040968 Ga0157369_100409684 305
273 3300013105 Ga0157369_10509066 Ga0157369_105090662 305
274 3300013296 Ga0157374_10107629 Ga0157374_101076293 305
275 3300013307 Ga0157372_10101095 Ga0157372_101010954 305
276 3300013307 Ga0157372_10280912 Ga0157372_102809122 305
277 3300013308 Ga0157375_10054977 Ga0157375_100549771 305
278 3300014325 Ga0163163_10400697 Ga0163163_104006972 305
279 3300014326 Ga0157380_10000114 Ga0157380_1000011434 305
280 3300014968 Ga0157379_10224730 Ga0157379_102247301 305
281 3300014969 Ga0157376_10030928 Ga0157376_100309282 305
282 3300025298 Ga0209050_1013887 Ga0209050_10138873 305
283 3300025303 Ga0209051_1011234 Ga0209051_10112344 305
284 3300025315 Ga0207697_10028013 Ga0207697_100280132 305
285 3300025904 Ga0207647_10001869 Ga0207647_100018699 305
286 3300025909 Ga0207705_10007205 Ga0207705_100072053 305
287 3300025911 Ga0207654_10107726 Ga0207654_101077262 305
288 3300025912 Ga0207707_10036106 Ga0207707_100361062 305
289 3300025912 Ga0207707_10238315 Ga0207707_102383152 305
290 3300025913 Ga0207695_10006878 Ga0207695_100068787 305
291 3300025913 Ga0207695_10159823 Ga0207695_101598233 305
292 3300025915 Ga0207693_10067411 Ga0207693_100674112 305
293 3300025919 Ga0207657_10001988 Ga0207657_1000198827 305
294 3300025919 Ga0207657_10009409 Ga0207657_100094097 305
295 3300025920 Ga0207649_10003120 Ga0207649_100031209 305
296 3300025921 Ga0207652_10094510 Ga0207652_100945102 305
297 3300025925 Ga0207650_10032987 Ga0207650_100329872 305
298 3300025925 Ga0207650_10413278 Ga0207650_104132781 305
299 3300025927 Ga0207687_10000298 Ga0207687_1000029822 305
300 3300025927 Ga0207687_10061436 Ga0207687_100614362 305
301 3300025929 Ga0207664_10011395 Ga0207664_100113954 305
302 3300025931 Ga0207644_10117940 Ga0207644_101179402 305
303 3300025932 Ga0207690_10004750 Ga0207690_100047506 305
304 3300025932 Ga0207690_10121720 Ga0207690_101217202 305
305 3300025933 Ga0207706_10267750 Ga0207706_102677502 305
306 3300025940 Ga0207691_10052482 Ga0207691_100524822 305
307 3300025940 Ga0207691_10131637 Ga0207691_101316372 305
308 3300025941 Ga0207711_10022316 Ga0207711_100223162 305
309 3300025945 Ga0207679_10034382 Ga0207679_100343824 305
310 3300025949 Ga0207667_10005210 Ga0207667_1000521015 305
311 3300025949 Ga0207667_10058758 Ga0207667_100587582 305
312 3300025949 Ga0207667_10288238 Ga0207667_102882382 305
313 3300025949 Ga0207667_10408828 Ga0207667_104088281 305
314 3300025981 Ga0207640_10004131 Ga0207640_100041312 305
315 3300025986 Ga0207658_10002188 Ga0207658_1000218811 305
316 3300025986 Ga0207658_10276021 Ga0207658_102760212 305
317 3300026041 Ga0207639_10070898 Ga0207639_100708983 305
318 3300026041 Ga0207639_10181683 Ga0207639_101816832 305
319 3300026067 Ga0207678_10238032 Ga0207678_102380322 305
320 3300026078 Ga0207702_10020180 Ga0207702_100201803 305
321 3300026078 Ga0207702_10144806 Ga0207702_101448063 305
322 3300026088 Ga0207641_10025413 Ga0207641_100254135 305
323 3300026095 Ga0207676_10105712 Ga0207676_101057121 305
324 3300026095 Ga0207676_10273043 Ga0207676_102730432 305
325 3300026116 Ga0207674_10011756 Ga0207674_100117567 305
326 3300026116 Ga0207674_10051162 Ga0207674_100511624 305
327 3300026121 Ga0207683_10016296 Ga0207683_100162965 305
328 3300026121 Ga0207683_10391103 Ga0207683_103911031 305
329 3300026142 Ga0207698_10002291 Ga0207698_100022914 305
330 3300027462 Ga0210000_1002839 Ga0210000_10028392 305
331 3300027543 Ga0209999_1000831 Ga0209999_10008317 305
332 3300027552 Ga0209982_1002696 Ga0209982_10026963 305
333 3300027614 Ga0209970_1007495 Ga0209970_10074952 305
334 3300027682 Ga0209971_1001096 Ga0209971_10010963 305
335 3300027876 Ga0209974_10014357 Ga0209974_100143571 305
336 3300027907 Ga0207428_10051032 Ga0207428_100510322 305
337 3300028379 Ga0268266_10364862 Ga0268266_103648621 305
338 3300028380 Ga0268265_10115159 Ga0268265_101151592 305
339 3300028381 Ga0268264_10030656 Ga0268264_100306562 305
340 3300031507 Ga0307509_10102599 Ga0307509_101025992 305
341 3300031727 Ga0316576_10010553 Ga0316576_100105533 305
342 3300031824 Ga0307413_10004322 Ga0307413_100043224 305
343 3300031824 Ga0307413_10065277 Ga0307413_100652772 305
344 3300031824 Ga0307413_10216233 Ga0307413_102162332 305
345 3300031852 Ga0307410_10106896 Ga0307410_101068962 305
346 3300031852 Ga0307410_10152060 Ga0307410_101520602 305
347 3300031901 Ga0307406_10022167 Ga0307406_100221675 305
348 3300031903 Ga0307407_10047631 Ga0307407_100476312 305
349 3300031911 Ga0307412_10000445 Ga0307412_1000044522 305
350 3300031995 Ga0307409_100060791 Ga0307409_1000607912 305
351 3300032002 Ga0307416_100336778 Ga0307416_1003367782 305
352 3300032004 Ga0307414_10072543 Ga0307414_100725433 305
353 3300032004 Ga0307414_10086675 Ga0307414_100866753 305
354 3300032005 Ga0307411_10001485 Ga0307411_1000148511 305
355 3300032005 Ga0307411_10040251 Ga0307411_100402514 305
356 3300032126 Ga0307415_100068728 Ga0307415_1000687282 305
357 3300032126 Ga0307415_100190061 Ga0307415_1001900612 305
358 3300035086 Ga0373934_0008204 Ga0373934_0008204_1307_2233 305
359 3300035111 Ga0373923_0000056 Ga0373923_0000056_6296_7222 305
360 3300035113 Ga0373936_0015945 Ga0373936_0015945_1352_2278 305
361 3300035117 Ga0373953_0005940 Ga0373953_0005940_1806_2732 305
362 3300035118 Ga0373954_0007256 Ga0373954_0007256_3481_4407 305
363 3300035118 Ga0373954_0021985 Ga0373954_0021985_1872_2798 305
364 3300035119 Ga0373956_0005453 Ga0373956_0005453_885_1811 305
365 3300035120 Ga0373957_0008067 Ga0373957_0008067_1059_1991 305
366 3300035120 Ga0373957_0014212 Ga0373957_0014212_621_1580 305
367 3300035120 Ga0373957_0027152 Ga0373957_0027152_326_1252 305
368 3300035172 Ga0373955_0001249 Ga0373955_0001249_8102_9034 305
369 3300035172 Ga0373955_0005370 Ga0373955_0005370_148_1074 305
370 3300035242 Ga0373962_0007891 Ga0373962_0007891_1622_2581 305
371 3300035398 Ga0316574_0139144 Ga0316574_0139144_477_1415 305
372 3300035691 Ga0373931_0015899 Ga0373931_0015899_929_1888 305
373 3300035692 Ga0373935_0131967 Ga0373935_0131967_374_1297 305
374 3300035692 Ga0373935_0143274 Ga0373935_0143274_557_1591 305
375 3300035695 Ga0373927_0002114 Ga0373927_0002114_11385_12308 305
376 3300035724 Ga0373933_0194331 Ga0373933_0194331_21_944 305
377 3300035725 Ga0373947_0044769 Ga0373947_0044769_123_1151 305
378 3300035725 Ga0373947_0074317 Ga0373947_0074317_425_1351 305
379 3300036401 Ga0373937_0009412 Ga0373937_0009412_3346_4278 305
380 3300036401 Ga0373937_0076730 Ga0373937_0076730_419_1342 305
381 3300036401 Ga0373937_0198343 Ga0373937_0198343_376_1302 305
382 3300036401 Ga0373937_0441480 Ga0373937_0441480_219_1142 305
383 3300037068 Ga0373925_0011317 Ga0373925_0011317_4235_5161 305
384 3300037068 Ga0373925_0276282 Ga0373925_0276282_225_1148 305
385 3300037312 Ga0395899_0014151 Ga0395899_0014151_617_1549 305
386 3300037312 Ga0395899_0041062 Ga0395899_0041062_179_1111 305
387 3300037312 Ga0395899_0053950 Ga0395899_0053950_736_1698 305
388 3300037418 Ga0395900_0000463 Ga0395900_0000463_30527_31483 305
389 3300037418 Ga0395900_0005687 Ga0395900_0005687_5309_6241 305
390 3300037418 Ga0395900_0139380 Ga0395900_0139380_606_1538 305
391 3300037418 Ga0395900_0152379 Ga0395900_0152379_1270_2202 305
392 3300037418 Ga0395900_0605659 Ga0395900_0605659_25_957 305
393 3300037466 Ga0395898_0011241 Ga0395898_0011241_7597_8553 305
394 3300037466 Ga0395898_0034473 Ga0395898_0034473_430_1392 305
395 3300037466 Ga0395898_0035939 Ga0395898_0035939_3112_4044 305
396 3300037466 Ga0395898_0107552 Ga0395898_0107552_1619_2581 305
397 3300037466 Ga0395898_0220915 Ga0395898_0220915_11_943 305
398 3300037466 Ga0395898_0253128 Ga0395898_0253128_107_1039 305
399 3300037471 Ga0395905_0095282 Ga0395905_0095282_1095_2027 305
400 3300037471 Ga0395905_0154853 Ga0395905_0154853_18_950 305
401 3300038443 Ga0395901_0000188 Ga0395901_0000188_21626_22558 305
402 3300038443 Ga0395901_0000604 Ga0395901_0000604_13835_14797 305
403 3300038443 Ga0395901_0009119 Ga0395901_0009119_455_1417 305
404 3300038443 Ga0395901_0023104 Ga0395901_0023104_4382_5314 305
405 3300038443 Ga0395901_0120156 Ga0395901_0120156_1095_2051 305
406 3300038443 Ga0395901_0149284 Ga0395901_0149284_829_1761 305
407 3300038443 Ga0395901_0169395 Ga0395901_0169395_565_1527 305
408 3300039450 Ga0436363_1223925 Ga0436363_1223925_32_955 305
409 3300042012 Ga0439455_0003442 Ga0439455_0003442_1115_2041 305
410 3300044673 Ga0453683_0002195 Ga0453683_0002195_2611_3537 305
411 3300044684 Ga0466966_0077247 Ga0466966_0077247_154_1086 305
412 3300044694 Ga0466963_0001670 Ga0466963_0001670_9303_10235 305
413 3300045836 Ga0466958_0004196 Ga0466958_0004196_1533_2465 305
414 3300045976 Ga0466967_0023353 Ga0466967_0023353_1909_2841 305
415 3300046454 Ga0495592_0004872 Ga0495592_0004872_495_1421 305
416 3300046455 Ga0495603_0000388 Ga0495603_0000388_17700_18623 305
417 3300046457 Ga0495590_0001068 Ga0495590_0001068_6265_7188 305
418 3300046459 Ga0495629_0003174 Ga0495629_0003174_3548_4471 305
419 3300046461 Ga0495641_0008790 Ga0495641_0008790_1690_2616 305
420 3300046461 Ga0495641_0026207 Ga0495641_0026207_1841_2764 305
421 3300046463 Ga0495653_0004188 Ga0495653_0004188_9681_10607 305
422 3300046472 Ga0495580_0016401 Ga0495580_0016401_1706_2629 305
423 3300046472 Ga0495580_0041640 Ga0495580_0041640_1121_2047 305
424 3300046473 Ga0495582_0001097 Ga0495582_0001097_2312_3235 305
425 3300046473 Ga0495582_0013960 Ga0495582_0013960_60_986 305
426 3300046475 Ga0495639_0008348 Ga0495639_0008348_2073_2999 305
427 3300046499 Ga0495594_0000118 Ga0495594_0000118_15331_16254 305
428 3300046506 Ga0495583_0000005 Ga0495583_0000005_63996_64916 305
429 3300046511 Ga0495608_0107355 Ga0495608_0107355_326_1252 305
430 3300046512 Ga0495610_0001341 Ga0495610_0001341_15106_16029 305
431 3300046516 Ga0495628_0013802 Ga0495628_0013802_557_1483 305
432 3300046517 Ga0495630_0012679 Ga0495630_0012679_1318_2244 305
433 3300046518 Ga0495631_0014835 Ga0495631_0014835_2488_3411 305
434 3300046520 Ga0495637_0008788 Ga0495637_0008788_1634_2557 305
435 3300046524 Ga0495648_0000029 Ga0495648_0000029_208437_209360 305
436 3300046526 Ga0495666_0006889 Ga0495666_0006889_3848_4774 305
437 3300046529 Ga0495652_0103151 Ga0495652_0103151_823_1749 305
438 3300046531 Ga0495665_0044109 Ga0495665_0044109_826_1752 305
439 3300046533 Ga0495640_0006086 Ga0495640_0006086_3356_4282 305
440 3300046535 Ga0495586_0117398 Ga0495586_0117398_382_1308 305
441 3300046559 Ga0495667_0008613 Ga0495667_0008613_4680_5606 305
442 3300046616 Ga0495668_0011331 Ga0495668_0011331_1354_2277 305
443 3300046642 Ga0495634_0002446 Ga0495634_0002446_2407_3333 305
444 3300046660 Ga0495625_0000398 Ga0495625_0000398_24956_25876 305
445 3300046660 Ga0495625_0111871 Ga0495625_0111871_165_1085 305
446 3300046663 Ga0495635_0025209 Ga0495635_0025209_1800_2726 305
447 3300046674 Ga0495588_0057082 Ga0495588_0057082_911_1834 305
448 3300046678 Ga0495599_0018838 Ga0495599_0018838_558_1484 305
449 3300046678 Ga0495599_0023815 Ga0495599_0023815_896_1822 305
450 3300046681 Ga0495647_0000113 Ga0495647_0000113_4051_4977 305
451 3300046681 Ga0495647_0007512 Ga0495647_0007512_1846_2769 305
452 3300046683 Ga0495658_0002474 Ga0495658_0002474_1351_2277 305
453 3300046683 Ga0495658_0013350 Ga0495658_0013350_354_1277 305
454 3300046689 Ga0495613_0008625 Ga0495613_0008625_5795_6718 305
455 3300046689 Ga0495613_0029688 Ga0495613_0029688_559_1485 305
456 3300046809 Ga0495600_0009720 Ga0495600_0009720_3820_4746 305
457 3300047315 Ga0495581_0090757 Ga0495581_0090757_32_955 305
458 3300047317 Ga0495604_0003696 Ga0495604_0003696_10077_11003 305
459 3300047319 Ga0495674_0065303 Ga0495674_0065303_885_1811 305
460 3300047321 Ga0495676_0170342 Ga0495676_0170342_366_1289 305
461 3300047322 Ga0495680_0087469 Ga0495680_0087469_1071_1997 305
462 3300047322 Ga0495680_0361099 Ga0495680_0361099_66_989 305
463 3300047446 Ga0495679_003586 Ga0495679_003586_6164_7084 305
464 3300047469 Ga0495673_0000342 Ga0495673_0000342_27362_28285 305
465 3300047471 Ga0495684_0094860 Ga0495684_0094860_986_1912 305
466 3300047472 Ga0495686_0001836 Ga0495686_0001836_5623_6546 305
467 3300047673 Ga0495593_0000987 Ga0495593_0000987_7908_8831 305
468 3300048088 Ga0495602_0014733 Ga0495602_0014733_5609_6541 305
469 3300048089 Ga0495614_0042029 Ga0495614_0042029_803_1726 305
470 3300048910 Ga0496107_0186394 Ga0496107_0186394_540_1478 305
471 3300048915 Ga0496112_0072298 Ga0496112_0072298_190_1116 305
472 3300048917 Ga0496114_0160550 Ga0496114_0160550_11_934 305
473 3300048917 Ga0496114_0221649 Ga0496114_0221649_422_1414 305
474 3300048918 Ga0496115_0169765 Ga0496115_0169765_758_1696 305
475 3300048919 Ga0496116_0028883 Ga0496116_0028883_2578_3501 305
476 3300048919 Ga0496116_0038439 Ga0496116_0038439_1006_1929 305
477 3300048922 Ga0496119_0012759 Ga0496119_0012759_3493_4416 305
478 3300048923 Ga0496120_0015992 Ga0496120_0015992_1590_2513 305
479 3300048924 Ga0496121_0000145 Ga0496121_0000145_60860_61783 305
480 3300048924 Ga0496121_0099155 Ga0496121_0099155_248_1171 305
481 3300048925 Ga0496122_0000029 Ga0496122_0000029_277425_278348 305
482 3300048925 Ga0496122_0098434 Ga0496122_0098434_346_1269 305
483 3300048926 Ga0496123_0000216 Ga0496123_0000216_58049_58972 305
484 3300048926 Ga0496123_0041704 Ga0496123_0041704_1715_2638 305
485 3300048927 Ga0496124_0147417 Ga0496124_0147417_212_1135 305
486 3300048928 Ga0496125_0001102 Ga0496125_0001102_33062_33985 305
487 3300048928 Ga0496125_0018499 Ga0496125_0018499_579_1502 305
488 3300048929 Ga0496126_0073787 Ga0496126_0073787_2092_3015 305
489 3300049459 Ga0495678_003651 Ga0495678_003651_5913_6836 305
490 3300049570 Ga0501033_0060379 Ga0501033_0060379_1676_2638 305
491 3300049570 Ga0501033_0072968 Ga0501033_0072968_88_1011 305
492 3300049571 Ga0501034_0026913 Ga0501034_0026913_2545_3474 305
493 3300049581 Ga0501047_0122096 Ga0501047_0122096_514_1476 305
494 3300049586 Ga0501070_0023819 Ga0501070_0023819_4130_5062 305
495 3300049590 Ga0501074_0063087 Ga0501074_0063087_1589_2521 305
496 3300049742 Ga0501080_0034741 Ga0501080_0034741_1569_2501 305
497 3300049742 Ga0501080_0051306 Ga0501080_0051306_2676_3680 305
498 3300049744 Ga0501083_0014104 Ga0501083_0014104_625_1548 305
499 3300049744 Ga0501083_0069462 Ga0501083_0069462_242_1246 305
500 3300049822 Ga0501035_0019304 Ga0501035_0019304_3211_4134 305
501 3300050493 nmdc:mga0k408_34917_c1 nmdc:mga0k408_34917_c1_242_1165 305
502 3300050507 nmdc:mga05p37_155916_c1 nmdc:mga05p37_155916_c1_1528_2454 305
503 3300050507 nmdc:mga05p37_716_c1 nmdc:mga05p37_716_c1_9024_9950 305
504 3300050509 nmdc:mga0qj67_8357_c1 nmdc:mga0qj67_8357_c1_1119_2120 305
505 3300050510 nmdc:mga06r32_106735_c1 nmdc:mga06r32_106735_c1_1446_2372 305
506 3300050510 nmdc:mga06r32_7880_c1 nmdc:mga06r32_7880_c1_3927_4928 305
507 3300050511 nmdc:mga08y16_67396_c1 nmdc:mga08y16_67396_c1_1399_2379 305
508 3300050512 nmdc:mga0n895_214105_c1 nmdc:mga0n895_214105_c1_625_1551 305
509 3300050514 nmdc:mga08x19_26318_c1 nmdc:mga08x19_26318_c1_1441_2367 305
510 3300050515 nmdc:mga0a205_139417_c1 nmdc:mga0a205_139417_c1_1073_2089 305
511 3300050515 nmdc:mga0a205_8602_c1 nmdc:mga0a205_8602_c1_2917_3843 305
512 3300053077 Ga0495601_0002701 Ga0495601_0002701_7100_8026 305
513 3300053084 Ga0495595_0008305 Ga0495595_0008305_2787_3713 305
514 3300053085 Ga0495619_0002898 Ga0495619_0002898_5536_6462 305
515 3300053085 Ga0495619_0077528 Ga0495619_0077528_296_1219 305
516 3300053086 Ga0500578_0000102 Ga0500578_0000102_70507_71430 305
517 3300053088 Ga0500644_0000290 Ga0500644_0000290_15351_16274 305
518 3300053111 Ga0500572_000529 Ga0500572_000529_3333_4268 305
519 3300053118 Ga0500594_0002267 Ga0500594_0002267_731_1654 305
520 3300053122 Ga0500608_000158 Ga0500608_000158_13943_14887 305
521 3300053123 Ga0500614_005413 Ga0500614_005413_944_1888 305
522 3300053125 Ga0500618_000120 Ga0500618_000120_43855_44775 305
523 3300053136 Ga0500559_0000403 Ga0500559_0000403_21708_22628 305
524 3300053136 Ga0500559_0005605 Ga0500559_0005605_4544_5488 305
525 3300053136 Ga0500559_0021554 Ga0500559_0021554_113_1042 305
526 3300053138 Ga0500564_000115 Ga0500564_000115_689_1612 305
527 3300053138 Ga0500564_000291 Ga0500564_000291_2802_3746 305
528 3300053140 Ga0500573_0044788 Ga0500573_0044788_1539_2483 305
529 3300053156 Ga0500622_0000674 Ga0500622_0000674_16153_17076 305
530 3300053156 Ga0500622_0004041 Ga0500622_0004041_4942_5865 305
531 3300053723 Ga0500567_001143 Ga0500567_001143_4725_5669 305
532 3300053729 Ga0500625_000012 Ga0500625_000012_50265_51209 305
533 3300061719 Ga0466962_0005147 Ga0466962_0005147_4315_5247 305
534 iso_pu_bacteria 2501025504 2501406879 305
535 iso_pu_bacteria 2510917014 2511097785 305
536 iso_pu_bacteria 2599185292 2599905713 305
537 iso_pu_bacteria 2643221569 2643860596 305
538 iso_pu_bacteria 2643221574 2643882244 305
539 iso_pu_bacteria 2643221594 2643981540 305
540 iso_pu_bacteria 2643221699 2644549315 305
541 iso_pu_bacteria 2643221699 2644551440 305
542 iso_pu_bacteria 2808606373 2808906743 305
543 iso_pu_bacteria 2808606395 2809035447 305
544 3300001904 JGI24736J21556_1003706 JGI24736J21556_10037063 306
545 3300001904 JGI24736J21556_1018176 JGI24736J21556_10181761 306
546 3300001915 JGI24741J21665_1000800 JGI24741J21665_10008007 306
547 3300001915 JGI24741J21665_1000873 JGI24741J21665_10008734 306
548 3300001915 JGI24741J21665_1002927 JGI24741J21665_10029274 306
549 3300001979 JGI24740J21852_10000833 JGI24740J21852_100008338 306
550 3300001979 JGI24740J21852_10003279 JGI24740J21852_100032795 306
551 3300001979 JGI24740J21852_10011531 JGI24740J21852_100115312 306
552 3300001991 JGI24743J22301_10001171 JGI24743J22301_100011713 306
553 3300002075 JGI24738J21930_10002476 JGI24738J21930_100024763 306
554 3300002076 JGI24749J21850_1001805 JGI24749J21850_10018053 306
555 3300002155 JGI24033J26618_1001172 JGI24033J26618_10011722 306
556 3300002239 JGI24034J26672_10005980 JGI24034J26672_100059802 306
557 3300002737 JGI25162J39368_1000468 JGI25162J39368_100046813 306
558 3300002737 JGI25162J39368_1001279 JGI25162J39368_100127915 306
559 3300002741 JGI25157J39369_1000469 JGI25157J39369_10004697 306
560 3300002772 JGI25164J39214_1000193 JGI25164J39214_100019351 306
561 3300002772 JGI25164J39214_1000242 JGI25164J39214_100024250 306
562 3300003203 JGI25406J46586_10025745 JGI25406J46586_100257451 306
563 3300003214 JGI25165J46597_1000335 JGI25165J46597_100033550 306
564 3300003214 JGI25165J46597_1002530 JGI25165J46597_10025302 306
565 3300003756 Ga0055533_1000011 Ga0055533_1000011376 306
566 3300003756 Ga0055533_1005444 Ga0055533_10054443 306
567 3300003759 Ga0055525_1001594 Ga0055525_10015942 306
568 3300003775 Ga0055524_1003977 Ga0055524_10039779 306
569 3300003781 Ga0055536_1000621 Ga0055536_100062128 306
570 3300003781 Ga0055536_1001793 Ga0055536_100179314 306
571 3300003791 Ga0055530_10014991 Ga0055530_100149913 306
572 3300003792 Ga0055540_1005515 Ga0055540_10055152 306
573 3300003794 Ga0055531_10000450 Ga0055531_1000045034 306
574 3300003794 Ga0055531_10002822 Ga0055531_100028228 306
575 3300005262 Ga0065165_1004485 Ga0065165_100448510 306
576 3300005262 Ga0065165_1040512 Ga0065165_10405122 306
577 3300005293 Ga0065715_10023686 Ga0065715_100236861 306
578 3300005293 Ga0065715_10118965 Ga0065715_101189652 306
579 3300005293 Ga0065715_10181169 Ga0065715_101811692 306
580 3300005327 Ga0070658_10001353 Ga0070658_1000135319 306
581 3300005327 Ga0070658_10117242 Ga0070658_101172422 306
582 3300005328 Ga0070676_10015962 Ga0070676_100159623 306
583 3300005329 Ga0070683_100007585 Ga0070683_1000075858 306
584 3300005329 Ga0070683_100064518 Ga0070683_1000645184 306
585 3300005330 Ga0070690_100011275 Ga0070690_1000112754 306
586 3300005330 Ga0070690_100044508 Ga0070690_1000445082 306
587 3300005331 Ga0070670_100000002 Ga0070670_100000002134 306
588 3300005331 Ga0070670_100101779 Ga0070670_1001017792 306
589 3300005331 Ga0070670_100416273 Ga0070670_1004162731 306
590 3300005333 Ga0070677_10008613 Ga0070677_100086133 306
591 3300005333 Ga0070677_10014193 Ga0070677_100141932 306
592 3300005334 Ga0068869_100025426 Ga0068869_1000254261 306
593 3300005334 Ga0068869_100274068 Ga0068869_1002740681 306
594 3300005335 Ga0070666_10122162 Ga0070666_101221621 306
595 3300005336 Ga0070680_100004287 Ga0070680_10000428711 306
596 3300005336 Ga0070680_100055851 Ga0070680_1000558511 306
597 3300005336 Ga0070680_100065166 Ga0070680_1000651662 306
598 3300005337 Ga0070682_100057489 Ga0070682_1000574892 306
599 3300005337 Ga0070682_100080136 Ga0070682_1000801362 306
600 3300005337 Ga0070682_100221678 Ga0070682_1002216782 306
601 3300005338 Ga0068868_100028093 Ga0068868_1000280932 306
602 3300005339 Ga0070660_100004561 Ga0070660_1000045613 306
603 3300005339 Ga0070660_100005115 Ga0070660_1000051159 306
604 3300005339 Ga0070660_100036722 Ga0070660_1000367224 306
605 3300005339 Ga0070660_100046895 Ga0070660_1000468952 306
606 3300005340 Ga0070689_100000908 Ga0070689_10000090811 306
607 3300005340 Ga0070689_100078629 Ga0070689_1000786293 306
608 3300005340 Ga0070689_100349627 Ga0070689_1003496271 306
609 3300005341 Ga0070691_10037443 Ga0070691_100374432 306
610 3300005343 Ga0070687_100054025 Ga0070687_1000540252 306
611 3300005344 Ga0070661_100002483 Ga0070661_1000024836 306
612 3300005344 Ga0070661_100007312 Ga0070661_1000073124 306
613 3300005344 Ga0070661_100007351 Ga0070661_1000073515 306
614 3300005344 Ga0070661_100017270 Ga0070661_1000172704 306
615 3300005344 Ga0070661_100093035 Ga0070661_1000930352 306
616 3300005345 Ga0070692_10209677 Ga0070692_102096771 306
617 3300005347 Ga0070668_100020914 Ga0070668_1000209144 306
618 3300005347 Ga0070668_100101492 Ga0070668_1001014922 306
619 3300005353 Ga0070669_100002974 Ga0070669_1000029745 306
620 3300005353 Ga0070669_100072519 Ga0070669_1000725192 306
621 3300005353 Ga0070669_100110163 Ga0070669_1001101632 306
622 3300005354 Ga0070675_100060456 Ga0070675_1000604563 306
623 3300005354 Ga0070675_100152298 Ga0070675_1001522982 306
624 3300005355 Ga0070671_100000047 Ga0070671_10000004749 306
625 3300005355 Ga0070671_100001263 Ga0070671_10000126315 306
626 3300005355 Ga0070671_100018028 Ga0070671_1000180286 306
627 3300005355 Ga0070671_100042151 Ga0070671_1000421513 306
628 3300005355 Ga0070671_100304197 Ga0070671_1003041971 306
629 3300005364 Ga0070673_100001025 Ga0070673_1000010259 306
630 3300005364 Ga0070673_100133891 Ga0070673_1001338912 306
631 3300005364 Ga0070673_100178224 Ga0070673_1001782242 306
632 3300005364 Ga0070673_100240206 Ga0070673_1002402062 306
633 3300005365 Ga0070688_100029825 Ga0070688_1000298254 306
634 3300005365 Ga0070688_100141474 Ga0070688_1001414742 306
635 3300005366 Ga0070659_100001873 Ga0070659_1000018739 306
636 3300005366 Ga0070659_100003652 Ga0070659_10000365211 306
637 3300005366 Ga0070659_100013172 Ga0070659_1000131721 306
638 3300005366 Ga0070659_100050838 Ga0070659_1000508382 306
639 3300005366 Ga0070659_100209363 Ga0070659_1002093631 306
640 3300005367 Ga0070667_100000018 Ga0070667_100000018133 306
641 3300005367 Ga0070667_100002630 Ga0070667_1000026306 306
642 3300005434 Ga0070709_10002390 Ga0070709_100023904 306
643 3300005434 Ga0070709_10011717 Ga0070709_100117175 306
644 3300005435 Ga0070714_100000079 Ga0070714_10000007934 306
645 3300005435 Ga0070714_100001813 Ga0070714_10000181316 306
646 3300005435 Ga0070714_100003909 Ga0070714_1000039099 306
647 3300005435 Ga0070714_100005545 Ga0070714_10000554510 306
648 3300005435 Ga0070714_100016187 Ga0070714_1000161875 306
649 3300005436 Ga0070713_100027807 Ga0070713_1000278075 306
650 3300005439 Ga0070711_100113121 Ga0070711_1001131212 306
651 3300005440 Ga0070705_100008150 Ga0070705_1000081503 306
652 3300005440 Ga0070705_100066153 Ga0070705_1000661532 306
653 3300005441 Ga0070700_100009824 Ga0070700_1000098242 306
654 3300005441 Ga0070700_100040823 Ga0070700_1000408232 306
655 3300005441 Ga0070700_100050672 Ga0070700_1000506723 306
656 3300005455 Ga0070663_100002048 Ga0070663_10000204810 306
657 3300005455 Ga0070663_100011864 Ga0070663_1000118644 306
658 3300005455 Ga0070663_100070594 Ga0070663_1000705942 306
659 3300005455 Ga0070663_100156761 Ga0070663_1001567612 306
660 3300005455 Ga0070663_100165351 Ga0070663_1001653511 306
661 3300005455 Ga0070663_100373390 Ga0070663_1003733901 306
662 3300005456 Ga0070678_100035451 Ga0070678_1000354513 306
663 3300005456 Ga0070678_100072802 Ga0070678_1000728022 306
664 3300005456 Ga0070678_100092613 Ga0070678_1000926133 306
665 3300005456 Ga0070678_100294093 Ga0070678_1002940931 306
666 3300005457 Ga0070662_100000546 Ga0070662_1000005466 306
667 3300005458 Ga0070681_10000186 Ga0070681_1000018613 306
668 3300005458 Ga0070681_10001722 Ga0070681_1000172215 306
669 3300005458 Ga0070681_10001805 Ga0070681_100018059 306
670 3300005458 Ga0070681_10016914 Ga0070681_100169143 306
671 3300005458 Ga0070681_10028888 Ga0070681_100288885 306
672 3300005466 Ga0070685_10000011 Ga0070685_1000001124 306
673 3300005466 Ga0070685_10005572 Ga0070685_100055725 306
674 3300005466 Ga0070685_10012813 Ga0070685_100128132 306
675 3300005466 Ga0070685_10037523 Ga0070685_100375232 306
676 3300005518 Ga0070699_100006475 Ga0070699_1000064754 306
677 3300005518 Ga0070699_100093465 Ga0070699_1000934652 306
678 3300005530 Ga0070679_100000209 Ga0070679_10000020935 306
679 3300005530 Ga0070679_100006033 Ga0070679_10000603314 306
680 3300005530 Ga0070679_100017095 Ga0070679_1000170956 306
681 3300005530 Ga0070679_100046964 Ga0070679_1000469642 306
682 3300005530 Ga0070679_100098164 Ga0070679_1000981642 306
683 3300005530 Ga0070679_100245652 Ga0070679_1002456522 306
684 3300005535 Ga0070684_100013549 Ga0070684_1000135496 306
685 3300005535 Ga0070684_100020604 Ga0070684_1000206044 306
686 3300005539 Ga0068853_100002701 Ga0068853_10000270114 306
687 3300005539 Ga0068853_100025749 Ga0068853_1000257492 306
688 3300005539 Ga0068853_100143380 Ga0068853_1001433802 306
689 3300005539 Ga0068853_100156669 Ga0068853_1001566692 306
690 3300005543 Ga0070672_100021972 Ga0070672_1000219724 306
691 3300005543 Ga0070672_100043703 Ga0070672_1000437037 306
692 3300005543 Ga0070672_100142343 Ga0070672_1001423432 306
693 3300005543 Ga0070672_100297086 Ga0070672_1002970861 306
694 3300005544 Ga0070686_100030021 Ga0070686_1000300211 306
695 3300005545 Ga0070695_100008874 Ga0070695_1000088742 306
696 3300005546 Ga0070696_100001072 Ga0070696_1000010725 306
697 3300005546 Ga0070696_100003297 Ga0070696_1000032979 306
698 3300005546 Ga0070696_100030889 Ga0070696_1000308892 306
699 3300005546 Ga0070696_100055603 Ga0070696_1000556034 306
700 3300005546 Ga0070696_100064029 Ga0070696_1000640293 306
701 3300005547 Ga0070693_100034600 Ga0070693_1000346002 306
702 3300005547 Ga0070693_100036637 Ga0070693_1000366372 306
703 3300005548 Ga0070665_100007774 Ga0070665_1000077744 306
704 3300005548 Ga0070665_100019771 Ga0070665_1000197718 306
705 3300005548 Ga0070665_100025711 Ga0070665_1000257114 306
706 3300005563 Ga0068855_100000036 Ga0068855_10000003633 306
707 3300005563 Ga0068855_100001533 Ga0068855_10000153325 306
708 3300005563 Ga0068855_100004530 Ga0068855_10000453016 306
709 3300005563 Ga0068855_100026190 Ga0068855_1000261902 306
710 3300005563 Ga0068855_100026592 Ga0068855_1000265923 306
711 3300005563 Ga0068855_100109262 Ga0068855_1001092622 306
712 3300005563 Ga0068855_100197425 Ga0068855_1001974252 306
713 3300005564 Ga0070664_100000152 Ga0070664_10000015235 306
714 3300005564 Ga0070664_100002216 Ga0070664_1000022164 306
715 3300005564 Ga0070664_100002766 Ga0070664_1000027663 306
716 3300005564 Ga0070664_100031462 Ga0070664_1000314621 306
717 3300005564 Ga0070664_100037535 Ga0070664_1000375353 306
718 3300005577 Ga0068857_100020611 Ga0068857_1000206118 306
719 3300005577 Ga0068857_100080701 Ga0068857_1000807011 306
720 3300005577 Ga0068857_100560876 Ga0068857_1005608762 306
721 3300005578 Ga0068854_100000190 Ga0068854_10000019022 306
722 3300005578 Ga0068854_100007267 Ga0068854_1000072672 306
723 3300005578 Ga0068854_100014610 Ga0068854_1000146103 306
724 3300005614 Ga0068856_100000409 Ga0068856_10000040921 306
725 3300005614 Ga0068856_100004503 Ga0068856_1000045038 306
726 3300005614 Ga0068856_100020224 Ga0068856_1000202248 306
727 3300005614 Ga0068856_100062649 Ga0068856_1000626492 306
728 3300005614 Ga0068856_100149033 Ga0068856_1001490333 306
729 3300005614 Ga0068856_100343183 Ga0068856_1003431832 306
730 3300005614 Ga0068856_100460519 Ga0068856_1004605192 306
731 3300005615 Ga0070702_100026916 Ga0070702_1000269163 306
732 3300005615 Ga0070702_100038356 Ga0070702_1000383562 306
733 3300005615 Ga0070702_100207622 Ga0070702_1002076222 306
734 3300005616 Ga0068852_100052885 Ga0068852_1000528853 306
735 3300005616 Ga0068852_100122524 Ga0068852_1001225243 306
736 3300005617 Ga0068859_100003324 Ga0068859_1000033246 306
737 3300005617 Ga0068859_100018022 Ga0068859_1000180224 306
738 3300005617 Ga0068859_100091461 Ga0068859_1000914613 306
739 3300005618 Ga0068864_100000003 Ga0068864_100000003135 306
740 3300005618 Ga0068864_100015374 Ga0068864_1000153743 306
741 3300005618 Ga0068864_100022493 Ga0068864_1000224934 306
742 3300005618 Ga0068864_100038634 Ga0068864_1000386343 306
743 3300005618 Ga0068864_100065129 Ga0068864_1000651293 306
744 3300005618 Ga0068864_100065381 Ga0068864_1000653811 306
745 3300005718 Ga0068866_10004226 Ga0068866_100042265 306
746 3300005719 Ga0068861_100008881 Ga0068861_1000088813 306
747 3300005719 Ga0068861_100022771 Ga0068861_1000227712 306
748 3300005719 Ga0068861_100069845 Ga0068861_1000698454 306
749 3300005834 Ga0068851_10003350 Ga0068851_100033504 306
750 3300005834 Ga0068851_10010852 Ga0068851_100108525 306
751 3300005834 Ga0068851_10025248 Ga0068851_100252482 306
752 3300005834 Ga0068851_10120751 Ga0068851_101207511 306
753 3300005841 Ga0068863_100000676 Ga0068863_10000067616 306
754 3300005841 Ga0068863_100018221 Ga0068863_1000182213 306
755 3300005841 Ga0068863_100043692 Ga0068863_1000436923 306
756 3300005841 Ga0068863_100089543 Ga0068863_1000895434 306
757 3300005841 Ga0068863_100105072 Ga0068863_1001050721 306
758 3300005842 Ga0068858_100007507 Ga0068858_1000075074 306
759 3300005842 Ga0068858_100183499 Ga0068858_1001834992 306
760 3300005843 Ga0068860_100004338 Ga0068860_1000043386 306
761 3300005843 Ga0068860_100005019 Ga0068860_10000501912 306
762 3300005843 Ga0068860_100034112 Ga0068860_1000341126 306
763 3300005843 Ga0068860_100048959 Ga0068860_1000489594 306
764 3300005843 Ga0068860_100074436 Ga0068860_1000744363 306
765 3300005844 Ga0068862_100001116 Ga0068862_10000111634 306
766 3300005844 Ga0068862_100028576 Ga0068862_1000285765 306
767 3300005844 Ga0068862_100048865 Ga0068862_1000488652 306
768 3300005937 Ga0081455_10001237 Ga0081455_1000123729 306
769 3300005985 Ga0081539_10001910 Ga0081539_100019106 306
770 3300006028 Ga0070717_10472666 Ga0070717_104726662 306
771 3300006048 Ga0075363_100147866 Ga0075363_1001478662 306
772 3300006173 Ga0070716_100073708 Ga0070716_1000737082 306
773 3300006173 Ga0070716_100147098 Ga0070716_1001470982 306
774 3300006186 Ga0075369_10052301 Ga0075369_100523013 306
775 3300006195 Ga0075366_10101296 Ga0075366_101012962 306
776 3300006237 Ga0097621_100005667 Ga0097621_1000056676 306
777 3300006237 Ga0097621_100029431 Ga0097621_1000294313 306
778 3300006237 Ga0097621_100038404 Ga0097621_1000384042 306
779 3300006237 Ga0097621_100054938 Ga0097621_1000549383 306
780 3300006237 Ga0097621_100213191 Ga0097621_1002131912 306
781 3300006237 Ga0097621_100219439 Ga0097621_1002194392 306
782 3300006353 Ga0075370_10008051 Ga0075370_100080514 306
783 3300006353 Ga0075370_10026557 Ga0075370_100265573 306
784 3300006353 Ga0075370_10110310 Ga0075370_101103102 306
785 3300006358 Ga0068871_100000930 Ga0068871_10000093011 306
786 3300006358 Ga0068871_100054239 Ga0068871_1000542394 306
787 3300006358 Ga0068871_100148555 Ga0068871_1001485552 306
788 3300006358 Ga0068871_100201616 Ga0068871_1002016162 306
789 3300006881 Ga0068865_100038247 Ga0068865_1000382473 306
790 3300006881 Ga0068865_100087868 Ga0068865_1000878682 306
791 3300006931 Ga0097620_100003324 Ga0097620_1000033246 306
792 3300006931 Ga0097620_100018020 Ga0097620_1000180204 306
793 3300006931 Ga0097620_100091464 Ga0097620_1000914643 306
794 3300006946 Ga0079104_1016454 Ga0079104_10164542 306
795 3300007076 Ga0075435_100062520 Ga0075435_1000625202 306
796 3300007076 Ga0075435_100240315 Ga0075435_1002403152 306
797 3300009093 Ga0105240_10001797 Ga0105240_1000179716 306
798 3300009093 Ga0105240_10023500 Ga0105240_100235004 306
799 3300009093 Ga0105240_10140267 Ga0105240_101402673 306
800 3300009093 Ga0105240_10195986 Ga0105240_101959862 306
801 3300009094 Ga0111539_10057264 Ga0111539_100572643 306
802 3300009098 Ga0105245_10272104 Ga0105245_102721042 306
803 3300009148 Ga0105243_10098111 Ga0105243_100981112 306
804 3300009148 Ga0105243_10142412 Ga0105243_101424123 306
805 3300009174 Ga0105241_10290255 Ga0105241_102902551 306
806 3300009176 Ga0105242_10140285 Ga0105242_101402852 306
807 3300009177 Ga0105248_10003092 Ga0105248_1000309212 306
808 3300009177 Ga0105248_10011726 Ga0105248_100117268 306
809 3300009177 Ga0105248_10075626 Ga0105248_100756263 306
810 3300009177 Ga0105248_10145097 Ga0105248_101450973 306
811 3300009177 Ga0105248_10253051 Ga0105248_102530511 306
812 3300009177 Ga0105248_10295518 Ga0105248_102955181 306
813 3300009177 Ga0105248_10399827 Ga0105248_103998272 306
814 3300009177 Ga0105248_10436412 Ga0105248_104364122 306
815 3300009545 Ga0105237_10396390 Ga0105237_103963902 306
816 3300009545 Ga0105237_10422306 Ga0105237_104223062 306
817 3300009551 Ga0105238_10000864 Ga0105238_1000086426 306
818 3300009551 Ga0105238_10071848 Ga0105238_100718482 306
819 3300009551 Ga0105238_10078033 Ga0105238_100780333 306
820 3300009551 Ga0105238_10141550 Ga0105238_101415502 306
821 3300009551 Ga0105238_10161842 Ga0105238_101618422 306
822 3300009551 Ga0105238_10239149 Ga0105238_102391492 306
823 3300009551 Ga0105238_10362978 Ga0105238_103629782 306
824 3300009553 Ga0105249_10028673 Ga0105249_100286732 306
825 3300009553 Ga0105249_10078976 Ga0105249_100789763 306
826 3300010375 Ga0105239_10096260 Ga0105239_100962602 306
827 3300011119 Ga0105246_10243297 Ga0105246_102432972 306
828 3300013100 Ga0157373_10011386 Ga0157373_100113866 306
829 3300013100 Ga0157373_10022939 Ga0157373_100229395 306
830 3300013100 Ga0157373_10062337 Ga0157373_100623373 306
831 3300013100 Ga0157373_10129460 Ga0157373_101294602 306
832 3300013100 Ga0157373_10158310 Ga0157373_101583102 306
833 3300013102 Ga0157371_10001396 Ga0157371_100013968 306
834 3300013102 Ga0157371_10083526 Ga0157371_100835261 306
835 3300013102 Ga0157371_10092881 Ga0157371_100928812 306
836 3300013102 Ga0157371_10093688 Ga0157371_100936882 306
837 3300013102 Ga0157371_10125727 Ga0157371_101257272 306
838 3300013104 Ga0157370_10000793 Ga0157370_1000079336 306
839 3300013104 Ga0157370_10006992 Ga0157370_100069926 306
840 3300013104 Ga0157370_10007658 Ga0157370_100076588 306
841 3300013104 Ga0157370_10017138 Ga0157370_100171383 306
842 3300013104 Ga0157370_10112349 Ga0157370_101123492 306
843 3300013104 Ga0157370_10179950 Ga0157370_101799502 306
844 3300013105 Ga0157369_10004153 Ga0157369_1000415318 306
845 3300013296 Ga0157374_10034227 Ga0157374_100342275 306
846 3300013296 Ga0157374_10080136 Ga0157374_100801362 306
847 3300013296 Ga0157374_10090083 Ga0157374_100900832 306
848 3300013296 Ga0157374_10137624 Ga0157374_101376243 306
849 3300013296 Ga0157374_10175451 Ga0157374_101754512 306
850 3300013296 Ga0157374_10401366 Ga0157374_104013662 306
851 3300013297 Ga0157378_10214988 Ga0157378_102149882 306
852 3300013297 Ga0157378_10341662 Ga0157378_103416622 306
853 3300013306 Ga0163162_10081285 Ga0163162_100812855 306
854 3300013307 Ga0157372_10002671 Ga0157372_1000267119 306
855 3300013307 Ga0157372_10024015 Ga0157372_100240156 306
856 3300013307 Ga0157372_10025492 Ga0157372_100254925 306
857 3300013307 Ga0157372_10026197 Ga0157372_100261974 306
858 3300013307 Ga0157372_10059284 Ga0157372_100592843 306
859 3300013307 Ga0157372_10104398 Ga0157372_101043982 306
860 3300013307 Ga0157372_10120965 Ga0157372_101209652 306
861 3300013307 Ga0157372_10232360 Ga0157372_102323602 306
862 3300013307 Ga0157372_10252443 Ga0157372_102524432 306
863 3300013307 Ga0157372_10454398 Ga0157372_104543982 306
864 3300013308 Ga0157375_10002586 Ga0157375_100025866 306
865 3300013308 Ga0157375_10007788 Ga0157375_100077885 306
866 3300013308 Ga0157375_10019559 Ga0157375_100195594 306
867 3300013308 Ga0157375_10036322 Ga0157375_100363227 306
868 3300013308 Ga0157375_10078869 Ga0157375_100788692 306
869 3300013308 Ga0157375_10173230 Ga0157375_101732303 306
870 3300014325 Ga0163163_10000132 Ga0163163_1000013259 306
871 3300014325 Ga0163163_10036340 Ga0163163_100363402 306
872 3300014325 Ga0163163_10130413 Ga0163163_101304132 306
873 3300014325 Ga0163163_10458181 Ga0163163_104581812 306
874 3300014326 Ga0157380_10040570 Ga0157380_100405704 306
875 3300014497 Ga0182008_10008704 Ga0182008_100087042 306
876 3300014745 Ga0157377_10057967 Ga0157377_100579672 306
877 3300014968 Ga0157379_10000505 Ga0157379_1000050522 306
878 3300014968 Ga0157379_10009200 Ga0157379_100092006 306
879 3300014969 Ga0157376_10002600 Ga0157376_100026007 306
880 3300014969 Ga0157376_10042383 Ga0157376_100423833 306
881 3300014969 Ga0157376_10129041 Ga0157376_101290412 306
882 3300014969 Ga0157376_10240571 Ga0157376_102405712 306
883 3300015262 Ga0182007_10009993 Ga0182007_100099932 306
884 3300015262 Ga0182007_10031769 Ga0182007_100317692 306
885 3300017792 Ga0163161_10046242 Ga0163161_100462422 306
886 3300017792 Ga0163161_10131379 Ga0163161_101313792 306
887 3300020070 Ga0206356_10235604 Ga0206356_102356046 306
888 3300020077 Ga0206351_10193420 Ga0206351_101934201 306
889 3300020081 Ga0206354_10341756 Ga0206354_103417565 306
890 3300020082 Ga0206353_10095998 Ga0206353_100959982 306
891 3300020610 Ga0154015_1244858 Ga0154015_12448586 306
892 3300020610 Ga0154015_1402022 Ga0154015_14020223 306
893 3300021358 Ga0213873_10024325 Ga0213873_100243252 306
894 3300021377 Ga0213874_10033033 Ga0213874_100330332 306
895 3300021384 Ga0213876_10011988 Ga0213876_100119884 306
896 3300021384 Ga0213876_10023781 Ga0213876_100237814 306
897 3300025226 Ga0209674_100003 Ga0209674_100003675 306
898 3300025226 Ga0209674_100751 Ga0209674_1007515 306
899 3300025230 Ga0209563_100010 Ga0209563_100010405 306
900 3300025231 Ga0207427_100117 Ga0207427_10011795 306
901 3300025231 Ga0207427_100178 Ga0207427_10017863 306
902 3300025233 Ga0209437_100240 Ga0209437_10024017 306
903 3300025233 Ga0209437_100304 Ga0209437_10030463 306
904 3300025250 Ga0209026_1000093 Ga0209026_100009326 306
905 3300025253 Ga0209677_100044 Ga0209677_100044110 306
906 3300025253 Ga0209677_102377 Ga0209677_1023774 306
907 3300025254 Ga0209148_1000114 Ga0209148_1000114112 306
908 3300025256 Ga0209759_1006844 Ga0209759_10068441 306
909 3300025261 Ga0209233_1000083 Ga0209233_1000083318 306
910 3300025261 Ga0209233_1000287 Ga0209233_100028715 306
911 3300025261 Ga0209233_1000417 Ga0209233_100041717 306
912 3300025263 Ga0209565_1000597 Ga0209565_100059729 306
913 3300025273 Ga0209673_1002473 Ga0209673_100247313 306
914 3300025292 Ga0209676_1000414 Ga0209676_100041481 306
915 3300025292 Ga0209676_1000971 Ga0209676_100097130 306
916 3300025295 Ga0209564_1005783 Ga0209564_10057832 306
917 3300025297 Ga0209758_1004353 Ga0209758_10043532 306
918 3300025298 Ga0209050_1001001 Ga0209050_100100135 306
919 3300025298 Ga0209050_1001040 Ga0209050_100104030 306
920 3300025299 Ga0209256_1013905 Ga0209256_10139053 306
921 3300025303 Ga0209051_1000354 Ga0209051_100035419 306
922 3300025303 Ga0209051_1001411 Ga0209051_10014118 306
923 3300025304 Ga0209257_1000186 Ga0209257_100018667 306
924 3300025304 Ga0209257_1000616 Ga0209257_100061631 306
925 3300025304 Ga0209257_1001656 Ga0209257_100165627 306
926 3300025315 Ga0207697_10000097 Ga0207697_1000009721 306
927 3300025315 Ga0207697_10010256 Ga0207697_100102562 306
928 3300025321 Ga0207656_10020861 Ga0207656_100208612 306
929 3300025321 Ga0207656_10029893 Ga0207656_100298933 306
930 3300025321 Ga0207656_10089236 Ga0207656_100892361 306
931 3300025893 Ga0207682_10000606 Ga0207682_100006063 306
932 3300025893 Ga0207682_10009513 Ga0207682_100095133 306
933 3300025901 Ga0207688_10000116 Ga0207688_1000011623 306
934 3300025903 Ga0207680_10017501 Ga0207680_100175015 306
935 3300025904 Ga0207647_10006674 Ga0207647_100066742 306
936 3300025904 Ga0207647_10008408 Ga0207647_100084087 306
937 3300025904 Ga0207647_10015485 Ga0207647_100154852 306
938 3300025904 Ga0207647_10064672 Ga0207647_100646722 306
939 3300025906 Ga0207699_10007949 Ga0207699_100079494 306
940 3300025907 Ga0207645_10000751 Ga0207645_1000075118 306
941 3300025908 Ga0207643_10000178 Ga0207643_1000017823 306
942 3300025908 Ga0207643_10073745 Ga0207643_100737452 306
943 3300025909 Ga0207705_10000146 Ga0207705_100001462 306
944 3300025909 Ga0207705_10003406 Ga0207705_1000340612 306
945 3300025909 Ga0207705_10003729 Ga0207705_100037296 306
946 3300025909 Ga0207705_10008884 Ga0207705_100088845 306
947 3300025909 Ga0207705_10020214 Ga0207705_100202143 306
948 3300025909 Ga0207705_10033292 Ga0207705_100332925 306
949 3300025912 Ga0207707_10000168 Ga0207707_100001689 306
950 3300025912 Ga0207707_10000215 Ga0207707_1000021540 306
951 3300025912 Ga0207707_10006842 Ga0207707_100068429 306
952 3300025912 Ga0207707_10006998 Ga0207707_100069986 306
953 3300025912 Ga0207707_10014027 Ga0207707_100140275 306
954 3300025912 Ga0207707_10033686 Ga0207707_100336864 306
955 3300025912 Ga0207707_10078805 Ga0207707_100788053 306
956 3300025912 Ga0207707_10110001 Ga0207707_101100012 306
957 3300025913 Ga0207695_10001799 Ga0207695_100017997 306
958 3300025913 Ga0207695_10015367 Ga0207695_100153678 306
959 3300025913 Ga0207695_10022510 Ga0207695_100225103 306
960 3300025913 Ga0207695_10027319 Ga0207695_100273196 306
961 3300025913 Ga0207695_10030192 Ga0207695_100301923 306
962 3300025913 Ga0207695_10035912 Ga0207695_100359126 306
963 3300025914 Ga0207671_10136168 Ga0207671_101361682 306
964 3300025914 Ga0207671_10217718 Ga0207671_102177182 306
965 3300025917 Ga0207660_10000227 Ga0207660_1000022726 306
966 3300025917 Ga0207660_10002134 Ga0207660_1000213411 306
967 3300025917 Ga0207660_10003818 Ga0207660_100038189 306
968 3300025917 Ga0207660_10083176 Ga0207660_100831762 306
969 3300025918 Ga0207662_10015909 Ga0207662_100159094 306
970 3300025919 Ga0207657_10001611 Ga0207657_100016113 306
971 3300025919 Ga0207657_10006429 Ga0207657_100064293 306
972 3300025919 Ga0207657_10006601 Ga0207657_100066017 306
973 3300025919 Ga0207657_10011673 Ga0207657_100116736 306
974 3300025919 Ga0207657_10015108 Ga0207657_100151089 306
975 3300025919 Ga0207657_10182020 Ga0207657_101820202 306
976 3300025919 Ga0207657_10342971 Ga0207657_103429712 306
977 3300025920 Ga0207649_10001798 Ga0207649_1000179810 306
978 3300025920 Ga0207649_10022398 Ga0207649_100223981 306
979 3300025920 Ga0207649_10029248 Ga0207649_100292483 306
980 3300025920 Ga0207649_10030793 Ga0207649_100307932 306
981 3300025920 Ga0207649_10054677 Ga0207649_100546772 306
982 3300025920 Ga0207649_10060806 Ga0207649_100608063 306
983 3300025920 Ga0207649_10173575 Ga0207649_101735752 306
984 3300025921 Ga0207652_10000158 Ga0207652_1000015858 306
985 3300025921 Ga0207652_10000956 Ga0207652_100009566 306
986 3300025921 Ga0207652_10004584 Ga0207652_100045848 306
987 3300025921 Ga0207652_10005330 Ga0207652_100053309 306
988 3300025921 Ga0207652_10028196 Ga0207652_100281964 306
989 3300025921 Ga0207652_10061330 Ga0207652_100613302 306
990 3300025921 Ga0207652_10129621 Ga0207652_101296212 306
991 3300025921 Ga0207652_10277873 Ga0207652_102778732 306
992 3300025923 Ga0207681_10022395 Ga0207681_100223955 306
993 3300025923 Ga0207681_10084941 Ga0207681_100849412 306
994 3300025923 Ga0207681_10136124 Ga0207681_101361242 306
995 3300025924 Ga0207694_10002683 Ga0207694_1000268314 306
996 3300025924 Ga0207694_10062475 Ga0207694_100624753 306
997 3300025924 Ga0207694_10138033 Ga0207694_101380331 306
998 3300025924 Ga0207694_10203323 Ga0207694_102033232 306
999 3300025925 Ga0207650_10000003 Ga0207650_10000003687 306
1000 3300025925 Ga0207650_10008403 Ga0207650_100084034 306
1001 3300025925 Ga0207650_10033415 Ga0207650_100334153 306
1002 3300025925 Ga0207650_10055555 Ga0207650_100555552 306
1003 3300025925 Ga0207650_10185133 Ga0207650_101851331 306
1004 3300025926 Ga0207659_10017662 Ga0207659_100176623 306
1005 3300025926 Ga0207659_10202659 Ga0207659_102026592 306
1006 3300025928 Ga0207700_10030366 Ga0207700_100303665 306
1007 3300025928 Ga0207700_10154748 Ga0207700_101547482 306
1008 3300025928 Ga0207700_10499686 Ga0207700_104996861 306
1009 3300025929 Ga0207664_10000036 Ga0207664_10000036101 306
1010 3300025929 Ga0207664_10001394 Ga0207664_100013948 306
1011 3300025929 Ga0207664_10029328 Ga0207664_100293284 306
1012 3300025929 Ga0207664_10051411 Ga0207664_100514113 306
1013 3300025931 Ga0207644_10000055 Ga0207644_1000005552 306
1014 3300025931 Ga0207644_10000272 Ga0207644_1000027235 306
1015 3300025931 Ga0207644_10003350 Ga0207644_1000335010 306
1016 3300025931 Ga0207644_10050006 Ga0207644_100500062 306
1017 3300025931 Ga0207644_10095215 Ga0207644_100952152 306
1018 3300025932 Ga0207690_10000839 Ga0207690_100008398 306
1019 3300025932 Ga0207690_10000957 Ga0207690_1000095720 306
1020 3300025932 Ga0207690_10002972 Ga0207690_100029728 306
1021 3300025932 Ga0207690_10016359 Ga0207690_100163592 306
1022 3300025932 Ga0207690_10041918 Ga0207690_100419182 306
1023 3300025932 Ga0207690_10197854 Ga0207690_101978541 306
1024 3300025933 Ga0207706_10000267 Ga0207706_1000026731 306
1025 3300025933 Ga0207706_10004822 Ga0207706_100048224 306
1026 3300025933 Ga0207706_10022681 Ga0207706_100226812 306
1027 3300025935 Ga0207709_10002291 Ga0207709_100022916 306
1028 3300025935 Ga0207709_10101806 Ga0207709_101018062 306
1029 3300025935 Ga0207709_10372408 Ga0207709_103724082 306
1030 3300025936 Ga0207670_10028630 Ga0207670_100286303 306
1031 3300025936 Ga0207670_10033733 Ga0207670_100337333 306
1032 3300025937 Ga0207669_10061952 Ga0207669_100619523 306
1033 3300025937 Ga0207669_10083924 Ga0207669_100839242 306
1034 3300025938 Ga0207704_10125238 Ga0207704_101252382 306
1035 3300025939 Ga0207665_10056330 Ga0207665_100563302 306
1036 3300025939 Ga0207665_10073092 Ga0207665_100730922 306
1037 3300025940 Ga0207691_10010387 Ga0207691_100103873 306
1038 3300025940 Ga0207691_10011417 Ga0207691_100114172 306
1039 3300025940 Ga0207691_10013709 Ga0207691_100137093 306
1040 3300025940 Ga0207691_10019796 Ga0207691_100197961 306
1041 3300025940 Ga0207691_10045931 Ga0207691_100459313 306
1042 3300025941 Ga0207711_10000855 Ga0207711_100008559 306
1043 3300025941 Ga0207711_10013434 Ga0207711_100134348 306
1044 3300025941 Ga0207711_10013551 Ga0207711_100135518 306
1045 3300025941 Ga0207711_10070317 Ga0207711_100703172 306
1046 3300025942 Ga0207689_10000289 Ga0207689_100002899 306
1047 3300025942 Ga0207689_10118439 Ga0207689_101184392 306
1048 3300025942 Ga0207689_10265165 Ga0207689_102651652 306
1049 3300025944 Ga0207661_10009656 Ga0207661_100096562 306
1050 3300025944 Ga0207661_10030731 Ga0207661_100307312 306
1051 3300025944 Ga0207661_10313935 Ga0207661_103139352 306
1052 3300025945 Ga0207679_10007563 Ga0207679_100075639 306
1053 3300025945 Ga0207679_10023274 Ga0207679_100232745 306
1054 3300025945 Ga0207679_10043417 Ga0207679_100434172 306
1055 3300025945 Ga0207679_10088413 Ga0207679_100884132 306
1056 3300025949 Ga0207667_10000007 Ga0207667_10000007277 306
1057 3300025949 Ga0207667_10001393 Ga0207667_1000139327 306
1058 3300025949 Ga0207667_10003714 Ga0207667_100037143 306
1059 3300025949 Ga0207667_10016531 Ga0207667_100165315 306
1060 3300025949 Ga0207667_10020707 Ga0207667_100207075 306
1061 3300025949 Ga0207667_10032515 Ga0207667_100325158 306
1062 3300025949 Ga0207667_10091006 Ga0207667_100910064 306
1063 3300025949 Ga0207667_10104865 Ga0207667_101048653 306
1064 3300025960 Ga0207651_10001867 Ga0207651_100018679 306
1065 3300025960 Ga0207651_10031395 Ga0207651_100313952 306
1066 3300025960 Ga0207651_10039497 Ga0207651_100394972 306
1067 3300025960 Ga0207651_10056704 Ga0207651_100567042 306
1068 3300025960 Ga0207651_10087761 Ga0207651_100877612 306
1069 3300025961 Ga0207712_10074461 Ga0207712_100744613 306
1070 3300025972 Ga0207668_10039433 Ga0207668_100394333 306
1071 3300025972 Ga0207668_10059489 Ga0207668_100594893 306
1072 3300025981 Ga0207640_10000291 Ga0207640_1000029133 306
1073 3300025981 Ga0207640_10006559 Ga0207640_100065593 306
1074 3300025981 Ga0207640_10006932 Ga0207640_100069326 306
1075 3300025981 Ga0207640_10017678 Ga0207640_100176785 306
1076 3300025981 Ga0207640_10101615 Ga0207640_101016152 306
1077 3300025981 Ga0207640_10132263 Ga0207640_101322632 306
1078 3300025986 Ga0207658_10000004 Ga0207658_10000004134 306
1079 3300025986 Ga0207658_10025984 Ga0207658_100259844 306
1080 3300026023 Ga0207677_10053833 Ga0207677_100538332 306
1081 3300026023 Ga0207677_10120548 Ga0207677_101205482 306
1082 3300026035 Ga0207703_10131295 Ga0207703_101312952 306
1083 3300026041 Ga0207639_10003476 Ga0207639_100034765 306
1084 3300026041 Ga0207639_10009437 Ga0207639_100094374 306
1085 3300026041 Ga0207639_10065211 Ga0207639_100652112 306
1086 3300026041 Ga0207639_10074999 Ga0207639_100749992 306
1087 3300026041 Ga0207639_10171253 Ga0207639_101712532 306
1088 3300026041 Ga0207639_10301140 Ga0207639_103011401 306
1089 3300026067 Ga0207678_10001471 Ga0207678_1000147121 306
1090 3300026067 Ga0207678_10001480 Ga0207678_100014802 306
1091 3300026067 Ga0207678_10001640 Ga0207678_100016409 306
1092 3300026067 Ga0207678_10004079 Ga0207678_100040797 306
1093 3300026067 Ga0207678_10007045 Ga0207678_1000704512 306
1094 3300026067 Ga0207678_10027423 Ga0207678_100274232 306
1095 3300026067 Ga0207678_10149634 Ga0207678_101496342 306
1096 3300026067 Ga0207678_10353405 Ga0207678_103534052 306
1097 3300026075 Ga0207708_10000668 Ga0207708_1000066811 306
1098 3300026075 Ga0207708_10017052 Ga0207708_100170525 306
1099 3300026075 Ga0207708_10041195 Ga0207708_100411953 306
1100 3300026075 Ga0207708_10119680 Ga0207708_101196802 306
1101 3300026078 Ga0207702_10001776 Ga0207702_1000177620 306
1102 3300026078 Ga0207702_10002471 Ga0207702_100024718 306
1103 3300026078 Ga0207702_10002683 Ga0207702_100026837 306
1104 3300026078 Ga0207702_10004484 Ga0207702_100044848 306
1105 3300026078 Ga0207702_10008817 Ga0207702_1000881710 306
1106 3300026078 Ga0207702_10026919 Ga0207702_100269192 306
1107 3300026078 Ga0207702_10311971 Ga0207702_103119712 306
1108 3300026088 Ga0207641_10012760 Ga0207641_100127603 306
1109 3300026088 Ga0207641_10041063 Ga0207641_100410633 306
1110 3300026088 Ga0207641_10052892 Ga0207641_100528922 306
1111 3300026088 Ga0207641_10055781 Ga0207641_100557813 306
1112 3300026088 Ga0207641_10134443 Ga0207641_101344432 306
1113 3300026088 Ga0207641_10347728 Ga0207641_103477282 306
1114 3300026089 Ga0207648_10002794 Ga0207648_100027948 306
1115 3300026089 Ga0207648_10028635 Ga0207648_100286353 306
1116 3300026089 Ga0207648_10040163 Ga0207648_100401633 306
1117 3300026095 Ga0207676_10000003 Ga0207676_10000003408 306
1118 3300026095 Ga0207676_10002722 Ga0207676_1000272214 306
1119 3300026095 Ga0207676_10048100 Ga0207676_100481003 306
1120 3300026095 Ga0207676_10115176 Ga0207676_101151762 306
1121 3300026095 Ga0207676_10211234 Ga0207676_102112343 306
1122 3300026116 Ga0207674_10000039 Ga0207674_1000003929 306
1123 3300026116 Ga0207674_10005001 Ga0207674_1000500111 306
1124 3300026116 Ga0207674_10007751 Ga0207674_100077513 306
1125 3300026116 Ga0207674_10008565 Ga0207674_100085656 306
1126 3300026116 Ga0207674_10041750 Ga0207674_100417502 306
1127 3300026118 Ga0207675_100003529 Ga0207675_10000352913 306
1128 3300026118 Ga0207675_100007814 Ga0207675_1000078145 306
1129 3300026118 Ga0207675_100037403 Ga0207675_1000374034 306
1130 3300026118 Ga0207675_100045722 Ga0207675_1000457224 306
1131 3300026118 Ga0207675_100153901 Ga0207675_1001539012 306
1132 3300026118 Ga0207675_100161405 Ga0207675_1001614052 306
1133 3300026118 Ga0207675_100185942 Ga0207675_1001859423 306
1134 3300026118 Ga0207675_100231854 Ga0207675_1002318542 306
1135 3300026121 Ga0207683_10004053 Ga0207683_100040536 306
1136 3300026121 Ga0207683_10028344 Ga0207683_100283445 306
1137 3300026121 Ga0207683_10028751 Ga0207683_100287513 306
1138 3300026121 Ga0207683_10043033 Ga0207683_100430335 306
1139 3300026121 Ga0207683_10145620 Ga0207683_101456202 306
1140 3300026142 Ga0207698_10000511 Ga0207698_1000051116 306
1141 3300026142 Ga0207698_10000772 Ga0207698_1000077215 306
1142 3300026142 Ga0207698_10005977 Ga0207698_100059776 306
1143 3300026142 Ga0207698_10007308 Ga0207698_100073087 306
1144 3300026142 Ga0207698_10271249 Ga0207698_102712492 306
1145 3300027360 Ga0209969_1002467 Ga0209969_10024672 306
1146 3300027360 Ga0209969_1004138 Ga0209969_10041382 306
1147 3300027424 Ga0209984_1006643 Ga0209984_10066432 306
1148 3300027526 Ga0209968_1004405 Ga0209968_10044051 306
1149 3300027543 Ga0209999_1024095 Ga0209999_10240952 306
1150 3300027617 Ga0210002_1009435 Ga0210002_10094352 306
1151 3300027665 Ga0209983_1029795 Ga0209983_10297951 306
1152 3300027682 Ga0209971_1001702 Ga0209971_10017022 306
1153 3300027682 Ga0209971_1005689 Ga0209971_10056892 306
1154 3300027876 Ga0209974_10009957 Ga0209974_100099573 306
1155 3300027876 Ga0209974_10014761 Ga0209974_100147612 306
1156 3300028379 Ga0268266_10002350 Ga0268266_1000235022 306
1157 3300028379 Ga0268266_10021331 Ga0268266_100213313 306
1158 3300028379 Ga0268266_10081031 Ga0268266_100810313 306
1159 3300028380 Ga0268265_10004150 Ga0268265_100041506 306
1160 3300028381 Ga0268264_10000016 Ga0268264_10000016182 306
1161 3300028381 Ga0268264_10036457 Ga0268264_100364574 306
1162 3300028381 Ga0268264_10111651 Ga0268264_101116513 306
1163 3300028381 Ga0268264_10150826 Ga0268264_101508261 306
1164 3300028573 Ga0265334_10033440 Ga0265334_100334402 306
1165 3300028666 Ga0265336_10000008 Ga0265336_1000000862 306
1166 3300028794 Ga0307515_10073692 Ga0307515_100736925 306
1167 3300030521 Ga0307511_10173324 Ga0307511_101733241 306
1168 3300031247 Ga0265340_10010905 Ga0265340_100109055 306
1169 3300031456 Ga0307513_10009214 Ga0307513_100092144 306
1170 3300031456 Ga0307513_10025641 Ga0307513_100256414 306
1171 3300031456 Ga0307513_10031639 Ga0307513_100316394 306
1172 3300031507 Ga0307509_10040026 Ga0307509_100400263 306
1173 3300031507 Ga0307509_10175361 Ga0307509_101753612 306
1174 3300031548 Ga0307408_100016400 Ga0307408_1000164002 306
1175 3300031595 Ga0265313_10062816 Ga0265313_100628162 306
1176 3300031712 Ga0265342_10000896 Ga0265342_1000089610 306
1177 3300031852 Ga0307410_10033725 Ga0307410_100337252 306
1178 3300031852 Ga0307410_10053878 Ga0307410_100538782 306
1179 3300031901 Ga0307406_10125922 Ga0307406_101259222 306
1180 3300031995 Ga0307409_100002862 Ga0307409_1000028627 306
1181 3300031995 Ga0307409_100028252 Ga0307409_1000282526 306
1182 3300031995 Ga0307409_100132612 Ga0307409_1001326122 306
1183 3300031995 Ga0307409_100302238 Ga0307409_1003022382 306
1184 3300032002 Ga0307416_100043067 Ga0307416_1000430673 306
1185 3300032002 Ga0307416_100129481 Ga0307416_1001294813 306
1186 3300032004 Ga0307414_10078692 Ga0307414_100786923 306
1187 3300032005 Ga0307411_10003060 Ga0307411_100030603 306
1188 3300035086 Ga0373934_0052308 Ga0373934_0052308_590_1525 306
1189 3300035089 Ga0373944_0021727 Ga0373944_0021727_398_1324 306
1190 3300035118 Ga0373954_0015620 Ga0373954_0015620_2150_3085 306
1191 3300035119 Ga0373956_0088997 Ga0373956_0088997_469_1398 306
1192 3300035120 Ga0373957_0021645 Ga0373957_0021645_126_1061 306
1193 3300035171 Ga0373946_0058209 Ga0373946_0058209_507_1433 306
1194 3300035172 Ga0373955_0042797 Ga0373955_0042797_214_1149 306
1195 3300035172 Ga0373955_0063169 Ga0373955_0063169_556_1485 306
1196 3300035410 Ga0373924_0032456 Ga0373924_0032456_692_1627 306
1197 3300035695 Ga0373927_0000615 Ga0373927_0000615_6438_7364 306
1198 3300035724 Ga0373933_0035998 Ga0373933_0035998_1854_2789 306
1199 3300036401 Ga0373937_0065983 Ga0373937_0065983_1040_1975 306
1200 3300036712 Ga0316584_0030295 Ga0316584_0030295_2445_3437 306
1201 3300037068 Ga0373925_0000278 Ga0373925_0000278_2295_3221 306
1202 3300037312 Ga0395899_0015844 Ga0395899_0015844_802_1728 306
1203 3300037312 Ga0395899_0081700 Ga0395899_0081700_926_1885 306
1204 3300037418 Ga0395900_0004593 Ga0395900_0004593_674_1600 306
1205 3300037418 Ga0395900_0022152 Ga0395900_0022152_4916_5842 306
1206 3300037418 Ga0395900_0045251 Ga0395900_0045251_71_1030 306
1207 3300037418 Ga0395900_0319660 Ga0395900_0319660_309_1235 306
1208 3300037466 Ga0395898_0000485 Ga0395898_0000485_28572_29501 306
1209 3300037466 Ga0395898_0042918 Ga0395898_0042918_3026_3985 306
1210 3300037466 Ga0395898_0188804 Ga0395898_0188804_57_1004 306
1211 3300037471 Ga0395905_0048902 Ga0395905_0048902_1222_2154 306
1212 3300038443 Ga0395901_0000913 Ga0395901_0000913_26623_27570 306
1213 3300038443 Ga0395901_0003975 Ga0395901_0003975_5318_6244 306
1214 3300038443 Ga0395901_0030354 Ga0395901_0030354_3383_4309 306
1215 3300038443 Ga0395901_0177660 Ga0395901_0177660_1186_2112 306
1216 3300038443 Ga0395901_0182239 Ga0395901_0182239_821_1753 306
1217 3300039437 Ga0436365_0871778 Ga0436365_0871778_6144_7082 306
1218 3300039438 Ga0436360_0701846 Ga0436360_0701846_1396_2337 306
1219 3300039438 Ga0436360_1373761 Ga0436360_1373761_589_1524 306
1220 3300039447 Ga0436361_1117061 Ga0436361_1117061_112_1089 306
1221 3300039450 Ga0436363_1399761 Ga0436363_1399761_6014_6973 306
1222 3300042003 Ga0439443_006540 Ga0439443_006540_443_1366 306
1223 3300042006 Ga0439432_044976 Ga0439432_044976_360_1286 306
1224 3300042115 Ga0450911_000006 Ga0450911_000006_164968_165891 306
1225 3300042156 Ga0439446_0027405 Ga0439446_0027405_305_1228 306
1226 3300044656 Ga0466969_0000992 Ga0466969_0000992_3146_4078 306
1227 3300044684 Ga0466966_0002380 Ga0466966_0002380_1602_2534 306
1228 3300044693 Ga0466961_0000220 Ga0466961_0000220_3676_4608 306
1229 3300044694 Ga0466963_0106828 Ga0466963_0106828_43_1026 306
1230 3300044706 Ga0466964_0012863 Ga0466964_0012863_1517_2449 306
1231 3300044712 Ga0453684_0005726 Ga0453684_0005726_11455_12417 306
1232 3300044719 Ga0466971_0002396 Ga0466971_0002396_3838_4770 306
1233 3300044765 Ga0466970_0001995 Ga0466970_0001995_1425_2357 306
1234 3300044842 Ga0466957_0029399 Ga0466957_0029399_775_1707 306
1235 3300044842 Ga0466957_0140031 Ga0466957_0140031_138_1121 306
1236 3300045049 Ga0466959_0000847 Ga0466959_0000847_7123_8067 306
1237 3300045049 Ga0466959_0009479 Ga0466959_0009479_3146_4078 306
1238 3300045836 Ga0466958_0114592 Ga0466958_0114592_138_1121 306
1239 3300045976 Ga0466967_0043468 Ga0466967_0043468_2636_3619 306
1240 3300045976 Ga0466967_0316416 Ga0466967_0316416_264_1247 306
1241 3300046457 Ga0495590_0006992 Ga0495590_0006992_2197_3129 306
1242 3300046457 Ga0495590_0093949 Ga0495590_0093949_20_946 306
1243 3300046460 Ga0495638_0000728 Ga0495638_0000728_22833_23756 306
1244 3300046460 Ga0495638_0001464 Ga0495638_0001464_18133_19056 306
1245 3300046460 Ga0495638_0005121 Ga0495638_0005121_526_1449 306
1246 3300046460 Ga0495638_0007439 Ga0495638_0007439_6543_7466 306
1247 3300046460 Ga0495638_0040718 Ga0495638_0040718_884_1816 306
1248 3300046471 Ga0495650_0000024 Ga0495650_0000024_239400_240323 306
1249 3300046471 Ga0495650_0077945 Ga0495650_0077945_30_959 306
1250 3300046492 Ga0495585_0085265 Ga0495585_0085265_534_1460 306
1251 3300046506 Ga0495583_0000149 Ga0495583_0000149_80013_80942 306
1252 3300046507 Ga0495606_0002446 Ga0495606_0002446_17801_18730 306
1253 3300046512 Ga0495610_0000465 Ga0495610_0000465_10927_11850 306
1254 3300046513 Ga0495616_0016634 Ga0495616_0016634_3051_3983 306
1255 3300046513 Ga0495616_0019285 Ga0495616_0019285_2183_3106 306
1256 3300046515 Ga0495620_0016023 Ga0495620_0016023_2405_3331 306
1257 3300046519 Ga0495632_0004886 Ga0495632_0004886_7513_8436 306
1258 3300046519 Ga0495632_0019802 Ga0495632_0019802_835_1758 306
1259 3300046519 Ga0495632_0065291 Ga0495632_0065291_12_944 306
1260 3300046523 Ga0495644_0111145 Ga0495644_0111145_81_1004 306
1261 3300046524 Ga0495648_0100364 Ga0495648_0100364_238_1161 306
1262 3300046530 Ga0495654_0000226 Ga0495654_0000226_7137_8060 306
1263 3300046536 Ga0495587_0014439 Ga0495587_0014439_3864_4793 306
1264 3300046536 Ga0495587_0191616 Ga0495587_0191616_136_1071 306
1265 3300046542 Ga0495597_0017049 Ga0495597_0017049_1077_2003 306
1266 3300046559 Ga0495667_0020228 Ga0495667_0020228_95_1030 306
1267 3300046616 Ga0495668_0000141 Ga0495668_0000141_22135_23061 306
1268 3300046616 Ga0495668_0007336 Ga0495668_0007336_5884_6807 306
1269 3300046660 Ga0495625_0036300 Ga0495625_0036300_2366_3289 306
1270 3300046660 Ga0495625_0042417 Ga0495625_0042417_438_1364 306
1271 3300046660 Ga0495625_0116865 Ga0495625_0116865_417_1349 306
1272 3300046660 Ga0495625_0130092 Ga0495625_0130092_317_1243 306
1273 3300046675 Ga0495657_0022358 Ga0495657_0022358_491_1426 306
1274 3300046675 Ga0495657_0089723 Ga0495657_0089723_675_1601 306
1275 3300046679 Ga0495623_0039267 Ga0495623_0039267_2031_2966 306
1276 3300046694 Ga0495649_0000396 Ga0495649_0000396_19451_20380 306
1277 3300046794 Ga0495589_0024889 Ga0495589_0024889_1213_2142 306
1278 3300046809 Ga0495600_0025908 Ga0495600_0025908_186_1121 306
1279 3300046810 Ga0495660_0005715 Ga0495660_0005715_6117_7040 306
1280 3300047320 Ga0495672_0128180 Ga0495672_0128180_256_1179 306
1281 3300047322 Ga0495680_0042645 Ga0495680_0042645_2516_3451 306
1282 3300047323 Ga0495683_0077491 Ga0495683_0077491_435_1364 306
1283 3300047444 Ga0495675_0090651 Ga0495675_0090651_564_1499 306
1284 3300047470 Ga0495681_0079948 Ga0495681_0079948_142_1065 306
1285 3300047471 Ga0495684_0078492 Ga0495684_0078492_816_1745 306
1286 3300048088 Ga0495602_0044383 Ga0495602_0044383_2913_3848 306
1287 3300048088 Ga0495602_0374641 Ga0495602_0374641_49_978 306
1288 3300048903 Ga0496100_0102199 Ga0496100_0102199_1019_1945 306
1289 3300048903 Ga0496100_0216104 Ga0496100_0216104_413_1339 306
1290 3300048904 Ga0496101_0015659 Ga0496101_0015659_1354_2280 306
1291 3300048904 Ga0496101_0017706 Ga0496101_0017706_2801_3727 306
1292 3300048904 Ga0496101_0022049 Ga0496101_0022049_2038_2964 306
1293 3300048904 Ga0496101_0279814 Ga0496101_0279814_157_1110 306
1294 3300048905 Ga0496102_0039951 Ga0496102_0039951_3011_3991 306
1295 3300048905 Ga0496102_0047630 Ga0496102_0047630_759_1685 306
1296 3300048905 Ga0496102_0250431 Ga0496102_0250431_90_1016 306
1297 3300048906 Ga0496103_0040376 Ga0496103_0040376_1654_2580 306
1298 3300048906 Ga0496103_0129682 Ga0496103_0129682_290_1216 306
1299 3300048907 Ga0496104_0032285 Ga0496104_0032285_3683_4609 306
1300 3300048907 Ga0496104_0055115 Ga0496104_0055115_1299_2225 306
1301 3300048907 Ga0496104_0186776 Ga0496104_0186776_877_1803 306
1302 3300048908 Ga0496105_0019536 Ga0496105_0019536_3699_4625 306
1303 3300048908 Ga0496105_0292398 Ga0496105_0292398_154_1080 306
1304 3300048909 Ga0496106_0047561 Ga0496106_0047561_565_1491 306
1305 3300048909 Ga0496106_0063844 Ga0496106_0063844_1305_2285 306
1306 3300048909 Ga0496106_0271146 Ga0496106_0271146_257_1258 306
1307 3300048910 Ga0496107_0000214 Ga0496107_0000214_24233_25156 306
1308 3300048910 Ga0496107_0019860 Ga0496107_0019860_3012_3938 306
1309 3300048910 Ga0496107_0077760 Ga0496107_0077760_1302_2228 306
1310 3300048911 Ga0496108_0003688 Ga0496108_0003688_10017_10943 306
1311 3300048911 Ga0496108_0016259 Ga0496108_0016259_5106_6032 306
1312 3300048911 Ga0496108_0126533 Ga0496108_0126533_51_1001 306
1313 3300048911 Ga0496108_0384164 Ga0496108_0384164_212_1192 306
1314 3300048912 Ga0496109_0001865 Ga0496109_0001865_8883_9809 306
1315 3300048912 Ga0496109_0048552 Ga0496109_0048552_1168_2094 306
1316 3300048912 Ga0496109_0091181 Ga0496109_0091181_1153_2079 306
1317 3300048912 Ga0496109_0188056 Ga0496109_0188056_789_1769 306
1318 3300048912 Ga0496109_0212961 Ga0496109_0212961_163_1089 306
1319 3300048913 Ga0496110_0012559 Ga0496110_0012559_2966_3892 306
1320 3300048913 Ga0496110_0077735 Ga0496110_0077735_1831_2757 306
1321 3300048913 Ga0496110_0150420 Ga0496110_0150420_1073_1999 306
1322 3300048913 Ga0496110_0457692 Ga0496110_0457692_166_1095 306
1323 3300048914 Ga0496111_0022773 Ga0496111_0022773_1478_2404 306
1324 3300048915 Ga0496112_0027176 Ga0496112_0027176_4290_5216 306
1325 3300048915 Ga0496112_0175465 Ga0496112_0175465_1150_2076 306
1326 3300048915 Ga0496112_0453340 Ga0496112_0453340_32_958 306
1327 3300048917 Ga0496114_0098484 Ga0496114_0098484_260_1240 306
1328 3300048917 Ga0496114_0136746 Ga0496114_0136746_914_1840 306
1329 3300048917 Ga0496114_0352639 Ga0496114_0352639_154_1080 306
1330 3300048918 Ga0496115_0197088 Ga0496115_0197088_535_1461 306
1331 3300048918 Ga0496115_0271290 Ga0496115_0271290_146_1072 306
1332 3300048920 Ga0496117_0040086 Ga0496117_0040086_911_1837 306
1333 3300048920 Ga0496117_0054532 Ga0496117_0054532_880_1806 306
1334 3300048921 Ga0496118_0003890 Ga0496118_0003890_7632_8558 306
1335 3300048921 Ga0496118_0029873 Ga0496118_0029873_407_1333 306
1336 3300048924 Ga0496121_0000021 Ga0496121_0000021_167685_168611 306
1337 3300048924 Ga0496121_0000042 Ga0496121_0000042_179057_179983 306
1338 3300048927 Ga0496124_0088371 Ga0496124_0088371_1361_2287 306
1339 3300048928 Ga0496125_0029699 Ga0496125_0029699_2470_3459 306
1340 3300048929 Ga0496126_0021905 Ga0496126_0021905_4950_5939 306
1341 3300048929 Ga0496126_0305946 Ga0496126_0305946_347_1273 306
1342 3300049568 Ga0501031_0036277 Ga0501031_0036277_250_1176 306
1343 3300049570 Ga0501033_0016780 Ga0501033_0016780_186_1112 306
1344 3300049571 Ga0501034_0043094 Ga0501034_0043094_349_1275 306
1345 3300049571 Ga0501034_0046443 Ga0501034_0046443_2597_3523 306
1346 3300049571 Ga0501034_0056312 Ga0501034_0056312_461_1387 306
1347 3300049572 Ga0501036_0140941 Ga0501036_0140941_932_1858 306
1348 3300049574 Ga0501038_0009310 Ga0501038_0009310_1348_2274 306
1349 3300049574 Ga0501038_0023889 Ga0501038_0023889_4242_5177 306
1350 3300049574 Ga0501038_0087373 Ga0501038_0087373_608_1534 306
1351 3300049575 Ga0501039_0235261 Ga0501039_0235261_164_1090 306
1352 3300049575 Ga0501039_0265879 Ga0501039_0265879_274_1200 306
1353 3300049578 Ga0501042_0000054 Ga0501042_0000054_38450_39463 306
1354 3300049578 Ga0501042_0120352 Ga0501042_0120352_498_1421 306
1355 3300049579 Ga0501043_0112989 Ga0501043_0112989_488_1540 306
1356 3300049580 Ga0501046_0000108 Ga0501046_0000108_64965_65891 306
1357 3300049581 Ga0501047_0002839 Ga0501047_0002839_4050_4985 306
1358 3300049581 Ga0501047_0019890 Ga0501047_0019890_3382_4308 306
1359 3300049581 Ga0501047_0021564 Ga0501047_0021564_3827_4753 306
1360 3300049581 Ga0501047_0060215 Ga0501047_0060215_2063_2989 306
1361 3300049581 Ga0501047_0176192 Ga0501047_0176192_205_1131 306
1362 3300049583 Ga0501067_0114492 Ga0501067_0114492_348_1274 306
1363 3300049585 Ga0501069_0101362 Ga0501069_0101362_43_1014 306
1364 3300049585 Ga0501069_0185100 Ga0501069_0185100_198_1169 306
1365 3300049585 Ga0501069_0217959 Ga0501069_0217959_69_1040 306
1366 3300049586 Ga0501070_0000102 Ga0501070_0000102_5025_5996 306
1367 3300049586 Ga0501070_0044639 Ga0501070_0044639_644_1567 306
1368 3300049586 Ga0501070_0051997 Ga0501070_0051997_1081_2052 306
1369 3300049586 Ga0501070_0058239 Ga0501070_0058239_469_1521 306
1370 3300049586 Ga0501070_0173712 Ga0501070_0173712_393_1364 306
1371 3300049586 Ga0501070_0352055 Ga0501070_0352055_87_1013 306
1372 3300049586 Ga0501070_0423843 Ga0501070_0423843_51_974 306
1373 3300049587 Ga0501071_0018432 Ga0501071_0018432_341_1300 306
1374 3300049587 Ga0501071_0139032 Ga0501071_0139032_662_1585 306
1375 3300049589 Ga0501073_0051133 Ga0501073_0051133_100_1026 306
1376 3300049591 Ga0501075_0036165 Ga0501075_0036165_2565_3488 306
1377 3300049741 Ga0501079_0041115 Ga0501079_0041115_2203_3126 306
1378 3300049741 Ga0501079_0145936 Ga0501079_0145936_350_1321 306
1379 3300049742 Ga0501080_0015766 Ga0501080_0015766_1407_2333 306
1380 3300049742 Ga0501080_0016767 Ga0501080_0016767_532_1458 306
1381 3300049742 Ga0501080_0022903 Ga0501080_0022903_753_1724 306
1382 3300049742 Ga0501080_0207020 Ga0501080_0207020_171_1094 306
1383 3300049744 Ga0501083_0044708 Ga0501083_0044708_1078_2004 306
1384 3300049822 Ga0501035_0003292 Ga0501035_0003292_9886_10812 306
1385 3300049822 Ga0501035_0057698 Ga0501035_0057698_830_1756 306
1386 3300049822 Ga0501035_0059231 Ga0501035_0059231_2149_3120 306
1387 3300049822 Ga0501035_0069916 Ga0501035_0069916_1800_2852 306
1388 3300049822 Ga0501035_0078600 Ga0501035_0078600_365_1291 306
1389 3300049822 Ga0501035_0383847 Ga0501035_0383847_116_1042 306
1390 3300049823 Ga0501044_0002339 Ga0501044_0002339_1873_2799 306
1391 3300049823 Ga0501044_0024481 Ga0501044_0024481_4992_5918 306
1392 3300049823 Ga0501044_0045879 Ga0501044_0045879_596_1567 306
1393 3300049823 Ga0501044_0053284 Ga0501044_0053284_666_1592 306
1394 3300049823 Ga0501044_0085608 Ga0501044_0085608_2186_3121 306
1395 3300049823 Ga0501044_0092573 Ga0501044_0092573_786_1838 306
1396 3300050491 nmdc:mga00v17_36848_c2 nmdc:mga00v17_36848_c2_529_1509 306
1397 3300050496 nmdc:mga07m45_119838_c1 nmdc:mga07m45_119838_c1_35_961 306
1398 3300050496 nmdc:mga07m45_85713_c1 nmdc:mga07m45_85713_c1_312_1235 306
1399 3300050511 nmdc:mga08y16_50166_c1 nmdc:mga08y16_50166_c1_553_1479 306
1400 3300050513 nmdc:mga0rr50_222830_c1 nmdc:mga0rr50_222830_c1_340_1260 306
1401 3300050513 nmdc:mga0rr50_300447_c1 nmdc:mga0rr50_300447_c1_238_1173 306
1402 3300053077 Ga0495601_0051546 Ga0495601_0051546_279_1214 306
1403 3300053077 Ga0495601_0260732 Ga0495601_0260732_59_988 306
1404 3300053078 Ga0495612_0025055 Ga0495612_0025055_508_1443 306
1405 3300053080 Ga0500635_0000140 Ga0500635_0000140_3191_4120 306
1406 3300053083 Ga0495655_0000320 Ga0495655_0000320_7558_8484 306
1407 3300053084 Ga0495595_0007105 Ga0495595_0007105_3019_3954 306
1408 3300053085 Ga0495619_0015975 Ga0495619_0015975_3630_4565 306
1409 3300053087 Ga0500643_001428 Ga0500643_001428_3435_4358 306
1410 3300053087 Ga0500643_037967 Ga0500643_037967_39_971 306
1411 3300053104 Ga0500556_0001879 Ga0500556_0001879_503_1426 306
1412 3300053108 Ga0500562_000497 Ga0500562_000497_2150_3076 306
1413 3300053130 Ga0500642_0083140 Ga0500642_0083140_95_1021 306
1414 3300053136 Ga0500559_0021028 Ga0500559_0021028_1784_2710 306
1415 3300053139 Ga0500568_0016301 Ga0500568_0016301_1061_2008 306
1416 3300053156 Ga0500622_0020591 Ga0500622_0020591_270_1196 306
1417 3300053157 Ga0500624_000075 Ga0500624_000075_795_1721 306
1418 3300053177 Ga0500636_0000055 Ga0500636_0000055_52573_53502 306
1419 3300053178 Ga0500637_0000681 Ga0500637_0000681_11821_12747 306
1420 3300053729 Ga0500625_009792 Ga0500625_009792_304_1233 306
1421 3300053730 Ga0500645_001003 Ga0500645_001003_7770_8693 306
1422 3300053731 Ga0500609_001387 Ga0500609_001387_2533_3456 306
1423 3300060353 Ga0501082_0006095 Ga0501082_0006095_2491_3417 306
1424 3300061719 Ga0466962_0000555 Ga0466962_0000555_9453_10385 306
1425 iso_pu_bacteria 2519103095 2519460345 306
1426 iso_pu_bacteria 2524614729 2525558312 306
1427 iso_pu_bacteria 2582581311 2585292648 306
1428 iso_pu_bacteria 2585428062 2587759172 306
1429 iso_pu_bacteria 2599185240 2599747260 306
1430 iso_pu_bacteria 2599185355 2600209115 306
1431 iso_pu_bacteria 2627854209 2630650300 306
1432 iso_pu_bacteria 2675903129 2676745144 306
1433 iso_pu_bacteria 2816332253 2817257863 306
1434 iso_pu_bacteria 2816332286 2817455998 306
1435 iso_pu_bacteria 2863421361 2863427857 306
1436 iso_pu_bacteria 2870068957 2870073562 306
1437 iso_pu_bacteria 2904564687 2904567559 306
1438 iso_pu_bacteria 2904571731 2904574604 306
1439 iso_pu_bacteria 2928157003 2928158354 306
1440 iso_pu_bacteria 2928163908 2928167442 306
1441 iso_pu_bacteria 2928536128 2928540281 306
1442 iso_pu_bacteria 2981990288 2981991815 306
1443 iso_pu_bacteria 641736154 642417434 306
1444 iso_pu_bacteria 8020938398 8020941215 306
1445 iso_pu_bacteria 8020945358 8020946740 306
1446 iso_pu_bacteria 8020953355 8020958469 306
1447 iso_pu_bacteria 8039098773 8039100380 306
1448 iso_pu_bacteria 8040167225 8040170759 306
1449 3300001915 JGI24741J21665_1000867 JGI24741J21665_10008676 307
1450 3300001979 JGI24740J21852_10002444 JGI24740J21852_100024445 307
1451 3300001989 JGI24739J22299_10003964 JGI24739J22299_100039642 307
1452 3300001990 JGI24737J22298_10004736 JGI24737J22298_100047363 307
1453 3300002067 JGI24735J21928_10001752 JGI24735J21928_100017522 307
1454 3300002705 JGI25156J39149_1000673 JGI25156J39149_10006735 307
1455 3300002705 JGI25156J39149_1002242 JGI25156J39149_10022422 307
1456 3300002737 JGI25162J39368_1000971 JGI25162J39368_100097117 307
1457 3300002738 JGI25154J39366_1001421 JGI25154J39366_10014219 307
1458 3300002741 JGI25157J39369_1000075 JGI25157J39369_100007539 307
1459 3300002741 JGI25157J39369_1000772 JGI25157J39369_10007728 307
1460 3300003752 Ga0055539_1002563 Ga0055539_10025632 307
1461 3300003759 Ga0055525_1000089 Ga0055525_100008993 307
1462 3300003760 Ga0055527_1000084 Ga0055527_100008446 307
1463 3300003760 Ga0055527_1000206 Ga0055527_100020613 307
1464 3300003761 Ga0055535_1000426 Ga0055535_100042627 307
1465 3300003761 Ga0055535_1000639 Ga0055535_10006394 307
1466 3300003761 Ga0055535_1000728 Ga0055535_100072814 307
1467 3300003762 Ga0055542_1000057 Ga0055542_1000057124 307
1468 3300003762 Ga0055542_1000107 Ga0055542_100010752 307
1469 3300003762 Ga0055542_1000195 Ga0055542_100019527 307
1470 3300003762 Ga0055542_1000455 Ga0055542_100045513 307
1471 3300003763 Ga0055529_1000460 Ga0055529_100046027 307
1472 3300003763 Ga0055529_1000881 Ga0055529_10008814 307
1473 3300003781 Ga0055536_1008702 Ga0055536_10087023 307
1474 3300003794 Ga0055531_10013622 Ga0055531_100136223 307
1475 3300005290 Ga0065712_10084506 Ga0065712_100845063 307
1476 3300005327 Ga0070658_10003530 Ga0070658_1000353015 307
1477 3300005327 Ga0070658_10005606 Ga0070658_100056062 307
1478 3300005327 Ga0070658_10070760 Ga0070658_100707603 307
1479 3300005327 Ga0070658_10136788 Ga0070658_101367883 307
1480 3300005329 Ga0070683_100024660 Ga0070683_1000246605 307
1481 3300005329 Ga0070683_100037375 Ga0070683_1000373755 307
1482 3300005334 Ga0068869_100049779 Ga0068869_1000497792 307
1483 3300005336 Ga0070680_100128398 Ga0070680_1001283982 307
1484 3300005336 Ga0070680_100197564 Ga0070680_1001975642 307
1485 3300005336 Ga0070680_100204475 Ga0070680_1002044751 307
1486 3300005336 Ga0070680_100249745 Ga0070680_1002497451 307
1487 3300005337 Ga0070682_100003586 Ga0070682_1000035864 307
1488 3300005339 Ga0070660_100000378 Ga0070660_1000003788 307
1489 3300005339 Ga0070660_100031954 Ga0070660_1000319544 307
1490 3300005344 Ga0070661_100006538 Ga0070661_1000065387 307
1491 3300005344 Ga0070661_100094016 Ga0070661_1000940163 307
1492 3300005344 Ga0070661_100143156 Ga0070661_1001431562 307
1493 3300005344 Ga0070661_100163917 Ga0070661_1001639172 307
1494 3300005345 Ga0070692_10022026 Ga0070692_100220264 307
1495 3300005353 Ga0070669_100025109 Ga0070669_1000251091 307
1496 3300005354 Ga0070675_100027074 Ga0070675_1000270744 307
1497 3300005355 Ga0070671_100304496 Ga0070671_1003044962 307
1498 3300005366 Ga0070659_100029716 Ga0070659_1000297161 307
1499 3300005366 Ga0070659_100082379 Ga0070659_1000823792 307
1500 3300005366 Ga0070659_100083949 Ga0070659_1000839493 307
1501 3300005367 Ga0070667_100152524 Ga0070667_1001525243 307
1502 3300005367 Ga0070667_100287926 Ga0070667_1002879262 307
1503 3300005436 Ga0070713_100027496 Ga0070713_1000274964 307
1504 3300005455 Ga0070663_100010569 Ga0070663_1000105691 307
1505 3300005455 Ga0070663_100017483 Ga0070663_1000174832 307
1506 3300005455 Ga0070663_100056714 Ga0070663_1000567143 307
1507 3300005455 Ga0070663_100087373 Ga0070663_1000873732 307
1508 3300005455 Ga0070663_100206060 Ga0070663_1002060602 307
1509 3300005457 Ga0070662_100038980 Ga0070662_1000389802 307
1510 3300005458 Ga0070681_10313016 Ga0070681_103130161 307
1511 3300005466 Ga0070685_10202572 Ga0070685_102025721 307
1512 3300005530 Ga0070679_100015243 Ga0070679_1000152434 307
1513 3300005530 Ga0070679_100222455 Ga0070679_1002224552 307
1514 3300005539 Ga0068853_100212350 Ga0068853_1002123502 307
1515 3300005547 Ga0070693_100082785 Ga0070693_1000827851 307
1516 3300005548 Ga0070665_100003964 Ga0070665_1000039648 307
1517 3300005563 Ga0068855_100000480 Ga0068855_10000048023 307
1518 3300005563 Ga0068855_100030225 Ga0068855_1000302254 307
1519 3300005563 Ga0068855_100136938 Ga0068855_1001369383 307
1520 3300005563 Ga0068855_100171276 Ga0068855_1001712762 307
1521 3300005564 Ga0070664_100192630 Ga0070664_1001926302 307
1522 3300005564 Ga0070664_100335752 Ga0070664_1003357522 307
1523 3300005577 Ga0068857_100018647 Ga0068857_1000186477 307
1524 3300005577 Ga0068857_100125818 Ga0068857_1001258183 307
1525 3300005578 Ga0068854_100005665 Ga0068854_1000056657 307
1526 3300005578 Ga0068854_100089482 Ga0068854_1000894823 307
1527 3300005578 Ga0068854_100132664 Ga0068854_1001326642 307
1528 3300005614 Ga0068856_100000871 Ga0068856_10000087118 307
1529 3300005614 Ga0068856_100004156 Ga0068856_1000041568 307
1530 3300005616 Ga0068852_100015026 Ga0068852_1000150264 307
1531 3300005616 Ga0068852_100023687 Ga0068852_1000236874 307
1532 3300005616 Ga0068852_100048219 Ga0068852_1000482194 307
1533 3300005617 Ga0068859_100013908 Ga0068859_1000139089 307
1534 3300005719 Ga0068861_100022627 Ga0068861_1000226272 307
1535 3300005834 Ga0068851_10016754 Ga0068851_100167543 307
1536 3300005841 Ga0068863_100015016 Ga0068863_1000150162 307
1537 3300005843 Ga0068860_100032807 Ga0068860_1000328072 307
1538 3300005844 Ga0068862_100000550 Ga0068862_10000055033 307
1539 3300005844 Ga0068862_100531222 Ga0068862_1005312222 307
1540 3300006028 Ga0070717_10003857 Ga0070717_1000385719 307
1541 3300006038 Ga0075365_10060459 Ga0075365_100604592 307
1542 3300006931 Ga0097620_100013909 Ga0097620_1000139099 307
1543 3300009101 Ga0105247_10055366 Ga0105247_100553663 307
1544 3300009174 Ga0105241_10214386 Ga0105241_102143862 307
1545 3300009545 Ga0105237_10046769 Ga0105237_100467692 307
1546 3300009545 Ga0105237_10061882 Ga0105237_100618825 307
1547 3300009551 Ga0105238_10057176 Ga0105238_100571766 307
1548 3300009551 Ga0105238_10154215 Ga0105238_101542152 307
1549 3300010375 Ga0105239_10048993 Ga0105239_100489934 307
1550 3300013100 Ga0157373_10084911 Ga0157373_100849112 307
1551 3300013100 Ga0157373_10113382 Ga0157373_101133822 307
1552 3300013102 Ga0157371_10120715 Ga0157371_101207152 307
1553 3300013104 Ga0157370_10128016 Ga0157370_101280163 307
1554 3300013104 Ga0157370_10323000 Ga0157370_103230002 307
1555 3300013105 Ga0157369_10065759 Ga0157369_100657592 307
1556 3300013306 Ga0163162_10815076 Ga0163162_108150762 307
1557 3300013307 Ga0157372_10193241 Ga0157372_101932413 307
1558 3300013307 Ga0157372_10201177 Ga0157372_102011772 307
1559 3300014325 Ga0163163_10228447 Ga0163163_102284473 307
1560 3300014969 Ga0157376_10100800 Ga0157376_101008002 307
1561 3300015687 Ga0183368_1003 Ga0183368_10031133 307
1562 3300025226 Ga0209674_100086 Ga0209674_100086169 307
1563 3300025228 Ga0209672_100029 Ga0209672_100029284 307
1564 3300025228 Ga0209672_100049 Ga0209672_100049197 307
1565 3300025230 Ga0209563_100051 Ga0209563_100051196 307
1566 3300025231 Ga0207427_101735 Ga0207427_1017355 307
1567 3300025231 Ga0207427_102934 Ga0207427_1029343 307
1568 3300025233 Ga0209437_100482 Ga0209437_10048222 307
1569 3300025242 Ga0209258_100053 Ga0209258_10005346 307
1570 3300025242 Ga0209258_100087 Ga0209258_100087197 307
1571 3300025242 Ga0209258_100144 Ga0209258_10014416 307
1572 3300025242 Ga0209258_100647 Ga0209258_10064722 307
1573 3300025242 Ga0209258_102270 Ga0209258_1022705 307
1574 3300025246 Ga0209646_1000066 Ga0209646_100006639 307
1575 3300025250 Ga0209026_1000027 Ga0209026_1000027290 307
1576 3300025250 Ga0209026_1000074 Ga0209026_1000074130 307
1577 3300025250 Ga0209026_1001064 Ga0209026_100106413 307
1578 3300025253 Ga0209677_100128 Ga0209677_10012825 307
1579 3300025253 Ga0209677_101339 Ga0209677_1013395 307
1580 3300025254 Ga0209148_1000009 Ga0209148_1000009284 307
1581 3300025254 Ga0209148_1000055 Ga0209148_100005554 307
1582 3300025254 Ga0209148_1000096 Ga0209148_1000096197 307
1583 3300025254 Ga0209148_1000141 Ga0209148_1000141121 307
1584 3300025256 Ga0209759_1000110 Ga0209759_1000110130 307
1585 3300025256 Ga0209759_1000387 Ga0209759_100038711 307
1586 3300025272 Ga0209455_1000060 Ga0209455_1000060284 307
1587 3300025272 Ga0209455_1000088 Ga0209455_1000088197 307
1588 3300025272 Ga0209455_1003953 Ga0209455_10039534 307
1589 3300025292 Ga0209676_1000928 Ga0209676_100092833 307
1590 3300025304 Ga0209257_1000184 Ga0209257_1000184125 307
1591 3300025321 Ga0207656_10001616 Ga0207656_100016162 307
1592 3300025909 Ga0207705_10000131 Ga0207705_1000013177 307
1593 3300025909 Ga0207705_10003397 Ga0207705_100033973 307
1594 3300025909 Ga0207705_10005607 Ga0207705_100056071 307
1595 3300025909 Ga0207705_10008024 Ga0207705_100080247 307
1596 3300025909 Ga0207705_10061477 Ga0207705_100614773 307
1597 3300025909 Ga0207705_10075461 Ga0207705_100754613 307
1598 3300025909 Ga0207705_10097427 Ga0207705_100974272 307
1599 3300025911 Ga0207654_10192013 Ga0207654_101920132 307
1600 3300025912 Ga0207707_10014706 Ga0207707_100147063 307
1601 3300025913 Ga0207695_10148734 Ga0207695_101487343 307
1602 3300025913 Ga0207695_10165850 Ga0207695_101658502 307
1603 3300025913 Ga0207695_10166453 Ga0207695_101664532 307
1604 3300025917 Ga0207660_10004969 Ga0207660_100049695 307
1605 3300025917 Ga0207660_10017556 Ga0207660_100175562 307
1606 3300025917 Ga0207660_10117507 Ga0207660_101175072 307
1607 3300025917 Ga0207660_10139263 Ga0207660_101392631 307
1608 3300025919 Ga0207657_10005362 Ga0207657_100053626 307
1609 3300025919 Ga0207657_10008053 Ga0207657_100080538 307
1610 3300025919 Ga0207657_10009315 Ga0207657_100093152 307
1611 3300025919 Ga0207657_10169956 Ga0207657_101699562 307
1612 3300025919 Ga0207657_10174880 Ga0207657_101748802 307
1613 3300025921 Ga0207652_10007449 Ga0207652_100074498 307
1614 3300025921 Ga0207652_10012340 Ga0207652_100123405 307
1615 3300025923 Ga0207681_10007817 Ga0207681_100078172 307
1616 3300025923 Ga0207681_10045690 Ga0207681_100456903 307
1617 3300025924 Ga0207694_10008293 Ga0207694_100082934 307
1618 3300025924 Ga0207694_10195737 Ga0207694_101957372 307
1619 3300025926 Ga0207659_10004458 Ga0207659_100044584 307
1620 3300025928 Ga0207700_10033041 Ga0207700_100330414 307
1621 3300025929 Ga0207664_10015374 Ga0207664_100153744 307
1622 3300025929 Ga0207664_10260182 Ga0207664_102601822 307
1623 3300025932 Ga0207690_10001891 Ga0207690_1000189112 307
1624 3300025933 Ga0207706_10007955 Ga0207706_100079553 307
1625 3300025933 Ga0207706_10117762 Ga0207706_101177622 307
1626 3300025944 Ga0207661_10143425 Ga0207661_101434252 307
1627 3300025945 Ga0207679_10000467 Ga0207679_1000046730 307
1628 3300025945 Ga0207679_10004621 Ga0207679_100046218 307
1629 3300025945 Ga0207679_10182615 Ga0207679_101826152 307
1630 3300025949 Ga0207667_10000586 Ga0207667_1000058640 307
1631 3300025949 Ga0207667_10001159 Ga0207667_100011594 307
1632 3300025949 Ga0207667_10022920 Ga0207667_100229202 307
1633 3300025949 Ga0207667_10023090 Ga0207667_100230904 307
1634 3300025949 Ga0207667_10118201 Ga0207667_101182013 307
1635 3300025972 Ga0207668_10240923 Ga0207668_102409232 307
1636 3300025981 Ga0207640_10002225 Ga0207640_100022259 307
1637 3300025986 Ga0207658_10190401 Ga0207658_101904011 307
1638 3300025986 Ga0207658_10192318 Ga0207658_101923182 307
1639 3300026023 Ga0207677_10177041 Ga0207677_101770412 307
1640 3300026041 Ga0207639_10030575 Ga0207639_100305753 307
1641 3300026067 Ga0207678_10001768 Ga0207678_1000176815 307
1642 3300026067 Ga0207678_10005267 Ga0207678_100052675 307
1643 3300026067 Ga0207678_10006377 Ga0207678_100063776 307
1644 3300026067 Ga0207678_10048833 Ga0207678_100488333 307
1645 3300026067 Ga0207678_10092102 Ga0207678_100921022 307
1646 3300026067 Ga0207678_10232695 Ga0207678_102326952 307
1647 3300026078 Ga0207702_10000128 Ga0207702_1000012864 307
1648 3300026078 Ga0207702_10000244 Ga0207702_1000024420 307
1649 3300026078 Ga0207702_10000432 Ga0207702_1000043227 307
1650 3300026078 Ga0207702_10001083 Ga0207702_100010833 307
1651 3300026078 Ga0207702_10290341 Ga0207702_102903412 307
1652 3300026088 Ga0207641_10118221 Ga0207641_101182212 307
1653 3300026089 Ga0207648_10244865 Ga0207648_102448652 307
1654 3300026089 Ga0207648_10312090 Ga0207648_103120902 307
1655 3300026095 Ga0207676_10017485 Ga0207676_100174855 307
1656 3300026116 Ga0207674_10003404 Ga0207674_1000340411 307
1657 3300026116 Ga0207674_10005506 Ga0207674_1000550611 307
1658 3300026116 Ga0207674_10088975 Ga0207674_100889753 307
1659 3300026118 Ga0207675_100056446 Ga0207675_1000564462 307
1660 3300026142 Ga0207698_10011617 Ga0207698_100116174 307
1661 3300026142 Ga0207698_10038140 Ga0207698_100381404 307
1662 3300026142 Ga0207698_10044515 Ga0207698_100445152 307
1663 3300028379 Ga0268266_10006760 Ga0268266_100067607 307
1664 3300028380 Ga0268265_10000166 Ga0268265_1000016637 307
1665 3300031344 Ga0265316_10032066 Ga0265316_100320665 307
1666 3300031548 Ga0307408_100078785 Ga0307408_1000787853 307
1667 3300031548 Ga0307408_100084695 Ga0307408_1000846952 307
1668 3300031548 Ga0307408_100090577 Ga0307408_1000905773 307
1669 3300031731 Ga0307405_10114597 Ga0307405_101145973 307
1670 3300031824 Ga0307413_10020874 Ga0307413_100208742 307
1671 3300031824 Ga0307413_10070999 Ga0307413_100709993 307
1672 3300031852 Ga0307410_10036495 Ga0307410_100364953 307
1673 3300031852 Ga0307410_10119677 Ga0307410_101196772 307
1674 3300031901 Ga0307406_10039119 Ga0307406_100391193 307
1675 3300031901 Ga0307406_10040688 Ga0307406_100406883 307
1676 3300031901 Ga0307406_10045880 Ga0307406_100458804 307
1677 3300031903 Ga0307407_10033693 Ga0307407_100336933 307
1678 3300031911 Ga0307412_10003289 Ga0307412_1000328912 307
1679 3300031911 Ga0307412_10114727 Ga0307412_101147272 307
1680 3300031911 Ga0307412_10152871 Ga0307412_101528712 307
1681 3300031911 Ga0307412_10274744 Ga0307412_102747442 307
1682 3300032004 Ga0307414_10034680 Ga0307414_100346804 307
1683 3300032004 Ga0307414_10081381 Ga0307414_100813812 307
1684 3300032004 Ga0307414_10342435 Ga0307414_103424352 307
1685 3300032126 Ga0307415_100304614 Ga0307415_1003046142 307
1686 3300037312 Ga0395899_0000261 Ga0395899_0000261_56147_57088 307
1687 3300037312 Ga0395899_0000309 Ga0395899_0000309_31962_32909 307
1688 3300037312 Ga0395899_0080294 Ga0395899_0080294_154_1101 307
1689 3300037418 Ga0395900_0000036 Ga0395900_0000036_84886_85827 307
1690 3300037418 Ga0395900_0000421 Ga0395900_0000421_26101_27048 307
1691 3300037418 Ga0395900_0013849 Ga0395900_0013849_5819_6757 307
1692 3300037418 Ga0395900_0043088 Ga0395900_0043088_3202_4140 307
1693 3300037418 Ga0395900_0112961 Ga0395900_0112961_729_1667 307
1694 3300037418 Ga0395900_0158473 Ga0395900_0158473_1288_2226 307
1695 3300037466 Ga0395898_0000305 Ga0395898_0000305_31962_32909 307
1696 3300037466 Ga0395898_0011477 Ga0395898_0011477_1760_2701 307
1697 3300037466 Ga0395898_0014192 Ga0395898_0014192_6727_7665 307
1698 3300037466 Ga0395898_0019437 Ga0395898_0019437_1666_2607 307
1699 3300037466 Ga0395898_0037985 Ga0395898_0037985_3374_4375 307
1700 3300037471 Ga0395905_0018671 Ga0395905_0018671_2097_3038 307
1701 3300037471 Ga0395905_0034234 Ga0395905_0034234_3203_4141 307
1702 3300037471 Ga0395905_0059563 Ga0395905_0059563_360_1298 307
1703 3300037471 Ga0395905_0092636 Ga0395905_0092636_1522_2457 307
1704 3300037471 Ga0395905_0296101 Ga0395905_0296101_441_1442 307
1705 3300038443 Ga0395901_0000036 Ga0395901_0000036_134071_135012 307
1706 3300038443 Ga0395901_0001198 Ga0395901_0001198_9899_10900 307
1707 3300038443 Ga0395901_0015319 Ga0395901_0015319_4947_5894 307
1708 3300038443 Ga0395901_0055205 Ga0395901_0055205_1674_2612 307
1709 3300038443 Ga0395901_0116576 Ga0395901_0116576_976_1914 307
1710 3300038443 Ga0395901_0119581 Ga0395901_0119581_1604_2551 307
1711 3300038443 Ga0395901_0519707 Ga0395901_0519707_132_1073 307
1712 3300038443 Ga0395901_0620186 Ga0395901_0620186_50_988 307
1713 3300038705 Ga0237819_00728 Ga0237819_00728_5369_6304 307
1714 3300039145 Ga0237816_02003 Ga0237816_02003_528_1463 307
1715 3300041413 Ga0439465_0033940 Ga0439465_0033940_600_1538 307
1716 3300042139 Ga0450904_000100 Ga0450904_000100_10864_11796 307
1717 3300044656 Ga0466969_0016933 Ga0466969_0016933_648_1595 307
1718 3300044656 Ga0466969_0055710 Ga0466969_0055710_730_1677 307
1719 3300044684 Ga0466966_0066226 Ga0466966_0066226_1304_2245 307
1720 3300044684 Ga0466966_0104783 Ga0466966_0104783_152_1099 307
1721 3300044693 Ga0466961_0000978 Ga0466961_0000978_6806_7753 307
1722 3300044693 Ga0466961_0004586 Ga0466961_0004586_6282_7229 307
1723 3300044694 Ga0466963_0025535 Ga0466963_0025535_2639_3577 307
1724 3300044765 Ga0466970_0001613 Ga0466970_0001613_4336_5283 307
1725 3300044765 Ga0466970_0021702 Ga0466970_0021702_1466_2413 307
1726 3300044842 Ga0466957_0018706 Ga0466957_0018706_668_1615 307
1727 3300045049 Ga0466959_0000978 Ga0466959_0000978_1184_2131 307
1728 3300045049 Ga0466959_0141147 Ga0466959_0141147_524_1471 307
1729 3300045049 Ga0466959_0248444 Ga0466959_0248444_140_1081 307
1730 3300045836 Ga0466958_0082202 Ga0466958_0082202_529_1467 307
1731 3300045976 Ga0466967_0016847 Ga0466967_0016847_4364_5302 307
1732 3300046500 Ga0495596_0045858 Ga0495596_0045858_385_1320 307
1733 3300046512 Ga0495610_0033321 Ga0495610_0033321_1318_2325 307
1734 3300046522 Ga0495643_0015990 Ga0495643_0015990_2962_3969 307
1735 3300046539 Ga0495621_0013656 Ga0495621_0013656_1116_2114 307
1736 3300046558 Ga0495633_0000162 Ga0495633_0000162_82599_83531 307
1737 3300046616 Ga0495668_0058761 Ga0495668_0058761_150_1079 307
1738 3300046660 Ga0495625_0010691 Ga0495625_0010691_4171_5178 307
1739 3300046660 Ga0495625_0015161 Ga0495625_0015161_452_1399 307
1740 3300046694 Ga0495649_0000165 Ga0495649_0000165_19799_20767 307
1741 3300048912 Ga0496109_0206078 Ga0496109_0206078_392_1345 307
1742 3300048913 Ga0496110_0156563 Ga0496110_0156563_1058_1996 307
1743 3300048915 Ga0496112_0003292 Ga0496112_0003292_4756_5694 307
1744 3300048922 Ga0496119_0005178 Ga0496119_0005178_5016_5978 307
1745 3300048924 Ga0496121_0033279 Ga0496121_0033279_882_1856 307
1746 3300048925 Ga0496122_0013321 Ga0496122_0013321_5297_6259 307
1747 3300048926 Ga0496123_0006678 Ga0496123_0006678_3758_4720 307
1748 3300049460 Ga0495682_0022008 Ga0495682_0022008_338_1285 307
1749 3300049571 Ga0501034_0003528 Ga0501034_0003528_2098_3078 307
1750 3300049581 Ga0501047_0043063 Ga0501047_0043063_2838_3767 307
1751 3300049853 Ga0501226_000012 Ga0501226_000012_16430_17362 307
1752 3300050492 nmdc:mga0yw44_222117_c1 nmdc:mga0yw44_222117_c1_205_1158 307
1753 3300050493 nmdc:mga0k408_259977_c1 nmdc:mga0k408_259977_c1_20_1027 307
1754 3300053087 Ga0500643_001069 Ga0500643_001069_2747_3685 307
1755 3300053087 Ga0500643_002015 Ga0500643_002015_7245_8183 307
1756 3300053088 Ga0500644_0006534 Ga0500644_0006534_380_1318 307
1757 3300053093 Ga0500651_0013402 Ga0500651_0013402_3341_4309 307
1758 3300053104 Ga0500556_0000200 Ga0500556_0000200_41488_42450 307
1759 3300053134 Ga0500658_0021557 Ga0500658_0021557_1116_2123 307
1760 3300053156 Ga0500622_0074155 Ga0500622_0074155_449_1417 307
1761 3300053730 Ga0500645_008698 Ga0500645_008698_390_1346 307
1762 3300053739 Ga0500587_001238 Ga0500587_001238_1351_2358 307
1763 iso_pu_bacteria 2599185239 2599741329 307
1764 iso_pu_bacteria 2773857925 2774871110 307
1765 iso_pu_bacteria 2818991452 2819635188 307
1766 iso_pu_bacteria 2894510363 2894512120 307
1767 iso_pu_bacteria 2928170801 2928177009 307
1768 iso_pu_bacteria 2928963466 2928966402 307
1769 iso_pu_bacteria 8018845410 8018850205 307
1770 iso_pu_bacteria 8021120328 8021123866 307
1771 iso_pu_bacteria 8045864390 8045868635 307
1772 3300001979 JGI24740J21852_10050988 JGI24740J21852_100509882 308
1773 3300001989 JGI24739J22299_10003761 JGI24739J22299_100037613 308
1774 3300003794 Ga0055531_10010909 Ga0055531_100109093 308
1775 3300003856 Ga0058692_1015531 Ga0058692_10155313 308
1776 3300005262 Ga0065165_1000949 Ga0065165_100094913 308
1777 3300005327 Ga0070658_10011570 Ga0070658_100115704 308
1778 3300005328 Ga0070676_10044461 Ga0070676_100444613 308
1779 3300005331 Ga0070670_100102443 Ga0070670_1001024433 308
1780 3300005334 Ga0068869_100036648 Ga0068869_1000366482 308
1781 3300005336 Ga0070680_100008203 Ga0070680_1000082037 308
1782 3300005339 Ga0070660_100000006 Ga0070660_10000000663 308
1783 3300005339 Ga0070660_100025856 Ga0070660_1000258564 308
1784 3300005340 Ga0070689_100000001 Ga0070689_1000000018 308
1785 3300005344 Ga0070661_100000697 Ga0070661_1000006975 308
1786 3300005344 Ga0070661_100178757 Ga0070661_1001787572 308
1787 3300005347 Ga0070668_100026755 Ga0070668_1000267552 308
1788 3300005353 Ga0070669_100131910 Ga0070669_1001319102 308
1789 3300005365 Ga0070688_100126319 Ga0070688_1001263191 308
1790 3300005366 Ga0070659_100000082 Ga0070659_10000008226 308
1791 3300005366 Ga0070659_100044848 Ga0070659_1000448483 308
1792 3300005445 Ga0070708_100090787 Ga0070708_1000907874 308
1793 3300005455 Ga0070663_100000069 Ga0070663_10000006921 308
1794 3300005456 Ga0070678_100004415 Ga0070678_1000044155 308
1795 3300005458 Ga0070681_10209235 Ga0070681_102092353 308
1796 3300005471 Ga0070698_100002222 Ga0070698_10000222213 308
1797 3300005530 Ga0070679_100000168 Ga0070679_10000016853 308
1798 3300005548 Ga0070665_100057362 Ga0070665_1000573623 308
1799 3300005563 Ga0068855_100102087 Ga0068855_1001020873 308
1800 3300005578 Ga0068854_100019713 Ga0068854_1000197134 308
1801 3300005614 Ga0068856_100282905 Ga0068856_1002829052 308
1802 3300005616 Ga0068852_100035141 Ga0068852_1000351413 308
1803 3300005618 Ga0068864_100029374 Ga0068864_1000293741 308
1804 3300005618 Ga0068864_100051693 Ga0068864_1000516934 308
1805 3300005618 Ga0068864_100072359 Ga0068864_1000723592 308
1806 3300005841 Ga0068863_100047277 Ga0068863_1000472773 308
1807 3300006028 Ga0070717_10002720 Ga0070717_100027205 308
1808 3300006028 Ga0070717_10048918 Ga0070717_100489183 308
1809 3300009093 Ga0105240_10004421 Ga0105240_100044216 308
1810 3300009093 Ga0105240_10039469 Ga0105240_100394695 308
1811 3300009093 Ga0105240_10306918 Ga0105240_103069182 308
1812 3300009093 Ga0105240_10656185 Ga0105240_106561851 308
1813 3300009177 Ga0105248_10224022 Ga0105248_102240223 308
1814 3300009551 Ga0105238_10010092 Ga0105238_100100921 308
1815 3300009551 Ga0105238_10208849 Ga0105238_102088493 308
1816 3300010375 Ga0105239_10029266 Ga0105239_100292661 308
1817 3300013100 Ga0157373_10036718 Ga0157373_100367184 308
1818 3300013104 Ga0157370_10285818 Ga0157370_102858182 308
1819 3300013105 Ga0157369_10000185 Ga0157369_1000018514 308
1820 3300013105 Ga0157369_10008454 Ga0157369_100084544 308
1821 3300013105 Ga0157369_10135362 Ga0157369_101353623 308
1822 3300013296 Ga0157374_10019967 Ga0157374_100199675 308
1823 3300013297 Ga0157378_10034473 Ga0157378_100344733 308
1824 3300013306 Ga0163162_10000021 Ga0163162_1000002156 308
1825 3300013307 Ga0157372_10142936 Ga0157372_101429363 308
1826 3300014325 Ga0163163_10001449 Ga0163163_1000144911 308
1827 3300014497 Ga0182008_10008890 Ga0182008_100088907 308
1828 3300014968 Ga0157379_10017855 Ga0157379_100178556 308
1829 3300015261 Ga0182006_1000161 Ga0182006_100016149 308
1830 3300015265 Ga0182005_1004688 Ga0182005_10046881 308
1831 3300017792 Ga0163161_10188067 Ga0163161_101880672 308
1832 3300025226 Ga0209674_100488 Ga0209674_10048812 308
1833 3300025228 Ga0209672_100020 Ga0209672_100020139 308
1834 3300025228 Ga0209672_100066 Ga0209672_10006679 308
1835 3300025229 Ga0209147_100024 Ga0209147_100024139 308
1836 3300025229 Ga0209147_100084 Ga0209147_10008488 308
1837 3300025233 Ga0209437_101084 Ga0209437_1010847 308
1838 3300025242 Ga0209258_100084 Ga0209258_100084139 308
1839 3300025242 Ga0209258_100117 Ga0209258_10011788 308
1840 3300025254 Ga0209148_1000148 Ga0209148_100014848 308
1841 3300025254 Ga0209148_1001683 Ga0209148_10016836 308
1842 3300025256 Ga0209759_1008612 Ga0209759_10086123 308
1843 3300025258 Ga0209129_1009361 Ga0209129_10093612 308
1844 3300025263 Ga0209565_1008241 Ga0209565_10082413 308
1845 3300025272 Ga0209455_1000110 Ga0209455_100011088 308
1846 3300025273 Ga0209673_1000057 Ga0209673_100005756 308
1847 3300025295 Ga0209564_1017578 Ga0209564_10175784 308
1848 3300025297 Ga0209758_1010044 Ga0209758_10100443 308
1849 3300025299 Ga0209256_1010505 Ga0209256_10105055 308
1850 3300025304 Ga0209257_1002620 Ga0209257_10026209 308
1851 3300025904 Ga0207647_10001462 Ga0207647_100014628 308
1852 3300025904 Ga0207647_10050884 Ga0207647_100508842 308
1853 3300025907 Ga0207645_10049349 Ga0207645_100493493 308
1854 3300025909 Ga0207705_10000003 Ga0207705_10000003278 308
1855 3300025912 Ga0207707_10170473 Ga0207707_101704733 308
1856 3300025913 Ga0207695_10001113 Ga0207695_1000111339 308
1857 3300025913 Ga0207695_10163005 Ga0207695_101630052 308
1858 3300025914 Ga0207671_10021180 Ga0207671_100211805 308
1859 3300025917 Ga0207660_10005823 Ga0207660_100058234 308
1860 3300025919 Ga0207657_10000003 Ga0207657_10000003147 308
1861 3300025919 Ga0207657_10043281 Ga0207657_100432816 308
1862 3300025919 Ga0207657_10119040 Ga0207657_101190402 308
1863 3300025920 Ga0207649_10000589 Ga0207649_100005896 308
1864 3300025920 Ga0207649_10056667 Ga0207649_100566672 308
1865 3300025921 Ga0207652_10000282 Ga0207652_1000028252 308
1866 3300025923 Ga0207681_10050848 Ga0207681_100508483 308
1867 3300025924 Ga0207694_10005613 Ga0207694_1000561311 308
1868 3300025924 Ga0207694_10024724 Ga0207694_100247243 308
1869 3300025924 Ga0207694_10175408 Ga0207694_101754082 308
1870 3300025925 Ga0207650_10105568 Ga0207650_101055682 308
1871 3300025925 Ga0207650_10318920 Ga0207650_103189202 308
1872 3300025928 Ga0207700_10059559 Ga0207700_100595592 308
1873 3300025931 Ga0207644_10233212 Ga0207644_102332121 308
1874 3300025932 Ga0207690_10000007 Ga0207690_10000007148 308
1875 3300025932 Ga0207690_10002067 Ga0207690_100020676 308
1876 3300025936 Ga0207670_10000036 Ga0207670_100000368 308
1877 3300025936 Ga0207670_10017186 Ga0207670_100171862 308
1878 3300025940 Ga0207691_10020605 Ga0207691_100206052 308
1879 3300025942 Ga0207689_10046883 Ga0207689_100468832 308
1880 3300025949 Ga0207667_10014484 Ga0207667_100144849 308
1881 3300025949 Ga0207667_10114164 Ga0207667_101141642 308
1882 3300025960 Ga0207651_10090027 Ga0207651_100900272 308
1883 3300025981 Ga0207640_10003065 Ga0207640_100030658 308
1884 3300025981 Ga0207640_10004350 Ga0207640_100043507 308
1885 3300026041 Ga0207639_10246362 Ga0207639_102463622 308
1886 3300026067 Ga0207678_10001430 Ga0207678_1000143011 308
1887 3300026088 Ga0207641_10029638 Ga0207641_100296383 308
1888 3300026088 Ga0207641_10203206 Ga0207641_102032062 308
1889 3300026089 Ga0207648_10202405 Ga0207648_102024052 308
1890 3300026095 Ga0207676_10207077 Ga0207676_102070771 308
1891 3300026116 Ga0207674_10154524 Ga0207674_101545242 308
1892 3300026121 Ga0207683_10003397 Ga0207683_100033979 308
1893 3300026121 Ga0207683_10303500 Ga0207683_103035002 308
1894 3300026142 Ga0207698_10014360 Ga0207698_100143605 308
1895 3300026142 Ga0207698_10165669 Ga0207698_101656692 308
1896 3300027312 Ga0209371_1000402 Ga0209371_100040230 308
1897 3300027876 Ga0209974_10002606 Ga0209974_100026062 308
1898 3300028379 Ga0268266_10030898 Ga0268266_100308984 308
1899 3300028786 Ga0307517_10036337 Ga0307517_100363374 308
1900 3300028800 Ga0265338_10168423 Ga0265338_101684232 308
1901 3300030500 Ga0268256_1000749 Ga0268256_100074918 308
1902 3300031456 Ga0307513_10006109 Ga0307513_1000610912 308
1903 3300031456 Ga0307513_10009485 Ga0307513_100094855 308
1904 3300031456 Ga0307513_10126660 Ga0307513_101266602 308
1905 3300031456 Ga0307513_10146530 Ga0307513_101465302 308
1906 3300031616 Ga0307508_10010305 Ga0307508_100103052 308
1907 3300031616 Ga0307508_10034874 Ga0307508_100348743 308
1908 3300031730 Ga0307516_10011653 Ga0307516_100116532 308
1909 3300031824 Ga0307413_10000338 Ga0307413_100003384 308
1910 3300031852 Ga0307410_10046331 Ga0307410_100463312 308
1911 3300031911 Ga0307412_10149165 Ga0307412_101491652 308
1912 3300031911 Ga0307412_10291024 Ga0307412_102910241 308
1913 3300031995 Ga0307409_100003524 Ga0307409_1000035243 308
1914 3300032002 Ga0307416_100009355 Ga0307416_1000093554 308
1915 3300032004 Ga0307414_10003324 Ga0307414_100033249 308
1916 3300032004 Ga0307414_10039804 Ga0307414_100398044 308
1917 3300032004 Ga0307414_10040002 Ga0307414_100400022 308
1918 3300032004 Ga0307414_10067337 Ga0307414_100673374 308
1919 3300032005 Ga0307411_10104301 Ga0307411_101043012 308
1920 3300032126 Ga0307415_100003431 Ga0307415_1000034312 308
1921 3300033179 Ga0307507_10035501 Ga0307507_100355013 308
1922 3300033179 Ga0307507_10069877 Ga0307507_100698774 308
1923 3300035113 Ga0373936_0000074 Ga0373936_0000074_3111_4046 308
1924 3300035241 Ga0373961_0000126 Ga0373961_0000126_13686_14624 308
1925 3300037312 Ga0395899_0040051 Ga0395899_0040051_1536_2486 308
1926 3300037312 Ga0395899_0149996 Ga0395899_0149996_135_1079 308
1927 3300037312 Ga0395899_0162039 Ga0395899_0162039_468_1418 308
1928 3300037312 Ga0395899_0217919 Ga0395899_0217919_169_1119 308
1929 3300037418 Ga0395900_0002071 Ga0395900_0002071_8909_9859 308
1930 3300037418 Ga0395900_0030670 Ga0395900_0030670_3532_4482 308
1931 3300037418 Ga0395900_0081366 Ga0395900_0081366_731_1678 308
1932 3300037418 Ga0395900_0145385 Ga0395900_0145385_931_1881 308
1933 3300037418 Ga0395900_0168010 Ga0395900_0168010_361_1311 308
1934 3300037418 Ga0395900_0175775 Ga0395900_0175775_395_1345 308
1935 3300037418 Ga0395900_0176108 Ga0395900_0176108_865_1815 308
1936 3300037418 Ga0395900_0184034 Ga0395900_0184034_555_1505 308
1937 3300037418 Ga0395900_0269389 Ga0395900_0269389_458_1408 308
1938 3300037466 Ga0395898_0016672 Ga0395898_0016672_6022_6972 308
1939 3300037466 Ga0395898_0020422 Ga0395898_0020422_1309_2259 308
1940 3300037466 Ga0395898_0076987 Ga0395898_0076987_2045_2995 308
1941 3300037466 Ga0395898_0221856 Ga0395898_0221856_235_1185 308
1942 3300037471 Ga0395905_0018294 Ga0395905_0018294_135_1085 308
1943 3300037471 Ga0395905_0134658 Ga0395905_0134658_571_1521 308
1944 3300037471 Ga0395905_0194649 Ga0395905_0194649_512_1450 308
1945 3300037471 Ga0395905_0299238 Ga0395905_0299238_253_1206 308
1946 3300038443 Ga0395901_0002697 Ga0395901_0002697_16730_17680 308
1947 3300038443 Ga0395901_0054449 Ga0395901_0054449_2355_3305 308
1948 3300038443 Ga0395901_0090263 Ga0395901_0090263_1456_2406 308
1949 3300038443 Ga0395901_0131771 Ga0395901_0131771_1412_2362 308
1950 3300038443 Ga0395901_0449665 Ga0395901_0449665_349_1287 308
1951 3300038443 Ga0395901_0481965 Ga0395901_0481965_142_1095 308
1952 3300041404 Ga0439436_0000023 Ga0439436_0000023_18573_19529 308
1953 3300041404 Ga0439436_0012204 Ga0439436_0012204_365_1300 308
1954 3300041404 Ga0439436_0033111 Ga0439436_0033111_379_1335 308
1955 3300041406 Ga0439439_0043679 Ga0439439_0043679_114_1055 308
1956 3300041441 Ga0451787_571574 Ga0451787_571574_20_1075 308
1957 3300041486 Ga0451807_2136315 Ga0451807_2136315_1803_2741 308
1958 3300041512 Ga0451853_0162710 Ga0451853_0162710_3939_4877 308
1959 3300042006 Ga0439432_018244 Ga0439432_018244_706_1704 308
1960 3300042014 Ga0439457_018740 Ga0439457_018740_272_1213 308
1961 3300042015 Ga0439462_0026691 Ga0439462_0026691_231_1172 308
1962 3300042184 Ga0450908_000069 Ga0450908_000069_3908_4864 308
1963 3300044656 Ga0466969_0105306 Ga0466969_0105306_330_1280 308
1964 3300044672 Ga0466982_0000109 Ga0466982_0000109_12296_13252 308
1965 3300044673 Ga0453683_0067547 Ga0453683_0067547_610_1581 308
1966 3300044684 Ga0466966_0000004 Ga0466966_0000004_137816_138766 308
1967 3300044693 Ga0466961_0132258 Ga0466961_0132258_423_1373 308
1968 3300044694 Ga0466963_0034194 Ga0466963_0034194_1023_1973 308
1969 3300044842 Ga0466957_0082242 Ga0466957_0082242_478_1434 308
1970 3300044901 Ga0466960_0063911 Ga0466960_0063911_461_1474 308
1971 3300044901 Ga0466960_0224388 Ga0466960_0224388_66_1022 308
1972 3300046457 Ga0495590_0113147 Ga0495590_0113147_18_953 308
1973 3300046460 Ga0495638_0102411 Ga0495638_0102411_271_1212 308
1974 3300046512 Ga0495610_0001255 Ga0495610_0001255_7907_8863 308
1975 3300046525 Ga0495663_0000379 Ga0495663_0000379_10662_11603 308
1976 3300046692 Ga0495671_0011736 Ga0495671_0011736_3465_4406 308
1977 3300046694 Ga0495649_0010627 Ga0495649_0010627_2180_3136 308
1978 3300047318 Ga0495636_0002340 Ga0495636_0002340_5317_6318 308
1979 3300047318 Ga0495636_0018436 Ga0495636_0018436_759_1760 308
1980 3300047318 Ga0495636_0035560 Ga0495636_0035560_629_1612 308
1981 3300047447 Ga0495685_046996 Ga0495685_046996_367_1371 308
1982 3300048922 Ga0496119_0011034 Ga0496119_0011034_1866_2822 308
1983 3300048928 Ga0496125_0001807 Ga0496125_0001807_11201_12148 308
1984 3300049576 Ga0501040_0001815 Ga0501040_0001815_6881_7819 308
1985 3300049577 Ga0501041_0000192 Ga0501041_0000192_14469_15407 308
1986 3300049578 Ga0501042_0000271 Ga0501042_0000271_15719_16657 308
1987 3300049580 Ga0501046_0015253 Ga0501046_0015253_2060_2998 308
1988 3300049581 Ga0501047_0013253 Ga0501047_0013253_6473_7411 308
1989 3300049582 Ga0501048_0034331 Ga0501048_0034331_2082_3020 308
1990 3300049583 Ga0501067_0043101 Ga0501067_0043101_999_1937 308
1991 3300049587 Ga0501071_0016296 Ga0501071_0016296_1767_2705 308
1992 3300049588 Ga0501072_0000655 Ga0501072_0000655_10173_11111 308
1993 3300049590 Ga0501074_0033737 Ga0501074_0033737_1648_2586 308
1994 3300049591 Ga0501075_0032811 Ga0501075_0032811_2283_3221 308
1995 3300049591 Ga0501075_0049268 Ga0501075_0049268_636_1643 308
1996 3300049592 Ga0501076_0000057 Ga0501076_0000057_18572_19510 308
1997 3300049592 Ga0501076_0100931 Ga0501076_0100931_743_1750 308
1998 3300049593 Ga0501077_0000637 Ga0501077_0000637_14971_15909 308
1999 3300049741 Ga0501079_0000283 Ga0501079_0000283_23735_24673 308
2000 3300049742 Ga0501080_0364050 Ga0501080_0364050_11_1018 308
2001 3300049743 Ga0501081_0000123 Ga0501081_0000123_2485_3423 308
2002 3300049822 Ga0501035_0099716 Ga0501035_0099716_381_1319 308
2003 3300049822 Ga0501035_0269396 Ga0501035_0269396_165_1172 308
2004 3300049824 Ga0501045_0002226 Ga0501045_0002226_526_1464 308
2005 3300053080 Ga0500635_0043193 Ga0500635_0043193_19_945 308
2006 3300053086 Ga0500578_0213203 Ga0500578_0213203_18_953 308
2007 3300053095 Ga0500640_000515 Ga0500640_000515_3681_4616 308
2008 3300053123 Ga0500614_004049 Ga0500614_004049_162_1097 308
2009 3300053130 Ga0500642_0064213 Ga0500642_0064213_395_1330 308
2010 3300054114 Ga0501084_0001450 Ga0501084_0001450_1712_2650 308
2011 3300060353 Ga0501082_0005168 Ga0501082_0005168_9101_10039 308
2012 3300061734 Ga0530510_0000267 Ga0530510_0000267_10166_11104 308
2013 3300061734 Ga0530510_0121791 Ga0530510_0121791_356_1363 308
2014 iso_pu_bacteria 2571042365 2572255971 308
2015 iso_pu_bacteria 2593339238 2595447692 308
2016 iso_pu_bacteria 2593339239 2595450382 308
2017 iso_pu_bacteria 2842918807 2842922452 308
2018 iso_pu_bacteria 2953994433 2953996913 308
2019 iso_pu_bacteria 8020807995 8020812240 308
2020 iso_pu_bacteria 8040173305 8040176964 308
2021 3300025225 Ga0209566_100231 Ga0209566_10023142 309
2022 3300031251 Ga0265327_10022058 Ga0265327_100220584 309
2023 3300031456 Ga0307513_10000013 Ga0307513_10000013300 309
2024 3300031456 Ga0307513_10000037 Ga0307513_1000003785 309
2025 3300031824 Ga0307413_10010229 Ga0307413_100102293 309
2026 3300032005 Ga0307411_10004620 Ga0307411_100046204 309
2027 3300032126 Ga0307415_100378283 Ga0307415_1003782832 309
2028 3300041443 Ga0451789_0461212 Ga0451789_0461212_194_1174 309
2029 3300042876 Ga0451577_0000256 Ga0451577_0000256_78439_79392 309
2030 3300044712 Ga0453684_0000842 Ga0453684_0000842_25560_26513 309
2031 3300044712 Ga0453684_0229822 Ga0453684_0229822_792_1739 309
2032 3300049589 Ga0501073_0008965 Ga0501073_0008965_2703_3650 309
2033 3300049590 Ga0501074_0002305 Ga0501074_0002305_8181_9128 309
2034 3300049593 Ga0501077_0013351 Ga0501077_0013351_575_1522 309
2035 3300049742 Ga0501080_0029568 Ga0501080_0029568_3634_4581 309
2036 3300049744 Ga0501083_0149667 Ga0501083_0149667_34_981 309
2037 3300053093 Ga0500651_0000984 Ga0500651_0000984_12608_13585 309
2038 3300053730 Ga0500645_000250 Ga0500645_000250_31297_32247 309
2039 3300053730 Ga0500645_008241 Ga0500645_008241_605_1573 309
2040 3300054114 Ga0501084_0012475 Ga0501084_0012475_3631_4578 309
2041 iso_pu_bacteria 2511231002 2511245969 309
2042 iso_pu_bacteria 2808606384 2808973025 309
2043 iso_pu_bacteria 2808606390 2809008147 309
2044 iso_pu_bacteria 2808606391 2809014950 309
2045 iso_pu_bacteria 8001522603 8001523336 309
2046 3300002987 JGI25159J45721_1001136 JGI25159J45721_10011367 310
2047 3300003187 JGI25151J46595_10007622 JGI25151J46595_100076222 310
2048 3300003187 JGI25151J46595_10029108 JGI25151J46595_100291081 310
2049 3300003354 JGI25160J50197_1000076 JGI25160J50197_10000768 310
2050 3300003374 JGI25161J50226_1000058 JGI25161J50226_100005885 310
2051 3300003771 Ga0055526_1005854 Ga0055526_10058547 310
2052 3300003773 Ga0055537_1014657 Ga0055537_10146571 310
2053 3300003791 Ga0055530_10009456 Ga0055530_100094564 310
2054 3300004625 Ga0055543_1002375 Ga0055543_10023759 310
2055 3300005262 Ga0065165_1023570 Ga0065165_10235702 310
2056 3300005262 Ga0065165_1037799 Ga0065165_10377992 310
2057 3300006051 Ga0075364_10026765 Ga0075364_100267653 310
2058 3300025208 Ga0209436_110535 Ga0209436_1105352 310
2059 3300025245 Ga0207425_1010948 Ga0207425_10109481 310
2060 3300025263 Ga0209565_1003353 Ga0209565_10033532 310
2061 3300025284 Ga0209130_1000014 Ga0209130_1000014312 310
2062 3300025291 Ga0209675_1010551 Ga0209675_10105511 310
2063 3300025294 Ga0209025_1003991 Ga0209025_10039918 310
2064 3300025295 Ga0209564_1002122 Ga0209564_100212212 310
2065 3300025295 Ga0209564_1004135 Ga0209564_10041357 310
2066 3300025297 Ga0209758_1004543 Ga0209758_10045436 310
2067 3300025298 Ga0209050_1005563 Ga0209050_10055635 310
2068 3300025298 Ga0209050_1006477 Ga0209050_10064771 310
2069 3300025302 Ga0207426_1000174 Ga0207426_100017479 310
2070 3300025304 Ga0209257_1015048 Ga0209257_10150483 310
2071 3300031901 Ga0307406_10003967 Ga0307406_100039672 310
2072 3300049572 Ga0501036_0113245 Ga0501036_0113245_1177_2139 310
2073 3300049589 Ga0501073_0018310 Ga0501073_0018310_3902_4864 310
2074 3300050489 nmdc:mga03683_72905_c1 nmdc:mga03683_72905_c1_119_1132 310
2075 3300053088 Ga0500644_0073460 Ga0500644_0073460_212_1171 310
2076 3300053094 Ga0500566_0004593 Ga0500566_0004593_7200_8162 310
2077 3300053117 Ga0500593_001627 Ga0500593_001627_4335_5294 310
2078 3300053129 Ga0500628_000537 Ga0500628_000537_2202_3158 310
2079 iso_pu_bacteria 2818991457 2819662386 311
2080 iso_pu_bacteria 2852684882 2852687898 311
2081 iso_pu_bacteria 2919130084 2919133032 311
2082 iso_pu_bacteria 2929195423 2929199329 311
2083 3300003187 JGI25151J46595_10004543 JGI25151J46595_100045432 312
2084 3300003781 Ga0055536_1008264 Ga0055536_10082648 312
2085 3300003791 Ga0055530_10006463 Ga0055530_100064632 312
2086 3300003794 Ga0055531_10040125 Ga0055531_100401252 312
2087 3300003794 Ga0055531_10041520 Ga0055531_100415202 312
2088 3300025284 Ga0209130_1005797 Ga0209130_10057975 312
2089 3300025291 Ga0209675_1012756 Ga0209675_10127561 312
2090 3300025292 Ga0209676_1001166 Ga0209676_10011662 312
2091 3300025292 Ga0209676_1002764 Ga0209676_100276413 312
2092 3300025292 Ga0209676_1005511 Ga0209676_10055115 312
2093 3300025294 Ga0209025_1000819 Ga0209025_100081945 312
2094 3300025295 Ga0209564_1013128 Ga0209564_10131282 312
2095 3300025297 Ga0209758_1032092 Ga0209758_10320924 312
2096 3300025298 Ga0209050_1002812 Ga0209050_10028127 312
2097 3300025298 Ga0209050_1012340 Ga0209050_10123404 312
2098 3300025299 Ga0209256_1000670 Ga0209256_100067017 312
2099 3300025299 Ga0209256_1001995 Ga0209256_100199519 312
2100 3300025299 Ga0209256_1010741 Ga0209256_10107416 312
2101 3300025304 Ga0209257_1000916 Ga0209257_100091618 312
2102 3300025304 Ga0209257_1002298 Ga0209257_100229818 312
2103 3300025304 Ga0209257_1008929 Ga0209257_10089294 312
2104 3300028786 Ga0307517_10201167 Ga0307517_102011671 312
2105 3300032002 Ga0307416_100201961 Ga0307416_1002019612 312
2106 3300032004 Ga0307414_10408430 Ga0307414_104084301 312
2107 3300049579 Ga0501043_0034251 Ga0501043_0034251_1856_2881 312
2108 iso_pu_bacteria 8003014200 8003017602 312
2109 3300002704 JGI25155J39150_1000057 JGI25155J39150_100005754 313
2110 3300002705 JGI25156J39149_1000073 JGI25156J39149_100007354 313
2111 3300002738 JGI25154J39366_1000097 JGI25154J39366_100009718 313
2112 3300002741 JGI25157J39369_1000089 JGI25157J39369_100008918 313
2113 3300002987 JGI25159J45721_1005739 JGI25159J45721_10057394 313
2114 3300003771 Ga0055526_1005666 Ga0055526_10056664 313
2115 3300003773 Ga0055537_1000730 Ga0055537_100073014 313
2116 3300003775 Ga0055524_1001067 Ga0055524_10010678 313
2117 3300003784 Ga0055534_1002014 Ga0055534_10020145 313
2118 3300003790 Ga0055528_1006463 Ga0055528_10064632 313
2119 3300003791 Ga0055530_10002477 Ga0055530_1000247710 313
2120 3300003792 Ga0055540_1001926 Ga0055540_100192610 313
2121 3300003794 Ga0055531_10008906 Ga0055531_100089066 313
2122 3300005539 Ga0068853_100018661 Ga0068853_1000186614 313
2123 3300005563 Ga0068855_100399817 Ga0068855_1003998172 313
2124 3300010375 Ga0105239_10082305 Ga0105239_100823055 313
2125 3300025206 Ga0209435_100008 Ga0209435_100008224 313
2126 3300025246 Ga0209646_1000029 Ga0209646_100002954 313
2127 3300025250 Ga0209026_1000016 Ga0209026_100001654 313
2128 3300025256 Ga0209759_1000016 Ga0209759_100001654 313
2129 3300025263 Ga0209565_1000041 Ga0209565_1000041203 313
2130 3300025273 Ga0209673_1001316 Ga0209673_100131620 313
2131 3300025284 Ga0209130_1003456 Ga0209130_10034568 313
2132 3300025291 Ga0209675_1000783 Ga0209675_100078310 313
2133 3300025292 Ga0209676_1000013 Ga0209676_1000013438 313
2134 3300025292 Ga0209676_1000153 Ga0209676_10001538 313
2135 3300025294 Ga0209025_1013203 Ga0209025_10132036 313
2136 3300025295 Ga0209564_1001403 Ga0209564_10014038 313
2137 3300025298 Ga0209050_1000008 Ga0209050_1000008438 313
2138 3300025299 Ga0209256_1000039 Ga0209256_100003937 313
2139 3300025302 Ga0207426_1002190 Ga0207426_10021908 313
2140 3300025303 Ga0209051_1000005 Ga0209051_1000005438 313
2141 3300025303 Ga0209051_1017460 Ga0209051_10174603 313
2142 3300025304 Ga0209257_1000031 Ga0209257_100003128 313
2143 3300025949 Ga0207667_10350065 Ga0207667_103500652 313
2144 3300026041 Ga0207639_10003451 Ga0207639_100034514 313
2145 3300031548 Ga0307408_100098516 Ga0307408_1000985162 313
2146 3300031901 Ga0307406_10009035 Ga0307406_100090352 313
2147 3300049568 Ga0501031_0003304 Ga0501031_0003304_8994_9935 313
2148 3300049569 Ga0501032_0002277 Ga0501032_0002277_12778_13719 313
2149 3300049570 Ga0501033_0020882 Ga0501033_0020882_2642_3583 313
2150 3300049571 Ga0501034_0013919 Ga0501034_0013919_5240_6181 313
2151 3300049572 Ga0501036_0129900 Ga0501036_0129900_1015_1956 313
2152 3300049573 Ga0501037_0046554 Ga0501037_0046554_216_1157 313
2153 3300049574 Ga0501038_0000654 Ga0501038_0000654_21904_22845 313
2154 3300049579 Ga0501043_0085298 Ga0501043_0085298_1214_2155 313
2155 3300049581 Ga0501047_0017768 Ga0501047_0017768_524_1465 313
2156 3300049589 Ga0501073_0013754 Ga0501073_0013754_2177_3118 313
2157 3300049742 Ga0501080_0132429 Ga0501080_0132429_803_1744 313
2158 3300049823 Ga0501044_0094691 Ga0501044_0094691_728_1669 313
2159 3300042134 Ga0450898_006509 Ga0450898_006509_736_1680 314
2160 2162886007 SwRhRL2b_contig_719950 SwRhRL2b_0529.00002880 315
2161 3300015261 Ga0182006_1022511 Ga0182006_10225112 315
2162 3300015265 Ga0182005_1004909 Ga0182005_10049092 315
2163 3300025923 Ga0207681_10137195 Ga0207681_101371952 315
2164 3300025925 Ga0207650_10002909 Ga0207650_1000290915 315
2165 3300041486 Ga0451807_0322861 Ga0451807_0322861_4371_5318 315
2166 3300048920 Ga0496117_0016132 Ga0496117_0016132_2299_3246 315
2167 3300048921 Ga0496118_0119622 Ga0496118_0119622_373_1320 315
2168 3300048922 Ga0496119_0000733 Ga0496119_0000733_6103_7050 315
2169 3300048923 Ga0496120_0000671 Ga0496120_0000671_37249_38196 315
2170 3300048926 Ga0496123_0000974 Ga0496123_0000974_31301_32248 315
2171 3300048927 Ga0496124_0000681 Ga0496124_0000681_36995_37942 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

85

227

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9414 1 222
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9413 1 225
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.939 5 216
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9365 3 218
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9332 2 221
ID Description Score Start End Superfamily
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9475 3 219 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9467 5 222 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9445 5 221 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9434 1 208 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.942 2 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y4ZA76-F1-model_v4 ABC transporter ATP-binding protein 0.9695 3 216 GO:0005524
GO:0016887
AF-A0A348B4H2-F1-model_v4 ABC transporter domain-containing protein 0.9684 34 222 GO:0005524
GO:0016887
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9653 3 222 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9637 3 225 GO:0005524
GO:0016887
AF-A0A842N7Y0-F1-model_v4 ABC transporter ATP-binding protein 0.9629 37 219 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.22 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map