F496400

General Info

Members Datasets Scaffolds Average Seq Length
2104 570 2103 96

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10268789|Ga0157376_102687894
Length 103
Sequence MPRSTKKGPFVDKYLAKKIAAAQKEANPGKRMISTYSRRSFIIPDMIGLTFSVHNGRKFIPVYVTEQMIGHKLGEFSHTRTFHGHTGERKASSGPSPAAPPAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
160 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
235 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
236 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
237 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
238 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
239 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
243 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
244 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
260 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
261 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
265 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
277 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
278 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
280 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
287 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
288 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
289 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
290 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
291 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
292 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
293 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
297 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
298 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
299 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
300 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
301 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
302 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
303 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
304 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
305 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
306 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
313 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
317 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
318 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
319 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
320 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
321 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
322 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
325 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
326 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
327 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
330 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
331 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
332 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
333 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
334 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
335 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
336 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
337 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
338 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
339 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
340 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
341 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
342 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
343 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
344 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
345 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
346 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
347 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
348 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
349 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
352 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
353 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
354 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
355 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
356 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
357 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
358 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
359 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
360 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
361 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
362 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
363 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
364 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
365 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
366 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
367 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
368 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
369 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
370 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
371 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
372 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
373 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
374 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
375 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
376 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
377 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
378 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
379 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
380 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
381 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
382 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
383 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
384 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
385 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
386 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
387 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
388 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
389 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
390 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
391 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
395 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
396 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
397 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
398 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
399 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
400 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
401 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
406 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
407 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
411 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
412 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
413 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
414 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
415 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
416 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
417 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
418 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
419 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
423 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
424 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
425 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
426 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
427 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
428 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
429 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
430 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
431 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
432 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
433 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
434 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
435 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
445 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
455 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
476 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
477 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
478 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
479 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
480 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
481 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
482 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
483 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
484 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
485 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
486 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
487 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
488 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
489 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
493 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
494 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
495 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
496 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
497 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
498 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
499 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
500 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
501 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
502 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
503 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
504 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
505 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
506 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
507 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
508 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
509 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
510 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
511 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
512 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
513 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
514 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
515 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
516 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
517 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
518 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
519 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
520 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
521 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
522 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
523 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
524 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
525 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
526 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
527 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
528 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
529 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
530 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
531 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
532 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
533 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
534 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
535 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
536 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
537 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
538 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
539 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
540 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
541 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
569 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
570 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.63
Metatranscriptomes 7.32
Isolates 0.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 2.61
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
2 JGI25157J39369_1033203 3300002741 Bacteria 585
3 Ga0006769J43182_106623 3300002863 Bacteria 1434
4 Ga0006761J43178_109203 3300002865 Bacteria 1591
5 Ga0006767J43181_103125 3300002868 Bacteria 8971
6 Ga0006763J43179_104103 3300002870 Bacteria 8906
7 Ga0006762J43184_103419 3300002872 Bacteria 7285
8 Ga0006760J45825_103232 3300003158 Bacteria 1404
9 Ga0006765J45826_111518 3300003161 Bacteria 3818
10 Ga0006759J45824_1006649 3300003163 Bacteria 16605
11 Ga0006759J45824_1057093 3300003163 Bacteria 901
12 Ga0006759J45824_1074785 3300003163 Bacteria 1141
13 Ga0006759J45824_1119133 3300003163 Bacteria 681
14 JGI25165J46597_1001315 3300003214 Bacteria 14050
15 JGI25153J46596_10000830 3300003215 Bacteria 18874
16 Ga0006758J48902_1008419 3300003300 Bacteria 4745
17 Ga0006770J48903_1037599 3300003305 Bacteria 1269
18 rootH2_10053580 3300003320 Bacteria 2507
19 rootL2_10268495 3300003322 Bacteria 1353
20 Ga0032354_1009872 3300003693 Bacteria 14763
21 Ga0032354_1064715 3300003693 Bacteria 1119
22 Ga0058858_1357820 3300004785 Bacteria 538
23 Ga0058859_11690238 3300004798 Bacteria 522
24 Ga0058863_11971106 3300004799 Bacteria 502
25 Ga0058861_11886521 3300004800 Bacteria 1468
26 Ga0058861_11942326 3300004800 Bacteria 1050
27 Ga0058862_12348238 3300004803 Bacteria 1183
28 Ga0058862_12474685 3300004803 Bacteria 639
29 Ga0058862_12878651 3300004803 Bacteria 1071
30 Ga0065704_10070132 3300005289 Bacteria 1955461
31 Ga0065704_10277068 3300005289 Bacteria 930
32 Ga0065707_10003983 3300005295 Bacteria 7463
33 Ga0065707_11047092 3300005295 Bacteria 528
34 Ga0070658_10021396 3300005327 Bacteria 5184
35 Ga0070658_10074053 3300005327 Bacteria 2793
36 Ga0070658_10094080 3300005327 Bacteria 2472
37 Ga0070658_10127826 3300005327 Bacteria 2116
38 Ga0070658_10399383 3300005327 Bacteria 1181
39 Ga0070658_10616711 3300005327 Bacteria 941
40 Ga0070658_11252490 3300005327 Bacteria 645
41 Ga0070658_11981444 3300005327 Bacteria 503
42 Ga0070676_10018760 3300005328 Bacteria 3838
43 Ga0070676_10431694 3300005328 Bacteria 923
44 Ga0070676_10506729 3300005328 Bacteria 858
45 Ga0070683_100044407 3300005329 Bacteria 4098
46 Ga0070683_100084181 3300005329 Bacteria 2980
47 Ga0070683_100093535 3300005329 Bacteria 2824
48 Ga0070683_100562558 3300005329 Bacteria 1090
49 Ga0070683_101127127 3300005329 Bacteria 754
50 Ga0070683_101471944 3300005329 Bacteria 654
51 Ga0070683_102338035 3300005329 Bacteria 513
52 Ga0070690_101267928 3300005330 Bacteria 590
53 Ga0070670_100034493 3300005331 Bacteria 4354
54 Ga0070670_100168448 3300005331 Bacteria 1900
55 Ga0070670_100282344 3300005331 Bacteria 1450
56 Ga0070670_100389223 3300005331 Bacteria 1229
57 Ga0070670_100649247 3300005331 Bacteria 946
58 Ga0070670_100689737 3300005331 Bacteria 918
59 Ga0070670_101039269 3300005331 Bacteria 746
60 Ga0070670_101410847 3300005331 Bacteria 639
61 Ga0070677_10107166 3300005333 Bacteria 1242
62 Ga0070677_10346196 3300005333 Bacteria 769
63 Ga0068869_100612850 3300005334 Bacteria 921
64 Ga0070666_10413436 3300005335 Bacteria 971
65 Ga0070680_100002998 3300005336 Bacteria 12534
66 Ga0070680_100020347 3300005336 Bacteria 5268
67 Ga0070680_100078067 3300005336 Bacteria 2727
68 Ga0070680_100163580 3300005336 Bacteria 1870
69 Ga0070680_100311991 3300005336 Bacteria 1334
70 Ga0070680_100419896 3300005336 Bacteria 1141
71 Ga0070680_101916672 3300005336 Bacteria 514
72 Ga0070682_100000787 3300005337 Bacteria 18636
73 Ga0070682_100018185 3300005337 Bacteria 4104
74 Ga0070682_100065479 3300005337 Bacteria 2309
75 Ga0070682_100083544 3300005337 Bacteria 2072
76 Ga0070682_100259703 3300005337 Bacteria 1256
77 Ga0070682_100334486 3300005337 Bacteria 1123
78 Ga0070682_100637422 3300005337 Bacteria 847
79 Ga0070682_100661292 3300005337 Bacteria 833
80 Ga0070682_101379448 3300005337 Bacteria 602
81 Ga0070682_101964132 3300005337 Bacteria 514
82 Ga0068868_100021507 3300005338 Bacteria 4857
83 Ga0068868_100734323 3300005338 Bacteria 886
84 Ga0068868_101098906 3300005338 Bacteria 731
85 Ga0068868_101126186 3300005338 Bacteria 723
86 Ga0068868_102431636 3300005338 Bacteria 500
87 Ga0070660_100001324 3300005339 Bacteria 16829
88 Ga0070660_100051230 3300005339 Bacteria 3178
89 Ga0070660_100659389 3300005339 Bacteria 876
90 Ga0070660_101228290 3300005339 Bacteria 635
91 Ga0070660_101680789 3300005339 Bacteria 540
92 Ga0070660_101717507 3300005339 Bacteria 535
93 Ga0070660_101831593 3300005339 Bacteria 517
94 Ga0070689_100060425 3300005340 Bacteria 2947
95 Ga0070689_101284078 3300005340 Bacteria 659
96 Ga0070689_102017290 3300005340 Bacteria 528
97 Ga0070691_10000386 3300005341 Bacteria 16019
98 Ga0070691_10000795 3300005341 Bacteria 12588
99 Ga0070687_100164833 3300005343 Bacteria 1313
100 Ga0070687_100366271 3300005343 Bacteria 934
101 Ga0070661_100134242 3300005344 Bacteria 1861
102 Ga0070661_100376345 3300005344 Bacteria 1118
103 Ga0070661_100988733 3300005344 Bacteria 697
104 Ga0070661_101169555 3300005344 Bacteria 642
105 Ga0070692_10232205 3300005345 Bacteria 1096
106 Ga0070668_100662884 3300005347 Bacteria 918
107 Ga0070668_100844572 3300005347 Bacteria 816
108 Ga0070668_101083206 3300005347 Bacteria 723
109 Ga0070668_101476648 3300005347 Bacteria 621
110 Ga0070668_101918602 3300005347 Bacteria 546
111 Ga0070669_100019075 3300005353 Bacteria 4902
112 Ga0070669_100311201 3300005353 Bacteria 1270
113 Ga0070669_101360044 3300005353 Bacteria 616
114 Ga0070675_100227378 3300005354 Bacteria 1626
115 Ga0070675_100228176 3300005354 Bacteria 1624
116 Ga0070675_100515280 3300005354 Bacteria 1079
117 Ga0070675_100868114 3300005354 Bacteria 826
118 Ga0070671_100001396 3300005355 Bacteria 18034
119 Ga0070671_101941644 3300005355 Bacteria 524
120 Ga0070674_100238459 3300005356 Bacteria 1422
121 Ga0070674_101113373 3300005356 Bacteria 698
122 Ga0070674_102148098 3300005356 Bacteria 509
123 Ga0070673_101117438 3300005364 Bacteria 737
124 Ga0070688_100173219 3300005365 Bacteria 1491
125 Ga0070688_100272178 3300005365 Bacteria 1214
126 Ga0070688_100627123 3300005365 Bacteria 825
127 Ga0070659_100018128 3300005366 Bacteria 5309
128 Ga0070659_100640375 3300005366 Bacteria 916
129 Ga0070659_101338197 3300005366 Bacteria 636
130 Ga0070667_100000264 3300005367 Bacteria 59426
131 Ga0070667_100417406 3300005367 Bacteria 1223
132 Ga0070667_100689703 3300005367 Bacteria 944
133 Ga0070667_101143834 3300005367 Bacteria 728
134 Ga0070667_101302292 3300005367 Bacteria 681
135 Ga0070667_102057871 3300005367 Bacteria 538
136 Ga0070709_10003511 3300005434 Bacteria 8423
137 Ga0070709_10029058 3300005434 Bacteria 3303
138 Ga0070709_10302961 3300005434 Bacteria 1168
139 Ga0070709_10317157 3300005434 Bacteria 1143
140 Ga0070709_10740342 3300005434 Bacteria 767
141 Ga0070714_100011419 3300005435 Bacteria 7044
142 Ga0070714_100524404 3300005435 Bacteria 1132
143 Ga0070714_100536585 3300005435 Bacteria 1119
144 Ga0070714_100551229 3300005435 Bacteria 1104
145 Ga0070714_101834831 3300005435 Bacteria 592
146 Ga0070714_102338122 3300005435 Bacteria 520
147 Ga0070713_100000012 3300005436 Bacteria 137708
148 Ga0070713_100689694 3300005436 Bacteria 975
149 Ga0070713_100835800 3300005436 Bacteria 884
150 Ga0070713_101029602 3300005436 Bacteria 795
151 Ga0070713_101970965 3300005436 Bacteria 566
152 Ga0070710_10380241 3300005437 Bacteria 942
153 Ga0070701_10190934 3300005438 Bacteria 1205
154 Ga0070701_10692576 3300005438 Bacteria 685
155 Ga0070701_10806812 3300005438 Bacteria 641
156 Ga0070711_100047699 3300005439 Bacteria 2926
157 Ga0070711_100096800 3300005439 Bacteria 2139
158 Ga0070711_101004960 3300005439 Bacteria 716
159 Ga0070705_100058504 3300005440 Bacteria 2278
160 Ga0070705_100245882 3300005440 Bacteria 1253
161 Ga0070705_100517257 3300005440 Bacteria 909
162 Ga0070700_100821894 3300005441 Bacteria 750
163 Ga0070700_101224337 3300005441 Bacteria 628
164 Ga0070694_100171499 3300005444 Bacteria 1599
165 Ga0070694_100428657 3300005444 Bacteria 1040
166 Ga0070708_100364942 3300005445 Bacteria 1361
167 Ga0070708_102235854 3300005445 Bacteria 505
168 Ga0070663_100025785 3300005455 Bacteria 3973
169 Ga0070663_100099452 3300005455 Bacteria 2168
170 Ga0070663_100257055 3300005455 Bacteria 1384
171 Ga0070663_101560774 3300005455 Bacteria 588
172 Ga0070663_101568088 3300005455 Bacteria 587
173 Ga0070678_100063732 3300005456 Bacteria 2729
174 Ga0070678_100120481 3300005456 Bacteria 2068
175 Ga0070678_100146094 3300005456 Bacteria 1899
176 Ga0070678_100339394 3300005456 Bacteria 1288
177 Ga0070678_100369055 3300005456 Bacteria 1239
178 Ga0070678_100430696 3300005456 Bacteria 1152
179 Ga0070678_100464119 3300005456 Bacteria 1111
180 Ga0070678_101106020 3300005456 Bacteria 732
181 Ga0070662_100153489 3300005457 Bacteria 1795
182 Ga0070681_10000037 3300005458 Bacteria 96087
183 Ga0070681_10029349 3300005458 Bacteria 5523
184 Ga0070681_10126477 3300005458 Bacteria 2488
185 Ga0070681_10234315 3300005458 Bacteria 1750
186 Ga0070681_10315185 3300005458 Bacteria 1473
187 Ga0070681_11856747 3300005458 Bacteria 530
188 Ga0068867_100035463 3300005459 Bacteria 3618
189 Ga0068867_100150220 3300005459 Bacteria 1829
190 Ga0068867_100971319 3300005459 Bacteria 768
191 Ga0068867_101526565 3300005459 Bacteria 623
192 Ga0070685_10811086 3300005466 Bacteria 691
193 Ga0070706_100392904 3300005467 Bacteria 1291
194 Ga0070707_100076529 3300005468 Bacteria 3228
195 Ga0070698_100149880 3300005471 Bacteria 2280
196 Ga0070679_100008411 3300005530 Bacteria 9712
197 Ga0070679_100035943 3300005530 Bacteria 4915
198 Ga0070679_100057285 3300005530 Bacteria 3884
199 Ga0070679_100084772 3300005530 Bacteria 3156
200 Ga0070679_100219292 3300005530 Bacteria 1864
201 Ga0070679_100467057 3300005530 Bacteria 1206
202 Ga0070679_100492885 3300005530 Bacteria 1169
203 Ga0070679_101008351 3300005530 Bacteria 777
204 Ga0070679_101249348 3300005530 Bacteria 688
205 Ga0070679_101411516 3300005530 Bacteria 643
206 Ga0070684_100046281 3300005535 Bacteria 3769
207 Ga0070684_100058335 3300005535 Bacteria 3374
208 Ga0070684_100075494 3300005535 Bacteria 2973
209 Ga0070684_100446183 3300005535 Bacteria 1196
210 Ga0070684_100986294 3300005535 Bacteria 791
211 Ga0070684_102008232 3300005535 Bacteria 546
212 Ga0070684_102009842 3300005535 Bacteria 546
213 Ga0070697_101033534 3300005536 Bacteria 731
214 Ga0068853_100002020 3300005539 Bacteria 15004
215 Ga0068853_100002660 3300005539 Bacteria 13466
216 Ga0068853_100002850 3300005539 Bacteria 13105
217 Ga0068853_100246205 3300005539 Bacteria 1639
218 Ga0068853_100261070 3300005539 Bacteria 1592
219 Ga0068853_100505804 3300005539 Bacteria 1141
220 Ga0068853_100542024 3300005539 Bacteria 1101
221 Ga0068853_100732017 3300005539 Bacteria 945
222 Ga0068853_101606880 3300005539 Bacteria 630
223 Ga0068853_101883767 3300005539 Bacteria 580
224 Ga0068853_102213377 3300005539 Bacteria 533
225 Ga0070672_100102627 3300005543 Bacteria 2321
226 Ga0070672_100180803 3300005543 Bacteria 1757
227 Ga0070672_100486106 3300005543 Bacteria 1067
228 Ga0070672_100585659 3300005543 Bacteria 971
229 Ga0070686_100016687 3300005544 Bacteria 4276
230 Ga0070695_100003098 3300005545 Bacteria 9679
231 Ga0070695_100074248 3300005545 Bacteria 2234
232 Ga0070695_100367732 3300005545 Bacteria 1082
233 Ga0070695_101414852 3300005545 Bacteria 577
234 Ga0070696_100043134 3300005546 Bacteria 3120
235 Ga0070693_100640849 3300005547 Bacteria 772
236 Ga0070693_100704176 3300005547 Bacteria 740
237 Ga0070693_100901271 3300005547 Bacteria 663
238 Ga0070693_100961721 3300005547 Bacteria 644
239 Ga0070693_101164234 3300005547 Bacteria 591
240 Ga0070693_101421878 3300005547 Bacteria 540
241 Ga0070665_100014624 3300005548 Bacteria 7876
242 Ga0070665_100116987 3300005548 Bacteria 2668
243 Ga0070665_100133004 3300005548 Bacteria 2489
244 Ga0070665_100240462 3300005548 Bacteria 1811
245 Ga0070665_100260774 3300005548 Bacteria 1734
246 Ga0070665_100316206 3300005548 Bacteria 1565
247 Ga0070665_100515389 3300005548 Bacteria 1207
248 Ga0070665_101554983 3300005548 Bacteria 670
249 Ga0070704_100310320 3300005549 Bacteria 1318
250 Ga0070704_100483519 3300005549 Bacteria 1072
251 Ga0068855_100000266 3300005563 Bacteria 65127
252 Ga0068855_100012001 3300005563 Bacteria 10474
253 Ga0068855_100057023 3300005563 Bacteria 4580
254 Ga0068855_100102876 3300005563 Bacteria 3287
255 Ga0068855_100152247 3300005563 Bacteria 2629
256 Ga0068855_100153786 3300005563 Bacteria 2614
257 Ga0068855_100348946 3300005563 Bacteria 1630
258 Ga0068855_100406348 3300005563 Bacteria 1491
259 Ga0068855_100611332 3300005563 Bacteria 1174
260 Ga0068855_100843113 3300005563 Bacteria 972
261 Ga0068855_100903953 3300005563 Bacteria 932
262 Ga0068855_101090663 3300005563 Bacteria 835
263 Ga0068855_101317446 3300005563 Bacteria 747
264 Ga0068855_101741400 3300005563 Bacteria 634
265 Ga0070664_101022723 3300005564 Bacteria 777
266 Ga0068857_100007896 3300005577 Bacteria 9178
267 Ga0068857_100131593 3300005577 Bacteria 2256
268 Ga0068857_100217230 3300005577 Bacteria 1746
269 Ga0068857_100434573 3300005577 Bacteria 1225
270 Ga0068857_101384140 3300005577 Bacteria 684
271 Ga0068854_100207776 3300005578 Bacteria 1543
272 Ga0068854_101109969 3300005578 Bacteria 705
273 Ga0068854_101142297 3300005578 Bacteria 696
274 Ga0068854_102125146 3300005578 Bacteria 519
275 Ga0068856_100001032 3300005614 Bacteria 29659
276 Ga0068856_100009234 3300005614 Bacteria 9591
277 Ga0068856_100034393 3300005614 Bacteria 4964
278 Ga0068856_100056835 3300005614 Bacteria 3862
279 Ga0068856_100058503 3300005614 Bacteria 3806
280 Ga0068856_100106915 3300005614 Bacteria 2793
281 Ga0068856_100180882 3300005614 Bacteria 2121
282 Ga0068856_100454497 3300005614 Bacteria 1302
283 Ga0068856_100501716 3300005614 Bacteria 1234
284 Ga0068856_100672486 3300005614 Bacteria 1056
285 Ga0068856_100717938 3300005614 Bacteria 1020
286 Ga0068856_101441540 3300005614 Bacteria 703
287 Ga0068856_101481333 3300005614 Bacteria 693
288 Ga0068856_101581582 3300005614 Bacteria 669
289 Ga0068856_101595886 3300005614 Bacteria 666
290 Ga0068856_101698402 3300005614 Bacteria 644
291 Ga0068856_101878950 3300005614 Bacteria 610
292 Ga0070702_100159510 3300005615 Bacteria 1456
293 Ga0070702_100327833 3300005615 Bacteria 1069
294 Ga0070702_101303169 3300005615 Bacteria 590
295 Ga0068852_100006800 3300005616 Bacteria 8301
296 Ga0068852_100136255 3300005616 Bacteria 2267
297 Ga0068852_100287982 3300005616 Bacteria 1586
298 Ga0068852_100452675 3300005616 Bacteria 1271
299 Ga0068852_100620931 3300005616 Bacteria 1086
300 Ga0068852_100813977 3300005616 Bacteria 949
301 Ga0068852_100817674 3300005616 Bacteria 946
302 Ga0068852_101238213 3300005616 Bacteria 768
303 Ga0068852_102689900 3300005616 Bacteria 517
304 Ga0068852_102701910 3300005616 Bacteria 515
305 Ga0068859_100001281 3300005617 Bacteria 25688
306 Ga0068859_100042834 3300005617 Bacteria 4548
307 Ga0068859_100935628 3300005617 Bacteria 950
308 Ga0068859_101482467 3300005617 Bacteria 749
309 Ga0068859_102320026 3300005617 Bacteria 592
310 Ga0068864_100218441 3300005618 Bacteria 1758
311 Ga0068864_100614562 3300005618 Bacteria 1056
312 Ga0068864_101771474 3300005618 Bacteria 623
313 Ga0068864_101908929 3300005618 Bacteria 600
314 Ga0068864_102436329 3300005618 Bacteria 530
315 Ga0068866_10028876 3300005718 Bacteria 2647
316 Ga0068866_10354506 3300005718 Bacteria 933
317 Ga0068861_100025699 3300005719 Bacteria 4274
318 Ga0068861_100234091 3300005719 Bacteria 1559
319 Ga0068861_100481175 3300005719 Bacteria 1119
320 Ga0068861_100775180 3300005719 Bacteria 898
321 Ga0068861_100783058 3300005719 Bacteria 894
322 Ga0068861_100790701 3300005719 Bacteria 890
323 Ga0068861_101022611 3300005719 Bacteria 790
324 Ga0068851_10169615 3300005834 Bacteria 1204
325 Ga0068870_10172786 3300005840 Bacteria 1291
326 Ga0068863_100169945 3300005841 Bacteria 2091
327 Ga0068863_100663928 3300005841 Bacteria 1034
328 Ga0068863_100720801 3300005841 Bacteria 992
329 Ga0068863_100889396 3300005841 Bacteria 891
330 Ga0068863_101284882 3300005841 Bacteria 738
331 Ga0068863_101359979 3300005841 Bacteria 717
332 Ga0068863_102132528 3300005841 Bacteria 570
333 Ga0068858_100201140 3300005842 Bacteria 1884
334 Ga0068858_100311797 3300005842 Bacteria 1502
335 Ga0068858_100523629 3300005842 Bacteria 1147
336 Ga0068858_101825677 3300005842 Bacteria 601
337 Ga0068860_100074863 3300005843 Bacteria 3220
338 Ga0068860_100306771 3300005843 Bacteria 1556
339 Ga0068860_100668858 3300005843 Bacteria 1047
340 Ga0068860_101044268 3300005843 Bacteria 836
341 Ga0068860_101313994 3300005843 Bacteria 744
342 Ga0068860_101383927 3300005843 Bacteria 725
343 Ga0068860_101666537 3300005843 Bacteria 660
344 Ga0068862_100153862 3300005844 Bacteria 2049
345 Ga0068862_100208382 3300005844 Bacteria 1766
346 Ga0068862_100475543 3300005844 Bacteria 1182
347 Ga0068862_102267421 3300005844 Bacteria 554
348 Ga0081455_10594441 3300005937 Bacteria 723
349 Ga0081455_10599981 3300005937 Bacteria 718
350 Ga0081540_1073511 3300005983 Bacteria 1570
351 Ga0070717_10381674 3300006028 Bacteria 1264
352 Ga0070717_10401963 3300006028 Bacteria 1231
353 Ga0070717_10729257 3300006028 Bacteria 901
354 Ga0075368_10043676 3300006042 Bacteria 1766
355 Ga0075363_100371062 3300006048 Bacteria 838
356 Ga0075364_10001038 3300006051 Bacteria 14772
357 Ga0075364_10037544 3300006051 Bacteria 3137
358 Ga0070715_10538733 3300006163 Bacteria 675
359 Ga0070716_100046578 3300006173 Bacteria 2441
360 Ga0070712_100000902 3300006175 Bacteria 17764
361 Ga0070712_100004052 3300006175 Bacteria 8996
362 Ga0070712_100090345 3300006175 Bacteria 2242
363 Ga0070712_100497089 3300006175 Bacteria 1022
364 Ga0070712_101715197 3300006175 Bacteria 550
365 Ga0075362_10754663 3300006177 Bacteria 510
366 Ga0075367_10001012 3300006178 Bacteria 11557
367 Ga0075367_10025225 3300006178 Bacteria 3360
368 Ga0075367_10214038 3300006178 Bacteria 1205
369 Ga0075367_10573759 3300006178 Bacteria 717
370 Ga0075367_10945544 3300006178 Bacteria 550
371 Ga0075369_10017712 3300006186 Bacteria 2893
372 Ga0075369_10170368 3300006186 Bacteria 1000
373 Ga0075366_10035947 3300006195 Bacteria 2920
374 Ga0075366_10076481 3300006195 Bacteria 1998
375 Ga0075366_10107452 3300006195 Bacteria 1678
376 Ga0075366_10116451 3300006195 Bacteria 1609
377 Ga0075366_10155782 3300006195 Bacteria 1383
378 Ga0075366_10158180 3300006195 Bacteria 1373
379 Ga0075366_10179631 3300006195 Bacteria 1285
380 Ga0075366_10306970 3300006195 Bacteria 971
381 Ga0097621_100014459 3300006237 Bacteria 5906
382 Ga0097621_100198649 3300006237 Bacteria 1740
383 Ga0097621_100210269 3300006237 Bacteria 1692
384 Ga0097621_100245519 3300006237 Bacteria 1566
385 Ga0097621_100427527 3300006237 Bacteria 1190
386 Ga0097621_100575850 3300006237 Bacteria 1027
387 Ga0097621_100647350 3300006237 Bacteria 969
388 Ga0097621_100690917 3300006237 Bacteria 939
389 Ga0097621_101129412 3300006237 Bacteria 736
390 Ga0097621_102337467 3300006237 Bacteria 511
391 Ga0075370_10054879 3300006353 Bacteria 2263
392 Ga0068871_100017488 3300006358 Bacteria 5427
393 Ga0068871_100197095 3300006358 Bacteria 1737
394 Ga0068871_100390975 3300006358 Bacteria 1237
395 Ga0068871_100549564 3300006358 Bacteria 1046
396 Ga0068871_100687431 3300006358 Bacteria 936
397 Ga0068871_100928525 3300006358 Bacteria 808
398 Ga0068871_101185736 3300006358 Bacteria 716
399 Ga0075428_101644800 3300006844 Bacteria 671
400 Ga0075428_102358057 3300006844 Bacteria 547
401 Ga0075430_101228452 3300006846 Bacteria 617
402 Ga0075433_10288233 3300006852 Bacteria 1454
403 Ga0075434_100129075 3300006871 Bacteria 2546
404 Ga0075429_100099513 3300006880 Bacteria 2537
405 Ga0075429_100242965 3300006880 Bacteria 1577
406 Ga0068865_100071202 3300006881 Bacteria 2466
407 Ga0068865_100473020 3300006881 Bacteria 1040
408 Ga0068865_100565165 3300006881 Bacteria 957
409 Ga0068865_100756534 3300006881 Bacteria 835
410 Ga0068865_101357384 3300006881 Bacteria 633
411 Ga0075436_100002564 3300006914 Bacteria 12509
412 Ga0075436_100019157 3300006914 Bacteria 4689
413 Ga0075436_100098312 3300006914 Bacteria 2037
414 Ga0075436_100813804 3300006914 Bacteria 696
415 Ga0097620_100001281 3300006931 Bacteria 25688
416 Ga0097620_100042837 3300006931 Bacteria 4548
417 Ga0097620_100379189 3300006931 Bacteria 1510
418 Ga0097620_100935624 3300006931 Bacteria 950
419 Ga0097620_101482226 3300006931 Bacteria 749
420 Ga0097620_102320136 3300006931 Bacteria 592
421 Ga0075435_100104949 3300007076 Bacteria 2345
422 Ga0075435_100137181 3300007076 Bacteria 2050
423 Ga0075435_100198784 3300007076 Bacteria 1698
424 Ga0075435_100359896 3300007076 Bacteria 1248
425 Ga0105250_10260048 3300009092 Bacteria 743
426 Ga0105250_10270458 3300009092 Bacteria 730
427 Ga0105240_10000795 3300009093 Bacteria 57129
428 Ga0105240_10004696 3300009093 Bacteria 20647
429 Ga0105240_10017473 3300009093 Bacteria 9666
430 Ga0105240_10273726 3300009093 Bacteria 1943
431 Ga0105240_10632833 3300009093 Bacteria 1174
432 Ga0105240_10798295 3300009093 Bacteria 1023
433 Ga0105240_11020127 3300009093 Bacteria 884
434 Ga0105240_11185643 3300009093 Bacteria 809
435 Ga0105240_11427260 3300009093 Bacteria 727
436 Ga0105240_11557839 3300009093 Bacteria 692
437 Ga0105240_12463727 3300009093 Bacteria 538
438 Ga0105240_12510524 3300009093 Bacteria 533
439 Ga0105240_12778556 3300009093 Bacteria 504
440 Ga0111539_10050779 3300009094 Bacteria 4941
441 Ga0111539_10140381 3300009094 Bacteria 2829
442 Ga0111539_10156432 3300009094 Bacteria 2667
443 Ga0111539_10165120 3300009094 Bacteria 2589
444 Ga0111539_10272780 3300009094 Bacteria 1969
445 Ga0111539_10699183 3300009094 Bacteria 1180
446 Ga0111539_10703475 3300009094 Bacteria 1176
447 Ga0111539_11734057 3300009094 Bacteria 724
448 Ga0111539_12752674 3300009094 Bacteria 570
449 Ga0105245_10003702 3300009098 Bacteria 13642
450 Ga0105245_10042887 3300009098 Bacteria 4035
451 Ga0105245_10057540 3300009098 Bacteria 3497
452 Ga0105245_10236797 3300009098 Bacteria 1768
453 Ga0105245_11127055 3300009098 Bacteria 831
454 Ga0105245_11609788 3300009098 Bacteria 701
455 Ga0105245_12029068 3300009098 Bacteria 629
456 Ga0105245_12778195 3300009098 Bacteria 542
457 Ga0105245_12780844 3300009098 Bacteria 542
458 Ga0105247_10001485 3300009101 Bacteria 16868
459 Ga0105247_10041573 3300009101 Bacteria 2814
460 Ga0105247_10609112 3300009101 Bacteria 811
461 Ga0105247_11051255 3300009101 Bacteria 639
462 Ga0105243_10037311 3300009148 Bacteria 3776
463 Ga0105243_10186214 3300009148 Bacteria 1809
464 Ga0105243_10202972 3300009148 Bacteria 1740
465 Ga0105243_12354829 3300009148 Bacteria 570
466 Ga0105241_10047989 3300009174 Bacteria 3248
467 Ga0105241_10083130 3300009174 Bacteria 2511
468 Ga0105241_10174638 3300009174 Bacteria 1777
469 Ga0105241_10181427 3300009174 Bacteria 1747
470 Ga0105241_10515910 3300009174 Bacteria 1068
471 Ga0105241_11019538 3300009174 Bacteria 775
472 Ga0105241_11297195 3300009174 Bacteria 693
473 Ga0105241_12367744 3300009174 Bacteria 529
474 Ga0105242_10044757 3300009176 Bacteria 3585
475 Ga0105242_10176597 3300009176 Bacteria 1881
476 Ga0105242_10190451 3300009176 Bacteria 1815
477 Ga0105242_10545713 3300009176 Bacteria 1111
478 Ga0105242_10916566 3300009176 Bacteria 878
479 Ga0105242_11510832 3300009176 Bacteria 703
480 Ga0105242_11621797 3300009176 Bacteria 681
481 Ga0105242_12080104 3300009176 Bacteria 611
482 Ga0105242_12838952 3300009176 Bacteria 535
483 Ga0105248_10000005 3300009177 Bacteria 673111
484 Ga0105248_10196603 3300009177 Bacteria 2272
485 Ga0105248_10849088 3300009177 Bacteria 1031
486 Ga0105248_11023283 3300009177 Bacteria 933
487 Ga0105248_11855779 3300009177 Bacteria 684
488 Ga0105237_10002220 3300009545 Bacteria 24289
489 Ga0105237_10032303 3300009545 Bacteria 5300
490 Ga0105237_10053645 3300009545 Bacteria 4043
491 Ga0105237_10270358 3300009545 Bacteria 1703
492 Ga0105237_10276820 3300009545 Bacteria 1680
493 Ga0105237_10352289 3300009545 Bacteria 1476
494 Ga0105237_11055521 3300009545 Bacteria 819
495 Ga0105237_11150289 3300009545 Bacteria 783
496 Ga0105237_11267325 3300009545 Bacteria 744
497 Ga0105237_11817798 3300009545 Bacteria 617
498 Ga0105237_12314678 3300009545 Bacteria 547
499 Ga0105238_10001939 3300009551 Bacteria 20807
500 Ga0105238_10020343 3300009551 Bacteria 6756
501 Ga0105238_10035831 3300009551 Bacteria 5044
502 Ga0105238_10056048 3300009551 Bacteria 3954
503 Ga0105238_10119819 3300009551 Bacteria 2611
504 Ga0105238_10145915 3300009551 Bacteria 2343
505 Ga0105238_10212861 3300009551 Bacteria 1909
506 Ga0105238_10459356 3300009551 Bacteria 1271
507 Ga0105238_10602342 3300009551 Bacteria 1107
508 Ga0105238_10742030 3300009551 Bacteria 995
509 Ga0105238_10777081 3300009551 Bacteria 972
510 Ga0105238_10812446 3300009551 Bacteria 951
511 Ga0105238_12061443 3300009551 Bacteria 604
512 Ga0105249_11821929 3300009553 Bacteria 681
513 Ga0105249_12298625 3300009553 Bacteria 612
514 Ga0105249_13021379 3300009553 Bacteria 540
515 Ga0105028_114477 3300009993 Bacteria 837
516 Ga0105239_10026360 3300010375 Bacteria 6397
517 Ga0105239_10028473 3300010375 Bacteria 6145
518 Ga0105239_10060445 3300010375 Bacteria 4159
519 Ga0105239_10104618 3300010375 Bacteria 3134
520 Ga0105239_10537215 3300010375 Bacteria 1331
521 Ga0105239_10961555 3300010375 Bacteria 981
522 Ga0105239_11007657 3300010375 Bacteria 958
523 Ga0105239_11719347 3300010375 Bacteria 726
524 Ga0105239_11733662 3300010375 Bacteria 723
525 Ga0105239_13114768 3300010375 Bacteria 540
526 Ga0105246_10371582 3300011119 Bacteria 1178
527 Ga0105246_10721512 3300011119 Bacteria 876
528 Ga0105246_11449667 3300011119 Bacteria 643
529 Ga0157373_10000820 3300013100 Bacteria 24076
530 Ga0157373_10049430 3300013100 Bacteria 2997
531 Ga0157373_10529297 3300013100 Bacteria 853
532 Ga0157373_11388550 3300013100 Bacteria 534
533 Ga0157371_10077470 3300013102 Bacteria 2354
534 Ga0157371_10254833 3300013102 Bacteria 1264
535 Ga0157371_10429515 3300013102 Bacteria 969
536 Ga0157371_10697038 3300013102 Bacteria 760
537 Ga0157371_11181467 3300013102 Bacteria 589
538 Ga0157370_10003448 3300013104 Bacteria 18559
539 Ga0157370_10040902 3300013104 Bacteria 4474
540 Ga0157370_10308418 3300013104 Bacteria 1461
541 Ga0157370_10457613 3300013104 Bacteria 1173
542 Ga0157370_10598420 3300013104 Bacteria 1010
543 Ga0157370_10709655 3300013104 Bacteria 918
544 Ga0157370_11157073 3300013104 Bacteria 698
545 Ga0157370_11311568 3300013104 Bacteria 652
546 Ga0157369_10001535 3300013105 Bacteria 28280
547 Ga0157369_10150003 3300013105 Bacteria 2464
548 Ga0157369_10243522 3300013105 Bacteria 1878
549 Ga0157369_10762523 3300013105 Bacteria 995
550 Ga0157369_12282312 3300013105 Bacteria 548
551 Ga0157374_10054827 3300013296 Bacteria 3720
552 Ga0157374_10674279 3300013296 Bacteria 1046
553 Ga0157374_10789257 3300013296 Bacteria 965
554 Ga0157374_10881780 3300013296 Bacteria 912
555 Ga0157374_11171520 3300013296 Bacteria 790
556 Ga0157374_11813368 3300013296 Bacteria 635
557 Ga0157374_12364951 3300013296 Bacteria 559
558 Ga0157378_10558165 3300013297 Bacteria 1151
559 Ga0157378_10578343 3300013297 Bacteria 1132
560 Ga0157378_10693388 3300013297 Bacteria 1037
561 Ga0157378_11128321 3300013297 Bacteria 822
562 Ga0157378_11667835 3300013297 Bacteria 684
563 Ga0157378_11741264 3300013297 Bacteria 671
564 Ga0157378_11778809 3300013297 Bacteria 664
565 Ga0163162_10080358 3300013306 Bacteria 3328
566 Ga0163162_10386848 3300013306 Bacteria 1532
567 Ga0163162_11012996 3300013306 Bacteria 939
568 Ga0157372_10059581 3300013307 Bacteria 4270
569 Ga0157372_10161422 3300013307 Bacteria 2590
570 Ga0157372_10352103 3300013307 Bacteria 1716
571 Ga0157372_10427269 3300013307 Bacteria 1544
572 Ga0157372_10502349 3300013307 Bacteria 1414
573 Ga0157372_10926981 3300013307 Bacteria 1010
574 Ga0157372_11286204 3300013307 Bacteria 844
575 Ga0157372_11374248 3300013307 Bacteria 814
576 Ga0157372_11894393 3300013307 Bacteria 685
577 Ga0157372_12619924 3300013307 Bacteria 579
578 Ga0157375_10768689 3300013308 Bacteria 1114
579 Ga0157375_11593235 3300013308 Bacteria 772
580 Ga0157375_12928559 3300013308 Bacteria 570
581 Ga0157375_13646614 3300013308 Bacteria 512
582 Ga0163163_10008003 3300014325 Bacteria 9355
583 Ga0163163_10009581 3300014325 Bacteria 8656
584 Ga0163163_10056493 3300014325 Bacteria 3880
585 Ga0163163_10517871 3300014325 Bacteria 1255
586 Ga0163163_10533382 3300014325 Bacteria 1236
587 Ga0163163_10993552 3300014325 Bacteria 902
588 Ga0163163_11579463 3300014325 Bacteria 717
589 Ga0163163_12198364 3300014325 Bacteria 611
590 Ga0163163_12687902 3300014325 Bacteria 555
591 Ga0163163_12981265 3300014325 Bacteria 528
592 Ga0157380_10190356 3300014326 Bacteria 1811
593 Ga0157380_10198169 3300014326 Bacteria 1779
594 Ga0157380_10313692 3300014326 Bacteria 1451
595 Ga0182008_10205188 3300014497 Bacteria 1004
596 Ga0182008_10398681 3300014497 Bacteria 739
597 Ga0157379_10018151 3300014968 Bacteria 6200
598 Ga0157379_10018171 3300014968 Bacteria 6195
599 Ga0157379_10038101 3300014968 Bacteria 4289
600 Ga0157379_10041021 3300014968 Bacteria 4131
601 Ga0157379_10254063 3300014968 Bacteria 1596
602 Ga0157379_10694934 3300014968 Bacteria 954
603 Ga0157379_11561156 3300014968 Bacteria 644
604 Ga0157379_11748817 3300014968 Bacteria 610
605 Ga0157379_12166507 3300014968 Bacteria 552
606 Ga0157376_10072267 3300014969 Bacteria 2934
607 Ga0157376_10268789 3300014969 Bacteria 1601
608 Ga0157376_10607551 3300014969 Bacteria 1089
609 Ga0157376_10755899 3300014969 Bacteria 982
610 Ga0157376_10783984 3300014969 Bacteria 965
611 Ga0157376_11362533 3300014969 Bacteria 740
612 Ga0157376_11437631 3300014969 Bacteria 722
613 Ga0157376_12141807 3300014969 Bacteria 598
614 Ga0157376_12411156 3300014969 Bacteria 566
615 Ga0157376_12789347 3300014969 Bacteria 528
616 Ga0182007_10118528 3300015262 Bacteria 884
617 Ga0182007_10316487 3300015262 Bacteria 577
618 Ga0182005_1076503 3300015265 Bacteria 922
619 Ga0163161_10262539 3300017792 Bacteria 1349
620 Ga0163161_10681539 3300017792 Bacteria 854
621 Ga0163161_10896391 3300017792 Bacteria 751
622 Ga0206356_10984312 3300020070 Bacteria 711
623 Ga0206352_10757005 3300020078 Bacteria 1122
624 Ga0213874_10194127 3300021377 Bacteria 728
625 Ga0213876_10173681 3300021384 Bacteria 1147
626 Ga0213876_10203418 3300021384 Bacteria 1053
627 Ga0213876_10403726 3300021384 Bacteria 727
628 Ga0213871_10138395 3300021441 Bacteria 735
629 Ga0213871_10154721 3300021441 Bacteria 699
630 Ga0209026_1006530 3300025250 Bacteria 2830
631 Ga0209233_1000013 3300025261 Bacteria 1013785
632 Ga0209758_1000013 3300025297 Bacteria 873003
633 Ga0209758_1115838 3300025297 Bacteria 733
634 Ga0207697_10056445 3300025315 Bacteria 1629
635 Ga0207697_10447666 3300025315 Bacteria 573
636 Ga0207696_1126183 3300025711 Bacteria 689
637 Ga0207682_10051864 3300025893 Bacteria 1700
638 Ga0207692_10279642 3300025898 Bacteria 1009
639 Ga0207692_10375142 3300025898 Bacteria 882
640 Ga0207692_10385918 3300025898 Bacteria 870
641 Ga0207642_10052412 3300025899 Bacteria 1851
642 Ga0207710_10008638 3300025900 Bacteria 4295
643 Ga0207710_10348264 3300025900 Bacteria 754
644 Ga0207688_10115856 3300025901 Bacteria 1560
645 Ga0207680_10191580 3300025903 Bacteria 1388
646 Ga0207680_10259710 3300025903 Bacteria 1202
647 Ga0207647_10228311 3300025904 Bacteria 1071
648 Ga0207699_10000164 3300025906 Bacteria 41177
649 Ga0207699_10068253 3300025906 Bacteria 2165
650 Ga0207699_10081049 3300025906 Bacteria 2012
651 Ga0207699_10178109 3300025906 Bacteria 1427
652 Ga0207645_10010484 3300025907 Bacteria 6361
653 Ga0207645_10180997 3300025907 Bacteria 1383
654 Ga0207643_10071361 3300025908 Bacteria 1999
655 Ga0207705_10000180 3300025909 Bacteria 66404
656 Ga0207705_10004720 3300025909 Bacteria 10265
657 Ga0207705_10026045 3300025909 Bacteria 4173
658 Ga0207705_10098564 3300025909 Bacteria 2148
659 Ga0207705_10163916 3300025909 Bacteria 1671
660 Ga0207705_10324341 3300025909 Bacteria 1184
661 Ga0207705_10500986 3300025909 Bacteria 943
662 Ga0207705_11223697 3300025909 Bacteria 575
663 Ga0207684_10234957 3300025910 Bacteria 1582
664 Ga0207654_10027363 3300025911 Bacteria 3098
665 Ga0207654_10047435 3300025911 Bacteria 2454
666 Ga0207654_10133125 3300025911 Bacteria 1576
667 Ga0207654_10258128 3300025911 Bacteria 1171
668 Ga0207654_10996631 3300025911 Bacteria 609
669 Ga0207654_11393918 3300025911 Bacteria 511
670 Ga0207707_10000011 3300025912 Bacteria 282857
671 Ga0207707_10002211 3300025912 Bacteria 17599
672 Ga0207707_10055935 3300025912 Bacteria 3432
673 Ga0207707_10379438 3300025912 Bacteria 1215
674 Ga0207707_11651296 3300025912 Bacteria 503
675 Ga0207695_10000018 3300025913 Bacteria 766611
676 Ga0207695_10000834 3300025913 Bacteria 57039
677 Ga0207695_10034689 3300025913 Bacteria 5483
678 Ga0207695_10036358 3300025913 Bacteria 5325
679 Ga0207695_10047727 3300025913 Bacteria 4528
680 Ga0207695_10060808 3300025913 Bacteria 3908
681 Ga0207695_10159646 3300025913 Bacteria 2187
682 Ga0207695_10318255 3300025913 Bacteria 1446
683 Ga0207695_10559903 3300025913 Bacteria 1025
684 Ga0207695_10779533 3300025913 Bacteria 836
685 Ga0207671_10000510 3300025914 Bacteria 52543
686 Ga0207671_10006782 3300025914 Bacteria 10121
687 Ga0207671_10016535 3300025914 Bacteria 5730
688 Ga0207671_10288856 3300025914 Bacteria 1294
689 Ga0207671_10289752 3300025914 Bacteria 1292
690 Ga0207671_10375180 3300025914 Bacteria 1130
691 Ga0207671_10590017 3300025914 Bacteria 886
692 Ga0207671_10806160 3300025914 Bacteria 744
693 Ga0207671_11133058 3300025914 Bacteria 614
694 Ga0207693_10001210 3300025915 Bacteria 23009
695 Ga0207693_10001929 3300025915 Bacteria 18163
696 Ga0207693_10037608 3300025915 Bacteria 3814
697 Ga0207693_10235998 3300025915 Bacteria 1436
698 Ga0207693_10811620 3300025915 Bacteria 721
699 Ga0207663_10011662 3300025916 Bacteria 4728
700 Ga0207663_10155878 3300025916 Bacteria 1606
701 Ga0207663_10479651 3300025916 Bacteria 963
702 Ga0207660_10000110 3300025917 Bacteria 46792
703 Ga0207660_10003537 3300025917 Bacteria 10180
704 Ga0207660_10359927 3300025917 Bacteria 1167
705 Ga0207660_10488489 3300025917 Bacteria 998
706 Ga0207660_10807505 3300025917 Bacteria 766
707 Ga0207660_11055973 3300025917 Bacteria 662
708 Ga0207662_10845977 3300025918 Bacteria 646
709 Ga0207657_10000241 3300025919 Bacteria 57958
710 Ga0207657_10043533 3300025919 Bacteria 3954
711 Ga0207657_10223380 3300025919 Bacteria 1508
712 Ga0207657_10513723 3300025919 Bacteria 938
713 Ga0207657_10897946 3300025919 Bacteria 683
714 Ga0207657_10907976 3300025919 Bacteria 678
715 Ga0207657_11193500 3300025919 Bacteria 579
716 Ga0207649_10395807 3300025920 Bacteria 1033
717 Ga0207649_10479676 3300025920 Bacteria 943
718 Ga0207649_10823733 3300025920 Bacteria 725
719 Ga0207652_10000824 3300025921 Bacteria 29561
720 Ga0207652_10001654 3300025921 Bacteria 19554
721 Ga0207652_10211975 3300025921 Bacteria 1744
722 Ga0207652_10230660 3300025921 Bacteria 1669
723 Ga0207652_10245543 3300025921 Bacteria 1614
724 Ga0207652_10303869 3300025921 Bacteria 1440
725 Ga0207652_10460565 3300025921 Bacteria 1146
726 Ga0207652_10791361 3300025921 Bacteria 842
727 Ga0207652_10804641 3300025921 Bacteria 834
728 Ga0207652_11555433 3300025921 Bacteria 565
729 Ga0207646_10094365 3300025922 Bacteria 2679
730 Ga0207681_10373400 3300025923 Bacteria 1146
731 Ga0207681_10411454 3300025923 Bacteria 1094
732 Ga0207681_11750413 3300025923 Bacteria 519
733 Ga0207694_10000010 3300025924 Bacteria 439722
734 Ga0207694_10008694 3300025924 Bacteria 7666
735 Ga0207694_10019794 3300025924 Bacteria 5092
736 Ga0207694_10027389 3300025924 Bacteria 4340
737 Ga0207694_10047803 3300025924 Bacteria 3309
738 Ga0207694_10200439 3300025924 Bacteria 1624
739 Ga0207694_10344284 3300025924 Bacteria 1233
740 Ga0207694_10394442 3300025924 Bacteria 1150
741 Ga0207694_10733665 3300025924 Bacteria 834
742 Ga0207694_10864648 3300025924 Bacteria 764
743 Ga0207650_10048909 3300025925 Bacteria 3120
744 Ga0207650_10265999 3300025925 Bacteria 1392
745 Ga0207650_10297350 3300025925 Bacteria 1318
746 Ga0207650_10389095 3300025925 Bacteria 1152
747 Ga0207650_10464145 3300025925 Bacteria 1055
748 Ga0207650_11503519 3300025925 Bacteria 572
749 Ga0207659_10095005 3300025926 Bacteria 2235
750 Ga0207659_10171687 3300025926 Bacteria 1711
751 Ga0207659_11002531 3300025926 Bacteria 719
752 Ga0207687_10002323 3300025927 Bacteria 12949
753 Ga0207687_10021304 3300025927 Bacteria 4305
754 Ga0207687_10146863 3300025927 Bacteria 1795
755 Ga0207687_10205589 3300025927 Bacteria 1542
756 Ga0207687_11111576 3300025927 Bacteria 679
757 Ga0207687_11354549 3300025927 Bacteria 612
758 Ga0207700_10000295 3300025928 Bacteria 29631
759 Ga0207700_10210184 3300025928 Bacteria 1645
760 Ga0207700_10211171 3300025928 Bacteria 1641
761 Ga0207700_10267533 3300025928 Bacteria 1466
762 Ga0207700_10586744 3300025928 Bacteria 991
763 Ga0207664_10028891 3300025929 Bacteria 4219
764 Ga0207664_10385370 3300025929 Bacteria 1245
765 Ga0207664_10386910 3300025929 Bacteria 1242
766 Ga0207664_10429066 3300025929 Bacteria 1178
767 Ga0207664_10461302 3300025929 Bacteria 1135
768 Ga0207664_11461454 3300025929 Bacteria 605
769 Ga0207664_11557504 3300025929 Bacteria 583
770 Ga0207644_10035600 3300025931 Bacteria 3489
771 Ga0207644_10226445 3300025931 Bacteria 1484
772 Ga0207644_10824129 3300025931 Bacteria 776
773 Ga0207690_10037357 3300025932 Bacteria 3153
774 Ga0207690_10060205 3300025932 Bacteria 2576
775 Ga0207706_10040241 3300025933 Bacteria 4142
776 Ga0207706_10231614 3300025933 Bacteria 1616
777 Ga0207686_10436892 3300025934 Bacteria 1004
778 Ga0207686_11228862 3300025934 Bacteria 614
779 Ga0207709_10022766 3300025935 Bacteria 3557
780 Ga0207670_10000022 3300025936 Bacteria 145904
781 Ga0207670_10026569 3300025936 Bacteria 3649
782 Ga0207670_11648309 3300025936 Bacteria 545
783 Ga0207670_11900115 3300025936 Bacteria 506
784 Ga0207669_10169938 3300025937 Bacteria 1551
785 Ga0207669_10184395 3300025937 Bacteria 1499
786 Ga0207669_11523089 3300025937 Bacteria 570
787 Ga0207704_10068990 3300025938 Bacteria 2232
788 Ga0207704_10243547 3300025938 Bacteria 1345
789 Ga0207704_10319383 3300025938 Bacteria 1197
790 Ga0207704_10561584 3300025938 Bacteria 929
791 Ga0207665_10070338 3300025939 Bacteria 2388
792 Ga0207665_10541432 3300025939 Bacteria 904
793 Ga0207691_10081581 3300025940 Bacteria 2906
794 Ga0207691_10111430 3300025940 Bacteria 2433
795 Ga0207691_10630502 3300025940 Bacteria 906
796 Ga0207691_10665836 3300025940 Bacteria 879
797 Ga0207711_10000002 3300025941 Bacteria 1228676
798 Ga0207711_10096675 3300025941 Bacteria 2607
799 Ga0207711_10286550 3300025941 Bacteria 1517
800 Ga0207711_10709725 3300025941 Bacteria 938
801 Ga0207711_11974168 3300025941 Bacteria 526
802 Ga0207689_10325135 3300025942 Bacteria 1277
803 Ga0207689_10572753 3300025942 Bacteria 949
804 Ga0207689_10919244 3300025942 Bacteria 738
805 Ga0207661_10038767 3300025944 Bacteria 3737
806 Ga0207661_10117898 3300025944 Bacteria 2256
807 Ga0207661_10376877 3300025944 Bacteria 1284
808 Ga0207661_10584044 3300025944 Bacteria 1025
809 Ga0207661_10919077 3300025944 Bacteria 806
810 Ga0207661_11286502 3300025944 Bacteria 672
811 Ga0207661_11446894 3300025944 Bacteria 630
812 Ga0207667_10000388 3300025949 Bacteria 59263
813 Ga0207667_10000612 3300025949 Bacteria 46149
814 Ga0207667_10004297 3300025949 Bacteria 17460
815 Ga0207667_10006198 3300025949 Bacteria 14519
816 Ga0207667_10024994 3300025949 Bacteria 6548
817 Ga0207667_10032645 3300025949 Bacteria 5606
818 Ga0207667_10059983 3300025949 Bacteria 3983
819 Ga0207667_10238165 3300025949 Bacteria 1863
820 Ga0207667_10238237 3300025949 Bacteria 1862
821 Ga0207667_10473726 3300025949 Bacteria 1271
822 Ga0207667_10610635 3300025949 Bacteria 1099
823 Ga0207667_10795590 3300025949 Bacteria 943
824 Ga0207667_11206421 3300025949 Bacteria 736
825 Ga0207651_12070196 3300025960 Bacteria 511
826 Ga0207712_11820891 3300025961 Bacteria 545
827 Ga0207668_10007456 3300025972 Bacteria 6507
828 Ga0207668_10592495 3300025972 Bacteria 965
829 Ga0207668_11047154 3300025972 Bacteria 730
830 Ga0207668_11523470 3300025972 Bacteria 603
831 Ga0207668_11851600 3300025972 Bacteria 544
832 Ga0207640_10194683 3300025981 Bacteria 1531
833 Ga0207640_10256332 3300025981 Bacteria 1361
834 Ga0207640_10946538 3300025981 Bacteria 755
835 Ga0207658_10000130 3300025986 Bacteria 81577
836 Ga0207658_10310759 3300025986 Bacteria 1361
837 Ga0207658_10953420 3300025986 Bacteria 782
838 Ga0207658_11048947 3300025986 Bacteria 744
839 Ga0207677_10012660 3300026023 Bacteria 4859
840 Ga0207677_10317051 3300026023 Bacteria 1294
841 Ga0207677_10544175 3300026023 Bacteria 1011
842 Ga0207677_11274741 3300026023 Bacteria 674
843 Ga0207677_11275135 3300026023 Bacteria 674
844 Ga0207703_10044546 3300026035 Bacteria 3567
845 Ga0207703_10086143 3300026035 Bacteria 2631
846 Ga0207703_10139627 3300026035 Bacteria 2102
847 Ga0207703_11688373 3300026035 Bacteria 609
848 Ga0207703_11837273 3300026035 Bacteria 582
849 Ga0207639_10000867 3300026041 Bacteria 20545
850 Ga0207639_10005667 3300026041 Bacteria 8449
851 Ga0207639_10010763 3300026041 Bacteria 6339
852 Ga0207639_10123083 3300026041 Bacteria 2134
853 Ga0207639_10435761 3300026041 Bacteria 1187
854 Ga0207639_10483975 3300026041 Bacteria 1128
855 Ga0207639_10634684 3300026041 Bacteria 987
856 Ga0207678_10087627 3300026067 Bacteria 2660
857 Ga0207678_10146066 3300026067 Bacteria 2018
858 Ga0207678_10371805 3300026067 Bacteria 1235
859 Ga0207678_10488489 3300026067 Bacteria 1073
860 Ga0207708_10129461 3300026075 Bacteria 1972
861 Ga0207708_10593322 3300026075 Bacteria 938
862 Ga0207708_11036395 3300026075 Bacteria 714
863 Ga0207708_11249567 3300026075 Bacteria 650
864 Ga0207708_11794718 3300026075 Bacteria 538
865 Ga0207708_11950481 3300026075 Bacteria 514
866 Ga0207702_10000315 3300026078 Bacteria 55383
867 Ga0207702_10001471 3300026078 Bacteria 23360
868 Ga0207702_10009824 3300026078 Bacteria 8022
869 Ga0207702_10081498 3300026078 Bacteria 2810
870 Ga0207702_10130884 3300026078 Bacteria 2258
871 Ga0207702_10478378 3300026078 Bacteria 1212
872 Ga0207702_10640752 3300026078 Bacteria 1045
873 Ga0207702_11033834 3300026078 Bacteria 815
874 Ga0207702_11183791 3300026078 Bacteria 758
875 Ga0207641_10024023 3300026088 Bacteria 5023
876 Ga0207641_10036533 3300026088 Bacteria 4101
877 Ga0207641_10076094 3300026088 Bacteria 2901
878 Ga0207641_10720339 3300026088 Bacteria 983
879 Ga0207641_11084005 3300026088 Bacteria 799
880 Ga0207641_11433694 3300026088 Bacteria 692
881 Ga0207648_10012510 3300026089 Bacteria 7943
882 Ga0207648_10055432 3300026089 Bacteria 3460
883 Ga0207648_10654656 3300026089 Bacteria 971
884 Ga0207676_10329811 3300026095 Bacteria 1404
885 Ga0207676_10345720 3300026095 Bacteria 1374
886 Ga0207676_10521060 3300026095 Bacteria 1132
887 Ga0207676_11470826 3300026095 Bacteria 678
888 Ga0207676_12554022 3300026095 Bacteria 507
889 Ga0207674_10001605 3300026116 Bacteria 29115
890 Ga0207674_10208980 3300026116 Bacteria 1901
891 Ga0207674_10249760 3300026116 Bacteria 1721
892 Ga0207674_10431870 3300026116 Bacteria 1273
893 Ga0207674_10550097 3300026116 Bacteria 1115
894 Ga0207674_10684319 3300026116 Bacteria 990
895 Ga0207674_10733592 3300026116 Bacteria 953
896 Ga0207674_11104304 3300026116 Bacteria 762
897 Ga0207675_100034510 3300026118 Bacteria 4717
898 Ga0207675_100091574 3300026118 Bacteria 2859
899 Ga0207675_100367651 3300026118 Bacteria 1412
900 Ga0207675_100374906 3300026118 Bacteria 1398
901 Ga0207675_100500138 3300026118 Bacteria 1210
902 Ga0207675_100713765 3300026118 Bacteria 1012
903 Ga0207675_102138796 3300026118 Bacteria 576
904 Ga0207683_10049254 3300026121 Bacteria 3688
905 Ga0207683_10200848 3300026121 Bacteria 1812
906 Ga0207683_10404348 3300026121 Bacteria 1256
907 Ga0207683_10669358 3300026121 Bacteria 962
908 Ga0207683_10679181 3300026121 Bacteria 954
909 Ga0207683_10711853 3300026121 Bacteria 931
910 Ga0207683_11216595 3300026121 Bacteria 698
911 Ga0207698_10012405 3300026142 Bacteria 5574
912 Ga0207698_10067772 3300026142 Bacteria 2815
913 Ga0207698_10263113 3300026142 Bacteria 1586
914 Ga0207698_10314639 3300026142 Bacteria 1463
915 Ga0207698_11488272 3300026142 Bacteria 692
916 Ga0207698_12654032 3300026142 Bacteria 510
917 Ga0209813_10012362 3300027866 Bacteria 2255
918 Ga0209813_10052605 3300027866 Bacteria 1278
919 Ga0207428_10071472 3300027907 Bacteria 2725
920 Ga0268266_10000557 3300028379 Bacteria 51935
921 Ga0268266_10088994 3300028379 Bacteria 2702
922 Ga0268266_10105068 3300028379 Bacteria 2494
923 Ga0268266_10283355 3300028379 Bacteria 1541
924 Ga0268266_10337307 3300028379 Bacteria 1414
925 Ga0268266_11018029 3300028379 Bacteria 801
926 Ga0268266_11568471 3300028379 Bacteria 634
927 Ga0268265_10027081 3300028380 Bacteria 4087
928 Ga0268265_10052967 3300028380 Bacteria 3072
929 Ga0268265_10179633 3300028380 Bacteria 1817
930 Ga0268265_10607160 3300028380 Bacteria 1046
931 Ga0268265_10740184 3300028380 Bacteria 953
932 Ga0268265_12422972 3300028380 Bacteria 531
933 Ga0268264_10069223 3300028381 Bacteria 2984
934 Ga0268264_10072664 3300028381 Bacteria 2917
935 Ga0268264_10604970 3300028381 Bacteria 1081
936 Ga0268264_10618502 3300028381 Bacteria 1069
937 Ga0268264_11048936 3300028381 Bacteria 823
938 Ga0268264_11901796 3300028381 Bacteria 605
939 Ga0265337_1008843 3300028556 Bacteria 3630
940 Ga0265337_1014346 3300028556 Bacteria 2628
941 Ga0265337_1113854 3300028556 Bacteria 734
942 Ga0265337_1154863 3300028556 Bacteria 621
943 Ga0265319_1000071 3300028563 Bacteria 81543
944 Ga0265319_1029049 3300028563 Bacteria 1944
945 Ga0265319_1034208 3300028563 Bacteria 1750
946 Ga0265334_10001615 3300028573 Bacteria 10823
947 Ga0265334_10003040 3300028573 Bacteria 7662
948 Ga0265334_10008474 3300028573 Bacteria 4370
949 Ga0265334_10095022 3300028573 Bacteria 1084
950 Ga0265334_10176623 3300028573 Bacteria 746
951 Ga0265318_10000169 3300028577 Bacteria 57590
952 Ga0265318_10000273 3300028577 Bacteria 43832
953 Ga0265318_10000384 3300028577 Bacteria 34508
954 Ga0265318_10004765 3300028577 Bacteria 6501
955 Ga0265318_10008259 3300028577 Bacteria 4644
956 Ga0265318_10123633 3300028577 Bacteria 951
957 Ga0265323_10003319 3300028653 Bacteria 7141
958 Ga0265323_10015822 3300028653 Bacteria 2960
959 Ga0265323_10015991 3300028653 Bacteria 2938
960 Ga0265323_10018664 3300028653 Bacteria 2681
961 Ga0265322_10007541 3300028654 Bacteria 3172
962 Ga0265322_10012481 3300028654 Bacteria 2459
963 Ga0265336_10165819 3300028666 Bacteria 657
964 Ga0307517_10481474 3300028786 Bacteria 636
965 Ga0307515_10228948 3300028794 Bacteria 1657
966 Ga0265338_10000017 3300028800 Bacteria 344481
967 Ga0265338_10000401 3300028800 Bacteria 77602
968 Ga0265338_10001810 3300028800 Bacteria 33582
969 Ga0265338_10005387 3300028800 Bacteria 16717
970 Ga0265338_10016967 3300028800 Bacteria 7878
971 Ga0265338_10017000 3300028800 Bacteria 7869
972 Ga0265338_10023435 3300028800 Bacteria 6346
973 Ga0265338_10023604 3300028800 Bacteria 6316
974 Ga0265338_10028203 3300028800 Bacteria 5605
975 Ga0265338_10049941 3300028800 Bacteria 3785
976 Ga0265338_10068199 3300028800 Bacteria 3066
977 Ga0265338_10084066 3300028800 Bacteria 2659
978 Ga0265338_10161608 3300028800 Bacteria 1729
979 Ga0265338_10272535 3300028800 Bacteria 1240
980 Ga0265338_10362629 3300028800 Bacteria 1039
981 Ga0265338_10430593 3300028800 Bacteria 936
982 Ga0265338_10477212 3300028800 Bacteria 880
983 Ga0265338_10526471 3300028800 Bacteria 830
984 Ga0265324_10005897 3300029957 Bacteria 5205
985 Ga0265324_10047822 3300029957 Bacteria 1471
986 Ga0265324_10056497 3300029957 Bacteria 1344
987 Ga0265766_1014642 3300030863 Bacteria 599
988 Ga0265330_10000068 3300031235 Bacteria 90225
989 Ga0265330_10000541 3300031235 Bacteria 24732
990 Ga0265330_10000998 3300031235 Bacteria 17255
991 Ga0265330_10003264 3300031235 Bacteria 8535
992 Ga0265330_10003962 3300031235 Bacteria 7608
993 Ga0265330_10009350 3300031235 Bacteria 4660
994 Ga0265330_10010377 3300031235 Bacteria 4394
995 Ga0265330_10013183 3300031235 Bacteria 3855
996 Ga0265330_10015081 3300031235 Bacteria 3578
997 Ga0265330_10016429 3300031235 Bacteria 3415
998 Ga0265330_10046835 3300031235 Bacteria 1904
999 Ga0265330_10067893 3300031235 Bacteria 1545
1000 Ga0265330_10097152 3300031235 Bacteria 1262
1001 Ga0265330_10213971 3300031235 Bacteria 814
1002 Ga0265330_10293273 3300031235 Bacteria 685
1003 Ga0265332_10000280 3300031238 Bacteria 40175
1004 Ga0265332_10001607 3300031238 Bacteria 12385
1005 Ga0265332_10002023 3300031238 Bacteria 10619
1006 Ga0265332_10012502 3300031238 Bacteria 3767
1007 Ga0265332_10017013 3300031238 Bacteria 3208
1008 Ga0265332_10026618 3300031238 Bacteria 2536
1009 Ga0265332_10057168 3300031238 Bacteria 1671
1010 Ga0265332_10072254 3300031238 Bacteria 1469
1011 Ga0265332_10105510 3300031238 Bacteria 1188
1012 Ga0265332_10170269 3300031238 Bacteria 909
1013 Ga0265332_10192511 3300031238 Bacteria 849
1014 Ga0265332_10202080 3300031238 Bacteria 826
1015 Ga0265328_10000172 3300031239 Bacteria 29964
1016 Ga0265328_10000528 3300031239 Bacteria 17832
1017 Ga0265328_10003166 3300031239 Bacteria 7314
1018 Ga0265328_10004363 3300031239 Bacteria 6145
1019 Ga0265328_10033026 3300031239 Bacteria 1919
1020 Ga0265328_10080353 3300031239 Bacteria 1201
1021 Ga0265320_10000069 3300031240 Bacteria 90253
1022 Ga0265320_10000485 3300031240 Bacteria 31127
1023 Ga0265320_10002069 3300031240 Bacteria 14126
1024 Ga0265320_10005252 3300031240 Bacteria 8348
1025 Ga0265320_10009684 3300031240 Bacteria 5789
1026 Ga0265320_10017635 3300031240 Bacteria 3957
1027 Ga0265320_10028549 3300031240 Bacteria 2896
1028 Ga0265320_10029258 3300031240 Bacteria 2851
1029 Ga0265320_10154304 3300031240 Bacteria 1036
1030 Ga0265320_10419719 3300031240 Bacteria 591
1031 Ga0265320_10470855 3300031240 Bacteria 555
1032 Ga0265325_10000014 3300031241 Bacteria 131579
1033 Ga0265325_10000820 3300031241 Bacteria 22557
1034 Ga0265325_10001575 3300031241 Bacteria 15904
1035 Ga0265325_10001732 3300031241 Bacteria 15146
1036 Ga0265325_10012680 3300031241 Bacteria 4814
1037 Ga0265325_10060434 3300031241 Bacteria 1925
1038 Ga0265325_10065512 3300031241 Bacteria 1834
1039 Ga0265325_10074830 3300031241 Bacteria 1693
1040 Ga0265325_10101794 3300031241 Bacteria 1405
1041 Ga0265325_10134617 3300031241 Bacteria 1180
1042 Ga0265325_10160384 3300031241 Bacteria 1058
1043 Ga0265325_10179606 3300031241 Bacteria 986
1044 Ga0265325_10218157 3300031241 Bacteria 874
1045 Ga0265325_10404261 3300031241 Bacteria 598
1046 Ga0265329_10000013 3300031242 Bacteria 70645
1047 Ga0265329_10000733 3300031242 Bacteria 16666
1048 Ga0265329_10003473 3300031242 Bacteria 6856
1049 Ga0265329_10018240 3300031242 Bacteria 2402
1050 Ga0265329_10321859 3300031242 Bacteria 525
1051 Ga0265340_10000189 3300031247 Bacteria 31156
1052 Ga0265340_10003857 3300031247 Bacteria 8447
1053 Ga0265340_10007508 3300031247 Bacteria 5918
1054 Ga0265340_10009613 3300031247 Bacteria 5183
1055 Ga0265340_10031774 3300031247 Bacteria 2638
1056 Ga0265340_10039494 3300031247 Bacteria 2328
1057 Ga0265340_10049006 3300031247 Bacteria 2052
1058 Ga0265340_10062582 3300031247 Bacteria 1777
1059 Ga0265340_10065028 3300031247 Bacteria 1737
1060 Ga0265340_10070347 3300031247 Bacteria 1660
1061 Ga0265340_10086766 3300031247 Bacteria 1467
1062 Ga0265340_10107204 3300031247 Bacteria 1294
1063 Ga0265340_10193840 3300031247 Bacteria 915
1064 Ga0265340_10196648 3300031247 Bacteria 908
1065 Ga0265340_10234527 3300031247 Bacteria 820
1066 Ga0265340_10245866 3300031247 Bacteria 798
1067 Ga0265339_10000001 3300031249 Bacteria 613713
1068 Ga0265339_10000256 3300031249 Bacteria 42839
1069 Ga0265339_10001407 3300031249 Bacteria 17881
1070 Ga0265339_10003500 3300031249 Bacteria 10970
1071 Ga0265339_10005687 3300031249 Bacteria 8275
1072 Ga0265339_10006249 3300031249 Bacteria 7843
1073 Ga0265339_10006835 3300031249 Bacteria 7436
1074 Ga0265339_10009282 3300031249 Bacteria 6196
1075 Ga0265339_10020355 3300031249 Bacteria 3877
1076 Ga0265339_10022740 3300031249 Bacteria 3628
1077 Ga0265339_10032693 3300031249 Bacteria 2933
1078 Ga0265339_10034119 3300031249 Bacteria 2861
1079 Ga0265339_10070933 3300031249 Bacteria 1857
1080 Ga0265339_10085966 3300031249 Bacteria 1655
1081 Ga0265339_10104746 3300031249 Bacteria 1469
1082 Ga0265339_10117963 3300031249 Bacteria 1366
1083 Ga0265339_10155002 3300031249 Bacteria 1156
1084 Ga0265339_10190822 3300031249 Bacteria 1016
1085 Ga0265339_10287312 3300031249 Bacteria 787
1086 Ga0265331_10000149 3300031250 Bacteria 90395
1087 Ga0265331_10001210 3300031250 Bacteria 19474
1088 Ga0265331_10011236 3300031250 Bacteria 4910
1089 Ga0265331_10014090 3300031250 Bacteria 4271
1090 Ga0265331_10018237 3300031250 Bacteria 3645
1091 Ga0265331_10019323 3300031250 Bacteria 3519
1092 Ga0265331_10030873 3300031250 Bacteria 2665
1093 Ga0265331_10056308 3300031250 Bacteria 1867
1094 Ga0265331_10067943 3300031250 Bacteria 1671
1095 Ga0265331_10163164 3300031250 Bacteria 1010
1096 Ga0265331_10184674 3300031250 Bacteria 941
1097 Ga0265331_10365462 3300031250 Bacteria 646
1098 Ga0265331_10472834 3300031250 Bacteria 563
1099 Ga0265316_10000251 3300031344 Bacteria 61672
1100 Ga0265316_10000984 3300031344 Bacteria 30933
1101 Ga0265316_10001048 3300031344 Bacteria 29962
1102 Ga0265316_10002957 3300031344 Bacteria 17386
1103 Ga0265316_10006437 3300031344 Bacteria 11220
1104 Ga0265316_10010311 3300031344 Bacteria 8524
1105 Ga0265316_10015836 3300031344 Bacteria 6566
1106 Ga0265316_10037888 3300031344 Bacteria 3887
1107 Ga0265316_10055970 3300031344 Bacteria 3083
1108 Ga0265316_10058086 3300031344 Bacteria 3015
1109 Ga0265316_10061302 3300031344 Bacteria 2922
1110 Ga0265316_10068712 3300031344 Bacteria 2735
1111 Ga0265316_10081403 3300031344 Bacteria 2482
1112 Ga0265316_10088158 3300031344 Bacteria 2370
1113 Ga0265316_10165235 3300031344 Bacteria 1653
1114 Ga0265316_10169434 3300031344 Bacteria 1629
1115 Ga0265316_10201779 3300031344 Bacteria 1474
1116 Ga0265316_10287264 3300031344 Bacteria 1201
1117 Ga0265316_10348326 3300031344 Bacteria 1073
1118 Ga0265316_10465364 3300031344 Bacteria 906
1119 Ga0265316_10470747 3300031344 Bacteria 900
1120 Ga0265316_10585638 3300031344 Bacteria 792
1121 Ga0265316_10721881 3300031344 Bacteria 702
1122 Ga0307513_10010515 3300031456 Bacteria 11583
1123 Ga0307513_10070133 3300031456 Bacteria 3665
1124 Ga0307513_10082281 3300031456 Bacteria 3315
1125 Ga0307513_10125501 3300031456 Bacteria 2523
1126 Ga0307513_10477424 3300031456 Bacteria 967
1127 Ga0307408_100395292 3300031548 Bacteria 1186
1128 Ga0307408_101609828 3300031548 Bacteria 617
1129 Ga0265313_10000463 3300031595 Bacteria 42820
1130 Ga0265313_10000800 3300031595 Bacteria 31814
1131 Ga0265313_10001355 3300031595 Bacteria 23078
1132 Ga0265313_10003761 3300031595 Bacteria 12048
1133 Ga0265313_10006146 3300031595 Bacteria 8620
1134 Ga0265313_10015578 3300031595 Bacteria 4416
1135 Ga0265313_10030710 3300031595 Bacteria 2761
1136 Ga0265313_10039375 3300031595 Bacteria 2345
1137 Ga0265313_10053229 3300031595 Bacteria 1927
1138 Ga0265313_10067511 3300031595 Bacteria 1654
1139 Ga0265313_10102835 3300031595 Bacteria 1266
1140 Ga0265313_10106409 3300031595 Bacteria 1238
1141 Ga0265313_10125279 3300031595 Bacteria 1117
1142 Ga0265313_10228110 3300031595 Bacteria 766
1143 Ga0265313_10376278 3300031595 Bacteria 560
1144 Ga0307508_10076076 3300031616 Bacteria 2934
1145 Ga0307514_10203628 3300031649 Bacteria 1239
1146 Ga0316575_10194344 3300031665 Bacteria 844
1147 Ga0316579_10097572 3300031691 Bacteria 1406
1148 Ga0316579_10181944 3300031691 Bacteria 1016
1149 Ga0316579_10248300 3300031691 Bacteria 861
1150 Ga0316579_10483979 3300031691 Bacteria 599
1151 Ga0265314_10000003 3300031711 Bacteria 1653386
1152 Ga0265314_10000109 3300031711 Bacteria 125470
1153 Ga0265314_10000191 3300031711 Bacteria 91214
1154 Ga0265314_10001397 3300031711 Bacteria 27067
1155 Ga0265314_10002804 3300031711 Bacteria 17395
1156 Ga0265314_10009081 3300031711 Bacteria 8445
1157 Ga0265314_10011365 3300031711 Bacteria 7357
1158 Ga0265314_10012182 3300031711 Bacteria 7042
1159 Ga0265314_10019382 3300031711 Bacteria 5272
1160 Ga0265314_10040994 3300031711 Bacteria 3318
1161 Ga0265314_10046055 3300031711 Bacteria 3079
1162 Ga0265314_10081772 3300031711 Bacteria 2127
1163 Ga0265314_10101330 3300031711 Bacteria 1850
1164 Ga0265314_10104251 3300031711 Bacteria 1816
1165 Ga0265314_10114451 3300031711 Bacteria 1709
1166 Ga0265314_10125806 3300031711 Bacteria 1606
1167 Ga0265314_10213682 3300031711 Bacteria 1131
1168 Ga0265314_10275040 3300031711 Bacteria 955
1169 Ga0265314_10345428 3300031711 Bacteria 820
1170 Ga0265342_10000471 3300031712 Bacteria 43707
1171 Ga0265342_10000812 3300031712 Bacteria 31323
1172 Ga0265342_10001254 3300031712 Bacteria 23972
1173 Ga0265342_10001889 3300031712 Bacteria 18879
1174 Ga0265342_10002136 3300031712 Bacteria 17439
1175 Ga0265342_10004388 3300031712 Bacteria 11137
1176 Ga0265342_10006355 3300031712 Bacteria 8810
1177 Ga0265342_10008085 3300031712 Bacteria 7603
1178 Ga0265342_10008087 3300031712 Bacteria 7602
1179 Ga0265342_10028395 3300031712 Bacteria 3485
1180 Ga0265342_10030570 3300031712 Bacteria 3336
1181 Ga0265342_10042004 3300031712 Bacteria 2765
1182 Ga0265342_10042585 3300031712 Bacteria 2742
1183 Ga0265342_10046425 3300031712 Bacteria 2611
1184 Ga0265342_10048044 3300031712 Bacteria 2559
1185 Ga0265342_10056456 3300031712 Bacteria 2327
1186 Ga0265342_10061994 3300031712 Bacteria 2202
1187 Ga0265342_10078127 3300031712 Bacteria 1916
1188 Ga0265342_10168852 3300031712 Bacteria 1205
1189 Ga0265342_10183495 3300031712 Bacteria 1145
1190 Ga0265342_10240266 3300031712 Bacteria 970
1191 Ga0265342_10277145 3300031712 Bacteria 888
1192 Ga0265342_10305228 3300031712 Bacteria 837
1193 Ga0265342_10371912 3300031712 Bacteria 741
1194 Ga0265342_10438128 3300031712 Bacteria 672
1195 Ga0265342_10453144 3300031712 Bacteria 658
1196 Ga0316576_10000922 3300031727 Bacteria 15034
1197 Ga0316576_10051018 3300031727 Bacteria 3010
1198 Ga0316576_10209924 3300031727 Bacteria 1466
1199 Ga0316576_10212171 3300031727 Bacteria 1457
1200 Ga0316576_10254984 3300031727 Bacteria 1317
1201 Ga0316576_10292620 3300031727 Bacteria 1218
1202 Ga0316576_10345769 3300031727 Bacteria 1107
1203 Ga0316576_10425906 3300031727 Bacteria 982
1204 Ga0316576_10437911 3300031727 Bacteria 966
1205 Ga0316576_11184166 3300031727 Bacteria 540
1206 Ga0316576_11254420 3300031727 Bacteria 522
1207 Ga0316578_10029759 3300031728 Bacteria 3101
1208 Ga0316578_10115389 3300031728 Bacteria 1613
1209 Ga0316578_10371592 3300031728 Bacteria 849
1210 Ga0307516_10001565 3300031730 Bacteria 31484
1211 Ga0307516_10038268 3300031730 Bacteria 4788
1212 Ga0307516_10069484 3300031730 Bacteria 3387
1213 Ga0307516_10110667 3300031730 Bacteria 2550
1214 Ga0307516_10156750 3300031730 Bacteria 2031
1215 Ga0307516_10281172 3300031730 Bacteria 1346
1216 Ga0307405_11172404 3300031731 Bacteria 663
1217 Ga0316577_10155407 3300031733 Bacteria 1290
1218 Ga0316577_10391165 3300031733 Bacteria 790
1219 Ga0316577_10851051 3300031733 Bacteria 517
1220 Ga0307410_10002052 3300031852 Bacteria 9520
1221 Ga0307410_10939481 3300031852 Bacteria 743
1222 Ga0307410_11989557 3300031852 Bacteria 518
1223 Ga0307406_10084313 3300031901 Bacteria 2121
1224 Ga0307407_10011273 3300031903 Bacteria 4249
1225 Ga0307407_11477147 3300031903 Bacteria 537
1226 Ga0307407_11587093 3300031903 Bacteria 519
1227 Ga0307412_10010183 3300031911 Bacteria 5410
1228 Ga0307409_100000500 3300031995 Bacteria 16898
1229 Ga0307409_101228556 3300031995 Bacteria 773
1230 Ga0307409_102008334 3300031995 Bacteria 608
1231 Ga0307409_102183309 3300031995 Bacteria 583
1232 Ga0307409_102808839 3300031995 Bacteria 515
1233 Ga0307416_101528276 3300032002 Bacteria 773
1234 Ga0307416_102563072 3300032002 Bacteria 608
1235 Ga0307411_10001749 3300032005 Bacteria 9156
1236 Ga0307411_10530229 3300032005 Bacteria 1001
1237 Ga0307411_10767299 3300032005 Bacteria 846
1238 Ga0307415_101623683 3300032126 Bacteria 622
1239 Ga0307415_102000532 3300032126 Bacteria 564
1240 Ga0316583_10256192 3300032133 Bacteria 606
1241 Ga0316593_10001129 3300032168 Bacteria 5642
1242 Ga0316593_10004897 3300032168 Bacteria 3483
1243 Ga0316593_10009266 3300032168 Bacteria 2774
1244 Ga0316593_10010229 3300032168 Bacteria 2683
1245 Ga0316593_10026137 3300032168 Bacteria 1864
1246 Ga0316593_10055189 3300032168 Bacteria 1350
1247 Ga0316593_10062878 3300032168 Bacteria 1272
1248 Ga0316593_10068857 3300032168 Unclassified 1221
1249 Ga0316593_10106940 3300032168 Bacteria 997
1250 Ga0307507_10040401 3300033179 Bacteria 4687
1251 Ga0307507_10507944 3300033179 Bacteria 647
1252 Ga0316592_1000007 3300033524 Bacteria 14542
1253 Ga0316592_1000874 3300033524 Bacteria 4559
1254 Ga0316592_1003317 3300033524 Bacteria 2888
1255 Ga0316592_1009037 3300033524 Bacteria 1988
1256 Ga0316592_1022971 3300033524 Bacteria 1337
1257 Ga0316592_1035933 3300033524 Bacteria 1088
1258 Ga0316592_1042108 3300033524 Unclassified 1012
1259 Ga0316592_1047032 3300033524 Bacteria 961
1260 Ga0316592_1059262 3300033524 Bacteria 859
1261 Ga0316592_1074302 3300033524 Bacteria 770
1262 Ga0316592_1102728 3300033524 Bacteria 658
1263 Ga0316586_1013886 3300033527 Bacteria 1265
1264 Ga0316586_1089530 3300033527 Bacteria 580
1265 Ga0316588_1000005 3300033528 Bacteria 13840
1266 Ga0316588_1000022 3300033528 Bacteria 11194
1267 Ga0316588_1000057 3300033528 Bacteria 9369
1268 Ga0316588_1000158 3300033528 Bacteria 7460
1269 Ga0316588_1000820 3300033528 Bacteria 4683
1270 Ga0316588_1000956 3300033528 Bacteria 4470
1271 Ga0316588_1001749 3300033528 Bacteria 3652
1272 Ga0316588_1004229 3300033528 Bacteria 2699
1273 Ga0316588_1014683 3300033528 Unclassified 1718
1274 Ga0316588_1016992 3300033528 Bacteria 1618
1275 Ga0316588_1059981 3300033528 Bacteria 928
1276 Ga0316588_1085380 3300033528 Bacteria 784
1277 Ga0316588_1085484 3300033528 Bacteria 784
1278 Ga0316588_1187240 3300033528 Bacteria 539
1279 Ga0316588_1187808 3300033528 Bacteria 538
1280 Ga0316587_1026071 3300033529 Bacteria 1018
1281 Ga0316587_1039349 3300033529 Bacteria 852
1282 Ga0316587_1055191 3300033529 Bacteria 731
1283 Ga0316587_1089853 3300033529 Bacteria 585
1284 Ga0316587_1108979 3300033529 Bacteria 537
1285 Ga0316596_1000580 3300033541 Bacteria 6413
1286 Ga0316596_1002213 3300033541 Bacteria 4123
1287 Ga0316596_1008949 3300033541 Bacteria 2396
1288 Ga0316596_1011231 3300033541 Bacteria 2184
1289 Ga0316596_1012745 3300033541 Bacteria 2071
1290 Ga0316596_1018442 3300033541 Bacteria 1763
1291 Ga0316596_1020052 3300033541 Bacteria 1699
1292 Ga0316596_1043687 3300033541 Bacteria 1180
1293 Ga0316596_1083441 3300033541 Bacteria 859
1294 Ga0316596_1144095 3300033541 Bacteria 653
1295 Ga0316596_1214520 3300033541 Bacteria 537
1296 Ga0373938_0159264 3300034957 Bacteria 605
1297 Ga0373926_0020427 3300035083 Bacteria 2288
1298 Ga0373926_0057725 3300035083 Bacteria 1410
1299 Ga0373926_0210334 3300035083 Bacteria 750
1300 Ga0373926_0225834 3300035083 Bacteria 723
1301 Ga0373928_0005989 3300035084 Bacteria 2330
1302 Ga0373928_0071090 3300035084 Bacteria 861
1303 Ga0373928_0132496 3300035084 Bacteria 677
1304 Ga0373929_0120431 3300035085 Bacteria 679
1305 Ga0373934_0015071 3300035086 Bacteria 2931
1306 Ga0373934_0122743 3300035086 Bacteria 1057
1307 Ga0373940_0102962 3300035088 Bacteria 869
1308 Ga0373944_0065952 3300035089 Bacteria 1170
1309 Ga0373951_0072066 3300035091 Bacteria 882
1310 Ga0373923_0094438 3300035111 Bacteria 1312
1311 Ga0373923_0138225 3300035111 Bacteria 1100
1312 Ga0373923_0176142 3300035111 Bacteria 981
1313 Ga0373923_0458682 3300035111 Bacteria 618
1314 Ga0373932_0046688 3300035112 Bacteria 1271
1315 Ga0373932_0353191 3300035112 Bacteria 559
1316 Ga0373936_0047071 3300035113 Bacteria 1739
1317 Ga0373939_0126009 3300035114 Bacteria 909
1318 Ga0373941_0176056 3300035115 Bacteria 800
1319 Ga0373945_0045603 3300035116 Bacteria 1597
1320 Ga0373945_0357091 3300035116 Bacteria 635
1321 Ga0373953_0002723 3300035117 Bacteria 5364
1322 Ga0373954_0013761 3300035118 Bacteria 3605
1323 Ga0373954_0023685 3300035118 Bacteria 2795
1324 Ga0373954_0357579 3300035118 Bacteria 721
1325 Ga0373956_0009506 3300035119 Bacteria 3958
1326 Ga0373956_0086018 3300035119 Bacteria 1446
1327 Ga0373956_0120607 3300035119 Bacteria 1224
1328 Ga0373956_0154748 3300035119 Bacteria 1079
1329 Ga0373956_0341170 3300035119 Bacteria 714
1330 Ga0373957_0037107 3300035120 Bacteria 1819
1331 Ga0373957_0207158 3300035120 Bacteria 818
1332 Ga0373943_0143213 3300035170 Bacteria 1289
1333 Ga0373943_0301163 3300035170 Bacteria 910
1334 Ga0373946_0179861 3300035171 Bacteria 1003
1335 Ga0373946_0224019 3300035171 Bacteria 909
1336 Ga0373946_0768037 3300035171 Bacteria 506
1337 Ga0373955_0017677 3300035172 Bacteria 3533
1338 Ga0373955_0200232 3300035172 Bacteria 1189
1339 Ga0373955_0200901 3300035172 Bacteria 1187
1340 Ga0373955_0596255 3300035172 Bacteria 676
1341 Ga0373955_0792560 3300035172 Bacteria 582
1342 Ga0373942_0236493 3300035207 Bacteria 617
1343 Ga0316574_0097224 3300035398 Bacteria 1882
1344 Ga0316574_0114083 3300035398 Bacteria 1733
1345 Ga0316574_0174492 3300035398 Unclassified 1384
1346 Ga0316574_0218154 3300035398 Bacteria 1223
1347 Ga0316574_0337784 3300035398 Bacteria 955
1348 Ga0316574_0725800 3300035398 Bacteria 608
1349 Ga0373924_0207686 3300035410 Bacteria 864
1350 Ga0373924_0371616 3300035410 Bacteria 638
1351 Ga0373931_0298091 3300035691 Bacteria 995
1352 Ga0373931_0549811 3300035691 Bacteria 750
1353 Ga0373931_0651839 3300035691 Bacteria 692
1354 Ga0373935_0003403 3300035692 Bacteria 9238
1355 Ga0373935_0367197 3300035692 Bacteria 1029
1356 Ga0373935_0721045 3300035692 Bacteria 734
1357 Ga0373935_0784881 3300035692 Bacteria 703
1358 Ga0373935_0830032 3300035692 Bacteria 683
1359 Ga0373935_0910137 3300035692 Bacteria 652
1360 Ga0373927_0038864 3300035695 Bacteria 3089
1361 Ga0373927_0106584 3300035695 Bacteria 1825
1362 Ga0373927_0145210 3300035695 Bacteria 1553
1363 Ga0373927_0146095 3300035695 Bacteria 1548
1364 Ga0373927_0168305 3300035695 Bacteria 1436
1365 Ga0373933_0001189 3300035724 Bacteria 15436
1366 Ga0373933_0031586 3300035724 Bacteria 3072
1367 Ga0373933_0051470 3300035724 Bacteria 2462
1368 Ga0373933_0237630 3300035724 Bacteria 1171
1369 Ga0373933_0705611 3300035724 Bacteria 663
1370 Ga0373933_1151971 3300035724 Bacteria 511
1371 Ga0373933_1200269 3300035724 Bacteria 500
1372 Ga0373947_0009172 3300035725 Bacteria 5687
1373 Ga0373947_0078836 3300035725 Bacteria 2034
1374 Ga0373937_0013762 3300036401 Bacteria 7128
1375 Ga0373937_0025062 3300036401 Bacteria 5384
1376 Ga0373937_0051912 3300036401 Bacteria 3758
1377 Ga0373937_0058492 3300036401 Bacteria 3541
1378 Ga0373937_0096824 3300036401 Bacteria 2737
1379 Ga0373937_0125512 3300036401 Bacteria 2394
1380 Ga0373937_0304508 3300036401 Bacteria 1507
1381 Ga0373937_0336520 3300036401 Bacteria 1429
1382 Ga0373937_0345212 3300036401 Bacteria 1410
1383 Ga0373937_0494396 3300036401 Bacteria 1162
1384 Ga0373937_0507144 3300036401 Bacteria 1146
1385 Ga0373937_0960984 3300036401 Bacteria 803
1386 Ga0373937_2043433 3300036401 Bacteria 519
1387 Ga0373937_2141150 3300036401 Bacteria 505
1388 Ga0265778_024947 3300036457 Bacteria 753
1389 Ga0265778_027593 3300036457 Bacteria 724
1390 Ga0316582_0182455 3300036647 Bacteria 1428
1391 Ga0316582_0196368 3300036647 Bacteria 1376
1392 Ga0316582_0211025 3300036647 Bacteria 1327
1393 Ga0316582_0214065 3300036647 Bacteria 1317
1394 Ga0316582_0272663 3300036647 Bacteria 1161
1395 Ga0316582_0599031 3300036647 Bacteria 759
1396 Ga0316584_0070475 3300036712 Bacteria 2620
1397 Ga0316584_0305563 3300036712 Bacteria 1151
1398 Ga0316584_0390129 3300036712 Bacteria 994
1399 Ga0373925_0002514 3300037068 Bacteria 14651
1400 Ga0373925_0028694 3300037068 Bacteria 4078
1401 Ga0373925_0146974 3300037068 Bacteria 1848
1402 Ga0373925_0343453 3300037068 Bacteria 1211
1403 Ga0373925_0428104 3300037068 Bacteria 1082
1404 Ga0373925_0437185 3300037068 Bacteria 1070
1405 Ga0373925_1159488 3300037068 Bacteria 635
1406 Ga0373925_1239991 3300037068 Bacteria 612
1407 Ga0395899_0026792 3300037312 Bacteria 4349
1408 Ga0395899_0028972 3300037312 Bacteria 4166
1409 Ga0395899_0079933 3300037312 Bacteria 2380
1410 Ga0395899_0309774 3300037312 Bacteria 1066
1411 Ga0395900_0018609 3300037418 Bacteria 7084
1412 Ga0395900_0098160 3300037418 Bacteria 3010
1413 Ga0395900_0115358 3300037418 Bacteria 2756
1414 Ga0395900_0128634 3300037418 Bacteria 2596
1415 Ga0395900_0317189 3300037418 Bacteria 1540
1416 Ga0395900_0331193 3300037418 Bacteria 1501
1417 Ga0395900_0724545 3300037418 Bacteria 926
1418 Ga0395900_0736711 3300037418 Bacteria 917
1419 Ga0395898_0071967 3300037466 Bacteria 3340
1420 Ga0395898_0138781 3300037466 Bacteria 2327
1421 Ga0395898_0157160 3300037466 Bacteria 2175
1422 Ga0395898_0399087 3300037466 Bacteria 1311
1423 Ga0395898_1773432 3300037466 Bacteria 539
1424 Ga0395898_1874198 3300037466 Bacteria 520
1425 Ga0395905_0000275 3300037471 Bacteria 76114
1426 Ga0395905_0001744 3300037471 Bacteria 25404
1427 Ga0395905_0011466 3300037471 Bacteria 8565
1428 Ga0395905_0025951 3300037471 Bacteria 5524
1429 Ga0395905_0266979 3300037471 Bacteria 1597
1430 Ga0395905_0297762 3300037471 Bacteria 1500
1431 Ga0395905_0880234 3300037471 Bacteria 799
1432 Ga0395901_0015561 3300038443 Bacteria 7748
1433 Ga0395901_0315777 3300038443 Bacteria 1617
1434 Ga0400486_06268 3300038742 Bacteria 1471
1435 Ga0400489_16718 3300039093 Bacteria 2253
1436 Ga0400489_71255 3300039093 Bacteria 1391
1437 Ga0436365_0180274 3300039437 Bacteria 867
1438 Ga0436365_0261194 3300039437 Bacteria 897
1439 Ga0436365_0882944 3300039437 Bacteria 1382
1440 Ga0436365_0927876 3300039437 Bacteria 2170
1441 Ga0436365_0983361 3300039437 Bacteria 1892
1442 Ga0436360_0037775 3300039438 Bacteria 1434
1443 Ga0436360_0056553 3300039438 Bacteria 1894
1444 Ga0436360_0545196 3300039438 Bacteria 682
1445 Ga0436360_0858736 3300039438 Bacteria 1399
1446 Ga0436360_1075444 3300039438 Bacteria 1995
1447 Ga0436360_1093052 3300039438 Bacteria 977
1448 Ga0436360_1174196 3300039438 Bacteria 889
1449 Ga0436361_0038119 3300039447 Bacteria 903
1450 Ga0436361_1038105 3300039447 Bacteria 523
1451 Ga0436361_1182130 3300039447 Bacteria 665
1452 Ga0436363_0403178 3300039450 Bacteria 1616
1453 Ga0436363_1353046 3300039450 Bacteria 1180
1454 Ga0436363_1413390 3300039450 Bacteria 527
1455 Ga0436363_1579330 3300039450 Bacteria 556
1456 Ga0436363_1683799 3300039450 Bacteria 1524
1457 Ga0436362_0043488 3300039453 Bacteria 816
1458 Ga0436362_0070508 3300039453 Bacteria 820
1459 Ga0436362_0159922 3300039453 Bacteria 781
1460 Ga0436362_0189212 3300039453 Bacteria 920
1461 Ga0436362_0279827 3300039453 Bacteria 700
1462 Ga0436362_0362184 3300039453 Bacteria 710
1463 Ga0439436_0243829 3300041404 Bacteria 520
1464 Ga0439439_0124520 3300041406 Bacteria 721
1465 Ga0451789_0541849 3300041443 Bacteria 1320
1466 Ga0451791_0325319 3300041451 Bacteria 649
1467 Ga0451791_1562090 3300041451 Bacteria 761
1468 Ga0451793_1461807 3300041452 Bacteria 1304
1469 Ga0451797_0056393 3300041453 Bacteria 3162
1470 Ga0451797_0651722 3300041453 Bacteria 549
1471 Ga0451801_01133 3300041455 Bacteria 928
1472 Ga0451800_0695945 3300041459 Bacteria 561
1473 Ga0451800_0812420 3300041459 Bacteria 723
1474 Ga0451800_1503326 3300041459 Bacteria 657
1475 Ga0451800_1533229 3300041459 Bacteria 513
1476 Ga0451805_063863 3300041461 Bacteria 710
1477 Ga0451804_1085934 3300041463 Bacteria 1193
1478 Ga0451807_0540028 3300041486 Bacteria 684
1479 Ga0451807_0693757 3300041486 Bacteria 3328
1480 Ga0451807_1173163 3300041486 Bacteria 742
1481 Ga0451807_2060165 3300041486 Bacteria 525
1482 Ga0451807_2422029 3300041486 Bacteria 954
1483 Ga0451807_2661718 3300041486 Bacteria 713
1484 Ga0451807_2745794 3300041486 Bacteria 613
1485 Ga0451833_1141144 3300041491 Bacteria 537
1486 Ga0451835_0186430 3300041492 Bacteria 784
1487 Ga0451837_0896719 3300041494 Bacteria 732
1488 Ga0451837_1485297 3300041494 Bacteria 630
1489 Ga0451839_1456558 3300041496 Bacteria 585
1490 Ga0451845_0486343 3300041501 Bacteria 568
1491 Ga0451846_30955 3300041502 Bacteria 626
1492 Ga0451851_0775624 3300041507 Bacteria 2665
1493 Ga0451843_1718550 3300041509 Bacteria 537
1494 Ga0451853_0027383 3300041512 Bacteria 541
1495 Ga0451853_1677720 3300041512 Bacteria 6200
1496 Ga0451853_2287162 3300041512 Bacteria 710
1497 Ga0451853_2606472 3300041512 Bacteria 832
1498 Ga0439445_0021393 3300042004 Bacteria 1624
1499 Ga0439445_0098728 3300042004 Bacteria 827
1500 Ga0439445_0123887 3300042004 Bacteria 743
1501 Ga0439449_0245637 3300042007 Bacteria 673
1502 Ga0439462_0163355 3300042015 Bacteria 628
1503 Ga0439460_0018350 3300042461 Bacteria 1884
1504 Ga0451577_0002073 3300042876 Bacteria 24707
1505 Ga0451577_0007263 3300042876 Bacteria 10914
1506 Ga0451577_0015598 3300042876 Bacteria 7061
1507 Ga0451577_0023525 3300042876 Bacteria 5617
1508 Ga0451577_0036483 3300042876 Bacteria 4425
1509 Ga0451577_0038980 3300042876 Bacteria 4270
1510 Ga0451577_0043713 3300042876 Bacteria 4013
1511 Ga0451577_0056998 3300042876 Bacteria 3484
1512 Ga0451577_0125556 3300042876 Bacteria 2299
1513 Ga0451577_0332387 3300042876 Bacteria 1378
1514 Ga0451577_0355924 3300042876 Bacteria 1328
1515 Ga0451577_0391737 3300042876 Bacteria 1261
1516 Ga0451577_0693604 3300042876 Bacteria 922
1517 Ga0451577_1408031 3300042876 Bacteria 618
1518 Ga0466972_0379310 3300044658 Bacteria 662
1519 Ga0453683_0000002 3300044673 Bacteria 1244396
1520 Ga0453683_0000075 3300044673 Bacteria 150395
1521 Ga0453683_0000633 3300044673 Bacteria 38199
1522 Ga0453683_0003668 3300044673 Bacteria 11245
1523 Ga0453683_0004436 3300044673 Bacteria 9958
1524 Ga0453683_0005086 3300044673 Bacteria 9225
1525 Ga0453683_0006512 3300044673 Bacteria 8009
1526 Ga0453683_0010210 3300044673 Bacteria 6232
1527 Ga0453683_0012274 3300044673 Bacteria 5618
1528 Ga0453683_0049198 3300044673 Bacteria 2643
1529 Ga0453683_0063564 3300044673 Bacteria 2308
1530 Ga0453683_0107363 3300044673 Bacteria 1755
1531 Ga0453683_0112088 3300044673 Bacteria 1716
1532 Ga0453683_0379138 3300044673 Bacteria 910
1533 Ga0453683_0597432 3300044673 Bacteria 720
1534 Ga0453683_0846822 3300044673 Bacteria 603
1535 Ga0466963_0534902 3300044694 Bacteria 827
1536 Ga0466964_0583553 3300044706 Bacteria 611
1537 Ga0466964_0886054 3300044706 Bacteria 510
1538 Ga0453684_0000950 3300044712 Bacteria 95538
1539 Ga0453684_0001302 3300044712 Bacteria 74077
1540 Ga0453684_0003118 3300044712 Bacteria 38183
1541 Ga0453684_0005204 3300044712 Bacteria 26125
1542 Ga0453684_0005988 3300044712 Bacteria 23557
1543 Ga0453684_0007136 3300044712 Bacteria 20809
1544 Ga0453684_0007468 3300044712 Bacteria 20074
1545 Ga0453684_0037288 3300044712 Bacteria 6674
1546 Ga0453684_0040563 3300044712 Bacteria 6318
1547 Ga0453684_0042819 3300044712 Bacteria 6096
1548 Ga0453684_0057836 3300044712 Bacteria 5013
1549 Ga0453684_0091997 3300044712 Bacteria 3741
1550 Ga0453684_0093912 3300044712 Bacteria 3693
1551 Ga0453684_0109834 3300044712 Bacteria 3353
1552 Ga0453684_0146959 3300044712 Bacteria 2806
1553 Ga0453684_0368987 3300044712 Bacteria 1614
1554 Ga0453684_0400036 3300044712 Bacteria 1538
1555 Ga0453684_0599268 3300044712 Bacteria 1208
1556 Ga0453684_0765155 3300044712 Bacteria 1044
1557 Ga0453684_0797789 3300044712 Bacteria 1018
1558 Ga0453684_1040162 3300044712 Bacteria 869
1559 Ga0453684_2284097 3300044712 Bacteria 538
1560 Ga0453684_2463463 3300044712 Bacteria 514
1561 Ga0466971_0108332 3300044719 Bacteria 1281
1562 Ga0466971_0256961 3300044719 Bacteria 833
1563 Ga0466968_0174492 3300044735 Bacteria 997
1564 Ga0466970_0149593 3300044765 Bacteria 1289
1565 Ga0466957_0090403 3300044842 Bacteria 1917
1566 Ga0466960_0065709 3300044901 Bacteria 1792
1567 Ga0466960_0104664 3300044901 Bacteria 1462
1568 Ga0466960_0341536 3300044901 Bacteria 852
1569 Ga0466959_1091325 3300045049 Bacteria 531
1570 Ga0451576_0000151 3300045051 Bacteria 176466
1571 Ga0451576_0005912 3300045051 Bacteria 15170
1572 Ga0451576_0032584 3300045051 Bacteria 5546
1573 Ga0451576_0057114 3300045051 Bacteria 4080
1574 Ga0451576_0061298 3300045051 Bacteria 3923
1575 Ga0451576_0121448 3300045051 Bacteria 2720
1576 Ga0451576_0188314 3300045051 Bacteria 2155
1577 Ga0451576_0224355 3300045051 Bacteria 1962
1578 Ga0451576_0268543 3300045051 Bacteria 1783
1579 Ga0451576_0406248 3300045051 Bacteria 1428
1580 Ga0451576_0428681 3300045051 Bacteria 1388
1581 Ga0451576_0684101 3300045051 Unclassified 1078
1582 Ga0451576_0797867 3300045051 Bacteria 991
1583 Ga0451576_0937531 3300045051 Bacteria 908
1584 Ga0451576_1538020 3300045051 Bacteria 691
1585 Ga0451576_1769095 3300045051 Bacteria 639
1586 Ga0451576_2742422 3300045051 Bacteria 501
1587 Ga0466967_0131550 3300045976 Bacteria 2323
1588 Ga0466967_0807903 3300045976 Bacteria 931
1589 Ga0495617_133212 3300046452 Bacteria 796
1590 Ga0495603_0127891 3300046455 Bacteria 1480
1591 Ga0495591_069261 3300046458 Bacteria 920
1592 Ga0495641_0046289 3300046461 Bacteria 2001
1593 Ga0495641_0059937 3300046461 Bacteria 1720
1594 Ga0495651_0362177 3300046462 Bacteria 955
1595 Ga0495651_0370567 3300046462 Bacteria 942
1596 Ga0495651_0375415 3300046462 Bacteria 934
1597 Ga0495651_0924804 3300046462 Bacteria 532
1598 Ga0495653_0620486 3300046463 Bacteria 663
1599 Ga0495580_0003736 3300046472 Bacteria 12895
1600 Ga0495580_0053578 3300046472 Bacteria 2846
1601 Ga0495605_0117912 3300046474 Bacteria 1206
1602 Ga0495639_0313240 3300046475 Bacteria 784
1603 Ga0495639_0507951 3300046475 Bacteria 616
1604 Ga0495664_0076998 3300046477 Bacteria 1997
1605 Ga0495664_0359859 3300046477 Bacteria 876
1606 Ga0495584_0183045 3300046491 Bacteria 1065
1607 Ga0495583_0123208 3300046506 Bacteria 1090
1608 Ga0495608_0694563 3300046511 Bacteria 606
1609 Ga0495618_0379926 3300046514 Bacteria 867
1610 Ga0495620_0053516 3300046515 Bacteria 1709
1611 Ga0495628_0122932 3300046516 Bacteria 1990
1612 Ga0495630_0783295 3300046517 Bacteria 728
1613 Ga0495630_1265140 3300046517 Bacteria 557
1614 Ga0495632_0301218 3300046519 Bacteria 711
1615 Ga0495643_0488008 3300046522 Bacteria 531
1616 Ga0495648_0378545 3300046524 Bacteria 639
1617 Ga0495648_0524037 3300046524 Bacteria 504
1618 Ga0495663_0338692 3300046525 Bacteria 546
1619 Ga0495652_0026548 3300046529 Bacteria 5115
1620 Ga0495652_0141337 3300046529 Bacteria 1893
1621 Ga0495652_0179093 3300046529 Bacteria 1629
1622 Ga0495652_0195820 3300046529 Bacteria 1538
1623 Ga0495652_0480247 3300046529 Bacteria 865
1624 Ga0495652_1044373 3300046529 Bacteria 533
1625 Ga0495640_0099927 3300046533 Bacteria 1906
1626 Ga0495640_0103613 3300046533 Bacteria 1866
1627 Ga0495586_0277497 3300046535 Bacteria 959
1628 Ga0495586_0699392 3300046535 Bacteria 585
1629 Ga0495587_0096111 3300046536 Bacteria 1709
1630 Ga0495587_0145166 3300046536 Bacteria 1353
1631 Ga0495587_0215424 3300046536 Bacteria 1084
1632 Ga0495621_0121500 3300046539 Bacteria 1010
1633 Ga0495621_0142498 3300046539 Bacteria 938
1634 Ga0495597_0015301 3300046542 Bacteria 3634
1635 Ga0495645_0093461 3300046543 Bacteria 2146
1636 Ga0495645_0342442 3300046543 Bacteria 965
1637 Ga0495622_0003803 3300046557 Bacteria 7058
1638 Ga0495622_0245488 3300046557 Bacteria 788
1639 Ga0495633_0155709 3300046558 Bacteria 1055
1640 Ga0495667_0148471 3300046559 Bacteria 1510
1641 Ga0495667_0193681 3300046559 Bacteria 1302
1642 Ga0495667_0604192 3300046559 Bacteria 683
1643 Ga0495656_0000397 3300046615 Bacteria 14422
1644 Ga0495656_0040399 3300046615 Bacteria 1944
1645 Ga0495668_0112795 3300046616 Bacteria 1487
1646 Ga0495634_0334146 3300046642 Bacteria 910
1647 Ga0495611_0096380 3300046648 Bacteria 1370
1648 Ga0495611_0359403 3300046648 Bacteria 668
1649 Ga0495625_0254919 3300046660 Bacteria 1138
1650 Ga0495625_0289781 3300046660 Bacteria 1051
1651 Ga0495661_0361457 3300046665 Bacteria 713
1652 Ga0495657_0066740 3300046675 Bacteria 2363
1653 Ga0495657_0414678 3300046675 Bacteria 791
1654 Ga0495657_0802964 3300046675 Bacteria 538
1655 Ga0495599_0354729 3300046678 Bacteria 879
1656 Ga0495599_0555642 3300046678 Bacteria 672
1657 Ga0495623_0050531 3300046679 Bacteria 2633
1658 Ga0495623_0302678 3300046679 Bacteria 883
1659 Ga0495646_0422224 3300046680 Bacteria 691
1660 Ga0495658_0001492 3300046683 Bacteria 12268
1661 Ga0495669_0035699 3300046684 Bacteria 2195
1662 Ga0495613_0515613 3300046689 Bacteria 804
1663 Ga0495624_0572890 3300046690 Bacteria 674
1664 Ga0495624_0783828 3300046690 Bacteria 564
1665 Ga0495670_0035476 3300046691 Bacteria 2486
1666 Ga0495671_0393821 3300046692 Bacteria 663
1667 Ga0495649_0458288 3300046694 Bacteria 636
1668 Ga0495589_0042395 3300046794 Bacteria 2268
1669 Ga0495589_0262802 3300046794 Bacteria 805
1670 Ga0495600_0071727 3300046809 Bacteria 2263
1671 Ga0495600_0122033 3300046809 Bacteria 1695
1672 Ga0495600_0617310 3300046809 Bacteria 658
1673 Ga0495600_0743966 3300046809 Bacteria 587
1674 Ga0495660_0439077 3300046810 Bacteria 566
1675 Ga0495581_0064379 3300047315 Bacteria 2118
1676 Ga0495581_0459552 3300047315 Bacteria 741
1677 Ga0495604_0924170 3300047317 Bacteria 544
1678 Ga0495636_0000893 3300047318 Bacteria 11074
1679 Ga0495636_0001105 3300047318 Bacteria 10134
1680 Ga0495674_0268579 3300047319 Bacteria 1400
1681 Ga0495674_0375032 3300047319 Bacteria 1152
1682 Ga0495674_0698568 3300047319 Bacteria 796
1683 Ga0495674_0955827 3300047319 Bacteria 659
1684 Ga0495672_0412117 3300047320 Bacteria 616
1685 Ga0495676_0128870 3300047321 Bacteria 1830
1686 Ga0495676_0520697 3300047321 Bacteria 779
1687 Ga0495673_0268217 3300047469 Bacteria 619
1688 Ga0495681_0252461 3300047470 Bacteria 696
1689 Ga0495684_0257750 3300047471 Bacteria 1266
1690 Ga0495684_0384728 3300047471 Bacteria 989
1691 Ga0495602_0202910 3300048088 Bacteria 1511
1692 Ga0495602_0224370 3300048088 Bacteria 1416
1693 Ga0495615_0001445 3300048090 Bacteria 3543
1694 Ga0495615_0028731 3300048090 Bacteria 1314
1695 Ga0496100_0293149 3300048903 Bacteria 1216
1696 Ga0496100_0788657 3300048903 Bacteria 744
1697 Ga0496101_0653497 3300048904 Bacteria 831
1698 Ga0496101_1004803 3300048904 Bacteria 656
1699 Ga0496102_0177413 3300048905 Bacteria 2007
1700 Ga0496102_0504856 3300048905 Bacteria 1132
1701 Ga0496103_0964293 3300048906 Bacteria 532
1702 Ga0496104_0036226 3300048907 Bacteria 4612
1703 Ga0496104_1240616 3300048907 Bacteria 649
1704 Ga0496106_1197384 3300048909 Bacteria 593
1705 Ga0496107_0361610 3300048910 Bacteria 1080
1706 Ga0496107_0833397 3300048910 Bacteria 674
1707 Ga0496107_0874938 3300048910 Bacteria 656
1708 Ga0496107_1108531 3300048910 Bacteria 572
1709 Ga0496108_0934943 3300048911 Bacteria 743
1710 Ga0496109_1141491 3300048912 Bacteria 716
1711 Ga0496109_1583077 3300048912 Bacteria 590
1712 Ga0496110_0000091 3300048913 Bacteria 48115
1713 Ga0496110_0015589 3300048913 Bacteria 6329
1714 Ga0496110_0330799 3300048913 Bacteria 1388
1715 Ga0496110_0730308 3300048913 Bacteria 893
1716 Ga0496110_0740549 3300048913 Bacteria 886
1717 Ga0496111_0070848 3300048914 Bacteria 2537
1718 Ga0496111_0250511 3300048914 Bacteria 1315
1719 Ga0496111_0766148 3300048914 Bacteria 700
1720 Ga0496112_0283907 3300048915 Bacteria 1602
1721 Ga0496114_0006073 3300048917 Bacteria 9506
1722 Ga0496114_0040273 3300048917 Bacteria 3867
1723 Ga0496114_0366421 3300048917 Bacteria 1275
1724 Ga0496114_0640298 3300048917 Bacteria 936
1725 Ga0496114_0699411 3300048917 Bacteria 889
1726 Ga0496115_0139323 3300048918 Bacteria 2001
1727 Ga0496115_0721805 3300048918 Bacteria 782
1728 Ga0496115_0731018 3300048918 Bacteria 776
1729 Ga0496115_0871077 3300048918 Bacteria 696
1730 Ga0496116_0025193 3300048919 Bacteria 4378
1731 Ga0496119_0151411 3300048922 Bacteria 1243
1732 Ga0496121_0006108 3300048924 Bacteria 15150
1733 Ga0496121_0204711 3300048924 Bacteria 1403
1734 Ga0496121_0268201 3300048924 Bacteria 1175
1735 Ga0496122_0289706 3300048925 Bacteria 890
1736 Ga0496122_0291225 3300048925 Bacteria 886
1737 Ga0496124_0000001 3300048927 Bacteria 1747840
1738 Ga0496126_0021992 3300048929 Bacteria 6216
1739 Ga0496126_0176695 3300048929 Bacteria 1816
1740 Ga0496126_0224666 3300048929 Bacteria 1575
1741 Ga0496126_0357119 3300048929 Bacteria 1194
1742 Ga0496126_0357170 3300048929 Bacteria 1194
1743 Ga0496126_1019861 3300048929 Bacteria 620
1744 Ga0501310_020560 3300049130 Bacteria 820
1745 Ga0501310_038155 3300049130 Bacteria 661
1746 Ga0501310_041537 3300049130 Bacteria 642
1747 Ga0501310_070000 3300049130 Bacteria 536
1748 Ga0501304_023062 3300049160 Bacteria 628
1749 Ga0501305_053708 3300049161 Bacteria 681
1750 Ga0501299_023171 3300049522 Bacteria 1150
1751 Ga0501311_040873 3300049527 Bacteria 703
1752 Ga0501312_012715 3300049528 Bacteria 1162
1753 Ga0501313_041211 3300049529 Bacteria 621
1754 Ga0501314_042035 3300049530 Bacteria 535
1755 Ga0501315_079169 3300049531 Bacteria 556
1756 Ga0501323_057613 3300049539 Bacteria 601
1757 Ga0501335_047412 3300049551 Bacteria 518
1758 Ga0501031_0025716 3300049568 Bacteria 3840
1759 Ga0501031_0170119 3300049568 Bacteria 1424
1760 Ga0501031_0466433 3300049568 Bacteria 815
1761 Ga0501031_0589400 3300049568 Bacteria 715
1762 Ga0501032_0000374 3300049569 Bacteria 36951
1763 Ga0501032_0040734 3300049569 Bacteria 3156
1764 Ga0501032_0102577 3300049569 Bacteria 1895
1765 Ga0501032_0183900 3300049569 Bacteria 1368
1766 Ga0501032_0189796 3300049569 Bacteria 1343
1767 Ga0501032_0196354 3300049569 Bacteria 1318
1768 Ga0501032_0206621 3300049569 Bacteria 1281
1769 Ga0501032_0306261 3300049569 Bacteria 1027
1770 Ga0501032_0372509 3300049569 Bacteria 919
1771 Ga0501032_0786654 3300049569 Bacteria 601
1772 Ga0501033_0005260 3300049570 Bacteria 10269
1773 Ga0501033_0017879 3300049570 Bacteria 5352
1774 Ga0501033_0029185 3300049570 Bacteria 4145
1775 Ga0501033_0053353 3300049570 Bacteria 2994
1776 Ga0501033_0088176 3300049570 Bacteria 2270
1777 Ga0501033_0172789 3300049570 Bacteria 1551
1778 Ga0501033_0227590 3300049570 Bacteria 1325
1779 Ga0501033_0315597 3300049570 Bacteria 1098
1780 Ga0501033_0556659 3300049570 Bacteria 789
1781 Ga0501033_1160024 3300049570 Bacteria 512
1782 Ga0501033_1179937 3300049570 Bacteria 507
1783 Ga0501034_0010632 3300049571 Bacteria 9573
1784 Ga0501034_0010720 3300049571 Bacteria 9520
1785 Ga0501034_0040078 3300049571 Bacteria 4743
1786 Ga0501034_0101650 3300049571 Bacteria 2868
1787 Ga0501034_0161504 3300049571 Bacteria 2211
1788 Ga0501034_0213327 3300049571 Bacteria 1885
1789 Ga0501034_0272020 3300049571 Bacteria 1635
1790 Ga0501034_0321023 3300049571 Bacteria 1482
1791 Ga0501034_0323261 3300049571 Bacteria 1475
1792 Ga0501034_0344063 3300049571 Bacteria 1421
1793 Ga0501034_0729840 3300049571 Bacteria 887
1794 Ga0501034_0810734 3300049571 Bacteria 828
1795 Ga0501034_0820211 3300049571 Bacteria 822
1796 Ga0501034_1049866 3300049571 Bacteria 697
1797 Ga0501034_1103746 3300049571 Bacteria 674
1798 Ga0501034_1428113 3300049571 Bacteria 567
1799 Ga0501036_0005653 3300049572 Bacteria 10145
1800 Ga0501036_0044234 3300049572 Bacteria 3772
1801 Ga0501036_0209685 3300049572 Bacteria 1637
1802 Ga0501036_0456166 3300049572 Bacteria 1065
1803 Ga0501036_0921298 3300049572 Bacteria 717
1804 Ga0501036_1433767 3300049572 Bacteria 559
1805 Ga0501036_1637748 3300049572 Bacteria 519
1806 Ga0501037_0000862 3300049573 Bacteria 22616
1807 Ga0501037_0034293 3300049573 Bacteria 3745
1808 Ga0501037_0048165 3300049573 Bacteria 3123
1809 Ga0501037_0109752 3300049573 Bacteria 1988
1810 Ga0501037_0255269 3300049573 Bacteria 1226
1811 Ga0501037_0381347 3300049573 Bacteria 969
1812 Ga0501038_0037384 3300049574 Bacteria 4256
1813 Ga0501038_0054804 3300049574 Bacteria 3428
1814 Ga0501038_0059385 3300049574 Bacteria 3276
1815 Ga0501038_0069019 3300049574 Bacteria 3004
1816 Ga0501038_0121174 3300049574 Bacteria 2157
1817 Ga0501038_0173475 3300049574 Bacteria 1744
1818 Ga0501038_0356477 3300049574 Bacteria 1138
1819 Ga0501039_0131878 3300049575 Bacteria 1961
1820 Ga0501039_0494969 3300049575 Bacteria 960
1821 Ga0501039_0817971 3300049575 Bacteria 726
1822 Ga0501039_0893370 3300049575 Bacteria 692
1823 Ga0501042_0014227 3300049578 Bacteria 5429
1824 Ga0501043_0004627 3300049579 Bacteria 11159
1825 Ga0501043_0010388 3300049579 Bacteria 7296
1826 Ga0501043_0065848 3300049579 Bacteria 2845
1827 Ga0501043_0087898 3300049579 Bacteria 2442
1828 Ga0501043_0220539 3300049579 Bacteria 1467
1829 Ga0501043_0226689 3300049579 Bacteria 1444
1830 Ga0501043_0290769 3300049579 Bacteria 1251
1831 Ga0501043_0346936 3300049579 Bacteria 1128
1832 Ga0501043_0467598 3300049579 Bacteria 945
1833 Ga0501043_0616395 3300049579 Bacteria 800
1834 Ga0501046_0005416 3300049580 Bacteria 11410
1835 Ga0501046_0012992 3300049580 Bacteria 7068
1836 Ga0501046_0233704 3300049580 Bacteria 1357
1837 Ga0501046_0259183 3300049580 Bacteria 1278
1838 Ga0501046_0269201 3300049580 Bacteria 1250
1839 Ga0501046_0330421 3300049580 Bacteria 1109
1840 Ga0501046_0359221 3300049580 Bacteria 1056
1841 Ga0501047_0024757 3300049581 Bacteria 5762
1842 Ga0501047_0027205 3300049581 Bacteria 5508
1843 Ga0501047_0076358 3300049581 Bacteria 3224
1844 Ga0501047_0079255 3300049581 Bacteria 3158
1845 Ga0501047_0096678 3300049581 Bacteria 2832
1846 Ga0501047_0109042 3300049581 Bacteria 2651
1847 Ga0501047_0111494 3300049581 Bacteria 2618
1848 Ga0501047_0114571 3300049581 Bacteria 2578
1849 Ga0501047_0121226 3300049581 Bacteria 2497
1850 Ga0501047_0125622 3300049581 Bacteria 2445
1851 Ga0501047_0188242 3300049581 Bacteria 1928
1852 Ga0501047_0248776 3300049581 Bacteria 1626
1853 Ga0501047_0410118 3300049581 Bacteria 1187
1854 Ga0501047_0685927 3300049581 Bacteria 842
1855 Ga0501047_0758677 3300049581 Bacteria 786
1856 Ga0501047_1051391 3300049581 Bacteria 627
1857 Ga0501047_1088783 3300049581 Bacteria 612
1858 Ga0501047_1397847 3300049581 Bacteria 515
1859 Ga0501048_0056621 3300049582 Bacteria 2781
1860 Ga0501048_0077562 3300049582 Bacteria 2345
1861 Ga0501048_0138894 3300049582 Bacteria 1718
1862 Ga0501048_1010442 3300049582 Bacteria 598
1863 Ga0501067_0001776 3300049583 Bacteria 11844
1864 Ga0501067_0005578 3300049583 Bacteria 6979
1865 Ga0501067_0031948 3300049583 Bacteria 2921
1866 Ga0501067_0089579 3300049583 Bacteria 1707
1867 Ga0501067_0331764 3300049583 Bacteria 847
1868 Ga0501067_0452148 3300049583 Bacteria 717
1869 Ga0501068_0069573 3300049584 Bacteria 2146
1870 Ga0501068_0838638 3300049584 Bacteria 604
1871 Ga0501069_0001817 3300049585 Bacteria 10655
1872 Ga0501069_0005996 3300049585 Bacteria 6340
1873 Ga0501069_0183923 3300049585 Bacteria 1208
1874 Ga0501070_0001611 3300049586 Bacteria 20025
1875 Ga0501070_0003398 3300049586 Bacteria 13819
1876 Ga0501070_0091026 3300049586 Bacteria 2525
1877 Ga0501070_0390265 3300049586 Bacteria 1127
1878 Ga0501070_0496788 3300049586 Bacteria 980
1879 Ga0501070_0594122 3300049586 Bacteria 883
1880 Ga0501070_0646797 3300049586 Bacteria 840
1881 Ga0501070_0662402 3300049586 Bacteria 828
1882 Ga0501070_0973429 3300049586 Bacteria 659
1883 Ga0501072_0122987 3300049588 Bacteria 2067
1884 Ga0501073_0043107 3300049589 Bacteria 3182
1885 Ga0501073_0070983 3300049589 Bacteria 2427
1886 Ga0501073_0176085 3300049589 Bacteria 1480
1887 Ga0501073_0184587 3300049589 Bacteria 1443
1888 Ga0501073_0186729 3300049589 Bacteria 1435
1889 Ga0501073_0311314 3300049589 Bacteria 1086
1890 Ga0501074_0010906 3300049590 Bacteria 6595
1891 Ga0501074_0035296 3300049590 Bacteria 3622
1892 Ga0501076_0238655 3300049592 Bacteria 1487
1893 Ga0501077_0010172 3300049593 Bacteria 5857
1894 Ga0501077_0018109 3300049593 Bacteria 4453
1895 Ga0501238_037722 3300049671 Bacteria 707
1896 Ga0501249_168006 3300049679 Bacteria 561
1897 Ga0501257_072298 3300049686 Bacteria 882
1898 Ga0501079_0001478 3300049741 Bacteria 16629
1899 Ga0501079_0018448 3300049741 Bacteria 5331
1900 Ga0501079_0370911 3300049741 Bacteria 1122
1901 Ga0501079_0644498 3300049741 Bacteria 834
1902 Ga0501080_0001538 3300049742 Bacteria 19472
1903 Ga0501080_0006960 3300049742 Bacteria 10202
1904 Ga0501080_0028291 3300049742 Bacteria 5213
1905 Ga0501080_0055626 3300049742 Bacteria 3685
1906 Ga0501080_0080476 3300049742 Bacteria 3028
1907 Ga0501080_0232351 3300049742 Bacteria 1685
1908 Ga0501080_0283870 3300049742 Bacteria 1504
1909 Ga0501080_0300101 3300049742 Bacteria 1457
1910 Ga0501080_0314307 3300049742 Bacteria 1419
1911 Ga0501080_1005227 3300049742 Bacteria 723
1912 Ga0501080_1017787 3300049742 Bacteria 718
1913 Ga0501080_1529147 3300049742 Bacteria 567
1914 Ga0501083_0072982 3300049744 Bacteria 2281
1915 Ga0501083_0104019 3300049744 Bacteria 1871
1916 Ga0501083_0199911 3300049744 Bacteria 1304
1917 Ga0501083_0209064 3300049744 Bacteria 1272
1918 Ga0501083_0279902 3300049744 Bacteria 1085
1919 Ga0501035_0013364 3300049822 Bacteria 7579
1920 Ga0501035_0024934 3300049822 Bacteria 5484
1921 Ga0501035_0038345 3300049822 Bacteria 4339
1922 Ga0501035_0051927 3300049822 Bacteria 3668
1923 Ga0501035_0055903 3300049822 Bacteria 3523
1924 Ga0501035_0119715 3300049822 Bacteria 2302
1925 Ga0501035_0122106 3300049822 Bacteria 2276
1926 Ga0501035_0223231 3300049822 Bacteria 1608
1927 Ga0501035_0392177 3300049822 Bacteria 1156
1928 Ga0501035_0542400 3300049822 Bacteria 953
1929 Ga0501035_0627209 3300049822 Bacteria 874
1930 Ga0501035_0629836 3300049822 Bacteria 871
1931 Ga0501035_0985958 3300049822 Bacteria 663
1932 Ga0501044_0028702 3300049823 Bacteria 5870
1933 Ga0501044_0044447 3300049823 Bacteria 4609
1934 Ga0501044_0062058 3300049823 Bacteria 3821
1935 Ga0501044_0073264 3300049823 Bacteria 3481
1936 Ga0501044_0087802 3300049823 Bacteria 3140
1937 Ga0501044_0093398 3300049823 Bacteria 3033
1938 Ga0501044_0094754 3300049823 Bacteria 3009
1939 Ga0501044_0106319 3300049823 Bacteria 2818
1940 Ga0501044_0154289 3300049823 Bacteria 2276
1941 Ga0501044_0245909 3300049823 Bacteria 1731
1942 Ga0501044_0270468 3300049823 Bacteria 1635
1943 Ga0501044_0276504 3300049823 Bacteria 1614
1944 Ga0501044_0277202 3300049823 Bacteria 1611
1945 Ga0501044_0458440 3300049823 Bacteria 1180
1946 Ga0501044_0494129 3300049823 Bacteria 1125
1947 Ga0501044_0664052 3300049823 Bacteria 930
1948 Ga0501044_0722140 3300049823 Bacteria 880
1949 Ga0501044_0763394 3300049823 Bacteria 848
1950 Ga0501044_1087961 3300049823 Bacteria 669
1951 Ga0501045_0060997 3300049824 Bacteria 2766
1952 Ga0501045_0090970 3300049824 Bacteria 2255
1953 nmdc:mga03n38_163963_c1 3300050490 Bacteria 1127
1954 nmdc:mga03n38_167404_c1 3300050490 Bacteria 1117
1955 nmdc:mga03n38_864477_c1 3300050490 Bacteria 529
1956 nmdc:mga00v17_4550_c1 3300050491 Bacteria 7225
1957 nmdc:mga00v17_56248_c1 3300050491 Bacteria 2405
1958 nmdc:mga00v17_632651_c1 3300050491 Bacteria 689
1959 nmdc:mga00v17_839543_c1 3300050491 Bacteria 584
1960 nmdc:mga0k408_108053_c2 3300050493 Bacteria 1023
1961 nmdc:mga0k408_135320_c1 3300050493 Bacteria 1464
1962 nmdc:mga0k408_159669_c1 3300050493 Bacteria 1343
1963 nmdc:mga0k408_169594_c1 3300050493 Bacteria 1301
1964 nmdc:mga0k408_221757_c1 3300050493 Bacteria 1129
1965 nmdc:mga0k408_232332_c1 3300050493 Bacteria 1101
1966 nmdc:mga0k408_601108_c1 3300050493 Bacteria 649
1967 nmdc:mga0k408_881033_c1 3300050493 Bacteria 520
1968 nmdc:mga0k408_8810_c1 3300050493 Bacteria 5429
1969 nmdc:mga06z11_109527_c1 3300050494 Bacteria 1528
1970 nmdc:mga06z11_259219_c1 3300050494 Bacteria 1026
1971 nmdc:mga06z11_869805_c1 3300050494 Bacteria 549
1972 nmdc:mga04h51_14488_c1 3300050495 Bacteria 2254
1973 nmdc:mga04h51_262765_c1 3300050495 Bacteria 695
1974 nmdc:mga07m45_58977_c1 3300050496 Bacteria 2172
1975 nmdc:mga05p37_1009362_c1 3300050507 Bacteria 883
1976 nmdc:mga05p37_402822_c1 3300050507 Bacteria 1597
1977 nmdc:mga09592_390576_c1 3300050508 Bacteria 1203
1978 nmdc:mga09592_68918_c1 3300050508 Bacteria 3001
1979 nmdc:mga0qj67_812613_c1 3300050509 Bacteria 740
1980 nmdc:mga08y16_116437_c1 3300050511 Bacteria 2782
1981 nmdc:mga08y16_1232385_c1 3300050511 Bacteria 718
1982 nmdc:mga08y16_602566_c1 3300050511 Bacteria 1107
1983 nmdc:mga08y16_772704_c1 3300050511 Bacteria 955
1984 nmdc:mga08y16_92382_c1 3300050511 Bacteria 3154
1985 nmdc:mga0n895_129615_c1 3300050512 Bacteria 2547
1986 nmdc:mga0n895_1522112_c1 3300050512 Bacteria 635
1987 nmdc:mga0n895_1572688_c1 3300050512 Bacteria 622
1988 nmdc:mga0n895_2042959_c1 3300050512 Bacteria 530
1989 nmdc:mga0rr50_115823_c1 3300050513 Bacteria 2127
1990 nmdc:mga0rr50_173981_c1 3300050513 Bacteria 1756
1991 nmdc:mga0rr50_334808_c1 3300050513 Bacteria 1271
1992 nmdc:mga08x19_114136_c1 3300050514 Bacteria 1804
1993 nmdc:mga08x19_14934_c1 3300050514 Bacteria 4717
1994 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
1995 nmdc:mga08x19_84708_c1 3300050514 Bacteria 2085
1996 nmdc:mga0a205_213946_c1 3300050515 Bacteria 1815
1997 nmdc:mga0sz30_11705_c1 3300050516 Bacteria 3395
1998 nmdc:mga0sz30_164397_c1 3300050516 Bacteria 983
1999 Ga0495601_0540984 3300053077 Bacteria 750
2000 Ga0500635_0006898 3300053080 Bacteria 3054
2001 Ga0495595_0603146 3300053084 Bacteria 561
2002 Ga0495619_0028862 3300053085 Bacteria 3580
2003 Ga0500644_0058089 3300053088 Bacteria 1352
2004 Ga0500646_0136477 3300053090 Bacteria 802
2005 Ga0500651_0081525 3300053093 Bacteria 2003
2006 Ga0500566_0195987 3300053094 Bacteria 1024
2007 Ga0500641_0002384 3300053096 Bacteria 6663
2008 Ga0500641_0003388 3300053096 Bacteria 5637
2009 Ga0500554_190365 3300053102 Bacteria 688
2010 Ga0500555_016261 3300053103 Bacteria 2143
2011 Ga0500555_046091 3300053103 Bacteria 1203
2012 Ga0500569_000322 3300053109 Bacteria 7683
2013 Ga0500595_003166 3300053119 Bacteria 7792
2014 Ga0500595_008511 3300053119 Bacteria 4187
2015 Ga0500595_014727 3300053119 Bacteria 2958
2016 Ga0500597_235982 3300053120 Bacteria 754
2017 Ga0500614_241869 3300053123 Bacteria 562
2018 Ga0500642_0285062 3300053130 Bacteria 749
2019 Ga0500642_0399293 3300053130 Bacteria 600
2020 Ga0500652_000024 3300053131 Bacteria 116239
2021 Ga0500655_000570 3300053133 Bacteria 7397
2022 Ga0500655_024001 3300053133 Bacteria 1153
2023 Ga0500559_0021975 3300053136 Bacteria 2706
2024 Ga0500568_0031032 3300053139 Bacteria 2209
2025 Ga0500588_0006719 3300053146 Bacteria 2622
2026 Ga0500588_0135402 3300053146 Bacteria 881
2027 Ga0500590_003606 3300053148 Bacteria 7176
2028 Ga0500619_011027 3300053154 Bacteria 2309
2029 Ga0500619_266234 3300053154 Bacteria 561
2030 Ga0500622_0046772 3300053156 Bacteria 2236
2031 Ga0500639_257166 3300053163 Bacteria 694
2032 Ga0500636_0032406 3300053177 Bacteria 3093
2033 Ga0500637_0335938 3300053178 Bacteria 810
2034 Ga0500570_035251 3300053724 Bacteria 2668
2035 Ga0500645_062715 3300053730 Bacteria 1073
2036 Ga0501084_0007620 3300054114 Bacteria 8925
2037 Ga0501084_0030163 3300054114 Bacteria 4535
2038 Ga0590071_039425 3300059421 Bacteria 1135
2039 Ga0590075_029860 3300059424 Bacteria 1379
2040 Ga0590077_007205 3300059426 Bacteria 2276
2041 Ga0587084_066351 3300059477 Bacteria 672
2042 Ga0587084_074894 3300059477 Bacteria 646
2043 Ga0587084_079058 3300059477 Bacteria 634
2044 Ga0587084_144953 3300059477 Bacteria 518
2045 Ga0587093_026416 3300059478 Bacteria 811
2046 Ga0587093_048166 3300059478 Bacteria 666
2047 Ga0587093_059090 3300059478 Bacteria 622
2048 Ga0587066_008616 3300059490 Bacteria 1421
2049 Ga0587077_007699 3300059493 Bacteria 1580
2050 Ga0587077_200525 3300059493 Bacteria 552
2051 Ga0587082_046122 3300059504 Bacteria 816
2052 Ga0587083_0039236 3300059505 Bacteria 983
2053 Ga0587085_082509 3300059506 Bacteria 650
2054 Ga0587085_186149 3300059506 Bacteria 501
2055 Ga0587086_027435 3300059507 Bacteria 817
2056 Ga0587086_079793 3300059507 Bacteria 575
2057 Ga0587091_145094 3300059511 Bacteria 598
2058 Ga0587092_040572 3300059512 Bacteria 808
2059 Ga0587092_075814 3300059512 Bacteria 656
2060 Ga0587092_097792 3300059512 Bacteria 601
2061 Ga0587094_069773 3300059513 Bacteria 631
2062 Ga0587101_010265 3300059623 Bacteria 1173
2063 Ga0587101_028908 3300059623 Bacteria 852
2064 Ga0587101_141014 3300059623 Bacteria 515
2065 Ga0587109_002504 3300059624 Bacteria 2340
2066 Ga0587109_044517 3300059624 Bacteria 891
2067 Ga0587109_077708 3300059624 Bacteria 729
2068 Ga0587109_094041 3300059624 Bacteria 680
2069 Ga0587109_164629 3300059624 Bacteria 557
2070 Ga0587117_087623 3300059627 Bacteria 576
2071 Ga0587117_122483 3300059627 Bacteria 516
2072 Ga0587062_007334 3300059639 Bacteria 1284
2073 Ga0587062_020221 3300059639 Bacteria 937
2074 Ga0587062_072074 3300059639 Bacteria 627
2075 Ga0587062_079365 3300059639 Bacteria 607
2076 Ga0587062_100929 3300059639 Bacteria 562
2077 Ga0587068_008671 3300059641 Bacteria 1480
2078 Ga0587068_009003 3300059641 Bacteria 1461
2079 Ga0587068_169082 3300059641 Bacteria 505
2080 Ga0587072_005295 3300059643 Bacteria 1923
2081 Ga0587072_062919 3300059643 Bacteria 768
2082 Ga0587076_065541 3300059645 Bacteria 742
2083 Ga0587076_154490 3300059645 Bacteria 560
2084 Ga0587078_048028 3300059646 Bacteria 619
2085 Ga0587079_003083 3300059647 Unclassified 2137
2086 Ga0587100_008513 3300059648 Bacteria 831
2087 Ga0587108_024389 3300059653 Bacteria 591
2088 Ga0587110_022418 3300059654 Bacteria 724
2089 Ga0587116_02796 3300059656 Bacteria 940
2090 Ga0587119_037497 3300059658 Bacteria 684
2091 Ga0587124_003611 3300059660 Bacteria 1157
2092 Ga0587124_036624 3300059660 Bacteria 560
2093 Ga0587111_0020627 3300060346 Bacteria 1263
2094 Ga0587111_0071398 3300060346 Bacteria 811
2095 Ga0587111_0090330 3300060346 Bacteria 747
2096 Ga0587111_0093124 3300060346 Bacteria 739
2097 Ga0587111_0276326 3300060346 Bacteria 506
2098 Ga0501082_0032834 3300060353 Bacteria 4477
2099 Ga0501082_0047556 3300060353 Bacteria 3697
2100 Ga0501082_0246759 3300060353 Bacteria 1554
2101 Ga0501082_1600745 3300060353 Bacteria 569
2102 Ga0466962_0058982 3300061719 Bacteria 1832
2103 Ga0466962_0340689 3300061719 Bacteria 746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10697038 Ga0157371_106970382 86
2 3300009094 Ga0111539_10272780 Ga0111539_102727802 87
3 3300009174 Ga0105241_12367744 Ga0105241_123677442 87
4 3300031727 Ga0316576_10292620 Ga0316576_102926203 87
5 3300035398 Ga0316574_0337784 Ga0316574_0337784_103_378 87
6 3300049679 Ga0501249_168006 Ga0501249_168006_81_362 87
7 3300050507 nmdc:mga05p37_402822_c1 nmdc:mga05p37_402822_c1_76_483 87
8 3300005329 Ga0070683_100093535 Ga0070683_1000935352 88
9 3300005331 Ga0070670_100034493 Ga0070670_1000344933 88
10 3300005331 Ga0070670_100168448 Ga0070670_1001684484 88
11 3300005335 Ga0070666_10413436 Ga0070666_104134362 88
12 3300005337 Ga0070682_100000787 Ga0070682_1000007876 88
13 3300005337 Ga0070682_100018185 Ga0070682_1000181857 88
14 3300005338 Ga0068868_101126186 Ga0068868_1011261862 88
15 3300005339 Ga0070660_101831593 Ga0070660_1018315931 88
16 3300005345 Ga0070692_10232205 Ga0070692_102322052 88
17 3300005347 Ga0070668_101083206 Ga0070668_1010832062 88
18 3300005347 Ga0070668_101918602 Ga0070668_1019186021 88
19 3300005354 Ga0070675_100515280 Ga0070675_1005152802 88
20 3300005354 Ga0070675_100868114 Ga0070675_1008681142 88
21 3300005365 Ga0070688_100173219 Ga0070688_1001732191 88
22 3300005366 Ga0070659_100640375 Ga0070659_1006403751 88
23 3300005367 Ga0070667_100000264 Ga0070667_10000026426 88
24 3300005367 Ga0070667_101143834 Ga0070667_1011438342 88
25 3300005367 Ga0070667_102057871 Ga0070667_1020578711 88
26 3300005436 Ga0070713_101029602 Ga0070713_1010296022 88
27 3300005437 Ga0070710_10380241 Ga0070710_103802412 88
28 3300005438 Ga0070701_10190934 Ga0070701_101909342 88
29 3300005438 Ga0070701_10806812 Ga0070701_108068122 88
30 3300005439 Ga0070711_101004960 Ga0070711_1010049602 88
31 3300005440 Ga0070705_100058504 Ga0070705_1000585043 88
32 3300005444 Ga0070694_100171499 Ga0070694_1001714993 88
33 3300005455 Ga0070663_100025785 Ga0070663_1000257856 88
34 3300005456 Ga0070678_100120481 Ga0070678_1001204813 88
35 3300005459 Ga0068867_100035463 Ga0068867_1000354633 88
36 3300005471 Ga0070698_100149880 Ga0070698_1001498804 88
37 3300005535 Ga0070684_100986294 Ga0070684_1009862942 88
38 3300005539 Ga0068853_101883767 Ga0068853_1018837671 88
39 3300005543 Ga0070672_100102627 Ga0070672_1001026272 88
40 3300005545 Ga0070695_101414852 Ga0070695_1014148522 88
41 3300005547 Ga0070693_101421878 Ga0070693_1014218781 88
42 3300005548 Ga0070665_100133004 Ga0070665_1001330044 88
43 3300005549 Ga0070704_100483519 Ga0070704_1004835192 88
44 3300005563 Ga0068855_100843113 Ga0068855_1008431132 88
45 3300005564 Ga0070664_101022723 Ga0070664_1010227231 88
46 3300005577 Ga0068857_100131593 Ga0068857_1001315933 88
47 3300005614 Ga0068856_100106915 Ga0068856_1001069152 88
48 3300005616 Ga0068852_100452675 Ga0068852_1004526753 88
49 3300005719 Ga0068861_100025699 Ga0068861_1000256994 88
50 3300005719 Ga0068861_100775180 Ga0068861_1007751801 88
51 3300005841 Ga0068863_100169945 Ga0068863_1001699454 88
52 3300005843 Ga0068860_101313994 Ga0068860_1013139942 88
53 3300006178 Ga0075367_10945544 Ga0075367_109455442 88
54 3300006195 Ga0075366_10076481 Ga0075366_100764811 88
55 3300006195 Ga0075366_10155782 Ga0075366_101557822 88
56 3300006195 Ga0075366_10306970 Ga0075366_103069702 88
57 3300006237 Ga0097621_100198649 Ga0097621_1001986494 88
58 3300006358 Ga0068871_100390975 Ga0068871_1003909752 88
59 3300006846 Ga0075430_101228452 Ga0075430_1012284522 88
60 3300007076 Ga0075435_100137181 Ga0075435_1001371813 88
61 3300009094 Ga0111539_10050779 Ga0111539_100507796 88
62 3300009094 Ga0111539_10165120 Ga0111539_101651203 88
63 3300009098 Ga0105245_10003702 Ga0105245_100037028 88
64 3300009098 Ga0105245_12780844 Ga0105245_127808442 88
65 3300009148 Ga0105243_10186214 Ga0105243_101862144 88
66 3300009148 Ga0105243_10202972 Ga0105243_102029722 88
67 3300009148 Ga0105243_12354829 Ga0105243_123548291 88
68 3300009174 Ga0105241_11019538 Ga0105241_110195381 88
69 3300009176 Ga0105242_10044757 Ga0105242_100447576 88
70 3300009177 Ga0105248_10196603 Ga0105248_101966032 88
71 3300009551 Ga0105238_10212861 Ga0105238_102128613 88
72 3300011119 Ga0105246_10721512 Ga0105246_107215122 88
73 3300011119 Ga0105246_11449667 Ga0105246_114496671 88
74 3300013296 Ga0157374_12364951 Ga0157374_123649511 88
75 3300013307 Ga0157372_11894393 Ga0157372_118943932 88
76 3300013308 Ga0157375_11593235 Ga0157375_115932352 88
77 3300014325 Ga0163163_10993552 Ga0163163_109935522 88
78 3300014325 Ga0163163_12198364 Ga0163163_121983641 88
79 3300014325 Ga0163163_12687902 Ga0163163_126879022 88
80 3300014326 Ga0157380_10313692 Ga0157380_103136921 88
81 3300014969 Ga0157376_12789347 Ga0157376_127893472 88
82 3300021384 Ga0213876_10403726 Ga0213876_104037262 88
83 3300025898 Ga0207692_10375142 Ga0207692_103751422 88
84 3300025944 Ga0207661_11286502 Ga0207661_112865021 88
85 3300025949 Ga0207667_10473726 Ga0207667_104737262 88
86 3300025972 Ga0207668_11851600 Ga0207668_118516002 88
87 3300025986 Ga0207658_10000130 Ga0207658_1000013030 88
88 3300026023 Ga0207677_11275135 Ga0207677_112751352 88
89 3300026067 Ga0207678_10087627 Ga0207678_100876271 88
90 3300026067 Ga0207678_10146066 Ga0207678_101460661 88
91 3300026088 Ga0207641_10076094 Ga0207641_100760942 88
92 3300026089 Ga0207648_10012510 Ga0207648_100125106 88
93 3300026116 Ga0207674_10249760 Ga0207674_102497603 88
94 3300026118 Ga0207675_100034510 Ga0207675_1000345104 88
95 3300026118 Ga0207675_100713765 Ga0207675_1007137652 88
96 3300028577 Ga0265318_10008259 Ga0265318_100082594 88
97 3300028800 Ga0265338_10049941 Ga0265338_100499416 88
98 3300031240 Ga0265320_10029258 Ga0265320_100292584 88
99 3300031241 Ga0265325_10001575 Ga0265325_100015756 88
100 3300031247 Ga0265340_10009613 Ga0265340_100096136 88
101 3300031249 Ga0265339_10287312 Ga0265339_102873122 88
102 3300031250 Ga0265331_10067943 Ga0265331_100679433 88
103 3300031344 Ga0265316_10001048 Ga0265316_1000104838 88
104 3300031595 Ga0265313_10001355 Ga0265313_100013553 88
105 3300031727 Ga0316576_10345769 Ga0316576_103457692 88
106 3300031727 Ga0316576_11184166 Ga0316576_111841661 88
107 3300031852 Ga0307410_10002052 Ga0307410_1000205218 88
108 3300031852 Ga0307410_11989557 Ga0307410_119895571 88
109 3300031903 Ga0307407_10011273 Ga0307407_100112733 88
110 3300031995 Ga0307409_100000500 Ga0307409_10000050017 88
111 3300032002 Ga0307416_101528276 Ga0307416_1015282762 88
112 3300032005 Ga0307411_10001749 Ga0307411_1000174916 88
113 3300032005 Ga0307411_10767299 Ga0307411_107672992 88
114 3300032168 Ga0316593_10004897 Ga0316593_100048972 88
115 3300032168 Ga0316593_10106940 Ga0316593_101069402 88
116 3300033524 Ga0316592_1000874 Ga0316592_10008743 88
117 3300033524 Ga0316592_1009037 Ga0316592_10090373 88
118 3300033524 Ga0316592_1035933 Ga0316592_10359331 88
119 3300033524 Ga0316592_1047032 Ga0316592_10470322 88
120 3300033524 Ga0316592_1074302 Ga0316592_10743022 88
121 3300033528 Ga0316588_1000022 Ga0316588_10000221 88
122 3300033528 Ga0316588_1000956 Ga0316588_10009569 88
123 3300033528 Ga0316588_1004229 Ga0316588_10042296 88
124 3300033528 Ga0316588_1085484 Ga0316588_10854842 88
125 3300033541 Ga0316596_1000580 Ga0316596_10005807 88
126 3300033541 Ga0316596_1002213 Ga0316596_10022133 88
127 3300033541 Ga0316596_1011231 Ga0316596_10112314 88
128 3300033541 Ga0316596_1012745 Ga0316596_10127453 88
129 3300033541 Ga0316596_1020052 Ga0316596_10200523 88
130 3300033541 Ga0316596_1043687 Ga0316596_10436871 88
131 3300033541 Ga0316596_1083441 Ga0316596_10834412 88
132 3300035084 Ga0373928_0071090 Ga0373928_0071090_67_345 88
133 3300035171 Ga0373946_0224019 Ga0373946_0224019_403_732 88
134 3300035172 Ga0373955_0200232 Ga0373955_0200232_575_913 88
135 3300035398 Ga0316574_0114083 Ga0316574_0114083_1392_1667 88
136 3300035398 Ga0316574_0218154 Ga0316574_0218154_151_426 88
137 3300035398 Ga0316574_0725800 Ga0316574_0725800_232_507 88
138 3300035695 Ga0373927_0038864 Ga0373927_0038864_1647_1952 88
139 3300035724 Ga0373933_0051470 Ga0373933_0051470_1347_1628 88
140 3300036401 Ga0373937_0960984 Ga0373937_0960984_137_451 88
141 3300037068 Ga0373925_0028694 Ga0373925_0028694_2145_2450 88
142 3300037068 Ga0373925_1159488 Ga0373925_1159488_169_498 88
143 3300037418 Ga0395900_0098160 Ga0395900_0098160_65_391 88
144 3300037418 Ga0395900_0317189 Ga0395900_0317189_281_604 88
145 3300037418 Ga0395900_0736711 Ga0395900_0736711_52_378 88
146 3300037466 Ga0395898_0399087 Ga0395898_0399087_36_359 88
147 3300037466 Ga0395898_1773432 Ga0395898_1773432_133_408 88
148 3300037471 Ga0395905_0001744 Ga0395905_0001744_17198_17524 88
149 3300037471 Ga0395905_0011466 Ga0395905_0011466_5942_6265 88
150 3300037471 Ga0395905_0025951 Ga0395905_0025951_2291_2614 88
151 3300038742 Ga0400486_06268 Ga0400486_06268_779_1054 88
152 3300039093 Ga0400489_16718 Ga0400489_16718_1426_1725 88
153 3300039437 Ga0436365_0983361 Ga0436365_0983361_301_615 88
154 3300039450 Ga0436363_1579330 Ga0436363_1579330_152_532 88
155 3300041486 Ga0451807_2661718 Ga0451807_2661718_404_679 88
156 3300041494 Ga0451837_1485297 Ga0451837_1485297_205_477 88
157 3300041509 Ga0451843_1718550 Ga0451843_1718550_64_351 88
158 3300042876 Ga0451577_0391737 Ga0451577_0391737_584_859 88
159 3300044673 Ga0453683_0004436 Ga0453683_0004436_150_425 88
160 3300044673 Ga0453683_0012274 Ga0453683_0012274_2919_3197 88
161 3300044712 Ga0453684_0007136 Ga0453684_0007136_2991_3266 88
162 3300044712 Ga0453684_0109834 Ga0453684_0109834_530_805 88
163 3300045051 Ga0451576_0032584 Ga0451576_0032584_152_430 88
164 3300045051 Ga0451576_0121448 Ga0451576_0121448_2223_2501 88
165 3300045051 Ga0451576_0188314 Ga0451576_0188314_412_771 88
166 3300046536 Ga0495587_0096111 Ga0495587_0096111_100_384 88
167 3300048912 Ga0496109_1583077 Ga0496109_1583077_252_578 88
168 3300048919 Ga0496116_0025193 Ga0496116_0025193_2590_2904 88
169 3300048924 Ga0496121_0204711 Ga0496121_0204711_213_527 88
170 3300048929 Ga0496126_0357119 Ga0496126_0357119_745_1059 88
171 3300049571 Ga0501034_0272020 Ga0501034_0272020_69_350 88
172 3300049572 Ga0501036_1433767 Ga0501036_1433767_89_370 88
173 3300049593 Ga0501077_0018109 Ga0501077_0018109_3115_3396 88
174 3300049671 Ga0501238_037722 Ga0501238_037722_26_316 88
175 3300049686 Ga0501257_072298 Ga0501257_072298_385_666 88
176 3300050493 nmdc:mga0k408_108053_c2 nmdc:mga0k408_108053_c2_517_798 88
177 3300050493 nmdc:mga0k408_232332_c1 nmdc:mga0k408_232332_c1_530_811 88
178 3300050493 nmdc:mga0k408_601108_c1 nmdc:mga0k408_601108_c1_173_454 88
179 3300050493 nmdc:mga0k408_881033_c1 nmdc:mga0k408_881033_c1_32_376 88
180 3300050494 nmdc:mga06z11_869805_c1 nmdc:mga06z11_869805_c1_161_442 88
181 3300050509 nmdc:mga0qj67_812613_c1 nmdc:mga0qj67_812613_c1_399_677 88
182 3300053090 Ga0500646_0136477 Ga0500646_0136477_305_586 88
183 3300053103 Ga0500555_016261 Ga0500555_016261_1225_1506 88
184 3300053146 Ga0500588_0006719 Ga0500588_0006719_1789_2070 88
185 3300059504 Ga0587082_046122 Ga0587082_046122_136_459 88
186 3300059512 Ga0587092_040572 Ga0587092_040572_511_786 88
187 3300059627 Ga0587117_122483 Ga0587117_122483_132_413 88
188 3300059647 Ga0587079_003083 Ga0587079_003083_129_452 88
189 3300059656 Ga0587116_02796 Ga0587116_02796_111_395 88
190 3300005295 Ga0065707_10003983 Ga0065707_100039833 89
191 3300005295 Ga0065707_11047092 Ga0065707_110470921 89
192 3300005843 Ga0068860_101383927 Ga0068860_1013839272 89
193 3300006028 Ga0070717_10401963 Ga0070717_104019632 89
194 3300013297 Ga0157378_11778809 Ga0157378_117788092 89
195 3300020070 Ga0206356_10984312 Ga0206356_109843122 89
196 3300025916 Ga0207663_10479651 Ga0207663_104796512 89
197 3300025925 Ga0207650_10048909 Ga0207650_100489098 89
198 3300025926 Ga0207659_10171687 Ga0207659_101716872 89
199 3300025940 Ga0207691_10111430 Ga0207691_101114304 89
200 3300026023 Ga0207677_10544175 Ga0207677_105441753 89
201 3300027907 Ga0207428_10071472 Ga0207428_100714724 89
202 3300028800 Ga0265338_10477212 Ga0265338_104772121 89
203 3300031344 Ga0265316_10585638 Ga0265316_105856382 89
204 3300031691 Ga0316579_10181944 Ga0316579_101819442 89
205 3300031691 Ga0316579_10483979 Ga0316579_104839791 89
206 3300031711 Ga0265314_10275040 Ga0265314_102750402 89
207 3300031727 Ga0316576_10254984 Ga0316576_102549842 89
208 3300031733 Ga0316577_10851051 Ga0316577_108510511 89
209 3300032133 Ga0316583_10256192 Ga0316583_102561922 89
210 3300033524 Ga0316592_1000007 Ga0316592_10000078 89
211 3300033524 Ga0316592_1003317 Ga0316592_10033172 89
212 3300033524 Ga0316592_1022971 Ga0316592_10229712 89
213 3300033524 Ga0316592_1059262 Ga0316592_10592622 89
214 3300033527 Ga0316586_1013886 Ga0316586_10138862 89
215 3300033528 Ga0316588_1000820 Ga0316588_10008208 89
216 3300033528 Ga0316588_1187240 Ga0316588_11872401 89
217 3300033529 Ga0316587_1089853 Ga0316587_10898532 89
218 3300035084 Ga0373928_0005989 Ga0373928_0005989_1111_1392 89
219 3300035171 Ga0373946_0768037 Ga0373946_0768037_124_399 89
220 3300035691 Ga0373931_0549811 Ga0373931_0549811_251_604 89
221 3300035695 Ga0373927_0146095 Ga0373927_0146095_960_1235 89
222 3300035725 Ga0373947_0078836 Ga0373947_0078836_322_597 89
223 3300036401 Ga0373937_2141150 Ga0373937_2141150_75_419 89
224 3300041461 Ga0451805_063863 Ga0451805_063863_262_540 89
225 3300042876 Ga0451577_0002073 Ga0451577_0002073_20419_20700 89
226 3300042876 Ga0451577_0007263 Ga0451577_0007263_2830_3111 89
227 3300042876 Ga0451577_0015598 Ga0451577_0015598_3279_3560 89
228 3300042876 Ga0451577_0023525 Ga0451577_0023525_4784_5065 89
229 3300042876 Ga0451577_0036483 Ga0451577_0036483_909_1190 89
230 3300042876 Ga0451577_0043713 Ga0451577_0043713_707_988 89
231 3300042876 Ga0451577_0056998 Ga0451577_0056998_248_529 89
232 3300042876 Ga0451577_0332387 Ga0451577_0332387_224_505 89
233 3300042876 Ga0451577_0355924 Ga0451577_0355924_826_1107 89
234 3300042876 Ga0451577_1408031 Ga0451577_1408031_239_520 89
235 3300044673 Ga0453683_0000002 Ga0453683_0000002_903413_903694 89
236 3300044673 Ga0453683_0000075 Ga0453683_0000075_119646_119927 89
237 3300044673 Ga0453683_0000633 Ga0453683_0000633_3005_3286 89
238 3300044673 Ga0453683_0003668 Ga0453683_0003668_2921_3202 89
239 3300044673 Ga0453683_0005086 Ga0453683_0005086_3402_3683 89
240 3300044673 Ga0453683_0006512 Ga0453683_0006512_4850_5131 89
241 3300044673 Ga0453683_0063564 Ga0453683_0063564_1319_1600 89
242 3300044673 Ga0453683_0107363 Ga0453683_0107363_102_383 89
243 3300044673 Ga0453683_0379138 Ga0453683_0379138_465_746 89
244 3300044673 Ga0453683_0597432 Ga0453683_0597432_280_561 89
245 3300044712 Ga0453684_0000950 Ga0453684_0000950_3279_3560 89
246 3300044712 Ga0453684_0001302 Ga0453684_0001302_2891_3172 89
247 3300044712 Ga0453684_0003118 Ga0453684_0003118_34898_35179 89
248 3300044712 Ga0453684_0005204 Ga0453684_0005204_14473_14754 89
249 3300044712 Ga0453684_0005988 Ga0453684_0005988_20493_20774 89
250 3300044712 Ga0453684_0040563 Ga0453684_0040563_3156_3437 89
251 3300044712 Ga0453684_0057836 Ga0453684_0057836_2885_3166 89
252 3300044712 Ga0453684_0091997 Ga0453684_0091997_386_667 89
253 3300044712 Ga0453684_0146959 Ga0453684_0146959_1414_1692 89
254 3300044712 Ga0453684_0599268 Ga0453684_0599268_378_659 89
255 3300044712 Ga0453684_0765155 Ga0453684_0765155_611_895 89
256 3300044712 Ga0453684_1040162 Ga0453684_1040162_532_813 89
257 3300044712 Ga0453684_2284097 Ga0453684_2284097_71_352 89
258 3300044712 Ga0453684_2463463 Ga0453684_2463463_146_427 89
259 3300045051 Ga0451576_0000151 Ga0451576_0000151_173313_173594 89
260 3300045051 Ga0451576_0005912 Ga0451576_0005912_2893_3174 89
261 3300045051 Ga0451576_0061298 Ga0451576_0061298_2901_3182 89
262 3300045051 Ga0451576_0224355 Ga0451576_0224355_398_679 89
263 3300045051 Ga0451576_0268543 Ga0451576_0268543_1063_1344 89
264 3300045051 Ga0451576_0406248 Ga0451576_0406248_69_350 89
265 3300045051 Ga0451576_0428681 Ga0451576_0428681_519_800 89
266 3300045051 Ga0451576_0684101 Ga0451576_0684101_397_678 89
267 3300045051 Ga0451576_0797867 Ga0451576_0797867_355_636 89
268 3300045051 Ga0451576_1769095 Ga0451576_1769095_276_557 89
269 3300046522 Ga0495643_0488008 Ga0495643_0488008_191_466 89
270 3300046542 Ga0495597_0015301 Ga0495597_0015301_2016_2291 89
271 3300046616 Ga0495668_0112795 Ga0495668_0112795_746_1021 89
272 3300048906 Ga0496103_0964293 Ga0496103_0964293_153_428 89
273 3300049551 Ga0501335_047412 Ga0501335_047412_45_326 89
274 3300049742 Ga0501080_0001538 Ga0501080_0001538_2050_2367 89
275 3300050511 nmdc:mga08y16_92382_c1 nmdc:mga08y16_92382_c1_2230_2589 89
276 3300053093 Ga0500651_0081525 Ga0500651_0081525_62_337 89
277 3300053130 Ga0500642_0285062 Ga0500642_0285062_192_467 89
278 3300053133 Ga0500655_000570 Ga0500655_000570_6282_6557 89
279 3300053148 Ga0500590_003606 Ga0500590_003606_644_919 89
280 3300053156 Ga0500622_0046772 Ga0500622_0046772_1440_1715 89
281 3300053724 Ga0500570_035251 Ga0500570_035251_1533_1808 89
282 3300002741 JGI25157J39369_1033203 JGI25157J39369_10332032 90
283 3300003214 JGI25165J46597_1001315 JGI25165J46597_100131521 90
284 3300003215 JGI25153J46596_10000830 JGI25153J46596_1000083027 90
285 3300004800 Ga0058861_11942326 Ga0058861_119423262 90
286 3300004803 Ga0058862_12348238 Ga0058862_123482383 90
287 3300004803 Ga0058862_12474685 Ga0058862_124746851 90
288 3300005327 Ga0070658_10021396 Ga0070658_100213967 90
289 3300005327 Ga0070658_10094080 Ga0070658_100940805 90
290 3300005327 Ga0070658_10127826 Ga0070658_101278263 90
291 3300005327 Ga0070658_10399383 Ga0070658_103993831 90
292 3300005327 Ga0070658_10616711 Ga0070658_106167112 90
293 3300005327 Ga0070658_11252490 Ga0070658_112524902 90
294 3300005327 Ga0070658_11981444 Ga0070658_119814442 90
295 3300005328 Ga0070676_10018760 Ga0070676_100187607 90
296 3300005328 Ga0070676_10431694 Ga0070676_104316941 90
297 3300005329 Ga0070683_100084181 Ga0070683_1000841812 90
298 3300005329 Ga0070683_102338035 Ga0070683_1023380351 90
299 3300005330 Ga0070690_101267928 Ga0070690_1012679281 90
300 3300005331 Ga0070670_100282344 Ga0070670_1002823442 90
301 3300005331 Ga0070670_100649247 Ga0070670_1006492472 90
302 3300005331 Ga0070670_101410847 Ga0070670_1014108471 90
303 3300005333 Ga0070677_10346196 Ga0070677_103461962 90
304 3300005334 Ga0068869_100612850 Ga0068869_1006128502 90
305 3300005336 Ga0070680_100002998 Ga0070680_10000299823 90
306 3300005336 Ga0070680_100020347 Ga0070680_1000203477 90
307 3300005336 Ga0070680_100163580 Ga0070680_1001635803 90
308 3300005336 Ga0070680_100419896 Ga0070680_1004198963 90
309 3300005336 Ga0070680_101916672 Ga0070680_1019166721 90
310 3300005337 Ga0070682_100259703 Ga0070682_1002597032 90
311 3300005337 Ga0070682_100637422 Ga0070682_1006374222 90
312 3300005338 Ga0068868_101098906 Ga0068868_1010989062 90
313 3300005338 Ga0068868_102431636 Ga0068868_1024316362 90
314 3300005339 Ga0070660_100001324 Ga0070660_10000132416 90
315 3300005339 Ga0070660_100051230 Ga0070660_1000512304 90
316 3300005339 Ga0070660_100659389 Ga0070660_1006593892 90
317 3300005339 Ga0070660_101228290 Ga0070660_1012282902 90
318 3300005339 Ga0070660_101680789 Ga0070660_1016807891 90
319 3300005339 Ga0070660_101717507 Ga0070660_1017175072 90
320 3300005340 Ga0070689_100060425 Ga0070689_1000604256 90
321 3300005341 Ga0070691_10000386 Ga0070691_1000038624 90
322 3300005341 Ga0070691_10000795 Ga0070691_1000079511 90
323 3300005344 Ga0070661_100134242 Ga0070661_1001342422 90
324 3300005344 Ga0070661_100376345 Ga0070661_1003763452 90
325 3300005344 Ga0070661_100988733 Ga0070661_1009887332 90
326 3300005344 Ga0070661_101169555 Ga0070661_1011695552 90
327 3300005347 Ga0070668_100662884 Ga0070668_1006628842 90
328 3300005353 Ga0070669_100019075 Ga0070669_1000190757 90
329 3300005353 Ga0070669_100311201 Ga0070669_1003112013 90
330 3300005353 Ga0070669_101360044 Ga0070669_1013600441 90
331 3300005354 Ga0070675_100227378 Ga0070675_1002273783 90
332 3300005354 Ga0070675_100228176 Ga0070675_1002281763 90
333 3300005355 Ga0070671_100001396 Ga0070671_1000013962 90
334 3300005355 Ga0070671_101941644 Ga0070671_1019416442 90
335 3300005356 Ga0070674_100238459 Ga0070674_1002384591 90
336 3300005356 Ga0070674_101113373 Ga0070674_1011133732 90
337 3300005356 Ga0070674_102148098 Ga0070674_1021480981 90
338 3300005366 Ga0070659_100018128 Ga0070659_1000181287 90
339 3300005366 Ga0070659_101338197 Ga0070659_1013381971 90
340 3300005367 Ga0070667_100689703 Ga0070667_1006897033 90
341 3300005367 Ga0070667_101302292 Ga0070667_1013022921 90
342 3300005434 Ga0070709_10003511 Ga0070709_100035117 90
343 3300005434 Ga0070709_10029058 Ga0070709_100290588 90
344 3300005434 Ga0070709_10302961 Ga0070709_103029611 90
345 3300005435 Ga0070714_100011419 Ga0070714_1000114199 90
346 3300005435 Ga0070714_100524404 Ga0070714_1005244042 90
347 3300005435 Ga0070714_100536585 Ga0070714_1005365852 90
348 3300005435 Ga0070714_102338122 Ga0070714_1023381222 90
349 3300005436 Ga0070713_100000012 Ga0070713_100000012120 90
350 3300005436 Ga0070713_100689694 Ga0070713_1006896942 90
351 3300005436 Ga0070713_100835800 Ga0070713_1008358002 90
352 3300005436 Ga0070713_101970965 Ga0070713_1019709651 90
353 3300005438 Ga0070701_10692576 Ga0070701_106925762 90
354 3300005439 Ga0070711_100047699 Ga0070711_1000476995 90
355 3300005439 Ga0070711_100096800 Ga0070711_1000968003 90
356 3300005440 Ga0070705_100245882 Ga0070705_1002458822 90
357 3300005440 Ga0070705_100517257 Ga0070705_1005172572 90
358 3300005445 Ga0070708_100364942 Ga0070708_1003649423 90
359 3300005445 Ga0070708_102235854 Ga0070708_1022358542 90
360 3300005455 Ga0070663_100099452 Ga0070663_1000994524 90
361 3300005455 Ga0070663_100257055 Ga0070663_1002570552 90
362 3300005456 Ga0070678_100146094 Ga0070678_1001460944 90
363 3300005456 Ga0070678_100339394 Ga0070678_1003393941 90
364 3300005456 Ga0070678_100430696 Ga0070678_1004306962 90
365 3300005456 Ga0070678_100464119 Ga0070678_1004641193 90
366 3300005458 Ga0070681_10000037 Ga0070681_100000377 90
367 3300005458 Ga0070681_10029349 Ga0070681_100293493 90
368 3300005458 Ga0070681_10234315 Ga0070681_102343152 90
369 3300005459 Ga0068867_100971319 Ga0068867_1009713191 90
370 3300005459 Ga0068867_101526565 Ga0068867_1015265652 90
371 3300005530 Ga0070679_100008411 Ga0070679_1000084117 90
372 3300005530 Ga0070679_100035943 Ga0070679_1000359436 90
373 3300005530 Ga0070679_100057285 Ga0070679_1000572855 90
374 3300005530 Ga0070679_100084772 Ga0070679_1000847722 90
375 3300005530 Ga0070679_100219292 Ga0070679_1002192922 90
376 3300005530 Ga0070679_101008351 Ga0070679_1010083511 90
377 3300005530 Ga0070679_101249348 Ga0070679_1012493481 90
378 3300005535 Ga0070684_100075494 Ga0070684_1000754942 90
379 3300005535 Ga0070684_100446183 Ga0070684_1004461832 90
380 3300005535 Ga0070684_102008232 Ga0070684_1020082322 90
381 3300005535 Ga0070684_102009842 Ga0070684_1020098421 90
382 3300005536 Ga0070697_101033534 Ga0070697_1010335342 90
383 3300005539 Ga0068853_100002020 Ga0068853_1000020206 90
384 3300005539 Ga0068853_100002660 Ga0068853_10000266019 90
385 3300005539 Ga0068853_100246205 Ga0068853_1002462054 90
386 3300005539 Ga0068853_100261070 Ga0068853_1002610702 90
387 3300005539 Ga0068853_100505804 Ga0068853_1005058042 90
388 3300005539 Ga0068853_100542024 Ga0068853_1005420242 90
389 3300005543 Ga0070672_100585659 Ga0070672_1005856592 90
390 3300005545 Ga0070695_100003098 Ga0070695_1000030985 90
391 3300005545 Ga0070695_100367732 Ga0070695_1003677323 90
392 3300005547 Ga0070693_100640849 Ga0070693_1006408492 90
393 3300005548 Ga0070665_100014624 Ga0070665_1000146247 90
394 3300005548 Ga0070665_100116987 Ga0070665_1001169872 90
395 3300005548 Ga0070665_100240462 Ga0070665_1002404622 90
396 3300005548 Ga0070665_100260774 Ga0070665_1002607742 90
397 3300005548 Ga0070665_100316206 Ga0070665_1003162063 90
398 3300005548 Ga0070665_100515389 Ga0070665_1005153892 90
399 3300005563 Ga0068855_100012001 Ga0068855_10001200112 90
400 3300005563 Ga0068855_100057023 Ga0068855_1000570236 90
401 3300005563 Ga0068855_100348946 Ga0068855_1003489463 90
402 3300005563 Ga0068855_100406348 Ga0068855_1004063483 90
403 3300005563 Ga0068855_100611332 Ga0068855_1006113323 90
404 3300005563 Ga0068855_100903953 Ga0068855_1009039532 90
405 3300005563 Ga0068855_101741400 Ga0068855_1017414002 90
406 3300005577 Ga0068857_100007896 Ga0068857_10000789615 90
407 3300005577 Ga0068857_100217230 Ga0068857_1002172303 90
408 3300005577 Ga0068857_100434573 Ga0068857_1004345733 90
409 3300005578 Ga0068854_101109969 Ga0068854_1011099691 90
410 3300005578 Ga0068854_101142297 Ga0068854_1011422972 90
411 3300005578 Ga0068854_102125146 Ga0068854_1021251461 90
412 3300005614 Ga0068856_100001032 Ga0068856_1000010327 90
413 3300005614 Ga0068856_100034393 Ga0068856_1000343937 90
414 3300005614 Ga0068856_100056835 Ga0068856_1000568356 90
415 3300005614 Ga0068856_100180882 Ga0068856_1001808822 90
416 3300005614 Ga0068856_100717938 Ga0068856_1007179382 90
417 3300005614 Ga0068856_101441540 Ga0068856_1014415402 90
418 3300005614 Ga0068856_101481333 Ga0068856_1014813332 90
419 3300005614 Ga0068856_101698402 Ga0068856_1016984022 90
420 3300005615 Ga0070702_100327833 Ga0070702_1003278332 90
421 3300005616 Ga0068852_100006800 Ga0068852_1000068009 90
422 3300005616 Ga0068852_100136255 Ga0068852_1001362552 90
423 3300005616 Ga0068852_100287982 Ga0068852_1002879823 90
424 3300005616 Ga0068852_100620931 Ga0068852_1006209312 90
425 3300005616 Ga0068852_100813977 Ga0068852_1008139772 90
426 3300005616 Ga0068852_101238213 Ga0068852_1012382132 90
427 3300005616 Ga0068852_102701910 Ga0068852_1027019102 90
428 3300005617 Ga0068859_100001281 Ga0068859_10000128138 90
429 3300005617 Ga0068859_100935628 Ga0068859_1009356283 90
430 3300005617 Ga0068859_101482467 Ga0068859_1014824672 90
431 3300005617 Ga0068859_102320026 Ga0068859_1023200262 90
432 3300005618 Ga0068864_101771474 Ga0068864_1017714742 90
433 3300005618 Ga0068864_102436329 Ga0068864_1024363291 90
434 3300005718 Ga0068866_10028876 Ga0068866_100288763 90
435 3300005719 Ga0068861_100481175 Ga0068861_1004811752 90
436 3300005719 Ga0068861_100783058 Ga0068861_1007830582 90
437 3300005719 Ga0068861_100790701 Ga0068861_1007907011 90
438 3300005834 Ga0068851_10169615 Ga0068851_101696153 90
439 3300005840 Ga0068870_10172786 Ga0068870_101727863 90
440 3300005841 Ga0068863_100663928 Ga0068863_1006639282 90
441 3300005841 Ga0068863_101359979 Ga0068863_1013599792 90
442 3300005841 Ga0068863_102132528 Ga0068863_1021325282 90
443 3300005842 Ga0068858_100201140 Ga0068858_1002011402 90
444 3300005842 Ga0068858_100311797 Ga0068858_1003117972 90
445 3300005843 Ga0068860_100074863 Ga0068860_1000748633 90
446 3300005843 Ga0068860_100306771 Ga0068860_1003067713 90
447 3300005843 Ga0068860_100668858 Ga0068860_1006688583 90
448 3300005844 Ga0068862_100153862 Ga0068862_1001538622 90
449 3300005844 Ga0068862_100208382 Ga0068862_1002083823 90
450 3300005844 Ga0068862_102267421 Ga0068862_1022674212 90
451 3300005937 Ga0081455_10594441 Ga0081455_105944412 90
452 3300005937 Ga0081455_10599981 Ga0081455_105999812 90
453 3300005983 Ga0081540_1073511 Ga0081540_10735114 90
454 3300006042 Ga0075368_10043676 Ga0075368_100436764 90
455 3300006048 Ga0075363_100371062 Ga0075363_1003710622 90
456 3300006051 Ga0075364_10001038 Ga0075364_1000103819 90
457 3300006051 Ga0075364_10037544 Ga0075364_100375445 90
458 3300006163 Ga0070715_10538733 Ga0070715_105387332 90
459 3300006173 Ga0070716_100046578 Ga0070716_1000465784 90
460 3300006175 Ga0070712_100000902 Ga0070712_1000009026 90
461 3300006175 Ga0070712_100004052 Ga0070712_1000040527 90
462 3300006175 Ga0070712_100090345 Ga0070712_1000903454 90
463 3300006175 Ga0070712_100497089 Ga0070712_1004970892 90
464 3300006177 Ga0075362_10754663 Ga0075362_107546632 90
465 3300006178 Ga0075367_10001012 Ga0075367_100010127 90
466 3300006178 Ga0075367_10025225 Ga0075367_100252253 90
467 3300006178 Ga0075367_10573759 Ga0075367_105737592 90
468 3300006186 Ga0075369_10017712 Ga0075369_100177127 90
469 3300006186 Ga0075369_10170368 Ga0075369_101703682 90
470 3300006195 Ga0075366_10116451 Ga0075366_101164512 90
471 3300006195 Ga0075366_10158180 Ga0075366_101581803 90
472 3300006195 Ga0075366_10179631 Ga0075366_101796313 90
473 3300006237 Ga0097621_100210269 Ga0097621_1002102692 90
474 3300006237 Ga0097621_100245519 Ga0097621_1002455193 90
475 3300006237 Ga0097621_100427527 Ga0097621_1004275273 90
476 3300006237 Ga0097621_100647350 Ga0097621_1006473503 90
477 3300006237 Ga0097621_100690917 Ga0097621_1006909172 90
478 3300006237 Ga0097621_101129412 Ga0097621_1011294122 90
479 3300006237 Ga0097621_102337467 Ga0097621_1023374671 90
480 3300006353 Ga0075370_10054879 Ga0075370_100548793 90
481 3300006358 Ga0068871_100197095 Ga0068871_1001970951 90
482 3300006358 Ga0068871_100687431 Ga0068871_1006874313 90
483 3300006358 Ga0068871_100928525 Ga0068871_1009285252 90
484 3300006358 Ga0068871_101185736 Ga0068871_1011857362 90
485 3300006871 Ga0075434_100129075 Ga0075434_1001290753 90
486 3300006881 Ga0068865_100071202 Ga0068865_1000712024 90
487 3300006881 Ga0068865_101357384 Ga0068865_1013573842 90
488 3300006914 Ga0075436_100002564 Ga0075436_10000256417 90
489 3300006914 Ga0075436_100019157 Ga0075436_1000191576 90
490 3300006914 Ga0075436_100813804 Ga0075436_1008138042 90
491 3300006931 Ga0097620_100001281 Ga0097620_10000128138 90
492 3300006931 Ga0097620_100935624 Ga0097620_1009356241 90
493 3300006931 Ga0097620_101482226 Ga0097620_1014822262 90
494 3300006931 Ga0097620_102320136 Ga0097620_1023201362 90
495 3300007076 Ga0075435_100104949 Ga0075435_1001049494 90
496 3300007076 Ga0075435_100359896 Ga0075435_1003598963 90
497 3300009093 Ga0105240_10004696 Ga0105240_1000469629 90
498 3300009093 Ga0105240_10017473 Ga0105240_100174737 90
499 3300009093 Ga0105240_10273726 Ga0105240_102737262 90
500 3300009093 Ga0105240_10632833 Ga0105240_106328333 90
501 3300009093 Ga0105240_10798295 Ga0105240_107982953 90
502 3300009093 Ga0105240_11185643 Ga0105240_111856432 90
503 3300009093 Ga0105240_11427260 Ga0105240_114272601 90
504 3300009093 Ga0105240_12510524 Ga0105240_125105242 90
505 3300009093 Ga0105240_12778556 Ga0105240_127785561 90
506 3300009094 Ga0111539_12752674 Ga0111539_127526742 90
507 3300009098 Ga0105245_10042887 Ga0105245_100428876 90
508 3300009098 Ga0105245_11127055 Ga0105245_111270552 90
509 3300009098 Ga0105245_11609788 Ga0105245_116097882 90
510 3300009098 Ga0105245_12029068 Ga0105245_120290682 90
511 3300009101 Ga0105247_10041573 Ga0105247_100415735 90
512 3300009101 Ga0105247_10609112 Ga0105247_106091121 90
513 3300009101 Ga0105247_11051255 Ga0105247_110512552 90
514 3300009148 Ga0105243_10037311 Ga0105243_100373113 90
515 3300009174 Ga0105241_10083130 Ga0105241_100831306 90
516 3300009174 Ga0105241_10181427 Ga0105241_101814272 90
517 3300009174 Ga0105241_10515910 Ga0105241_105159102 90
518 3300009176 Ga0105242_10176597 Ga0105242_101765972 90
519 3300009176 Ga0105242_10190451 Ga0105242_101904513 90
520 3300009176 Ga0105242_10545713 Ga0105242_105457132 90
521 3300009176 Ga0105242_10916566 Ga0105242_109165662 90
522 3300009176 Ga0105242_12838952 Ga0105242_128389522 90
523 3300009177 Ga0105248_10000005 Ga0105248_100000057 90
524 3300009177 Ga0105248_10849088 Ga0105248_108490882 90
525 3300009177 Ga0105248_11023283 Ga0105248_110232832 90
526 3300009177 Ga0105248_11855779 Ga0105248_118557792 90
527 3300009545 Ga0105237_10032303 Ga0105237_100323037 90
528 3300009545 Ga0105237_10053645 Ga0105237_100536457 90
529 3300009545 Ga0105237_10276820 Ga0105237_102768202 90
530 3300009545 Ga0105237_11055521 Ga0105237_110555211 90
531 3300009545 Ga0105237_11150289 Ga0105237_111502892 90
532 3300009545 Ga0105237_11817798 Ga0105237_118177982 90
533 3300009545 Ga0105237_12314678 Ga0105237_123146782 90
534 3300009551 Ga0105238_10001939 Ga0105238_100019397 90
535 3300009551 Ga0105238_10035831 Ga0105238_100358313 90
536 3300009551 Ga0105238_10119819 Ga0105238_101198193 90
537 3300009551 Ga0105238_10459356 Ga0105238_104593563 90
538 3300009551 Ga0105238_10777081 Ga0105238_107770811 90
539 3300009551 Ga0105238_10812446 Ga0105238_108124461 90
540 3300009551 Ga0105238_12061443 Ga0105238_120614432 90
541 3300009553 Ga0105249_11821929 Ga0105249_118219291 90
542 3300009553 Ga0105249_12298625 Ga0105249_122986251 90
543 3300009553 Ga0105249_13021379 Ga0105249_130213791 90
544 3300009993 Ga0105028_114477 Ga0105028_1144772 90
545 3300010375 Ga0105239_10028473 Ga0105239_100284739 90
546 3300010375 Ga0105239_10060445 Ga0105239_100604457 90
547 3300010375 Ga0105239_10104618 Ga0105239_101046182 90
548 3300010375 Ga0105239_10961555 Ga0105239_109615551 90
549 3300010375 Ga0105239_11007657 Ga0105239_110076572 90
550 3300010375 Ga0105239_11719347 Ga0105239_117193471 90
551 3300010375 Ga0105239_11733662 Ga0105239_117336622 90
552 3300010375 Ga0105239_13114768 Ga0105239_131147681 90
553 3300011119 Ga0105246_10371582 Ga0105246_103715822 90
554 3300013100 Ga0157373_10000820 Ga0157373_1000082032 90
555 3300013100 Ga0157373_10049430 Ga0157373_100494303 90
556 3300013100 Ga0157373_10529297 Ga0157373_105292972 90
557 3300013102 Ga0157371_10254833 Ga0157371_102548333 90
558 3300013102 Ga0157371_11181467 Ga0157371_111814672 90
559 3300013104 Ga0157370_10003448 Ga0157370_1000344826 90
560 3300013104 Ga0157370_10040902 Ga0157370_100409025 90
561 3300013104 Ga0157370_10308418 Ga0157370_103084182 90
562 3300013104 Ga0157370_10457613 Ga0157370_104576133 90
563 3300013104 Ga0157370_10598420 Ga0157370_105984202 90
564 3300013104 Ga0157370_10709655 Ga0157370_107096552 90
565 3300013105 Ga0157369_10001535 Ga0157369_100015357 90
566 3300013105 Ga0157369_10150003 Ga0157369_101500036 90
567 3300013105 Ga0157369_10243522 Ga0157369_102435222 90
568 3300013105 Ga0157369_10762523 Ga0157369_107625232 90
569 3300013105 Ga0157369_12282312 Ga0157369_122823121 90
570 3300013296 Ga0157374_10881780 Ga0157374_108817802 90
571 3300013296 Ga0157374_11171520 Ga0157374_111715202 90
572 3300013296 Ga0157374_11813368 Ga0157374_118133682 90
573 3300013297 Ga0157378_10558165 Ga0157378_105581652 90
574 3300013297 Ga0157378_10578343 Ga0157378_105783432 90
575 3300013297 Ga0157378_10693388 Ga0157378_106933882 90
576 3300013297 Ga0157378_11128321 Ga0157378_111283212 90
577 3300013297 Ga0157378_11741264 Ga0157378_117412642 90
578 3300013306 Ga0163162_10080358 Ga0163162_100803585 90
579 3300013306 Ga0163162_10386848 Ga0163162_103868482 90
580 3300013306 Ga0163162_11012996 Ga0163162_110129962 90
581 3300013307 Ga0157372_10059581 Ga0157372_100595817 90
582 3300013307 Ga0157372_10427269 Ga0157372_104272693 90
583 3300013307 Ga0157372_10502349 Ga0157372_105023493 90
584 3300013307 Ga0157372_11286204 Ga0157372_112862042 90
585 3300013307 Ga0157372_11374248 Ga0157372_113742482 90
586 3300013307 Ga0157372_12619924 Ga0157372_126199241 90
587 3300013308 Ga0157375_12928559 Ga0157375_129285592 90
588 3300014325 Ga0163163_10008003 Ga0163163_1000800315 90
589 3300014325 Ga0163163_10009581 Ga0163163_1000958112 90
590 3300014325 Ga0163163_10056493 Ga0163163_100564934 90
591 3300014325 Ga0163163_10533382 Ga0163163_105333823 90
592 3300014325 Ga0163163_11579463 Ga0163163_115794632 90
593 3300014325 Ga0163163_12981265 Ga0163163_129812652 90
594 3300014326 Ga0157380_10198169 Ga0157380_101981693 90
595 3300014497 Ga0182008_10205188 Ga0182008_102051882 90
596 3300014968 Ga0157379_10018151 Ga0157379_100181517 90
597 3300014968 Ga0157379_10018171 Ga0157379_100181717 90
598 3300014968 Ga0157379_10038101 Ga0157379_100381013 90
599 3300014968 Ga0157379_10041021 Ga0157379_100410217 90
600 3300014968 Ga0157379_10254063 Ga0157379_102540632 90
601 3300014968 Ga0157379_11748817 Ga0157379_117488172 90
602 3300014969 Ga0157376_11437631 Ga0157376_114376312 90
603 3300014969 Ga0157376_12141807 Ga0157376_121418072 90
604 3300014969 Ga0157376_12411156 Ga0157376_124111562 90
605 3300015262 Ga0182007_10118528 Ga0182007_101185282 90
606 3300015262 Ga0182007_10316487 Ga0182007_103164872 90
607 3300015265 Ga0182005_1076503 Ga0182005_10765032 90
608 3300017792 Ga0163161_10681539 Ga0163161_106815392 90
609 3300021377 Ga0213874_10194127 Ga0213874_101941271 90
610 3300021384 Ga0213876_10203418 Ga0213876_102034182 90
611 3300021441 Ga0213871_10138395 Ga0213871_101383952 90
612 3300021441 Ga0213871_10154721 Ga0213871_101547212 90
613 3300025250 Ga0209026_1006530 Ga0209026_10065303 90
614 3300025261 Ga0209233_1000013 Ga0209233_1000013731 90
615 3300025297 Ga0209758_1000013 Ga0209758_1000013906 90
616 3300025297 Ga0209758_1115838 Ga0209758_11158382 90
617 3300025315 Ga0207697_10056445 Ga0207697_100564453 90
618 3300025898 Ga0207692_10385918 Ga0207692_103859182 90
619 3300025899 Ga0207642_10052412 Ga0207642_100524123 90
620 3300025900 Ga0207710_10348264 Ga0207710_103482641 90
621 3300025901 Ga0207688_10115856 Ga0207688_101158562 90
622 3300025903 Ga0207680_10191580 Ga0207680_101915803 90
623 3300025903 Ga0207680_10259710 Ga0207680_102597103 90
624 3300025904 Ga0207647_10228311 Ga0207647_102283112 90
625 3300025906 Ga0207699_10000164 Ga0207699_1000016433 90
626 3300025906 Ga0207699_10068253 Ga0207699_100682532 90
627 3300025906 Ga0207699_10178109 Ga0207699_101781093 90
628 3300025907 Ga0207645_10010484 Ga0207645_100104847 90
629 3300025907 Ga0207645_10180997 Ga0207645_101809972 90
630 3300025908 Ga0207643_10071361 Ga0207643_100713612 90
631 3300025909 Ga0207705_10000180 Ga0207705_1000018067 90
632 3300025909 Ga0207705_10004720 Ga0207705_100047207 90
633 3300025909 Ga0207705_10098564 Ga0207705_100985643 90
634 3300025909 Ga0207705_10163916 Ga0207705_101639162 90
635 3300025909 Ga0207705_10324341 Ga0207705_103243411 90
636 3300025909 Ga0207705_10500986 Ga0207705_105009861 90
637 3300025909 Ga0207705_11223697 Ga0207705_112236972 90
638 3300025911 Ga0207654_10047435 Ga0207654_100474352 90
639 3300025911 Ga0207654_10133125 Ga0207654_101331253 90
640 3300025911 Ga0207654_10258128 Ga0207654_102581282 90
641 3300025911 Ga0207654_10996631 Ga0207654_109966312 90
642 3300025911 Ga0207654_11393918 Ga0207654_113939181 90
643 3300025912 Ga0207707_10000011 Ga0207707_100000117 90
644 3300025912 Ga0207707_10002211 Ga0207707_100022119 90
645 3300025912 Ga0207707_11651296 Ga0207707_116512962 90
646 3300025913 Ga0207695_10000018 Ga0207695_1000001833 90
647 3300025913 Ga0207695_10034689 Ga0207695_1003468912 90
648 3300025913 Ga0207695_10036358 Ga0207695_100363582 90
649 3300025913 Ga0207695_10047727 Ga0207695_100477274 90
650 3300025913 Ga0207695_10060808 Ga0207695_100608082 90
651 3300025913 Ga0207695_10159646 Ga0207695_101596464 90
652 3300025913 Ga0207695_10318255 Ga0207695_103182552 90
653 3300025913 Ga0207695_10559903 Ga0207695_105599032 90
654 3300025913 Ga0207695_10779533 Ga0207695_107795332 90
655 3300025914 Ga0207671_10016535 Ga0207671_100165357 90
656 3300025914 Ga0207671_10375180 Ga0207671_103751802 90
657 3300025914 Ga0207671_10590017 Ga0207671_105900172 90
658 3300025914 Ga0207671_10806160 Ga0207671_108061602 90
659 3300025915 Ga0207693_10001210 Ga0207693_1000121030 90
660 3300025915 Ga0207693_10001929 Ga0207693_1000192926 90
661 3300025915 Ga0207693_10037608 Ga0207693_100376087 90
662 3300025915 Ga0207693_10235998 Ga0207693_102359983 90
663 3300025915 Ga0207693_10811620 Ga0207693_108116202 90
664 3300025916 Ga0207663_10011662 Ga0207663_100116622 90
665 3300025916 Ga0207663_10155878 Ga0207663_101558783 90
666 3300025917 Ga0207660_10000110 Ga0207660_1000011015 90
667 3300025917 Ga0207660_10003537 Ga0207660_100035377 90
668 3300025917 Ga0207660_10359927 Ga0207660_103599272 90
669 3300025917 Ga0207660_10488489 Ga0207660_104884892 90
670 3300025917 Ga0207660_10807505 Ga0207660_108075052 90
671 3300025919 Ga0207657_10000241 Ga0207657_1000024118 90
672 3300025919 Ga0207657_10043533 Ga0207657_100435337 90
673 3300025919 Ga0207657_10223380 Ga0207657_102233802 90
674 3300025919 Ga0207657_10897946 Ga0207657_108979461 90
675 3300025919 Ga0207657_10907976 Ga0207657_109079762 90
676 3300025919 Ga0207657_11193500 Ga0207657_111935002 90
677 3300025920 Ga0207649_10395807 Ga0207649_103958072 90
678 3300025920 Ga0207649_10479676 Ga0207649_104796762 90
679 3300025920 Ga0207649_10823733 Ga0207649_108237332 90
680 3300025921 Ga0207652_10000824 Ga0207652_1000082437 90
681 3300025921 Ga0207652_10001654 Ga0207652_1000165411 90
682 3300025921 Ga0207652_10230660 Ga0207652_102306603 90
683 3300025921 Ga0207652_10303869 Ga0207652_103038691 90
684 3300025921 Ga0207652_10460565 Ga0207652_104605652 90
685 3300025921 Ga0207652_10791361 Ga0207652_107913612 90
686 3300025921 Ga0207652_10804641 Ga0207652_108046411 90
687 3300025923 Ga0207681_10373400 Ga0207681_103734003 90
688 3300025923 Ga0207681_10411454 Ga0207681_104114543 90
689 3300025923 Ga0207681_11750413 Ga0207681_117504131 90
690 3300025924 Ga0207694_10000010 Ga0207694_10000010355 90
691 3300025924 Ga0207694_10008694 Ga0207694_1000869412 90
692 3300025924 Ga0207694_10047803 Ga0207694_100478033 90
693 3300025924 Ga0207694_10200439 Ga0207694_102004393 90
694 3300025924 Ga0207694_10394442 Ga0207694_103944423 90
695 3300025925 Ga0207650_10265999 Ga0207650_102659993 90
696 3300025925 Ga0207650_10297350 Ga0207650_102973502 90
697 3300025925 Ga0207650_10464145 Ga0207650_104641453 90
698 3300025926 Ga0207659_10095005 Ga0207659_100950054 90
699 3300025926 Ga0207659_11002531 Ga0207659_110025311 90
700 3300025927 Ga0207687_10205589 Ga0207687_102055893 90
701 3300025927 Ga0207687_11111576 Ga0207687_111115762 90
702 3300025927 Ga0207687_11354549 Ga0207687_113545492 90
703 3300025928 Ga0207700_10000295 Ga0207700_100002957 90
704 3300025928 Ga0207700_10211171 Ga0207700_102111713 90
705 3300025928 Ga0207700_10267533 Ga0207700_102675332 90
706 3300025928 Ga0207700_10586744 Ga0207700_105867442 90
707 3300025929 Ga0207664_10028891 Ga0207664_100288912 90
708 3300025929 Ga0207664_10385370 Ga0207664_103853702 90
709 3300025929 Ga0207664_10386910 Ga0207664_103869102 90
710 3300025929 Ga0207664_10461302 Ga0207664_104613021 90
711 3300025929 Ga0207664_11557504 Ga0207664_115575042 90
712 3300025931 Ga0207644_10035600 Ga0207644_100356002 90
713 3300025931 Ga0207644_10226445 Ga0207644_102264453 90
714 3300025931 Ga0207644_10824129 Ga0207644_108241292 90
715 3300025932 Ga0207690_10037357 Ga0207690_100373577 90
716 3300025932 Ga0207690_10060205 Ga0207690_100602054 90
717 3300025933 Ga0207706_10040241 Ga0207706_100402417 90
718 3300025934 Ga0207686_10436892 Ga0207686_104368922 90
719 3300025935 Ga0207709_10022766 Ga0207709_100227666 90
720 3300025936 Ga0207670_11900115 Ga0207670_119001151 90
721 3300025937 Ga0207669_10169938 Ga0207669_101699383 90
722 3300025937 Ga0207669_10184395 Ga0207669_101843951 90
723 3300025937 Ga0207669_11523089 Ga0207669_115230892 90
724 3300025938 Ga0207704_10068990 Ga0207704_100689902 90
725 3300025938 Ga0207704_10319383 Ga0207704_103193832 90
726 3300025939 Ga0207665_10070338 Ga0207665_100703384 90
727 3300025940 Ga0207691_10630502 Ga0207691_106305022 90
728 3300025940 Ga0207691_10665836 Ga0207691_106658362 90
729 3300025941 Ga0207711_10000002 Ga0207711_100000027 90
730 3300025941 Ga0207711_10096675 Ga0207711_100966752 90
731 3300025941 Ga0207711_10286550 Ga0207711_102865503 90
732 3300025941 Ga0207711_10709725 Ga0207711_107097253 90
733 3300025941 Ga0207711_11974168 Ga0207711_119741681 90
734 3300025942 Ga0207689_10572753 Ga0207689_105727532 90
735 3300025942 Ga0207689_10919244 Ga0207689_109192441 90
736 3300025944 Ga0207661_10117898 Ga0207661_101178983 90
737 3300025944 Ga0207661_10376877 Ga0207661_103768772 90
738 3300025944 Ga0207661_10584044 Ga0207661_105840441 90
739 3300025949 Ga0207667_10000388 Ga0207667_1000038868 90
740 3300025949 Ga0207667_10006198 Ga0207667_100061986 90
741 3300025949 Ga0207667_10024994 Ga0207667_100249948 90
742 3300025949 Ga0207667_10032645 Ga0207667_100326452 90
743 3300025949 Ga0207667_10059983 Ga0207667_100599839 90
744 3300025949 Ga0207667_10238237 Ga0207667_102382373 90
745 3300025949 Ga0207667_10610635 Ga0207667_106106352 90
746 3300025949 Ga0207667_11206421 Ga0207667_112064212 90
747 3300025960 Ga0207651_12070196 Ga0207651_120701961 90
748 3300025972 Ga0207668_10007456 Ga0207668_1000745614 90
749 3300025972 Ga0207668_10592495 Ga0207668_105924952 90
750 3300025981 Ga0207640_10256332 Ga0207640_102563321 90
751 3300025981 Ga0207640_10946538 Ga0207640_109465382 90
752 3300025986 Ga0207658_10310759 Ga0207658_103107593 90
753 3300025986 Ga0207658_10953420 Ga0207658_109534202 90
754 3300025986 Ga0207658_11048947 Ga0207658_110489471 90
755 3300026023 Ga0207677_10317051 Ga0207677_103170512 90
756 3300026035 Ga0207703_10044546 Ga0207703_100445462 90
757 3300026035 Ga0207703_10086143 Ga0207703_100861432 90
758 3300026035 Ga0207703_10139627 Ga0207703_101396274 90
759 3300026035 Ga0207703_11837273 Ga0207703_118372732 90
760 3300026041 Ga0207639_10000867 Ga0207639_1000086718 90
761 3300026041 Ga0207639_10010763 Ga0207639_100107636 90
762 3300026041 Ga0207639_10123083 Ga0207639_101230833 90
763 3300026041 Ga0207639_10435761 Ga0207639_104357612 90
764 3300026041 Ga0207639_10483975 Ga0207639_104839751 90
765 3300026041 Ga0207639_10634684 Ga0207639_106346843 90
766 3300026067 Ga0207678_10371805 Ga0207678_103718051 90
767 3300026067 Ga0207678_10488489 Ga0207678_104884892 90
768 3300026075 Ga0207708_10129461 Ga0207708_101294612 90
769 3300026078 Ga0207702_10000315 Ga0207702_1000031544 90
770 3300026078 Ga0207702_10009824 Ga0207702_100098247 90
771 3300026078 Ga0207702_10130884 Ga0207702_101308842 90
772 3300026088 Ga0207641_10036533 Ga0207641_100365332 90
773 3300026088 Ga0207641_10720339 Ga0207641_107203392 90
774 3300026089 Ga0207648_10654656 Ga0207648_106546562 90
775 3300026095 Ga0207676_10329811 Ga0207676_103298113 90
776 3300026095 Ga0207676_10345720 Ga0207676_103457202 90
777 3300026116 Ga0207674_10001605 Ga0207674_1000160534 90
778 3300026116 Ga0207674_10550097 Ga0207674_105500972 90
779 3300026116 Ga0207674_10684319 Ga0207674_106843193 90
780 3300026116 Ga0207674_10733592 Ga0207674_107335921 90
781 3300026118 Ga0207675_100091574 Ga0207675_1000915745 90
782 3300026118 Ga0207675_100500138 Ga0207675_1005001382 90
783 3300026121 Ga0207683_10200848 Ga0207683_102008484 90
784 3300026121 Ga0207683_10669358 Ga0207683_106693583 90
785 3300026121 Ga0207683_10679181 Ga0207683_106791812 90
786 3300026121 Ga0207683_10711853 Ga0207683_107118531 90
787 3300026142 Ga0207698_10012405 Ga0207698_1001240512 90
788 3300026142 Ga0207698_10263113 Ga0207698_102631133 90
789 3300026142 Ga0207698_10314639 Ga0207698_103146392 90
790 3300026142 Ga0207698_11488272 Ga0207698_114882722 90
791 3300027866 Ga0209813_10012362 Ga0209813_100123624 90
792 3300027866 Ga0209813_10052605 Ga0209813_100526053 90
793 3300028379 Ga0268266_10000557 Ga0268266_100005577 90
794 3300028379 Ga0268266_10088994 Ga0268266_100889944 90
795 3300028379 Ga0268266_10105068 Ga0268266_101050683 90
796 3300028379 Ga0268266_10283355 Ga0268266_102833553 90
797 3300028379 Ga0268266_10337307 Ga0268266_103373072 90
798 3300028379 Ga0268266_11018029 Ga0268266_110180292 90
799 3300028380 Ga0268265_10027081 Ga0268265_100270819 90
800 3300028380 Ga0268265_10052967 Ga0268265_100529672 90
801 3300028380 Ga0268265_10179633 Ga0268265_101796332 90
802 3300028380 Ga0268265_10740184 Ga0268265_107401842 90
803 3300028381 Ga0268264_10069223 Ga0268264_100692238 90
804 3300028381 Ga0268264_10072664 Ga0268264_100726644 90
805 3300028381 Ga0268264_10604970 Ga0268264_106049703 90
806 3300028556 Ga0265337_1008843 Ga0265337_10088434 90
807 3300028556 Ga0265337_1113854 Ga0265337_11138542 90
808 3300028573 Ga0265334_10176623 Ga0265334_101766231 90
809 3300028577 Ga0265318_10004765 Ga0265318_100047657 90
810 3300028653 Ga0265323_10003319 Ga0265323_100033195 90
811 3300028653 Ga0265323_10015991 Ga0265323_100159912 90
812 3300028654 Ga0265322_10012481 Ga0265322_100124813 90
813 3300028786 Ga0307517_10481474 Ga0307517_104814741 90
814 3300028800 Ga0265338_10000017 Ga0265338_10000017282 90
815 3300028800 Ga0265338_10005387 Ga0265338_100053877 90
816 3300028800 Ga0265338_10017000 Ga0265338_100170005 90
817 3300028800 Ga0265338_10023435 Ga0265338_100234359 90
818 3300028800 Ga0265338_10023604 Ga0265338_100236049 90
819 3300028800 Ga0265338_10068199 Ga0265338_100681992 90
820 3300028800 Ga0265338_10084066 Ga0265338_100840666 90
821 3300028800 Ga0265338_10272535 Ga0265338_102725352 90
822 3300028800 Ga0265338_10430593 Ga0265338_104305933 90
823 3300028800 Ga0265338_10526471 Ga0265338_105264712 90
824 3300029957 Ga0265324_10047822 Ga0265324_100478223 90
825 3300030863 Ga0265766_1014642 Ga0265766_10146421 90
826 3300031235 Ga0265330_10010377 Ga0265330_100103773 90
827 3300031235 Ga0265330_10015081 Ga0265330_100150819 90
828 3300031235 Ga0265330_10046835 Ga0265330_100468353 90
829 3300031235 Ga0265330_10097152 Ga0265330_100971522 90
830 3300031235 Ga0265330_10213971 Ga0265330_102139712 90
831 3300031238 Ga0265332_10012502 Ga0265332_100125027 90
832 3300031238 Ga0265332_10017013 Ga0265332_100170136 90
833 3300031238 Ga0265332_10026618 Ga0265332_100266184 90
834 3300031238 Ga0265332_10072254 Ga0265332_100722542 90
835 3300031238 Ga0265332_10170269 Ga0265332_101702692 90
836 3300031238 Ga0265332_10192511 Ga0265332_101925112 90
837 3300031238 Ga0265332_10202080 Ga0265332_102020803 90
838 3300031239 Ga0265328_10080353 Ga0265328_100803532 90
839 3300031240 Ga0265320_10002069 Ga0265320_1000206922 90
840 3300031240 Ga0265320_10419719 Ga0265320_104197191 90
841 3300031240 Ga0265320_10470855 Ga0265320_104708552 90
842 3300031241 Ga0265325_10000014 Ga0265325_10000014147 90
843 3300031241 Ga0265325_10000820 Ga0265325_100008209 90
844 3300031241 Ga0265325_10001732 Ga0265325_100017329 90
845 3300031241 Ga0265325_10012680 Ga0265325_100126804 90
846 3300031241 Ga0265325_10060434 Ga0265325_100604344 90
847 3300031241 Ga0265325_10065512 Ga0265325_100655123 90
848 3300031241 Ga0265325_10074830 Ga0265325_100748302 90
849 3300031241 Ga0265325_10101794 Ga0265325_101017942 90
850 3300031241 Ga0265325_10218157 Ga0265325_102181572 90
851 3300031241 Ga0265325_10404261 Ga0265325_104042612 90
852 3300031242 Ga0265329_10321859 Ga0265329_103218591 90
853 3300031247 Ga0265340_10003857 Ga0265340_100038571 90
854 3300031247 Ga0265340_10007508 Ga0265340_100075086 90
855 3300031247 Ga0265340_10031774 Ga0265340_100317745 90
856 3300031247 Ga0265340_10039494 Ga0265340_100394945 90
857 3300031247 Ga0265340_10062582 Ga0265340_100625823 90
858 3300031247 Ga0265340_10065028 Ga0265340_100650283 90
859 3300031247 Ga0265340_10070347 Ga0265340_100703472 90
860 3300031247 Ga0265340_10086766 Ga0265340_100867663 90
861 3300031247 Ga0265340_10107204 Ga0265340_101072041 90
862 3300031247 Ga0265340_10193840 Ga0265340_101938402 90
863 3300031247 Ga0265340_10234527 Ga0265340_102345272 90
864 3300031247 Ga0265340_10245866 Ga0265340_102458662 90
865 3300031249 Ga0265339_10000256 Ga0265339_1000025617 90
866 3300031249 Ga0265339_10005687 Ga0265339_1000568710 90
867 3300031249 Ga0265339_10009282 Ga0265339_100092827 90
868 3300031249 Ga0265339_10020355 Ga0265339_100203556 90
869 3300031249 Ga0265339_10070933 Ga0265339_100709332 90
870 3300031249 Ga0265339_10085966 Ga0265339_100859662 90
871 3300031249 Ga0265339_10117963 Ga0265339_101179632 90
872 3300031249 Ga0265339_10155002 Ga0265339_101550022 90
873 3300031249 Ga0265339_10190822 Ga0265339_101908223 90
874 3300031250 Ga0265331_10014090 Ga0265331_100140907 90
875 3300031250 Ga0265331_10018237 Ga0265331_100182377 90
876 3300031250 Ga0265331_10019323 Ga0265331_100193233 90
877 3300031250 Ga0265331_10056308 Ga0265331_100563084 90
878 3300031250 Ga0265331_10184674 Ga0265331_101846742 90
879 3300031250 Ga0265331_10365462 Ga0265331_103654622 90
880 3300031250 Ga0265331_10472834 Ga0265331_104728342 90
881 3300031344 Ga0265316_10037888 Ga0265316_100378886 90
882 3300031344 Ga0265316_10061302 Ga0265316_100613024 90
883 3300031344 Ga0265316_10081403 Ga0265316_100814032 90
884 3300031344 Ga0265316_10088158 Ga0265316_100881584 90
885 3300031344 Ga0265316_10165235 Ga0265316_101652353 90
886 3300031344 Ga0265316_10169434 Ga0265316_101694343 90
887 3300031344 Ga0265316_10201779 Ga0265316_102017792 90
888 3300031344 Ga0265316_10348326 Ga0265316_103483262 90
889 3300031344 Ga0265316_10465364 Ga0265316_104653641 90
890 3300031344 Ga0265316_10470747 Ga0265316_104707472 90
891 3300031344 Ga0265316_10721881 Ga0265316_107218812 90
892 3300031456 Ga0307513_10010515 Ga0307513_100105157 90
893 3300031456 Ga0307513_10082281 Ga0307513_100822814 90
894 3300031548 Ga0307408_100395292 Ga0307408_1003952922 90
895 3300031548 Ga0307408_101609828 Ga0307408_1016098281 90
896 3300031595 Ga0265313_10000800 Ga0265313_100008005 90
897 3300031595 Ga0265313_10015578 Ga0265313_100155784 90
898 3300031595 Ga0265313_10030710 Ga0265313_100307105 90
899 3300031595 Ga0265313_10039375 Ga0265313_100393752 90
900 3300031595 Ga0265313_10053229 Ga0265313_100532293 90
901 3300031595 Ga0265313_10067511 Ga0265313_100675113 90
902 3300031595 Ga0265313_10102835 Ga0265313_101028352 90
903 3300031595 Ga0265313_10106409 Ga0265313_101064091 90
904 3300031595 Ga0265313_10228110 Ga0265313_102281102 90
905 3300031595 Ga0265313_10376278 Ga0265313_103762781 90
906 3300031616 Ga0307508_10076076 Ga0307508_100760761 90
907 3300031711 Ga0265314_10000109 Ga0265314_100001096 90
908 3300031711 Ga0265314_10009081 Ga0265314_1000908110 90
909 3300031711 Ga0265314_10011365 Ga0265314_100113656 90
910 3300031711 Ga0265314_10019382 Ga0265314_100193825 90
911 3300031711 Ga0265314_10040994 Ga0265314_100409942 90
912 3300031711 Ga0265314_10081772 Ga0265314_100817722 90
913 3300031711 Ga0265314_10104251 Ga0265314_101042512 90
914 3300031711 Ga0265314_10114451 Ga0265314_101144512 90
915 3300031711 Ga0265314_10125806 Ga0265314_101258063 90
916 3300031711 Ga0265314_10345428 Ga0265314_103454282 90
917 3300031712 Ga0265342_10006355 Ga0265342_100063554 90
918 3300031712 Ga0265342_10008087 Ga0265342_100080878 90
919 3300031712 Ga0265342_10030570 Ga0265342_100305704 90
920 3300031712 Ga0265342_10042004 Ga0265342_100420045 90
921 3300031712 Ga0265342_10042585 Ga0265342_100425852 90
922 3300031712 Ga0265342_10056456 Ga0265342_100564563 90
923 3300031712 Ga0265342_10061994 Ga0265342_100619941 90
924 3300031712 Ga0265342_10168852 Ga0265342_101688522 90
925 3300031712 Ga0265342_10183495 Ga0265342_101834952 90
926 3300031712 Ga0265342_10277145 Ga0265342_102771452 90
927 3300031712 Ga0265342_10371912 Ga0265342_103719122 90
928 3300031712 Ga0265342_10438128 Ga0265342_104381282 90
929 3300031712 Ga0265342_10453144 Ga0265342_104531442 90
930 3300031727 Ga0316576_10209924 Ga0316576_102099242 90
931 3300031727 Ga0316576_10425906 Ga0316576_104259061 90
932 3300031727 Ga0316576_10437911 Ga0316576_104379111 90
933 3300031730 Ga0307516_10001565 Ga0307516_1000156539 90
934 3300031730 Ga0307516_10038268 Ga0307516_100382684 90
935 3300031730 Ga0307516_10110667 Ga0307516_101106671 90
936 3300031730 Ga0307516_10156750 Ga0307516_101567503 90
937 3300031730 Ga0307516_10281172 Ga0307516_102811722 90
938 3300031731 Ga0307405_11172404 Ga0307405_111724042 90
939 3300031733 Ga0316577_10155407 Ga0316577_101554072 90
940 3300031903 Ga0307407_11587093 Ga0307407_115870932 90
941 3300031995 Ga0307409_101228556 Ga0307409_1012285562 90
942 3300031995 Ga0307409_102183309 Ga0307409_1021833092 90
943 3300031995 Ga0307409_102808839 Ga0307409_1028088392 90
944 3300032002 Ga0307416_102563072 Ga0307416_1025630722 90
945 3300032005 Ga0307411_10530229 Ga0307411_105302291 90
946 3300032126 Ga0307415_101623683 Ga0307415_1016236832 90
947 3300032168 Ga0316593_10001129 Ga0316593_100011297 90
948 3300032168 Ga0316593_10009266 Ga0316593_100092664 90
949 3300032168 Ga0316593_10010229 Ga0316593_100102293 90
950 3300032168 Ga0316593_10055189 Ga0316593_100551892 90
951 3300032168 Ga0316593_10062878 Ga0316593_100628782 90
952 3300032168 Ga0316593_10068857 Ga0316593_100688572 90
953 3300033524 Ga0316592_1042108 Ga0316592_10421082 90
954 3300033528 Ga0316588_1000158 Ga0316588_100015811 90
955 3300033528 Ga0316588_1001749 Ga0316588_10017496 90
956 3300033528 Ga0316588_1016992 Ga0316588_10169923 90
957 3300033528 Ga0316588_1059981 Ga0316588_10599811 90
958 3300033528 Ga0316588_1085380 Ga0316588_10853802 90
959 3300033529 Ga0316587_1055191 Ga0316587_10551911 90
960 3300033541 Ga0316596_1008949 Ga0316596_10089491 90
961 3300033541 Ga0316596_1018442 Ga0316596_10184422 90
962 3300033541 Ga0316596_1214520 Ga0316596_12145201 90
963 3300034957 Ga0373938_0159264 Ga0373938_0159264_150_434 90
964 3300035083 Ga0373926_0057725 Ga0373926_0057725_461_742 90
965 3300035083 Ga0373926_0210334 Ga0373926_0210334_115_402 90
966 3300035083 Ga0373926_0225834 Ga0373926_0225834_375_662 90
967 3300035084 Ga0373928_0132496 Ga0373928_0132496_235_519 90
968 3300035085 Ga0373929_0120431 Ga0373929_0120431_160_447 90
969 3300035088 Ga0373940_0102962 Ga0373940_0102962_381_665 90
970 3300035089 Ga0373944_0065952 Ga0373944_0065952_718_999 90
971 3300035091 Ga0373951_0072066 Ga0373951_0072066_16_300 90
972 3300035111 Ga0373923_0138225 Ga0373923_0138225_46_333 90
973 3300035111 Ga0373923_0458682 Ga0373923_0458682_81_368 90
974 3300035112 Ga0373932_0046688 Ga0373932_0046688_547_831 90
975 3300035112 Ga0373932_0353191 Ga0373932_0353191_212_499 90
976 3300035113 Ga0373936_0047071 Ga0373936_0047071_1401_1682 90
977 3300035114 Ga0373939_0126009 Ga0373939_0126009_397_681 90
978 3300035115 Ga0373941_0176056 Ga0373941_0176056_139_417 90
979 3300035116 Ga0373945_0045603 Ga0373945_0045603_187_468 90
980 3300035117 Ga0373953_0002723 Ga0373953_0002723_632_976 90
981 3300035118 Ga0373954_0013761 Ga0373954_0013761_2102_2446 90
982 3300035118 Ga0373954_0023685 Ga0373954_0023685_455_742 90
983 3300035118 Ga0373954_0357579 Ga0373954_0357579_260_550 90
984 3300035119 Ga0373956_0086018 Ga0373956_0086018_534_878 90
985 3300035119 Ga0373956_0120607 Ga0373956_0120607_506_793 90
986 3300035170 Ga0373943_0143213 Ga0373943_0143213_805_1086 90
987 3300035170 Ga0373943_0301163 Ga0373943_0301163_70_351 90
988 3300035172 Ga0373955_0017677 Ga0373955_0017677_2562_2849 90
989 3300035172 Ga0373955_0200901 Ga0373955_0200901_140_424 90
990 3300035172 Ga0373955_0792560 Ga0373955_0792560_269_556 90
991 3300035207 Ga0373942_0236493 Ga0373942_0236493_150_434 90
992 3300035398 Ga0316574_0174492 Ga0316574_0174492_19_300 90
993 3300035410 Ga0373924_0207686 Ga0373924_0207686_225_569 90
994 3300035410 Ga0373924_0371616 Ga0373924_0371616_256_543 90
995 3300035691 Ga0373931_0298091 Ga0373931_0298091_347_631 90
996 3300035691 Ga0373931_0651839 Ga0373931_0651839_279_566 90
997 3300035692 Ga0373935_0003403 Ga0373935_0003403_2584_2865 90
998 3300035692 Ga0373935_0367197 Ga0373935_0367197_377_661 90
999 3300035695 Ga0373927_0145210 Ga0373927_0145210_427_708 90
1000 3300035695 Ga0373927_0168305 Ga0373927_0168305_393_680 90
1001 3300035724 Ga0373933_0705611 Ga0373933_0705611_316_603 90
1002 3300035724 Ga0373933_1151971 Ga0373933_1151971_182_466 90
1003 3300035724 Ga0373933_1200269 Ga0373933_1200269_27_311 90
1004 3300035725 Ga0373947_0009172 Ga0373947_0009172_2613_2894 90
1005 3300036401 Ga0373937_0025062 Ga0373937_0025062_2934_3221 90
1006 3300036401 Ga0373937_0051912 Ga0373937_0051912_1841_2185 90
1007 3300036401 Ga0373937_0058492 Ga0373937_0058492_1410_1697 90
1008 3300036401 Ga0373937_0125512 Ga0373937_0125512_292_570 90
1009 3300036401 Ga0373937_0304508 Ga0373937_0304508_17_301 90
1010 3300036401 Ga0373937_0336520 Ga0373937_0336520_428_709 90
1011 3300036401 Ga0373937_0345212 Ga0373937_0345212_214_498 90
1012 3300036401 Ga0373937_2043433 Ga0373937_2043433_139_429 90
1013 3300036647 Ga0316582_0182455 Ga0316582_0182455_587_874 90
1014 3300036647 Ga0316582_0211025 Ga0316582_0211025_745_1029 90
1015 3300036712 Ga0316584_0390129 Ga0316584_0390129_496_780 90
1016 3300037068 Ga0373925_0002514 Ga0373925_0002514_4504_4785 90
1017 3300037068 Ga0373925_0146974 Ga0373925_0146974_1464_1751 90
1018 3300037068 Ga0373925_0343453 Ga0373925_0343453_16_297 90
1019 3300037068 Ga0373925_0437185 Ga0373925_0437185_241_528 90
1020 3300037068 Ga0373925_1239991 Ga0373925_1239991_268_546 90
1021 3300037312 Ga0395899_0026792 Ga0395899_0026792_1942_2229 90
1022 3300037312 Ga0395899_0028972 Ga0395899_0028972_2915_3193 90
1023 3300037312 Ga0395899_0079933 Ga0395899_0079933_1662_1940 90
1024 3300037312 Ga0395899_0309774 Ga0395899_0309774_502_786 90
1025 3300037418 Ga0395900_0115358 Ga0395900_0115358_1557_1844 90
1026 3300037418 Ga0395900_0128634 Ga0395900_0128634_1073_1357 90
1027 3300037418 Ga0395900_0331193 Ga0395900_0331193_479_757 90
1028 3300037418 Ga0395900_0724545 Ga0395900_0724545_193_471 90
1029 3300037466 Ga0395898_0071967 Ga0395898_0071967_2410_2688 90
1030 3300037466 Ga0395898_0138781 Ga0395898_0138781_257_544 90
1031 3300037466 Ga0395898_0157160 Ga0395898_0157160_1818_2096 90
1032 3300037466 Ga0395898_1874198 Ga0395898_1874198_70_354 90
1033 3300038443 Ga0395901_0015561 Ga0395901_0015561_6753_7040 90
1034 3300038443 Ga0395901_0315777 Ga0395901_0315777_456_734 90
1035 3300039093 Ga0400489_71255 Ga0400489_71255_365_652 90
1036 3300039437 Ga0436365_0261194 Ga0436365_0261194_436_720 90
1037 3300039437 Ga0436365_0882944 Ga0436365_0882944_479_766 90
1038 3300039438 Ga0436360_0037775 Ga0436360_0037775_732_1016 90
1039 3300039438 Ga0436360_0056553 Ga0436360_0056553_1334_1612 90
1040 3300039438 Ga0436360_0858736 Ga0436360_0858736_458_736 90
1041 3300039438 Ga0436360_1075444 Ga0436360_1075444_445_729 90
1042 3300039438 Ga0436360_1093052 Ga0436360_1093052_627_911 90
1043 3300039447 Ga0436361_0038119 Ga0436361_0038119_539_817 90
1044 3300039450 Ga0436363_1353046 Ga0436363_1353046_536_823 90
1045 3300039450 Ga0436363_1683799 Ga0436363_1683799_142_432 90
1046 3300039453 Ga0436362_0043488 Ga0436362_0043488_470_754 90
1047 3300039453 Ga0436362_0189212 Ga0436362_0189212_298_582 90
1048 3300039453 Ga0436362_0279827 Ga0436362_0279827_251_541 90
1049 3300039453 Ga0436362_0362184 Ga0436362_0362184_251_529 90
1050 3300041406 Ga0439439_0124520 Ga0439439_0124520_202_480 90
1051 3300041443 Ga0451789_0541849 Ga0451789_0541849_759_1043 90
1052 3300041453 Ga0451797_0651722 Ga0451797_0651722_177_461 90
1053 3300041459 Ga0451800_1533229 Ga0451800_1533229_13_297 90
1054 3300041486 Ga0451807_0540028 Ga0451807_0540028_171_455 90
1055 3300041486 Ga0451807_2422029 Ga0451807_2422029_462_746 90
1056 3300041496 Ga0451839_1456558 Ga0451839_1456558_213_497 90
1057 3300041512 Ga0451853_0027383 Ga0451853_0027383_231_515 90
1058 3300042004 Ga0439445_0123887 Ga0439445_0123887_144_422 90
1059 3300042007 Ga0439449_0245637 Ga0439449_0245637_143_421 90
1060 3300042876 Ga0451577_0038980 Ga0451577_0038980_622_909 90
1061 3300042876 Ga0451577_0125556 Ga0451577_0125556_1166_1453 90
1062 3300044658 Ga0466972_0379310 Ga0466972_0379310_288_572 90
1063 3300044673 Ga0453683_0846822 Ga0453683_0846822_12_299 90
1064 3300044694 Ga0466963_0534902 Ga0466963_0534902_477_761 90
1065 3300044706 Ga0466964_0583553 Ga0466964_0583553_217_498 90
1066 3300044712 Ga0453684_0007468 Ga0453684_0007468_2951_3238 90
1067 3300044712 Ga0453684_0042819 Ga0453684_0042819_2887_3171 90
1068 3300044719 Ga0466971_0108332 Ga0466971_0108332_920_1204 90
1069 3300044842 Ga0466957_0090403 Ga0466957_0090403_53_337 90
1070 3300044901 Ga0466960_0341536 Ga0466960_0341536_423_707 90
1071 3300045051 Ga0451576_0057114 Ga0451576_0057114_1792_2079 90
1072 3300045976 Ga0466967_0131550 Ga0466967_0131550_508_792 90
1073 3300045976 Ga0466967_0807903 Ga0466967_0807903_425_706 90
1074 3300046452 Ga0495617_133212 Ga0495617_133212_330_614 90
1075 3300046458 Ga0495591_069261 Ga0495591_069261_492_776 90
1076 3300046462 Ga0495651_0362177 Ga0495651_0362177_502_786 90
1077 3300046462 Ga0495651_0370567 Ga0495651_0370567_180_470 90
1078 3300046462 Ga0495651_0375415 Ga0495651_0375415_79_363 90
1079 3300046462 Ga0495651_0924804 Ga0495651_0924804_221_505 90
1080 3300046463 Ga0495653_0620486 Ga0495653_0620486_229_513 90
1081 3300046472 Ga0495580_0003736 Ga0495580_0003736_490_771 90
1082 3300046472 Ga0495580_0053578 Ga0495580_0053578_1977_2264 90
1083 3300046474 Ga0495605_0117912 Ga0495605_0117912_665_949 90
1084 3300046475 Ga0495639_0313240 Ga0495639_0313240_119_400 90
1085 3300046475 Ga0495639_0507951 Ga0495639_0507951_264_542 90
1086 3300046477 Ga0495664_0076998 Ga0495664_0076998_1121_1411 90
1087 3300046477 Ga0495664_0359859 Ga0495664_0359859_416_706 90
1088 3300046491 Ga0495584_0183045 Ga0495584_0183045_216_500 90
1089 3300046506 Ga0495583_0123208 Ga0495583_0123208_600_884 90
1090 3300046514 Ga0495618_0379926 Ga0495618_0379926_437_718 90
1091 3300046515 Ga0495620_0053516 Ga0495620_0053516_16_300 90
1092 3300046516 Ga0495628_0122932 Ga0495628_0122932_1394_1678 90
1093 3300046517 Ga0495630_1265140 Ga0495630_1265140_126_407 90
1094 3300046519 Ga0495632_0301218 Ga0495632_0301218_84_368 90
1095 3300046524 Ga0495648_0378545 Ga0495648_0378545_36_320 90
1096 3300046524 Ga0495648_0524037 Ga0495648_0524037_118_402 90
1097 3300046525 Ga0495663_0338692 Ga0495663_0338692_105_383 90
1098 3300046529 Ga0495652_0026548 Ga0495652_0026548_4803_5087 90
1099 3300046529 Ga0495652_0179093 Ga0495652_0179093_1158_1445 90
1100 3300046529 Ga0495652_0195820 Ga0495652_0195820_970_1254 90
1101 3300046529 Ga0495652_0480247 Ga0495652_0480247_395_679 90
1102 3300046529 Ga0495652_1044373 Ga0495652_1044373_18_302 90
1103 3300046533 Ga0495640_0099927 Ga0495640_0099927_357_656 90
1104 3300046533 Ga0495640_0103613 Ga0495640_0103613_1466_1750 90
1105 3300046535 Ga0495586_0277497 Ga0495586_0277497_124_423 90
1106 3300046535 Ga0495586_0699392 Ga0495586_0699392_183_464 90
1107 3300046536 Ga0495587_0145166 Ga0495587_0145166_422_709 90
1108 3300046536 Ga0495587_0215424 Ga0495587_0215424_155_439 90
1109 3300046539 Ga0495621_0121500 Ga0495621_0121500_411_695 90
1110 3300046539 Ga0495621_0142498 Ga0495621_0142498_264_548 90
1111 3300046543 Ga0495645_0093461 Ga0495645_0093461_267_551 90
1112 3300046543 Ga0495645_0342442 Ga0495645_0342442_590_874 90
1113 3300046557 Ga0495622_0003803 Ga0495622_0003803_1139_1423 90
1114 3300046557 Ga0495622_0245488 Ga0495622_0245488_302_592 90
1115 3300046558 Ga0495633_0155709 Ga0495633_0155709_502_786 90
1116 3300046559 Ga0495667_0148471 Ga0495667_0148471_458_742 90
1117 3300046559 Ga0495667_0193681 Ga0495667_0193681_127_471 90
1118 3300046615 Ga0495656_0040399 Ga0495656_0040399_1025_1309 90
1119 3300046648 Ga0495611_0096380 Ga0495611_0096380_584_916 90
1120 3300046648 Ga0495611_0359403 Ga0495611_0359403_162_461 90
1121 3300046660 Ga0495625_0254919 Ga0495625_0254919_489_773 90
1122 3300046660 Ga0495625_0289781 Ga0495625_0289781_185_469 90
1123 3300046665 Ga0495661_0361457 Ga0495661_0361457_232_531 90
1124 3300046675 Ga0495657_0066740 Ga0495657_0066740_1461_1745 90
1125 3300046678 Ga0495599_0354729 Ga0495599_0354729_230_514 90
1126 3300046678 Ga0495599_0555642 Ga0495599_0555642_204_488 90
1127 3300046679 Ga0495623_0050531 Ga0495623_0050531_1138_1425 90
1128 3300046679 Ga0495623_0302678 Ga0495623_0302678_185_469 90
1129 3300046683 Ga0495658_0001492 Ga0495658_0001492_4469_4750 90
1130 3300046684 Ga0495669_0035699 Ga0495669_0035699_296_574 90
1131 3300046689 Ga0495613_0515613 Ga0495613_0515613_502_786 90
1132 3300046690 Ga0495624_0572890 Ga0495624_0572890_307_591 90
1133 3300046690 Ga0495624_0783828 Ga0495624_0783828_145_444 90
1134 3300046691 Ga0495670_0035476 Ga0495670_0035476_1508_1792 90
1135 3300046692 Ga0495671_0393821 Ga0495671_0393821_112_396 90
1136 3300046694 Ga0495649_0458288 Ga0495649_0458288_292_576 90
1137 3300046794 Ga0495589_0042395 Ga0495589_0042395_654_953 90
1138 3300046794 Ga0495589_0262802 Ga0495589_0262802_145_429 90
1139 3300046809 Ga0495600_0071727 Ga0495600_0071727_1477_1761 90
1140 3300046809 Ga0495600_0617310 Ga0495600_0617310_222_521 90
1141 3300046809 Ga0495600_0743966 Ga0495600_0743966_28_318 90
1142 3300046810 Ga0495660_0439077 Ga0495660_0439077_55_339 90
1143 3300047315 Ga0495581_0064379 Ga0495581_0064379_1363_1641 90
1144 3300047315 Ga0495581_0459552 Ga0495581_0459552_390_671 90
1145 3300047317 Ga0495604_0924170 Ga0495604_0924170_165_449 90
1146 3300047318 Ga0495636_0001105 Ga0495636_0001105_5085_5375 90
1147 3300047319 Ga0495674_0268579 Ga0495674_0268579_470_757 90
1148 3300047319 Ga0495674_0375032 Ga0495674_0375032_479_763 90
1149 3300047319 Ga0495674_0698568 Ga0495674_0698568_474_758 90
1150 3300047319 Ga0495674_0955827 Ga0495674_0955827_152_439 90
1151 3300047320 Ga0495672_0412117 Ga0495672_0412117_131_415 90
1152 3300047321 Ga0495676_0128870 Ga0495676_0128870_1476_1760 90
1153 3300047469 Ga0495673_0268217 Ga0495673_0268217_187_471 90
1154 3300047470 Ga0495681_0252461 Ga0495681_0252461_164_448 90
1155 3300047471 Ga0495684_0257750 Ga0495684_0257750_304_585 90
1156 3300047471 Ga0495684_0384728 Ga0495684_0384728_456_740 90
1157 3300048088 Ga0495602_0202910 Ga0495602_0202910_575_862 90
1158 3300048088 Ga0495602_0224370 Ga0495602_0224370_755_1042 90
1159 3300048090 Ga0495615_0001445 Ga0495615_0001445_2855_3145 90
1160 3300048903 Ga0496100_0293149 Ga0496100_0293149_858_1136 90
1161 3300048904 Ga0496101_0653497 Ga0496101_0653497_309_599 90
1162 3300048904 Ga0496101_1004803 Ga0496101_1004803_128_412 90
1163 3300048905 Ga0496102_0504856 Ga0496102_0504856_714_1001 90
1164 3300048910 Ga0496107_0874938 Ga0496107_0874938_90_371 90
1165 3300048911 Ga0496108_0934943 Ga0496108_0934943_155_442 90
1166 3300048912 Ga0496109_1141491 Ga0496109_1141491_369_656 90
1167 3300048913 Ga0496110_0730308 Ga0496110_0730308_154_432 90
1168 3300048914 Ga0496111_0070848 Ga0496111_0070848_1376_1663 90
1169 3300048917 Ga0496114_0006073 Ga0496114_0006073_2349_2663 90
1170 3300048917 Ga0496114_0640298 Ga0496114_0640298_596_877 90
1171 3300048917 Ga0496114_0699411 Ga0496114_0699411_176_490 90
1172 3300048918 Ga0496115_0139323 Ga0496115_0139323_967_1254 90
1173 3300048918 Ga0496115_0721805 Ga0496115_0721805_289_576 90
1174 3300048918 Ga0496115_0731018 Ga0496115_0731018_442_726 90
1175 3300048918 Ga0496115_0871077 Ga0496115_0871077_43_321 90
1176 3300048924 Ga0496121_0006108 Ga0496121_0006108_10840_11124 90
1177 3300048929 Ga0496126_0021992 Ga0496126_0021992_2275_2559 90
1178 3300048929 Ga0496126_0357170 Ga0496126_0357170_600_881 90
1179 3300048929 Ga0496126_1019861 Ga0496126_1019861_177_461 90
1180 3300049130 Ga0501310_070000 Ga0501310_070000_39_326 90
1181 3300049539 Ga0501323_057613 Ga0501323_057613_288_566 90
1182 3300049568 Ga0501031_0025716 Ga0501031_0025716_3473_3757 90
1183 3300049568 Ga0501031_0170119 Ga0501031_0170119_399_686 90
1184 3300049568 Ga0501031_0466433 Ga0501031_0466433_317_601 90
1185 3300049569 Ga0501032_0040734 Ga0501032_0040734_18_302 90
1186 3300049569 Ga0501032_0102577 Ga0501032_0102577_502_789 90
1187 3300049569 Ga0501032_0183900 Ga0501032_0183900_739_1026 90
1188 3300049569 Ga0501032_0189796 Ga0501032_0189796_608_895 90
1189 3300049569 Ga0501032_0196354 Ga0501032_0196354_104_391 90
1190 3300049569 Ga0501032_0206621 Ga0501032_0206621_725_1009 90
1191 3300049569 Ga0501032_0306261 Ga0501032_0306261_703_990 90
1192 3300049569 Ga0501032_0372509 Ga0501032_0372509_344_628 90
1193 3300049569 Ga0501032_0786654 Ga0501032_0786654_49_333 90
1194 3300049570 Ga0501033_0005260 Ga0501033_0005260_2003_2287 90
1195 3300049570 Ga0501033_0017879 Ga0501033_0017879_3278_3562 90
1196 3300049570 Ga0501033_0029185 Ga0501033_0029185_2527_2811 90
1197 3300049570 Ga0501033_0053353 Ga0501033_0053353_242_529 90
1198 3300049570 Ga0501033_0088176 Ga0501033_0088176_286_573 90
1199 3300049570 Ga0501033_0172789 Ga0501033_0172789_580_864 90
1200 3300049570 Ga0501033_0227590 Ga0501033_0227590_887_1171 90
1201 3300049570 Ga0501033_0315597 Ga0501033_0315597_646_933 90
1202 3300049570 Ga0501033_0556659 Ga0501033_0556659_471_755 90
1203 3300049570 Ga0501033_1160024 Ga0501033_1160024_38_322 90
1204 3300049570 Ga0501033_1179937 Ga0501033_1179937_46_330 90
1205 3300049571 Ga0501034_0010632 Ga0501034_0010632_2317_2601 90
1206 3300049571 Ga0501034_0101650 Ga0501034_0101650_2014_2298 90
1207 3300049571 Ga0501034_0161504 Ga0501034_0161504_806_1093 90
1208 3300049571 Ga0501034_0213327 Ga0501034_0213327_773_1057 90
1209 3300049571 Ga0501034_0321023 Ga0501034_0321023_615_914 90
1210 3300049571 Ga0501034_0344063 Ga0501034_0344063_129_416 90
1211 3300049571 Ga0501034_0729840 Ga0501034_0729840_485_763 90
1212 3300049571 Ga0501034_0810734 Ga0501034_0810734_210_497 90
1213 3300049571 Ga0501034_0820211 Ga0501034_0820211_386_670 90
1214 3300049571 Ga0501034_1049866 Ga0501034_1049866_271_558 90
1215 3300049571 Ga0501034_1428113 Ga0501034_1428113_140_424 90
1216 3300049572 Ga0501036_0005653 Ga0501036_0005653_2904_3188 90
1217 3300049572 Ga0501036_0209685 Ga0501036_0209685_435_719 90
1218 3300049572 Ga0501036_0456166 Ga0501036_0456166_540_827 90
1219 3300049572 Ga0501036_0921298 Ga0501036_0921298_413_697 90
1220 3300049572 Ga0501036_1637748 Ga0501036_1637748_200_484 90
1221 3300049573 Ga0501037_0034293 Ga0501037_0034293_2504_2788 90
1222 3300049573 Ga0501037_0048165 Ga0501037_0048165_2081_2365 90
1223 3300049573 Ga0501037_0109752 Ga0501037_0109752_1585_1866 90
1224 3300049573 Ga0501037_0255269 Ga0501037_0255269_419_706 90
1225 3300049573 Ga0501037_0381347 Ga0501037_0381347_619_903 90
1226 3300049574 Ga0501038_0037384 Ga0501038_0037384_2918_3202 90
1227 3300049574 Ga0501038_0069019 Ga0501038_0069019_2140_2424 90
1228 3300049574 Ga0501038_0121174 Ga0501038_0121174_682_966 90
1229 3300049574 Ga0501038_0173475 Ga0501038_0173475_352_639 90
1230 3300049574 Ga0501038_0356477 Ga0501038_0356477_784_1071 90
1231 3300049575 Ga0501039_0494969 Ga0501039_0494969_550_837 90
1232 3300049575 Ga0501039_0817971 Ga0501039_0817971_355_639 90
1233 3300049575 Ga0501039_0893370 Ga0501039_0893370_62_346 90
1234 3300049578 Ga0501042_0014227 Ga0501042_0014227_2243_2527 90
1235 3300049579 Ga0501043_0010388 Ga0501043_0010388_6492_6776 90
1236 3300049579 Ga0501043_0065848 Ga0501043_0065848_1097_1381 90
1237 3300049579 Ga0501043_0087898 Ga0501043_0087898_1746_2030 90
1238 3300049579 Ga0501043_0220539 Ga0501043_0220539_337_624 90
1239 3300049579 Ga0501043_0226689 Ga0501043_0226689_494_778 90
1240 3300049579 Ga0501043_0290769 Ga0501043_0290769_657_944 90
1241 3300049579 Ga0501043_0346936 Ga0501043_0346936_140_424 90
1242 3300049579 Ga0501043_0467598 Ga0501043_0467598_206_493 90
1243 3300049579 Ga0501043_0616395 Ga0501043_0616395_132_416 90
1244 3300049580 Ga0501046_0005416 Ga0501046_0005416_10606_10890 90
1245 3300049580 Ga0501046_0012992 Ga0501046_0012992_1340_1627 90
1246 3300049580 Ga0501046_0233704 Ga0501046_0233704_741_1025 90
1247 3300049580 Ga0501046_0259183 Ga0501046_0259183_159_446 90
1248 3300049580 Ga0501046_0269201 Ga0501046_0269201_220_504 90
1249 3300049580 Ga0501046_0330421 Ga0501046_0330421_740_1024 90
1250 3300049580 Ga0501046_0359221 Ga0501046_0359221_586_870 90
1251 3300049581 Ga0501047_0024757 Ga0501047_0024757_2522_2803 90
1252 3300049581 Ga0501047_0027205 Ga0501047_0027205_2190_2477 90
1253 3300049581 Ga0501047_0076358 Ga0501047_0076358_2018_2302 90
1254 3300049581 Ga0501047_0079255 Ga0501047_0079255_115_399 90
1255 3300049581 Ga0501047_0109042 Ga0501047_0109042_853_1137 90
1256 3300049581 Ga0501047_0111494 Ga0501047_0111494_603_887 90
1257 3300049581 Ga0501047_0121226 Ga0501047_0121226_1418_1702 90
1258 3300049581 Ga0501047_0125622 Ga0501047_0125622_1952_2239 90
1259 3300049581 Ga0501047_0188242 Ga0501047_0188242_393_677 90
1260 3300049581 Ga0501047_0248776 Ga0501047_0248776_250_534 90
1261 3300049581 Ga0501047_0410118 Ga0501047_0410118_645_923 90
1262 3300049581 Ga0501047_0685927 Ga0501047_0685927_110_394 90
1263 3300049581 Ga0501047_1051391 Ga0501047_1051391_290_577 90
1264 3300049581 Ga0501047_1088783 Ga0501047_1088783_98_385 90
1265 3300049581 Ga0501047_1397847 Ga0501047_1397847_67_348 90
1266 3300049582 Ga0501048_0056621 Ga0501048_0056621_1268_1552 90
1267 3300049582 Ga0501048_0077562 Ga0501048_0077562_1762_2049 90
1268 3300049582 Ga0501048_0138894 Ga0501048_0138894_962_1249 90
1269 3300049582 Ga0501048_1010442 Ga0501048_1010442_192_479 90
1270 3300049583 Ga0501067_0001776 Ga0501067_0001776_8580_8864 90
1271 3300049583 Ga0501067_0005578 Ga0501067_0005578_6487_6774 90
1272 3300049583 Ga0501067_0452148 Ga0501067_0452148_112_396 90
1273 3300049584 Ga0501068_0069573 Ga0501068_0069573_85_369 90
1274 3300049585 Ga0501069_0001817 Ga0501069_0001817_568_852 90
1275 3300049585 Ga0501069_0005996 Ga0501069_0005996_3255_3542 90
1276 3300049585 Ga0501069_0183923 Ga0501069_0183923_206_493 90
1277 3300049586 Ga0501070_0001611 Ga0501070_0001611_553_840 90
1278 3300049586 Ga0501070_0003398 Ga0501070_0003398_3572_3859 90
1279 3300049586 Ga0501070_0390265 Ga0501070_0390265_694_978 90
1280 3300049586 Ga0501070_0496788 Ga0501070_0496788_259_543 90
1281 3300049586 Ga0501070_0646797 Ga0501070_0646797_328_615 90
1282 3300049588 Ga0501072_0122987 Ga0501072_0122987_971_1255 90
1283 3300049589 Ga0501073_0043107 Ga0501073_0043107_252_536 90
1284 3300049589 Ga0501073_0176085 Ga0501073_0176085_987_1274 90
1285 3300049589 Ga0501073_0184587 Ga0501073_0184587_705_989 90
1286 3300049589 Ga0501073_0186729 Ga0501073_0186729_348_632 90
1287 3300049589 Ga0501073_0311314 Ga0501073_0311314_656_943 90
1288 3300049590 Ga0501074_0010906 Ga0501074_0010906_2737_3024 90
1289 3300049590 Ga0501074_0035296 Ga0501074_0035296_243_527 90
1290 3300049592 Ga0501076_0238655 Ga0501076_0238655_340_624 90
1291 3300049741 Ga0501079_0001478 Ga0501079_0001478_2956_3240 90
1292 3300049741 Ga0501079_0018448 Ga0501079_0018448_3340_3627 90
1293 3300049741 Ga0501079_0370911 Ga0501079_0370911_705_992 90
1294 3300049742 Ga0501080_0006960 Ga0501080_0006960_4612_4899 90
1295 3300049742 Ga0501080_0028291 Ga0501080_0028291_2030_2317 90
1296 3300049742 Ga0501080_0055626 Ga0501080_0055626_1440_1724 90
1297 3300049742 Ga0501080_0232351 Ga0501080_0232351_611_898 90
1298 3300049742 Ga0501080_0283870 Ga0501080_0283870_27_308 90
1299 3300049742 Ga0501080_0300101 Ga0501080_0300101_406_690 90
1300 3300049742 Ga0501080_0314307 Ga0501080_0314307_265_549 90
1301 3300049742 Ga0501080_1017787 Ga0501080_1017787_230_514 90
1302 3300049742 Ga0501080_1529147 Ga0501080_1529147_241_525 90
1303 3300049744 Ga0501083_0072982 Ga0501083_0072982_1096_1383 90
1304 3300049744 Ga0501083_0199911 Ga0501083_0199911_802_1089 90
1305 3300049744 Ga0501083_0209064 Ga0501083_0209064_883_1167 90
1306 3300049822 Ga0501035_0013364 Ga0501035_0013364_1841_2128 90
1307 3300049822 Ga0501035_0024934 Ga0501035_0024934_2154_2438 90
1308 3300049822 Ga0501035_0038345 Ga0501035_0038345_1343_1630 90
1309 3300049822 Ga0501035_0051927 Ga0501035_0051927_2931_3215 90
1310 3300049822 Ga0501035_0055903 Ga0501035_0055903_285_566 90
1311 3300049822 Ga0501035_0119715 Ga0501035_0119715_779_1063 90
1312 3300049822 Ga0501035_0122106 Ga0501035_0122106_364_651 90
1313 3300049822 Ga0501035_0392177 Ga0501035_0392177_31_315 90
1314 3300049822 Ga0501035_0542400 Ga0501035_0542400_403_687 90
1315 3300049822 Ga0501035_0627209 Ga0501035_0627209_360_644 90
1316 3300049822 Ga0501035_0629836 Ga0501035_0629836_540_827 90
1317 3300049822 Ga0501035_0985958 Ga0501035_0985958_116_400 90
1318 3300049823 Ga0501044_0028702 Ga0501044_0028702_2629_2916 90
1319 3300049823 Ga0501044_0044447 Ga0501044_0044447_2875_3156 90
1320 3300049823 Ga0501044_0062058 Ga0501044_0062058_2913_3197 90
1321 3300049823 Ga0501044_0073264 Ga0501044_0073264_718_1002 90
1322 3300049823 Ga0501044_0087802 Ga0501044_0087802_615_902 90
1323 3300049823 Ga0501044_0093398 Ga0501044_0093398_419_706 90
1324 3300049823 Ga0501044_0094754 Ga0501044_0094754_2026_2313 90
1325 3300049823 Ga0501044_0106319 Ga0501044_0106319_759_1043 90
1326 3300049823 Ga0501044_0154289 Ga0501044_0154289_1626_1913 90
1327 3300049823 Ga0501044_0245909 Ga0501044_0245909_393_677 90
1328 3300049823 Ga0501044_0270468 Ga0501044_0270468_532_816 90
1329 3300049823 Ga0501044_0276504 Ga0501044_0276504_741_1025 90
1330 3300049823 Ga0501044_0277202 Ga0501044_0277202_719_1003 90
1331 3300049823 Ga0501044_0458440 Ga0501044_0458440_585_869 90
1332 3300049823 Ga0501044_0494129 Ga0501044_0494129_647_931 90
1333 3300049823 Ga0501044_0664052 Ga0501044_0664052_58_342 90
1334 3300049823 Ga0501044_0722140 Ga0501044_0722140_20_307 90
1335 3300049823 Ga0501044_0763394 Ga0501044_0763394_364_648 90
1336 3300049824 Ga0501045_0090970 Ga0501045_0090970_1251_1535 90
1337 3300050490 nmdc:mga03n38_163963_c1 nmdc:mga03n38_163963_c1_219_530 90
1338 3300050490 nmdc:mga03n38_167404_c1 nmdc:mga03n38_167404_c1_583_861 90
1339 3300050490 nmdc:mga03n38_864477_c1 nmdc:mga03n38_864477_c1_172_483 90
1340 3300050491 nmdc:mga00v17_4550_c1 nmdc:mga00v17_4550_c1_4213_4491 90
1341 3300050491 nmdc:mga00v17_56248_c1 nmdc:mga00v17_56248_c1_690_1001 90
1342 3300050491 nmdc:mga00v17_632651_c1 nmdc:mga00v17_632651_c1_327_626 90
1343 3300050491 nmdc:mga00v17_839543_c1 nmdc:mga00v17_839543_c1_35_334 90
1344 3300050493 nmdc:mga0k408_159669_c1 nmdc:mga0k408_159669_c1_774_1052 90
1345 3300050493 nmdc:mga0k408_169594_c1 nmdc:mga0k408_169594_c1_925_1236 90
1346 3300050494 nmdc:mga06z11_109527_c1 nmdc:mga06z11_109527_c1_1011_1322 90
1347 3300050494 nmdc:mga06z11_259219_c1 nmdc:mga06z11_259219_c1_256_534 90
1348 3300050495 nmdc:mga04h51_14488_c1 nmdc:mga04h51_14488_c1_1423_1734 90
1349 3300050495 nmdc:mga04h51_262765_c1 nmdc:mga04h51_262765_c1_308_586 90
1350 3300050496 nmdc:mga07m45_58977_c1 nmdc:mga07m45_58977_c1_968_1246 90
1351 3300050512 nmdc:mga0n895_129615_c1 nmdc:mga0n895_129615_c1_1545_1832 90
1352 3300050513 nmdc:mga0rr50_173981_c1 nmdc:mga0rr50_173981_c1_540_827 90
1353 3300050513 nmdc:mga0rr50_334808_c1 nmdc:mga0rr50_334808_c1_162_449 90
1354 3300050514 nmdc:mga08x19_114136_c1 nmdc:mga08x19_114136_c1_717_1004 90
1355 3300050514 nmdc:mga08x19_14934_c1 nmdc:mga08x19_14934_c1_1816_2103 90
1356 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_19529_19816 90
1357 3300050516 nmdc:mga0sz30_11705_c1 nmdc:mga0sz30_11705_c1_562_873 90
1358 3300050516 nmdc:mga0sz30_164397_c1 nmdc:mga0sz30_164397_c1_410_718 90
1359 3300053077 Ga0495601_0540984 Ga0495601_0540984_281_568 90
1360 3300053080 Ga0500635_0006898 Ga0500635_0006898_2046_2330 90
1361 3300053085 Ga0495619_0028862 Ga0495619_0028862_2635_2979 90
1362 3300053094 Ga0500566_0195987 Ga0500566_0195987_50_328 90
1363 3300053096 Ga0500641_0002384 Ga0500641_0002384_3143_3421 90
1364 3300053096 Ga0500641_0003388 Ga0500641_0003388_3516_3794 90
1365 3300053102 Ga0500554_190365 Ga0500554_190365_336_614 90
1366 3300053103 Ga0500555_046091 Ga0500555_046091_780_1064 90
1367 3300053109 Ga0500569_000322 Ga0500569_000322_4174_4452 90
1368 3300053119 Ga0500595_003166 Ga0500595_003166_3533_3811 90
1369 3300053119 Ga0500595_008511 Ga0500595_008511_3162_3446 90
1370 3300053119 Ga0500595_014727 Ga0500595_014727_2490_2774 90
1371 3300053123 Ga0500614_241869 Ga0500614_241869_147_431 90
1372 3300053130 Ga0500642_0399293 Ga0500642_0399293_35_346 90
1373 3300053131 Ga0500652_000024 Ga0500652_000024_113042_113320 90
1374 3300053133 Ga0500655_024001 Ga0500655_024001_680_970 90
1375 3300053136 Ga0500559_0021975 Ga0500559_0021975_1065_1349 90
1376 3300053139 Ga0500568_0031032 Ga0500568_0031032_511_795 90
1377 3300053146 Ga0500588_0135402 Ga0500588_0135402_507_791 90
1378 3300053154 Ga0500619_011027 Ga0500619_011027_1273_1554 90
1379 3300053154 Ga0500619_266234 Ga0500619_266234_174_452 90
1380 3300053163 Ga0500639_257166 Ga0500639_257166_14_292 90
1381 3300053177 Ga0500636_0032406 Ga0500636_0032406_580_858 90
1382 3300053178 Ga0500637_0335938 Ga0500637_0335938_436_720 90
1383 3300053730 Ga0500645_062715 Ga0500645_062715_250_534 90
1384 3300054114 Ga0501084_0007620 Ga0501084_0007620_8573_8857 90
1385 3300054114 Ga0501084_0030163 Ga0501084_0030163_1607_1894 90
1386 3300059478 Ga0587093_048166 Ga0587093_048166_39_317 90
1387 3300059490 Ga0587066_008616 Ga0587066_008616_123_401 90
1388 3300059505 Ga0587083_0039236 Ga0587083_0039236_390_668 90
1389 3300059507 Ga0587086_027435 Ga0587086_027435_151_429 90
1390 3300059623 Ga0587101_141014 Ga0587101_141014_180_461 90
1391 3300059639 Ga0587062_020221 Ga0587062_020221_545_829 90
1392 3300059639 Ga0587062_100929 Ga0587062_100929_66_347 90
1393 3300059643 Ga0587072_062919 Ga0587072_062919_149_427 90
1394 3300059645 Ga0587076_154490 Ga0587076_154490_193_474 90
1395 3300059648 Ga0587100_008513 Ga0587100_008513_492_770 90
1396 3300060346 Ga0587111_0276326 Ga0587111_0276326_186_464 90
1397 3300060353 Ga0501082_0032834 Ga0501082_0032834_1055_1339 90
1398 3300060353 Ga0501082_0246759 Ga0501082_0246759_373_657 90
1399 3300061719 Ga0466962_0340689 Ga0466962_0340689_376_660 90
1400 3300005289 Ga0065704_10277068 Ga0065704_102770683 91
1401 3300005329 Ga0070683_100044407 Ga0070683_1000444074 91
1402 3300005329 Ga0070683_100562558 Ga0070683_1005625581 91
1403 3300005331 Ga0070670_100689737 Ga0070670_1006897372 91
1404 3300005331 Ga0070670_101039269 Ga0070670_1010392692 91
1405 3300005337 Ga0070682_100661292 Ga0070682_1006612921 91
1406 3300005337 Ga0070682_101964132 Ga0070682_1019641321 91
1407 3300005340 Ga0070689_101284078 Ga0070689_1012840782 91
1408 3300005364 Ga0070673_101117438 Ga0070673_1011174382 91
1409 3300005365 Ga0070688_100627123 Ga0070688_1006271232 91
1410 3300005434 Ga0070709_10740342 Ga0070709_107403422 91
1411 3300005435 Ga0070714_100551229 Ga0070714_1005512292 91
1412 3300005456 Ga0070678_100063732 Ga0070678_1000637321 91
1413 3300005456 Ga0070678_101106020 Ga0070678_1011060201 91
1414 3300005458 Ga0070681_10126477 Ga0070681_101264773 91
1415 3300005466 Ga0070685_10811086 Ga0070685_108110862 91
1416 3300005530 Ga0070679_101411516 Ga0070679_1014115162 91
1417 3300005535 Ga0070684_100046281 Ga0070684_1000462811 91
1418 3300005535 Ga0070684_100058335 Ga0070684_1000583355 91
1419 3300005548 Ga0070665_101554983 Ga0070665_1015549832 91
1420 3300005563 Ga0068855_100153786 Ga0068855_1001537864 91
1421 3300005614 Ga0068856_100454497 Ga0068856_1004544972 91
1422 3300005617 Ga0068859_100042834 Ga0068859_1000428346 91
1423 3300005718 Ga0068866_10354506 Ga0068866_103545061 91
1424 3300005842 Ga0068858_100523629 Ga0068858_1005236291 91
1425 3300006028 Ga0070717_10381674 Ga0070717_103816742 91
1426 3300006175 Ga0070712_101715197 Ga0070712_1017151971 91
1427 3300006237 Ga0097621_100014459 Ga0097621_1000144594 91
1428 3300006358 Ga0068871_100017488 Ga0068871_1000174886 91
1429 3300006880 Ga0075429_100242965 Ga0075429_1002429652 91
1430 3300006881 Ga0068865_100473020 Ga0068865_1004730202 91
1431 3300006881 Ga0068865_100565165 Ga0068865_1005651651 91
1432 3300006914 Ga0075436_100098312 Ga0075436_1000983124 91
1433 3300006931 Ga0097620_100042837 Ga0097620_1000428376 91
1434 3300009092 Ga0105250_10270458 Ga0105250_102704582 91
1435 3300009176 Ga0105242_11510832 Ga0105242_115108321 91
1436 3300009176 Ga0105242_11621797 Ga0105242_116217971 91
1437 3300009551 Ga0105238_10056048 Ga0105238_100560484 91
1438 3300013296 Ga0157374_10674279 Ga0157374_106742792 91
1439 3300013297 Ga0157378_11667835 Ga0157378_116678352 91
1440 3300013307 Ga0157372_10926981 Ga0157372_109269812 91
1441 3300013308 Ga0157375_10768689 Ga0157375_107686892 91
1442 3300014969 Ga0157376_10072267 Ga0157376_100722674 91
1443 3300014969 Ga0157376_10783984 Ga0157376_107839842 91
1444 3300020078 Ga0206352_10757005 Ga0206352_107570052 91
1445 3300025711 Ga0207696_1126183 Ga0207696_11261832 91
1446 3300025906 Ga0207699_10081049 Ga0207699_100810492 91
1447 3300025912 Ga0207707_10055935 Ga0207707_100559354 91
1448 3300025921 Ga0207652_11555433 Ga0207652_115554332 91
1449 3300025924 Ga0207694_10019794 Ga0207694_100197947 91
1450 3300025924 Ga0207694_10733665 Ga0207694_107336652 91
1451 3300025925 Ga0207650_10389095 Ga0207650_103890952 91
1452 3300025928 Ga0207700_10210184 Ga0207700_102101843 91
1453 3300025929 Ga0207664_10429066 Ga0207664_104290662 91
1454 3300025934 Ga0207686_11228862 Ga0207686_112288622 91
1455 3300025938 Ga0207704_10561584 Ga0207704_105615842 91
1456 3300025944 Ga0207661_10038767 Ga0207661_100387675 91
1457 3300025944 Ga0207661_10919077 Ga0207661_109190771 91
1458 3300025944 Ga0207661_11446894 Ga0207661_114468941 91
1459 3300025949 Ga0207667_10238165 Ga0207667_102381652 91
1460 3300026078 Ga0207702_11183791 Ga0207702_111837911 91
1461 3300026088 Ga0207641_10024023 Ga0207641_100240235 91
1462 3300026121 Ga0207683_11216595 Ga0207683_112165951 91
1463 3300028379 Ga0268266_11568471 Ga0268266_115684712 91
1464 3300028380 Ga0268265_12422972 Ga0268265_124229722 91
1465 3300028556 Ga0265337_1154863 Ga0265337_11548631 91
1466 3300028563 Ga0265319_1000071 Ga0265319_100007149 91
1467 3300028573 Ga0265334_10003040 Ga0265334_100030402 91
1468 3300028577 Ga0265318_10000273 Ga0265318_100002736 91
1469 3300028653 Ga0265323_10015822 Ga0265323_100158226 91
1470 3300028654 Ga0265322_10007541 Ga0265322_100075414 91
1471 3300028800 Ga0265338_10016967 Ga0265338_100169676 91
1472 3300028800 Ga0265338_10028203 Ga0265338_1002820313 91
1473 3300028800 Ga0265338_10362629 Ga0265338_103626292 91
1474 3300029957 Ga0265324_10005897 Ga0265324_100058977 91
1475 3300029957 Ga0265324_10056497 Ga0265324_100564972 91
1476 3300031235 Ga0265330_10000541 Ga0265330_1000054129 91
1477 3300031235 Ga0265330_10000998 Ga0265330_1000099827 91
1478 3300031235 Ga0265330_10003962 Ga0265330_1000396211 91
1479 3300031235 Ga0265330_10013183 Ga0265330_100131836 91
1480 3300031235 Ga0265330_10016429 Ga0265330_100164293 91
1481 3300031235 Ga0265330_10293273 Ga0265330_102932731 91
1482 3300031238 Ga0265332_10000280 Ga0265332_100002806 91
1483 3300031239 Ga0265328_10003166 Ga0265328_1000316613 91
1484 3300031240 Ga0265320_10000485 Ga0265320_1000048537 91
1485 3300031241 Ga0265325_10134617 Ga0265325_101346172 91
1486 3300031241 Ga0265325_10179606 Ga0265325_101796063 91
1487 3300031242 Ga0265329_10000013 Ga0265329_1000001349 91
1488 3300031242 Ga0265329_10003473 Ga0265329_1000347312 91
1489 3300031247 Ga0265340_10000189 Ga0265340_1000018937 91
1490 3300031247 Ga0265340_10196648 Ga0265340_101966482 91
1491 3300031249 Ga0265339_10000001 Ga0265339_10000001268 91
1492 3300031249 Ga0265339_10001407 Ga0265339_1000140712 91
1493 3300031249 Ga0265339_10003500 Ga0265339_100035007 91
1494 3300031249 Ga0265339_10006249 Ga0265339_100062498 91
1495 3300031250 Ga0265331_10011236 Ga0265331_100112366 91
1496 3300031250 Ga0265331_10030873 Ga0265331_100308733 91
1497 3300031344 Ga0265316_10000251 Ga0265316_100002516 91
1498 3300031344 Ga0265316_10000984 Ga0265316_1000098436 91
1499 3300031344 Ga0265316_10002957 Ga0265316_1000295727 91
1500 3300031344 Ga0265316_10006437 Ga0265316_100064376 91
1501 3300031344 Ga0265316_10010311 Ga0265316_100103116 91
1502 3300031344 Ga0265316_10068712 Ga0265316_100687125 91
1503 3300031344 Ga0265316_10287264 Ga0265316_102872642 91
1504 3300031595 Ga0265313_10000463 Ga0265313_100004636 91
1505 3300031595 Ga0265313_10003761 Ga0265313_100037613 91
1506 3300031595 Ga0265313_10125279 Ga0265313_101252793 91
1507 3300031665 Ga0316575_10194344 Ga0316575_101943442 91
1508 3300031691 Ga0316579_10097572 Ga0316579_100975722 91
1509 3300031711 Ga0265314_10000003 Ga0265314_100000031174 91
1510 3300031711 Ga0265314_10002804 Ga0265314_100028046 91
1511 3300031711 Ga0265314_10101330 Ga0265314_101013303 91
1512 3300031712 Ga0265342_10000471 Ga0265342_1000047149 91
1513 3300031712 Ga0265342_10000812 Ga0265342_100008126 91
1514 3300031712 Ga0265342_10004388 Ga0265342_100043887 91
1515 3300031712 Ga0265342_10008085 Ga0265342_100080855 91
1516 3300031712 Ga0265342_10046425 Ga0265342_100464252 91
1517 3300031712 Ga0265342_10078127 Ga0265342_100781273 91
1518 3300031728 Ga0316578_10029759 Ga0316578_100297592 91
1519 3300031901 Ga0307406_10084313 Ga0307406_100843131 91
1520 3300032168 Ga0316593_10026137 Ga0316593_100261372 91
1521 3300033524 Ga0316592_1102728 Ga0316592_11027282 91
1522 3300033527 Ga0316586_1089530 Ga0316586_10895302 91
1523 3300033528 Ga0316588_1000005 Ga0316588_10000056 91
1524 3300033528 Ga0316588_1000057 Ga0316588_100005716 91
1525 3300033528 Ga0316588_1187808 Ga0316588_11878081 91
1526 3300033529 Ga0316587_1026071 Ga0316587_10260712 91
1527 3300033529 Ga0316587_1039349 Ga0316587_10393491 91
1528 3300033541 Ga0316596_1144095 Ga0316596_11440952 91
1529 3300035086 Ga0373934_0122743 Ga0373934_0122743_356_682 91
1530 3300035111 Ga0373923_0094438 Ga0373923_0094438_280_606 91
1531 3300035119 Ga0373956_0009506 Ga0373956_0009506_2827_3153 91
1532 3300035120 Ga0373957_0207158 Ga0373957_0207158_287_613 91
1533 3300035171 Ga0373946_0179861 Ga0373946_0179861_44_382 91
1534 3300035695 Ga0373927_0106584 Ga0373927_0106584_508_834 91
1535 3300035724 Ga0373933_0237630 Ga0373933_0237630_503_829 91
1536 3300036401 Ga0373937_0013762 Ga0373937_0013762_3952_4278 91
1537 3300036647 Ga0316582_0196368 Ga0316582_0196368_394_693 91
1538 3300036647 Ga0316582_0272663 Ga0316582_0272663_730_1020 91
1539 3300039438 Ga0436360_0545196 Ga0436360_0545196_315_638 91
1540 3300039450 Ga0436363_1413390 Ga0436363_1413390_166_480 91
1541 3300039453 Ga0436362_0159922 Ga0436362_0159922_151_489 91
1542 3300041492 Ga0451835_0186430 Ga0451835_0186430_364_705 91
1543 3300041512 Ga0451853_2287162 Ga0451853_2287162_264_551 91
1544 3300042876 Ga0451577_0693604 Ga0451577_0693604_367_675 91
1545 3300044712 Ga0453684_0037288 Ga0453684_0037288_3302_3655 91
1546 3300044712 Ga0453684_0093912 Ga0453684_0093912_3035_3379 91
1547 3300044712 Ga0453684_0368987 Ga0453684_0368987_259_615 91
1548 3300044712 Ga0453684_0400036 Ga0453684_0400036_260_604 91
1549 3300045051 Ga0451576_1538020 Ga0451576_1538020_247_555 91
1550 3300046461 Ga0495641_0059937 Ga0495641_0059937_265_591 91
1551 3300046511 Ga0495608_0694563 Ga0495608_0694563_62_388 91
1552 3300046529 Ga0495652_0141337 Ga0495652_0141337_167_493 91
1553 3300046559 Ga0495667_0604192 Ga0495667_0604192_59_385 91
1554 3300046675 Ga0495657_0414678 Ga0495657_0414678_265_591 91
1555 3300046680 Ga0495646_0422224 Ga0495646_0422224_104_430 91
1556 3300046809 Ga0495600_0122033 Ga0495600_0122033_1169_1495 91
1557 3300048907 Ga0496104_1240616 Ga0496104_1240616_138_464 91
1558 3300048909 Ga0496106_1197384 Ga0496106_1197384_41_325 91
1559 3300048915 Ga0496112_0283907 Ga0496112_0283907_1119_1445 91
1560 3300048917 Ga0496114_0366421 Ga0496114_0366421_642_968 91
1561 3300049130 Ga0501310_020560 Ga0501310_020560_500_778 91
1562 3300049130 Ga0501310_041537 Ga0501310_041537_38_337 91
1563 3300049571 Ga0501034_0010720 Ga0501034_0010720_4654_4938 91
1564 3300049589 Ga0501073_0070983 Ga0501073_0070983_1567_1890 91
1565 3300049593 Ga0501077_0010172 Ga0501077_0010172_3427_3750 91
1566 3300049744 Ga0501083_0104019 Ga0501083_0104019_1386_1682 91
1567 3300049744 Ga0501083_0279902 Ga0501083_0279902_729_1055 91
1568 3300050508 nmdc:mga09592_390576_c1 nmdc:mga09592_390576_c1_767_1171 91
1569 3300050514 nmdc:mga08x19_84708_c1 nmdc:mga08x19_84708_c1_1509_1838 91
1570 3300053084 Ga0495595_0603146 Ga0495595_0603146_39_365 91
1571 3300053088 Ga0500644_0058089 Ga0500644_0058089_847_1149 91
1572 3300059506 Ga0587085_186149 Ga0587085_186149_11_319 91
1573 3300059511 Ga0587091_145094 Ga0587091_145094_163_471 91
1574 3300060353 Ga0501082_1600745 Ga0501082_1600745_27_350 91
1575 3300002863 Ga0006769J43182_106623 Ga0006769J43182_1066232 92
1576 3300002865 Ga0006761J43178_109203 Ga0006761J43178_1092032 92
1577 3300002868 Ga0006767J43181_103125 Ga0006767J43181_1031254 92
1578 3300002870 Ga0006763J43179_104103 Ga0006763J43179_1041034 92
1579 3300002872 Ga0006762J43184_103419 Ga0006762J43184_1034193 92
1580 3300003158 Ga0006760J45825_103232 Ga0006760J45825_1032322 92
1581 3300003161 Ga0006765J45826_111518 Ga0006765J45826_1115182 92
1582 3300003163 Ga0006759J45824_1006649 Ga0006759J45824_10066496 92
1583 3300003163 Ga0006759J45824_1119133 Ga0006759J45824_11191332 92
1584 3300003300 Ga0006758J48902_1008419 Ga0006758J48902_10084194 92
1585 3300003305 Ga0006770J48903_1037599 Ga0006770J48903_10375992 92
1586 3300003322 rootL2_10268495 rootL2_102684952 92
1587 3300003693 Ga0032354_1009872 Ga0032354_10098725 92
1588 3300005328 Ga0070676_10506729 Ga0070676_105067292 92
1589 3300005329 Ga0070683_101471944 Ga0070683_1014719442 92
1590 3300005338 Ga0068868_100021507 Ga0068868_1000215075 92
1591 3300005343 Ga0070687_100164833 Ga0070687_1001648332 92
1592 3300005367 Ga0070667_100417406 Ga0070667_1004174062 92
1593 3300005458 Ga0070681_11856747 Ga0070681_118567472 92
1594 3300005459 Ga0068867_100150220 Ga0068867_1001502201 92
1595 3300005539 Ga0068853_102213377 Ga0068853_1022133771 92
1596 3300005563 Ga0068855_101090663 Ga0068855_1010906632 92
1597 3300005615 Ga0070702_100159510 Ga0070702_1001595102 92
1598 3300005841 Ga0068863_101284882 Ga0068863_1012848822 92
1599 3300005843 Ga0068860_101666537 Ga0068860_1016665372 92
1600 3300006195 Ga0075366_10107452 Ga0075366_101074521 92
1601 3300009101 Ga0105247_10001485 Ga0105247_100014856 92
1602 3300009545 Ga0105237_10352289 Ga0105237_103522893 92
1603 3300013104 Ga0157370_11157073 Ga0157370_111570732 92
1604 3300013296 Ga0157374_10789257 Ga0157374_107892572 92
1605 3300013308 Ga0157375_13646614 Ga0157375_136466141 92
1606 3300014326 Ga0157380_10190356 Ga0157380_101903562 92
1607 3300021384 Ga0213876_10173681 Ga0213876_101736811 92
1608 3300025315 Ga0207697_10447666 Ga0207697_104476661 92
1609 3300025900 Ga0207710_10008638 Ga0207710_100086386 92
1610 3300025914 Ga0207671_10289752 Ga0207671_102897523 92
1611 3300025918 Ga0207662_10845977 Ga0207662_108459772 92
1612 3300025936 Ga0207670_10026569 Ga0207670_100265693 92
1613 3300025938 Ga0207704_10243547 Ga0207704_102435471 92
1614 3300025942 Ga0207689_10325135 Ga0207689_103251352 92
1615 3300026023 Ga0207677_10012660 Ga0207677_100126606 92
1616 3300026075 Ga0207708_11950481 Ga0207708_119504812 92
1617 3300026078 Ga0207702_10640752 Ga0207702_106407522 92
1618 3300026089 Ga0207648_10055432 Ga0207648_100554326 92
1619 3300026121 Ga0207683_10049254 Ga0207683_100492546 92
1620 3300028381 Ga0268264_11901796 Ga0268264_119017961 92
1621 3300031649 Ga0307514_10203628 Ga0307514_102036282 92
1622 3300031691 Ga0316579_10248300 Ga0316579_102483002 92
1623 3300031711 Ga0265314_10213682 Ga0265314_102136821 92
1624 3300031712 Ga0265342_10305228 Ga0265342_103052282 92
1625 3300031727 Ga0316576_10000922 Ga0316576_100009225 92
1626 3300031728 Ga0316578_10115389 Ga0316578_101153891 92
1627 3300031903 Ga0307407_11477147 Ga0307407_114771472 92
1628 3300031911 Ga0307412_10010183 Ga0307412_100101836 92
1629 3300033179 Ga0307507_10040401 Ga0307507_100404013 92
1630 3300036647 Ga0316582_0599031 Ga0316582_0599031_183_476 92
1631 3300036712 Ga0316584_0070475 Ga0316584_0070475_2208_2501 92
1632 3300037471 Ga0395905_0266979 Ga0395905_0266979_1241_1537 92
1633 3300039437 Ga0436365_0927876 Ga0436365_0927876_697_1047 92
1634 3300039450 Ga0436363_0403178 Ga0436363_0403178_1196_1549 92
1635 3300041451 Ga0451791_1562090 Ga0451791_1562090_391_720 92
1636 3300041453 Ga0451797_0056393 Ga0451797_0056393_2735_3064 92
1637 3300041459 Ga0451800_0695945 Ga0451800_0695945_151_480 92
1638 3300041459 Ga0451800_1503326 Ga0451800_1503326_26_364 92
1639 3300041486 Ga0451807_0693757 Ga0451807_0693757_701_1030 92
1640 3300041486 Ga0451807_2745794 Ga0451807_2745794_213_518 92
1641 3300041502 Ga0451846_30955 Ga0451846_30955_85_405 92
1642 3300044673 Ga0453683_0049198 Ga0453683_0049198_349_702 92
1643 3300044719 Ga0466971_0256961 Ga0466971_0256961_388_726 92
1644 3300046461 Ga0495641_0046289 Ga0495641_0046289_639_965 92
1645 3300048910 Ga0496107_1108531 Ga0496107_1108531_129_413 92
1646 3300049160 Ga0501304_023062 Ga0501304_023062_295_594 92
1647 3300049161 Ga0501305_053708 Ga0501305_053708_256_555 92
1648 3300049527 Ga0501311_040873 Ga0501311_040873_26_325 92
1649 3300049528 Ga0501312_012715 Ga0501312_012715_769_1068 92
1650 3300049571 Ga0501034_1103746 Ga0501034_1103746_75_401 92
1651 3300049581 Ga0501047_0758677 Ga0501047_0758677_172_507 92
1652 3300049586 Ga0501070_0973429 Ga0501070_0973429_37_396 92
1653 3300050493 nmdc:mga0k408_221757_c1 nmdc:mga0k408_221757_c1_72_377 92
1654 3300050512 nmdc:mga0n895_1522112_c1 nmdc:mga0n895_1522112_c1_27_383 92
1655 3300050512 nmdc:mga0n895_1572688_c1 nmdc:mga0n895_1572688_c1_169_573 92
1656 3300059421 Ga0590071_039425 Ga0590071_039425_607_930 92
1657 3300059424 Ga0590075_029860 Ga0590075_029860_863_1186 92
1658 3300059426 Ga0590077_007205 Ga0590077_007205_500_823 92
1659 3300059477 Ga0587084_079058 Ga0587084_079058_153_452 92
1660 3300059478 Ga0587093_026416 Ga0587093_026416_23_322 92
1661 3300059478 Ga0587093_059090 Ga0587093_059090_23_322 92
1662 3300059493 Ga0587077_007699 Ga0587077_007699_121_420 92
1663 3300059493 Ga0587077_200525 Ga0587077_200525_142_450 92
1664 3300059623 Ga0587101_010265 Ga0587101_010265_37_336 92
1665 3300059624 Ga0587109_002504 Ga0587109_002504_24_323 92
1666 3300059624 Ga0587109_164629 Ga0587109_164629_196_501 92
1667 3300059639 Ga0587062_007334 Ga0587062_007334_131_430 92
1668 3300059641 Ga0587068_009003 Ga0587068_009003_12_311 92
1669 3300059643 Ga0587072_005295 Ga0587072_005295_24_323 92
1670 3300059646 Ga0587078_048028 Ga0587078_048028_301_600 92
1671 3300059653 Ga0587108_024389 Ga0587108_024389_274_573 92
1672 3300059660 Ga0587124_003611 Ga0587124_003611_719_1018 92
1673 3300060346 Ga0587111_0020627 Ga0587111_0020627_24_323 92
1674 3300061719 Ga0466962_0058982 Ga0466962_0058982_1013_1351 92
1675 iso_pu_bacteria 8015556637 8015559905 92
1676 3300003163 Ga0006759J45824_1074785 Ga0006759J45824_10747852 93
1677 3300004799 Ga0058863_11971106 Ga0058863_119711061 93
1678 3300004800 Ga0058861_11886521 Ga0058861_118865212 93
1679 3300004803 Ga0058862_12878651 Ga0058862_128786512 93
1680 3300005327 Ga0070658_10074053 Ga0070658_100740537 93
1681 3300005329 Ga0070683_101127127 Ga0070683_1011271272 93
1682 3300005336 Ga0070680_100078067 Ga0070680_1000780672 93
1683 3300005336 Ga0070680_100311991 Ga0070680_1003119912 93
1684 3300005337 Ga0070682_100083544 Ga0070682_1000835442 93
1685 3300005337 Ga0070682_100334486 Ga0070682_1003344863 93
1686 3300005337 Ga0070682_101379448 Ga0070682_1013794482 93
1687 3300005340 Ga0070689_102017290 Ga0070689_1020172901 93
1688 3300005347 Ga0070668_100844572 Ga0070668_1008445722 93
1689 3300005347 Ga0070668_101476648 Ga0070668_1014766482 93
1690 3300005365 Ga0070688_100272178 Ga0070688_1002721782 93
1691 3300005434 Ga0070709_10317157 Ga0070709_103171573 93
1692 3300005441 Ga0070700_101224337 Ga0070700_1012243371 93
1693 3300005444 Ga0070694_100428657 Ga0070694_1004286572 93
1694 3300005455 Ga0070663_101560774 Ga0070663_1015607742 93
1695 3300005458 Ga0070681_10315185 Ga0070681_103151852 93
1696 3300005530 Ga0070679_100467057 Ga0070679_1004670572 93
1697 3300005530 Ga0070679_100492885 Ga0070679_1004928852 93
1698 3300005539 Ga0068853_100002850 Ga0068853_10000285024 93
1699 3300005539 Ga0068853_100732017 Ga0068853_1007320172 93
1700 3300005539 Ga0068853_101606880 Ga0068853_1016068801 93
1701 3300005544 Ga0070686_100016687 Ga0070686_1000166876 93
1702 3300005545 Ga0070695_100074248 Ga0070695_1000742482 93
1703 3300005546 Ga0070696_100043134 Ga0070696_1000431342 93
1704 3300005547 Ga0070693_101164234 Ga0070693_1011642341 93
1705 3300005563 Ga0068855_100000266 Ga0068855_10000026668 93
1706 3300005563 Ga0068855_100152247 Ga0068855_1001522475 93
1707 3300005563 Ga0068855_101317446 Ga0068855_1013174461 93
1708 3300005578 Ga0068854_100207776 Ga0068854_1002077763 93
1709 3300005614 Ga0068856_100501716 Ga0068856_1005017162 93
1710 3300005614 Ga0068856_101581582 Ga0068856_1015815822 93
1711 3300005614 Ga0068856_101595886 Ga0068856_1015958862 93
1712 3300005614 Ga0068856_101878950 Ga0068856_1018789502 93
1713 3300005616 Ga0068852_100817674 Ga0068852_1008176742 93
1714 3300005618 Ga0068864_100218441 Ga0068864_1002184412 93
1715 3300005719 Ga0068861_100234091 Ga0068861_1002340912 93
1716 3300005719 Ga0068861_101022611 Ga0068861_1010226111 93
1717 3300005841 Ga0068863_100720801 Ga0068863_1007208012 93
1718 3300005841 Ga0068863_100889396 Ga0068863_1008893962 93
1719 3300005843 Ga0068860_101044268 Ga0068860_1010442682 93
1720 3300006028 Ga0070717_10729257 Ga0070717_107292572 93
1721 3300006178 Ga0075367_10214038 Ga0075367_102140382 93
1722 3300006852 Ga0075433_10288233 Ga0075433_102882333 93
1723 3300006881 Ga0068865_100756534 Ga0068865_1007565342 93
1724 3300006931 Ga0097620_100379189 Ga0097620_1003791891 93
1725 3300007076 Ga0075435_100198784 Ga0075435_1001987843 93
1726 3300009093 Ga0105240_10000795 Ga0105240_100007956 93
1727 3300009094 Ga0111539_10699183 Ga0111539_106991832 93
1728 3300009094 Ga0111539_11734057 Ga0111539_117340571 93
1729 3300009098 Ga0105245_10057540 Ga0105245_100575404 93
1730 3300009174 Ga0105241_10174638 Ga0105241_101746382 93
1731 3300009545 Ga0105237_10002220 Ga0105237_1000222035 93
1732 3300009545 Ga0105237_10270358 Ga0105237_102703582 93
1733 3300009551 Ga0105238_10020343 Ga0105238_100203436 93
1734 3300009551 Ga0105238_10145915 Ga0105238_101459153 93
1735 3300009551 Ga0105238_10602342 Ga0105238_106023422 93
1736 3300009551 Ga0105238_10742030 Ga0105238_107420303 93
1737 3300013102 Ga0157371_10429515 Ga0157371_104295151 93
1738 3300013104 Ga0157370_11311568 Ga0157370_113115681 93
1739 3300013296 Ga0157374_10054827 Ga0157374_100548274 93
1740 3300014968 Ga0157379_10694934 Ga0157379_106949341 93
1741 3300014969 Ga0157376_10607551 Ga0157376_106075512 93
1742 3300025898 Ga0207692_10279642 Ga0207692_102796422 93
1743 3300025909 Ga0207705_10026045 Ga0207705_100260454 93
1744 3300025912 Ga0207707_10379438 Ga0207707_103794382 93
1745 3300025913 Ga0207695_10000834 Ga0207695_1000083430 93
1746 3300025914 Ga0207671_10000510 Ga0207671_1000051028 93
1747 3300025914 Ga0207671_10006782 Ga0207671_1000678215 93
1748 3300025914 Ga0207671_10288856 Ga0207671_102888562 93
1749 3300025914 Ga0207671_11133058 Ga0207671_111330581 93
1750 3300025917 Ga0207660_11055973 Ga0207660_110559732 93
1751 3300025919 Ga0207657_10513723 Ga0207657_105137233 93
1752 3300025921 Ga0207652_10211975 Ga0207652_102119752 93
1753 3300025921 Ga0207652_10245543 Ga0207652_102455432 93
1754 3300025924 Ga0207694_10027389 Ga0207694_1002738911 93
1755 3300025924 Ga0207694_10344284 Ga0207694_103442842 93
1756 3300025924 Ga0207694_10864648 Ga0207694_108646482 93
1757 3300025927 Ga0207687_10021304 Ga0207687_100213044 93
1758 3300025927 Ga0207687_10146863 Ga0207687_101468632 93
1759 3300025936 Ga0207670_10000022 Ga0207670_10000022132 93
1760 3300025936 Ga0207670_11648309 Ga0207670_116483092 93
1761 3300025949 Ga0207667_10004297 Ga0207667_1000429715 93
1762 3300025949 Ga0207667_10795590 Ga0207667_107955902 93
1763 3300025961 Ga0207712_11820891 Ga0207712_118208912 93
1764 3300025972 Ga0207668_11047154 Ga0207668_110471542 93
1765 3300025972 Ga0207668_11523470 Ga0207668_115234702 93
1766 3300025981 Ga0207640_10194683 Ga0207640_101946833 93
1767 3300026023 Ga0207677_11274741 Ga0207677_112747412 93
1768 3300026041 Ga0207639_10005667 Ga0207639_1000566714 93
1769 3300026075 Ga0207708_11249567 Ga0207708_112495672 93
1770 3300026078 Ga0207702_10478378 Ga0207702_104783782 93
1771 3300026078 Ga0207702_11033834 Ga0207702_110338342 93
1772 3300026095 Ga0207676_11470826 Ga0207676_114708262 93
1773 3300026116 Ga0207674_10208980 Ga0207674_102089802 93
1774 3300026118 Ga0207675_100367651 Ga0207675_1003676512 93
1775 3300026118 Ga0207675_100374906 Ga0207675_1003749062 93
1776 3300026118 Ga0207675_102138796 Ga0207675_1021387961 93
1777 3300026142 Ga0207698_10067772 Ga0207698_100677724 93
1778 3300028381 Ga0268264_10618502 Ga0268264_106185023 93
1779 3300028381 Ga0268264_11048936 Ga0268264_110489362 93
1780 3300028563 Ga0265319_1029049 Ga0265319_10290494 93
1781 3300028563 Ga0265319_1034208 Ga0265319_10342082 93
1782 3300028573 Ga0265334_10095022 Ga0265334_100950222 93
1783 3300028577 Ga0265318_10000169 Ga0265318_100001696 93
1784 3300028577 Ga0265318_10000384 Ga0265318_1000038414 93
1785 3300028653 Ga0265323_10018664 Ga0265323_100186645 93
1786 3300028666 Ga0265336_10165819 Ga0265336_101658192 93
1787 3300028800 Ga0265338_10001810 Ga0265338_1000181012 93
1788 3300028800 Ga0265338_10161608 Ga0265338_101616083 93
1789 3300031235 Ga0265330_10000068 Ga0265330_1000006895 93
1790 3300031235 Ga0265330_10003264 Ga0265330_1000326418 93
1791 3300031235 Ga0265330_10009350 Ga0265330_100093507 93
1792 3300031238 Ga0265332_10001607 Ga0265332_100016076 93
1793 3300031238 Ga0265332_10002023 Ga0265332_100020232 93
1794 3300031238 Ga0265332_10057168 Ga0265332_100571682 93
1795 3300031238 Ga0265332_10105510 Ga0265332_101055102 93
1796 3300031239 Ga0265328_10000172 Ga0265328_1000017214 93
1797 3300031239 Ga0265328_10000528 Ga0265328_1000052823 93
1798 3300031239 Ga0265328_10004363 Ga0265328_100043634 93
1799 3300031240 Ga0265320_10000069 Ga0265320_100000696 93
1800 3300031240 Ga0265320_10005252 Ga0265320_100052526 93
1801 3300031240 Ga0265320_10009684 Ga0265320_100096841 93
1802 3300031240 Ga0265320_10017635 Ga0265320_100176353 93
1803 3300031241 Ga0265325_10160384 Ga0265325_101603842 93
1804 3300031242 Ga0265329_10000733 Ga0265329_1000073327 93
1805 3300031242 Ga0265329_10018240 Ga0265329_100182403 93
1806 3300031249 Ga0265339_10006835 Ga0265339_1000683512 93
1807 3300031249 Ga0265339_10022740 Ga0265339_100227405 93
1808 3300031249 Ga0265339_10032693 Ga0265339_100326933 93
1809 3300031249 Ga0265339_10104746 Ga0265339_101047462 93
1810 3300031250 Ga0265331_10000149 Ga0265331_1000014995 93
1811 3300031250 Ga0265331_10001210 Ga0265331_1000121031 93
1812 3300031344 Ga0265316_10015836 Ga0265316_1001583610 93
1813 3300031344 Ga0265316_10058086 Ga0265316_100580865 93
1814 3300031456 Ga0307513_10125501 Ga0307513_101255012 93
1815 3300031595 Ga0265313_10006146 Ga0265313_100061469 93
1816 3300031711 Ga0265314_10000191 Ga0265314_1000019196 93
1817 3300031711 Ga0265314_10001397 Ga0265314_1000139725 93
1818 3300031711 Ga0265314_10012182 Ga0265314_1001218212 93
1819 3300031712 Ga0265342_10001254 Ga0265342_100012546 93
1820 3300031712 Ga0265342_10001889 Ga0265342_100018896 93
1821 3300031712 Ga0265342_10002136 Ga0265342_100021366 93
1822 3300031712 Ga0265342_10028395 Ga0265342_100283954 93
1823 3300031712 Ga0265342_10048044 Ga0265342_100480442 93
1824 3300031727 Ga0316576_10051018 Ga0316576_100510182 93
1825 3300031727 Ga0316576_10212171 Ga0316576_102121712 93
1826 3300031727 Ga0316576_11254420 Ga0316576_112544202 93
1827 3300031728 Ga0316578_10371592 Ga0316578_103715921 93
1828 3300031730 Ga0307516_10069484 Ga0307516_100694841 93
1829 3300031852 Ga0307410_10939481 Ga0307410_109394811 93
1830 3300031995 Ga0307409_102008334 Ga0307409_1020083342 93
1831 3300032126 Ga0307415_102000532 Ga0307415_1020005321 93
1832 3300033528 Ga0316588_1014683 Ga0316588_10146832 93
1833 3300035083 Ga0373926_0020427 Ga0373926_0020427_1260_1595 93
1834 3300035086 Ga0373934_0015071 Ga0373934_0015071_1232_1543 93
1835 3300035116 Ga0373945_0357091 Ga0373945_0357091_245_547 93
1836 3300035120 Ga0373957_0037107 Ga0373957_0037107_1007_1327 93
1837 3300035172 Ga0373955_0596255 Ga0373955_0596255_154_465 93
1838 3300035692 Ga0373935_0784881 Ga0373935_0784881_249_560 93
1839 3300035724 Ga0373933_0001189 Ga0373933_0001189_2416_2727 93
1840 3300036457 Ga0265778_024947 Ga0265778_024947_357_665 93
1841 3300036457 Ga0265778_027593 Ga0265778_027593_249_557 93
1842 3300037068 Ga0373925_0428104 Ga0373925_0428104_329_649 93
1843 3300037471 Ga0395905_0297762 Ga0395905_0297762_269_571 93
1844 3300037471 Ga0395905_0880234 Ga0395905_0880234_65_373 93
1845 3300039437 Ga0436365_0180274 Ga0436365_0180274_509_811 93
1846 3300039438 Ga0436360_1174196 Ga0436360_1174196_554_862 93
1847 3300039447 Ga0436361_1182130 Ga0436361_1182130_257_562 93
1848 3300041404 Ga0439436_0243829 Ga0439436_0243829_160_456 93
1849 3300041455 Ga0451801_01133 Ga0451801_01133_571_909 93
1850 3300041463 Ga0451804_1085934 Ga0451804_1085934_439_738 93
1851 3300041486 Ga0451807_1173163 Ga0451807_1173163_77_415 93
1852 3300041486 Ga0451807_2060165 Ga0451807_2060165_64_372 93
1853 3300041491 Ga0451833_1141144 Ga0451833_1141144_187_525 93
1854 3300041501 Ga0451845_0486343 Ga0451845_0486343_71_379 93
1855 3300041512 Ga0451853_2606472 Ga0451853_2606472_324_656 93
1856 3300042004 Ga0439445_0021393 Ga0439445_0021393_51_359 93
1857 3300042004 Ga0439445_0098728 Ga0439445_0098728_221_550 93
1858 3300042015 Ga0439462_0163355 Ga0439462_0163355_89_385 93
1859 3300044706 Ga0466964_0886054 Ga0466964_0886054_165_473 93
1860 3300044735 Ga0466968_0174492 Ga0466968_0174492_459_797 93
1861 3300044901 Ga0466960_0065709 Ga0466960_0065709_891_1229 93
1862 3300044901 Ga0466960_0104664 Ga0466960_0104664_1127_1426 93
1863 3300045051 Ga0451576_0937531 Ga0451576_0937531_257_565 93
1864 3300045051 Ga0451576_2742422 Ga0451576_2742422_125_433 93
1865 3300046455 Ga0495603_0127891 Ga0495603_0127891_539_859 93
1866 3300048903 Ga0496100_0788657 Ga0496100_0788657_417_716 93
1867 3300048907 Ga0496104_0036226 Ga0496104_0036226_127_426 93
1868 3300048910 Ga0496107_0361610 Ga0496107_0361610_739_1038 93
1869 3300048910 Ga0496107_0833397 Ga0496107_0833397_284_616 93
1870 3300048913 Ga0496110_0740549 Ga0496110_0740549_346_645 93
1871 3300048917 Ga0496114_0040273 Ga0496114_0040273_978_1277 93
1872 3300048922 Ga0496119_0151411 Ga0496119_0151411_77_373 93
1873 3300049130 Ga0501310_038155 Ga0501310_038155_41_349 93
1874 3300049529 Ga0501313_041211 Ga0501313_041211_12_350 93
1875 3300049530 Ga0501314_042035 Ga0501314_042035_187_525 93
1876 3300049531 Ga0501315_079169 Ga0501315_079169_206_544 93
1877 3300049583 Ga0501067_0031948 Ga0501067_0031948_40_384 93
1878 3300049583 Ga0501067_0331764 Ga0501067_0331764_89_427 93
1879 3300049584 Ga0501068_0838638 Ga0501068_0838638_215_550 93
1880 3300049586 Ga0501070_0594122 Ga0501070_0594122_302_640 93
1881 3300049741 Ga0501079_0644498 Ga0501079_0644498_73_438 93
1882 3300049742 Ga0501080_0080476 Ga0501080_0080476_406_765 93
1883 3300049742 Ga0501080_1005227 Ga0501080_1005227_141_506 93
1884 3300049822 Ga0501035_0223231 Ga0501035_0223231_832_1167 93
1885 3300049823 Ga0501044_1087961 Ga0501044_1087961_40_375 93
1886 3300049824 Ga0501045_0060997 Ga0501045_0060997_2169_2528 93
1887 3300050511 nmdc:mga08y16_1232385_c1 nmdc:mga08y16_1232385_c1_60_374 93
1888 3300050511 nmdc:mga08y16_602566_c1 nmdc:mga08y16_602566_c1_701_1093 93
1889 3300050513 nmdc:mga0rr50_115823_c1 nmdc:mga0rr50_115823_c1_1361_1663 93
1890 3300050515 nmdc:mga0a205_213946_c1 nmdc:mga0a205_213946_c1_1126_1428 93
1891 3300059477 Ga0587084_074894 Ga0587084_074894_175_483 93
1892 3300059477 Ga0587084_144953 Ga0587084_144953_150_458 93
1893 3300059507 Ga0587086_079793 Ga0587086_079793_67_375 93
1894 3300059512 Ga0587092_075814 Ga0587092_075814_207_515 93
1895 3300059513 Ga0587094_069773 Ga0587094_069773_177_539 93
1896 3300059623 Ga0587101_028908 Ga0587101_028908_364_672 93
1897 3300059624 Ga0587109_044517 Ga0587109_044517_502_798 93
1898 3300059624 Ga0587109_077708 Ga0587109_077708_280_588 93
1899 3300059627 Ga0587117_087623 Ga0587117_087623_132_440 93
1900 3300059639 Ga0587062_072074 Ga0587062_072074_280_603 93
1901 3300059639 Ga0587062_079365 Ga0587062_079365_154_462 93
1902 3300059641 Ga0587068_008671 Ga0587068_008671_1033_1341 93
1903 3300059645 Ga0587076_065541 Ga0587076_065541_373_681 93
1904 3300059654 Ga0587110_022418 Ga0587110_022418_312_674 93
1905 3300059658 Ga0587119_037497 Ga0587119_037497_235_543 93
1906 3300059660 Ga0587124_036624 Ga0587124_036624_129_437 93
1907 3300060346 Ga0587111_0071398 Ga0587111_0071398_204_500 93
1908 3300060346 Ga0587111_0090330 Ga0587111_0090330_353_661 93
1909 3300060353 Ga0501082_0047556 Ga0501082_0047556_1718_2062 93
1910 3300003320 rootH2_10053580 rootH2_100535803 94
1911 3300005333 Ga0070677_10107166 Ga0070677_101071661 94
1912 3300005343 Ga0070687_100366271 Ga0070687_1003662711 94
1913 3300005441 Ga0070700_100821894 Ga0070700_1008218941 94
1914 3300005547 Ga0070693_100704176 Ga0070693_1007041762 94
1915 3300005577 Ga0068857_101384140 Ga0068857_1013841402 94
1916 3300005614 Ga0068856_100009234 Ga0068856_10000923415 94
1917 3300005842 Ga0068858_101825677 Ga0068858_1018256771 94
1918 3300005844 Ga0068862_100475543 Ga0068862_1004755432 94
1919 3300006195 Ga0075366_10035947 Ga0075366_100359473 94
1920 3300006358 Ga0068871_100549564 Ga0068871_1005495642 94
1921 3300006844 Ga0075428_102358057 Ga0075428_1023580572 94
1922 3300009093 Ga0105240_11557839 Ga0105240_115578392 94
1923 3300009093 Ga0105240_12463727 Ga0105240_124637271 94
1924 3300009094 Ga0111539_10703475 Ga0111539_107034752 94
1925 3300009098 Ga0105245_10236797 Ga0105245_102367972 94
1926 3300009098 Ga0105245_12778195 Ga0105245_127781951 94
1927 3300009174 Ga0105241_10047989 Ga0105241_100479892 94
1928 3300009174 Ga0105241_11297195 Ga0105241_112971951 94
1929 3300009545 Ga0105237_11267325 Ga0105237_112673252 94
1930 3300014325 Ga0163163_10517871 Ga0163163_105178712 94
1931 3300014497 Ga0182008_10398681 Ga0182008_103986812 94
1932 3300014968 Ga0157379_11561156 Ga0157379_115611562 94
1933 3300014969 Ga0157376_10268789 Ga0157376_102687894 94
1934 3300014969 Ga0157376_10755899 Ga0157376_107558992 94
1935 3300017792 Ga0163161_10896391 Ga0163161_108963912 94
1936 3300025893 Ga0207682_10051864 Ga0207682_100518643 94
1937 3300025911 Ga0207654_10027363 Ga0207654_100273636 94
1938 3300025927 Ga0207687_10002323 Ga0207687_100023233 94
1939 3300026035 Ga0207703_11688373 Ga0207703_116883732 94
1940 3300026075 Ga0207708_10593322 Ga0207708_105933222 94
1941 3300026075 Ga0207708_11794718 Ga0207708_117947182 94
1942 3300026078 Ga0207702_10001471 Ga0207702_1000147124 94
1943 3300026116 Ga0207674_11104304 Ga0207674_111043042 94
1944 3300026142 Ga0207698_12654032 Ga0207698_126540321 94
1945 3300028380 Ga0268265_10607160 Ga0268265_106071602 94
1946 3300031733 Ga0316577_10391165 Ga0316577_103911651 94
1947 3300033179 Ga0307507_10507944 Ga0307507_105079442 94
1948 3300035111 Ga0373923_0176142 Ga0373923_0176142_324_629 94
1949 3300035119 Ga0373956_0154748 Ga0373956_0154748_551_874 94
1950 3300035119 Ga0373956_0341170 Ga0373956_0341170_265_570 94
1951 3300035692 Ga0373935_0830032 Ga0373935_0830032_115_420 94
1952 3300035724 Ga0373933_0031586 Ga0373933_0031586_1884_2234 94
1953 3300036401 Ga0373937_0096824 Ga0373937_0096824_1804_2127 94
1954 3300036647 Ga0316582_0214065 Ga0316582_0214065_473_781 94
1955 3300036712 Ga0316584_0305563 Ga0316584_0305563_659_967 94
1956 3300039447 Ga0436361_1038105 Ga0436361_1038105_96_446 94
1957 3300039453 Ga0436362_0070508 Ga0436362_0070508_107_466 94
1958 3300041459 Ga0451800_0812420 Ga0451800_0812420_342_665 94
1959 3300041494 Ga0451837_0896719 Ga0451837_0896719_296_619 94
1960 3300041507 Ga0451851_0775624 Ga0451851_0775624_180_503 94
1961 3300041512 Ga0451853_1677720 Ga0451853_1677720_2268_2591 94
1962 3300044712 Ga0453684_0797789 Ga0453684_0797789_309_599 94
1963 3300044765 Ga0466970_0149593 Ga0466970_0149593_28_339 94
1964 3300045049 Ga0466959_1091325 Ga0466959_1091325_119_439 94
1965 3300048913 Ga0496110_0330799 Ga0496110_0330799_60_353 94
1966 3300049581 Ga0501047_0096678 Ga0501047_0096678_26_325 94
1967 3300049583 Ga0501067_0089579 Ga0501067_0089579_78_398 94
1968 3300049586 Ga0501070_0662402 Ga0501070_0662402_102_425 94
1969 3300050493 nmdc:mga0k408_8810_c1 nmdc:mga0k408_8810_c1_965_1285 94
1970 3300050511 nmdc:mga08y16_772704_c1 nmdc:mga08y16_772704_c1_220_570 94
1971 3300050512 nmdc:mga0n895_2042959_c1 nmdc:mga0n895_2042959_c1_18_329 94
1972 3300059477 Ga0587084_066351 Ga0587084_066351_236_547 94
1973 3300059506 Ga0587085_082509 Ga0587085_082509_192_503 94
1974 3300059512 Ga0587092_097792 Ga0587092_097792_250_561 94
1975 3300059624 Ga0587109_094041 Ga0587109_094041_193_504 94
1976 3300059641 Ga0587068_169082 Ga0587068_169082_154_465 94
1977 3300060346 Ga0587111_0093124 Ga0587111_0093124_409_729 94
1978 3300003163 Ga0006759J45824_1057093 Ga0006759J45824_10570932 95
1979 3300003693 Ga0032354_1064715 Ga0032354_10647152 95
1980 3300004785 Ga0058858_1357820 Ga0058858_13578201 95
1981 3300004798 Ga0058859_11690238 Ga0058859_116902382 95
1982 3300005331 Ga0070670_100389223 Ga0070670_1003892232 95
1983 3300005337 Ga0070682_100065479 Ga0070682_1000654792 95
1984 3300005338 Ga0068868_100734323 Ga0068868_1007343232 95
1985 3300005455 Ga0070663_101568088 Ga0070663_1015680882 95
1986 3300005456 Ga0070678_100369055 Ga0070678_1003690551 95
1987 3300005457 Ga0070662_100153489 Ga0070662_1001534892 95
1988 3300005467 Ga0070706_100392904 Ga0070706_1003929041 95
1989 3300005468 Ga0070707_100076529 Ga0070707_1000765293 95
1990 3300005543 Ga0070672_100180803 Ga0070672_1001808033 95
1991 3300005543 Ga0070672_100486106 Ga0070672_1004861062 95
1992 3300005547 Ga0070693_100901271 Ga0070693_1009012712 95
1993 3300005547 Ga0070693_100961721 Ga0070693_1009617211 95
1994 3300005549 Ga0070704_100310320 Ga0070704_1003103202 95
1995 3300005563 Ga0068855_100102876 Ga0068855_1001028764 95
1996 3300005614 Ga0068856_100058503 Ga0068856_1000585035 95
1997 3300005615 Ga0070702_101303169 Ga0070702_1013031691 95
1998 3300005616 Ga0068852_102689900 Ga0068852_1026899002 95
1999 3300005618 Ga0068864_100614562 Ga0068864_1006145622 95
2000 3300005618 Ga0068864_101908929 Ga0068864_1019089291 95
2001 3300006237 Ga0097621_100575850 Ga0097621_1005758502 95
2002 3300006844 Ga0075428_101644800 Ga0075428_1016448002 95
2003 3300009092 Ga0105250_10260048 Ga0105250_102600482 95
2004 3300009094 Ga0111539_10140381 Ga0111539_101403817 95
2005 3300009094 Ga0111539_10156432 Ga0111539_101564326 95
2006 3300009176 Ga0105242_12080104 Ga0105242_120801041 95
2007 3300010375 Ga0105239_10537215 Ga0105239_105372153 95
2008 3300013100 Ga0157373_11388550 Ga0157373_113885501 95
2009 3300013102 Ga0157371_10077470 Ga0157371_100774704 95
2010 3300013307 Ga0157372_10161422 Ga0157372_101614223 95
2011 3300013307 Ga0157372_10352103 Ga0157372_103521032 95
2012 3300014969 Ga0157376_11362533 Ga0157376_113625332 95
2013 3300017792 Ga0163161_10262539 Ga0163161_102625391 95
2014 3300025910 Ga0207684_10234957 Ga0207684_102349573 95
2015 3300025922 Ga0207646_10094365 Ga0207646_100943654 95
2016 3300025925 Ga0207650_11503519 Ga0207650_115035191 95
2017 3300025933 Ga0207706_10231614 Ga0207706_102316142 95
2018 3300025939 Ga0207665_10541432 Ga0207665_105414322 95
2019 3300025940 Ga0207691_10081581 Ga0207691_100815811 95
2020 3300025949 Ga0207667_10000612 Ga0207667_1000061249 95
2021 3300026075 Ga0207708_11036395 Ga0207708_110363951 95
2022 3300026078 Ga0207702_10081498 Ga0207702_100814981 95
2023 3300026088 Ga0207641_11084005 Ga0207641_110840052 95
2024 3300026088 Ga0207641_11433694 Ga0207641_114336941 95
2025 3300026095 Ga0207676_10521060 Ga0207676_105210603 95
2026 3300026095 Ga0207676_12554022 Ga0207676_125540221 95
2027 3300026116 Ga0207674_10431870 Ga0207674_104318701 95
2028 3300026121 Ga0207683_10404348 Ga0207683_104043481 95
2029 3300028556 Ga0265337_1014346 Ga0265337_10143462 95
2030 3300028573 Ga0265334_10001615 Ga0265334_1000161518 95
2031 3300028794 Ga0307515_10228948 Ga0307515_102289482 95
2032 3300028800 Ga0265338_10000401 Ga0265338_1000040149 95
2033 3300031240 Ga0265320_10028549 Ga0265320_100285491 95
2034 3300031249 Ga0265339_10034119 Ga0265339_100341192 95
2035 3300031456 Ga0307513_10070133 Ga0307513_100701333 95
2036 3300031456 Ga0307513_10477424 Ga0307513_104774241 95
2037 3300031711 Ga0265314_10046055 Ga0265314_100460554 95
2038 3300031712 Ga0265342_10240266 Ga0265342_102402661 95
2039 3300035692 Ga0373935_0721045 Ga0373935_0721045_232_537 95
2040 3300035692 Ga0373935_0910137 Ga0373935_0910137_186_488 95
2041 3300036401 Ga0373937_0494396 Ga0373937_0494396_442_744 95
2042 3300036401 Ga0373937_0507144 Ga0373937_0507144_30_347 95
2043 3300041451 Ga0451791_0325319 Ga0451791_0325319_332_628 95
2044 3300041452 Ga0451793_1461807 Ga0451793_1461807_633_953 95
2045 3300042461 Ga0439460_0018350 Ga0439460_0018350_1226_1531 95
2046 3300046517 Ga0495630_0783295 Ga0495630_0783295_50_355 95
2047 3300046642 Ga0495634_0334146 Ga0495634_0334146_466_771 95
2048 3300046675 Ga0495657_0802964 Ga0495657_0802964_204_509 95
2049 3300047321 Ga0495676_0520697 Ga0495676_0520697_78_380 95
2050 3300049586 Ga0501070_0091026 Ga0501070_0091026_1962_2324 95
2051 3300050493 nmdc:mga0k408_135320_c1 nmdc:mga0k408_135320_c1_92_421 95
2052 3300050507 nmdc:mga05p37_1009362_c1 nmdc:mga05p37_1009362_c1_200_520 95
2053 3300050511 nmdc:mga08y16_116437_c1 nmdc:mga08y16_116437_c1_2208_2510 95
2054 3300053120 Ga0500597_235982 Ga0500597_235982_393_719 95
2055 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00006090 96
2056 3300005289 Ga0065704_10070132 Ga0065704_100701321337 96
2057 3300005435 Ga0070714_101834831 Ga0070714_1018348312 96
2058 3300005614 Ga0068856_100672486 Ga0068856_1006724862 96
2059 3300006880 Ga0075429_100099513 Ga0075429_1000995134 96
2060 3300009093 Ga0105240_11020127 Ga0105240_110201272 96
2061 3300010375 Ga0105239_10026360 Ga0105239_100263602 96
2062 3300014968 Ga0157379_12166507 Ga0157379_121665072 96
2063 3300025929 Ga0207664_11461454 Ga0207664_114614541 96
2064 3300028573 Ga0265334_10008474 Ga0265334_100084746 96
2065 3300028577 Ga0265318_10123633 Ga0265318_101236332 96
2066 3300031235 Ga0265330_10067893 Ga0265330_100678932 96
2067 3300031239 Ga0265328_10033026 Ga0265328_100330263 96
2068 3300031240 Ga0265320_10154304 Ga0265320_101543041 96
2069 3300031247 Ga0265340_10049006 Ga0265340_100490062 96
2070 3300031250 Ga0265331_10163164 Ga0265331_101631641 96
2071 3300031344 Ga0265316_10055970 Ga0265316_100559704 96
2072 3300033529 Ga0316587_1108979 Ga0316587_11089792 96
2073 3300035398 Ga0316574_0097224 Ga0316574_0097224_1496_1801 96
2074 3300037418 Ga0395900_0018609 Ga0395900_0018609_6428_6721 96
2075 3300037471 Ga0395905_0000275 Ga0395905_0000275_32332_32625 96
2076 3300044673 Ga0453683_0010210 Ga0453683_0010210_4598_4903 96
2077 3300044673 Ga0453683_0112088 Ga0453683_0112088_83_391 96
2078 3300046615 Ga0495656_0000397 Ga0495656_0000397_3819_4109 96
2079 3300047318 Ga0495636_0000893 Ga0495636_0000893_4982_5272 96
2080 3300048090 Ga0495615_0028731 Ga0495615_0028731_184_474 96
2081 3300048905 Ga0496102_0177413 Ga0496102_0177413_722_1021 96
2082 3300048913 Ga0496110_0000091 Ga0496110_0000091_14014_14304 96
2083 3300048913 Ga0496110_0015589 Ga0496110_0015589_4799_5089 96
2084 3300048914 Ga0496111_0250511 Ga0496111_0250511_304_594 96
2085 3300048914 Ga0496111_0766148 Ga0496111_0766148_70_360 96
2086 3300048924 Ga0496121_0268201 Ga0496121_0268201_340_633 96
2087 3300048925 Ga0496122_0289706 Ga0496122_0289706_106_396 96
2088 3300048925 Ga0496122_0291225 Ga0496122_0291225_552_845 96
2089 3300048927 Ga0496124_0000001 Ga0496124_0000001_100610_100900 96
2090 3300048929 Ga0496126_0176695 Ga0496126_0176695_260_553 96
2091 3300048929 Ga0496126_0224666 Ga0496126_0224666_1252_1542 96
2092 3300049522 Ga0501299_023171 Ga0501299_023171_263_568 96
2093 3300049568 Ga0501031_0589400 Ga0501031_0589400_163_462 96
2094 3300049569 Ga0501032_0000374 Ga0501032_0000374_24550_24849 96
2095 3300049571 Ga0501034_0040078 Ga0501034_0040078_2780_3079 96
2096 3300049571 Ga0501034_0323261 Ga0501034_0323261_442_741 96
2097 3300049572 Ga0501036_0044234 Ga0501036_0044234_662_961 96
2098 3300049573 Ga0501037_0000862 Ga0501037_0000862_11217_11516 96
2099 3300049574 Ga0501038_0054804 Ga0501038_0054804_156_455 96
2100 3300049574 Ga0501038_0059385 Ga0501038_0059385_2152_2451 96
2101 3300049575 Ga0501039_0131878 Ga0501039_0131878_823_1122 96
2102 3300049579 Ga0501043_0004627 Ga0501043_0004627_6676_6975 96
2103 3300049581 Ga0501047_0114571 Ga0501047_0114571_1465_1764 96
2104 3300050508 nmdc:mga09592_68918_c1 nmdc:mga09592_68918_c1_472_777 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

85

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.94 12 76
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9266 12 76
6ha8-assembly1.cif.gz_s cryo-em structure of the abcf protein vmlr bound to the bacillus subtilis ribosome 0.9215 4 80
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9142 8 83
7qv3-assembly1.cif.gz_s bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9109 4 80
ID Description Score Start End Superfamily
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8825 4 80 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8812 3 80 3.30.860.10
3huyS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8785 4 80 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8745 7 83 3.30.860.10
4tpaS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.871 3 80 3.30.860.10
ID Description Score Start End GO Terms
AF-Q36807-F1-model_v4 Small ribosomal subunit protein uS19c 0.9105 1 80 GO:0003735
GO:0006412
GO:0009507
GO:0015935
GO:0019843
AF-A0A5N8YY27-F1-model_v4 Small ribosomal subunit protein uS19 0.9041 1 83 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1F4QGH0-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9037 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-Q36807-F1-model_v4 Small ribosomal subunit protein uS19c 0.8997 1 80 GO:0003735
GO:0006412
GO:0009507
GO:0015935
GO:0019843
AF-A0A4Q5X3G4-F1-model_v4 Small ribosomal subunit protein uS19 0.8992 2 84 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
81.96 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map