F496223

General Info

Members Datasets Scaffolds Average Seq Length
1997 1468 933 436

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1022270|Ga0055524_10222701
Length 519
Sequence MSTGFFGDIAKIKYEGPDSTNPLAFRHYNKDEVVLGKRMEDHLRFAVAYWHTFVWPGGDPFGGQTFERPWFKDTMDAAKLKADVAFEFFDLLGVPFYCFHDADVRPEGKSFAENTKNLNEIVDHFEKKQAETGVNLLWGTANLFSNRRYMSGAATNPDPDVFAFAAATVKTCLDATKRLGGQNYVLWGGREGYETLLNTDLKRELDQLGRFVNLVVEYKHKIGFKGAILIEPKPQEPTKHQYDYDVATVYGFLKNYGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRNDYQSGWDTDQFPNNVPEMALAYYQVLAGGGFKTGGTNFDAKLRRQSIDPEDLLIGHIGGMDCCARGLKAAAKMIEDKALSAPLNQRYAGWQVPEAKKMLDGGFSLEEIEAWVLKSDLNPQPKSGKQELLENVVNRYVXALSRGCSRRPGLSGPSVCDDCVVPARQVGLPHEIDYKSLGNLRLRQLPPVKNLLALAPATFQVRQLWRKQGAIVPPCRRLTG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
6 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
7 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
8 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
9 2509276019 Ensifer aridi TW10 Isolate Nodule
10 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
11 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
12 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
13 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
14 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
15 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
16 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
17 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
18 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
19 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
20 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
21 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
22 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
23 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
24 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
25 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
26 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
27 2512875024 Mesorhizobium loti R88b Isolate Nodule
28 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
29 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
30 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
31 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
32 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
33 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
34 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
35 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
36 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
37 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
38 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
39 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
40 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
41 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
42 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
43 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
44 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
45 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
46 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
47 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
48 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
49 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
50 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
51 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
52 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
53 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
54 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
55 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
56 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
57 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
58 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
59 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
60 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
61 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
62 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
63 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
64 2516143018 Ensifer sp. BR816 Isolate Nodule
65 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
66 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
67 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
68 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
69 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
70 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
71 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
72 2519899620 Rhizobium sp. Pop5 Isolate Nodule
73 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
74 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
75 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
76 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
77 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
78 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
79 2534681786 Brucella suis 92/29 Isolate Unclassified
80 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
81 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
82 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
83 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
84 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
85 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
86 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
87 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
88 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
89 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
90 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
91 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
92 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
93 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
94 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
95 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
96 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
97 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
98 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
99 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
100 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
101 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
102 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
103 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
104 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
105 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
106 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
107 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
108 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
109 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
110 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
111 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
112 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
113 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
114 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
115 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
116 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
117 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
118 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
119 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
120 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
121 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
122 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
123 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
124 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
125 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
126 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
127 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
128 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
129 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
130 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
131 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
132 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
133 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
134 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
135 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
136 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
137 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
138 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
139 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
140 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
141 2643221557 Ensifer sp. Root558 Isolate Unclassified
142 2643221558 Rhizobium sp. Root149 Isolate Unclassified
143 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
144 2643221568 Rhizobium sp. Root564 Isolate Unclassified
145 2643221580 Devosia sp. Root635 Isolate Unclassified
146 2643221582 Rhizobium sp. Root651 Isolate Unclassified
147 2643221591 Devosia sp. Root685 Isolate Unclassified
148 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
149 2643221599 Rhizobium sp. Root708 Isolate Unclassified
150 2643221607 Rhizobium sp. Root73 Isolate Unclassified
151 2643221610 Ensifer sp. Root74 Isolate Unclassified
152 2643221618 Ensifer sp. Root231 Isolate Unclassified
153 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
154 2643221626 Ensifer sp. Root31 Isolate Unclassified
155 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
156 2643221629 Devosia sp. Root105 Isolate Unclassified
157 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
158 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
159 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
160 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
161 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
162 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
163 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
164 2643221655 Ensifer sp. Root1252 Isolate Unclassified
165 2643221659 Ensifer sp. Root127 Isolate Unclassified
166 2643221662 Devosia sp. Root413D1 Isolate Unclassified
167 2643221668 Ensifer sp. Root423 Isolate Unclassified
168 2643221674 Devosia sp. Root436 Isolate Unclassified
169 2643221675 Ensifer sp. Root1298 Isolate Unclassified
170 2643221680 Ensifer sp. Root1312 Isolate Unclassified
171 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
172 2643221688 Rhizobium sp. Root482 Isolate Unclassified
173 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
174 2643221693 Rhizobium sp. Root491 Isolate Unclassified
175 2643221698 Ensifer sp. Root142 Isolate Unclassified
176 2643221712 Ensifer sp. Root258 Isolate Unclassified
177 2643221718 Rhizobium sp. Root268 Isolate Unclassified
178 2643221719 Rhizobium sp. Root274 Isolate Unclassified
179 2643221723 Ensifer sp. Root278 Isolate Unclassified
180 2643221726 Ensifer sp. Root954 Isolate Unclassified
181 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
182 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
183 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
184 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
185 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
186 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
187 2718217882 Rhizobium sp. N741 Isolate Nodule
188 2718217927 Rhizobium sp. N324 Isolate Nodule
189 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
190 2718218009 Rhizobium sp. N561 Isolate Nodule
191 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
192 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
193 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
194 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
195 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
196 2718218363 Rhizobium sp. N113 Isolate Nodule
197 2718218365 Rhizobium sp. N731 Isolate Nodule
198 2718218366 Rhizobium sp. N621 Isolate Nodule
199 2718218423 Rhizobium sp. N941 Isolate Nodule
200 2721755514 Rhizobium sp. N6212 Isolate Nodule
201 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
202 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
203 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
204 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
205 2721755809 Rhizobium sp. N541 Isolate Nodule
206 2721755810 Rhizobium sp. N871 Isolate Nodule
207 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
208 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
209 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
210 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
211 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
212 2728369365 Rhizobium sp. N1341 Isolate Nodule
213 2728369397 Rhizobium sp. N1314 Isolate Nodule
214 2738541293 Rhizobium sp. GV031 Isolate Unclassified
215 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
216 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
217 2738543024 Aminobacter sp. AP02 Isolate Unclassified
218 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
219 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
220 2751185800 Brucella pituitosa AA2 Isolate Unclassified
221 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
222 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
223 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
224 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
225 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
226 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
227 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
228 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
229 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
230 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
231 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
232 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
233 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
234 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
235 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
236 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
237 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
238 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
239 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
240 2791355256 Rhizobium sp. M10 Isolate Nodule
241 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
242 2791355260 Rhizobium sp. L9 Isolate Nodule
243 2791355261 Rhizobium sp. J15 Isolate Nodule
244 2791355262 Rhizobium sp. M1 Isolate Nodule
245 2791355263 Rhizobium chutanense C5 Isolate Nodule
246 2791355264 Rhizobium sp. S9 Isolate Nodule
247 2791355265 Rhizobium sp. H4 Isolate Nodule
248 2791355266 Rhizobium sp. L43 Isolate Nodule
249 2791355267 Rhizobium sp. L18 Isolate Nodule
250 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
251 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
252 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
253 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
254 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
255 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
256 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
257 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
258 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
259 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
260 2802429633 Rhizobium anhuiense J3 Isolate Nodule
261 2802429634 Rhizobium anhuiense S10 Isolate Nodule
262 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
263 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
264 2802429637 Rhizobium anhuiense C15 Isolate Nodule
265 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
266 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
267 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
268 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
269 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
270 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
271 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
272 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
273 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
274 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
275 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
276 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
277 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
278 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
279 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
280 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
281 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
282 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
283 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
284 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
285 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
286 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
287 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
288 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
289 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
290 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
291 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
292 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
293 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
294 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
295 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
296 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
297 2838048938 Rhizobium pisi 27/80 Isolate Nodule
298 2838061910 Rhizobium phaseoli L15 Isolate Nodule
299 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
300 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
301 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
302 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
303 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
304 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
305 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
306 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
307 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
308 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
309 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
310 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
311 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
312 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
313 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
314 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
315 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
316 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
317 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
318 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
319 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
320 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
321 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
322 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
323 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
324 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
325 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
326 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
327 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
328 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
329 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
330 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
331 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
332 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
333 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
334 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
335 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
336 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
337 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
338 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
339 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
340 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
341 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
342 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
343 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
344 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
345 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
346 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
347 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
348 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
349 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
350 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
351 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
352 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
353 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
354 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
355 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
356 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
357 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
358 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
359 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
360 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
361 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
362 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
363 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
364 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
365 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
366 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
367 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
368 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
369 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
370 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
371 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
372 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
373 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
374 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
375 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
376 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
377 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
378 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
379 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
380 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
381 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
382 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
383 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
384 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
385 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
386 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
387 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
388 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
389 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
390 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
391 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
392 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
393 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
394 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
395 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
396 2844163670 Ensifer sp. 1H6 Isolate Unclassified
397 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
398 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
399 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
400 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
401 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
402 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
403 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
404 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
405 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
406 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
407 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
408 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
409 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
410 2854911287 Brucella lupini LUP21 Isolate Unclassified
411 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
412 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
413 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
414 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
415 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
416 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
417 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
418 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
419 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
420 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
421 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
422 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
423 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
424 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
425 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
426 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
427 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
428 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
429 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
430 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
431 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
432 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
433 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
434 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
435 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
436 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
437 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
438 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
439 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
440 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
441 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
442 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
443 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
444 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
445 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
446 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
447 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
448 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
449 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
450 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
451 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
452 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
453 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
454 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
455 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
456 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
457 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
458 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
459 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
460 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
461 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
462 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
463 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
464 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
465 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
466 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
467 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
468 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
469 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
470 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
471 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
472 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
473 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
474 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
475 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
476 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
477 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
478 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
479 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
480 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
481 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
482 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
483 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
484 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
485 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
486 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
487 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
488 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
489 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
490 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
491 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
492 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
493 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
494 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
495 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
496 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
497 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
498 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
499 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
500 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
501 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
502 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
503 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
504 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
505 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
506 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
507 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
508 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
509 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
510 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
511 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
512 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
513 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
514 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
515 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
516 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
517 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
518 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
519 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
520 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
521 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
522 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
523 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
524 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
525 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
526 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
527 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
528 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
529 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
530 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
531 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
532 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
533 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
534 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
535 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
536 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
537 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
538 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
539 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
540 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
541 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
542 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
543 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
544 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
545 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
546 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
547 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
548 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
549 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
550 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
551 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
552 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
553 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
554 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
555 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
556 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
557 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
558 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
559 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
560 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
561 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
562 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
563 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
564 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
565 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
566 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
567 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
568 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
569 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
570 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
571 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
572 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
573 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
574 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
575 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
576 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
577 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
578 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
579 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
580 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
581 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
582 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
583 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
584 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
585 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
586 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
587 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
588 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
589 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
590 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
591 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
592 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
593 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
594 2922368715
595 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
596 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
597 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
598 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
599 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
600 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
601 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
602 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
603 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
604 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
605 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
606 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
607 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
608 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
609 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
610 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
611 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
612 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
613 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
614 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
615 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
616 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
617 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
618 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
619 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
620 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
621 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
622 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
623 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
624 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
625 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
626 2932401849 Devosia sp. 2618 Isolate Rhizosphere
627 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
628 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
629 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
630 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
631 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
632 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
633 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
634 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
635 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
636 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
637 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
638 2933599457 Rhizobium phaseoli M3 Isolate Nodule
639 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
640 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
641 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
642 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
643 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
644 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
645 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
646 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
647 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
648 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
649 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
650 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
651 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
652 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
653 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
654 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
655 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
656 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
657 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
658 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
659 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
660 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
661 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
662 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
663 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
664 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
665 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
666 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
667 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
668 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
669 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
670 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
671 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
672 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
673 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
674 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
675 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
676 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
677 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
678 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
679 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
680 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
681 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
682 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
683 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
684 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
685 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
686 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
687 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
688 2936381700 Rhizobium chutanense C16 Isolate Unclassified
689 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
690 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
691 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
692 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
693 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
694 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
695 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
696 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
697 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
698 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
699 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
700 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
701 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
702 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
703 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
704 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
705 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
706 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
707 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
708 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
709 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
710 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
711 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
712 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
713 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
714 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
715 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
716 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
717 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
718 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
719 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
720 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
721 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
722 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
723 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
724 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
725 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
726 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
727 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
728 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
729 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
730 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
731 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
732 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
733 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
734 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
735 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
736 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
737 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
738 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
739 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
740 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
741 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
742 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
743 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
744 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
745 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
746 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
747 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
748 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
749 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
750 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
751 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
752 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
753 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
754 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
755 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
756 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
757 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
758 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
759 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
760 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
761 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
762 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
763 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
764 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
765 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
766 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
767 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
768 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
769 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
770 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
771 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
772 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
773 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
774 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
775 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
776 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
777 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
778 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
779 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
780 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
781 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
782 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
783 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
784 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
785 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
786 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
787 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
788 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
789 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
790 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
791 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
792 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
793 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
794 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
795 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
796 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
797 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
798 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
799 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
800 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
801 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
802 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
803 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
804 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
805 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
806 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
807 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
808 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
809 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
810 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
811 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
812 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
813 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
814 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
815 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
816 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
817 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
818 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
819 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
820 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
821 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
822 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
823 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
824 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
825 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
826 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
827 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
828 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
829 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
830 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
831 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
832 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
833 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
834 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
835 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
836 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
837 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
838 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
839 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
840 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
841 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
842 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
843 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
844 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
845 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
846 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
847 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
848 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
849 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
850 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
851 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
852 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
853 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
854 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
855 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
856 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
857 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
858 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
859 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
860 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
861 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
862 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
863 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
864 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
865 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
866 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
867 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
868 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
869 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
870 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
871 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
872 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
873 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
874 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
875 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
876 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
877 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
878 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
879 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
880 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
881 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
882 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
883 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
884 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
885 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
886 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
887 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
888 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
889 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
890 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
891 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
892 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
893 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
894 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
895 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
896 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
897 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
898 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
899 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
900 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
901 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
902 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
903 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
904 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
905 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
906 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
907 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
908 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
909 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
910 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
911 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
912 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
913 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
914 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
915 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
916 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
917 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
918 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
919 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
920 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
921 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
922 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
923 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
924 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
925 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
926 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
927 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
928 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
929 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
930 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
931 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
932 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
933 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
934 2996887358 Rhizobium sp. R711 Isolate Nodule
935 2996893221 Rhizobium sp. R635 Isolate Nodule
936 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
937 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
938 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
939 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
940 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
941 3004167301 Mesorhizobium loti 582 Isolate Unclassified
942 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
943 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
944 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
945 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
946 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
947 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
948 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
949 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
950 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
951 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
952 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
953 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
954 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
955 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
956 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
957 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
958 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
959 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
960 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
961 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
962 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
963 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
964 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
965 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
966 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
967 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
968 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
969 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
970 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
971 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
972 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
973 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
974 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
975 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
976 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
977 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
978 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
979 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
980 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
981 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
982 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
983 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
984 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
985 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
986 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
987 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
988 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
989 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
990 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
991 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
992 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
993 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
994 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
995 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
996 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
997 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
998 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
999 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
1000 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
1001 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
1002 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
1003 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
1004 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
1005 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
1006 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
1007 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
1008 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
1009 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
1010 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
1011 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
1012 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
1013 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
1014 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
1015 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
1016 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
1017 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
1018 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
1019 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
1020 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
1021 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
1022 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
1023 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
1024 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
1025 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
1026 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
1027 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
1028 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1029 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1030 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
1031 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
1032 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
1033 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
1034 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
1035 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
1036 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
1037 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
1038 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
1039 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
1040 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
1041 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
1042 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
1043 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
1044 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
1045 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
1046 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
1047 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
1048 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
1049 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
1050 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
1051 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
1052 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
1053 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
1054 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
1055 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
1056 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
1057 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
1058 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
1059 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
1060 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
1061 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
1062 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
1063 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
1064 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
1065 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
1066 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1067 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1068 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
1069 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1070 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1071 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1072 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1073 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
1074 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1075 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
1076 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1077 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
1078 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1079 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1080 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1081 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1082 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1083 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1084 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1085 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1086 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1087 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1088 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1089 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1090 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1091 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1092 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1093 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1094 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1095 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1096 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1097 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1098 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1099 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1142 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1143 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1144 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
1151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
1152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
1153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
1157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1162 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
1181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
1182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1188 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1192 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1194 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1195 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1196 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1197 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
1198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
1199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1206 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1215 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1221 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1223 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1224 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
1225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1226 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1227 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
1228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1229 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
1230 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
1231 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
1232 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
1233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1244 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1247 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1256 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1294 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1318 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
1319 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
1320 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
1321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1324 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
1325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1344 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1346 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
1347 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1348 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1349 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1350 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1351 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1352 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1354 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
1355 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1356 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1359 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1361 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1362 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1363 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1365 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1366 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1367 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1368 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1369 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1373 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1374 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1375 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1376 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1377 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1378 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1379 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1380 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1381 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1382 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1383 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1384 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1385 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1386 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1387 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1388 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1389 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1390 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1391 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1392 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1393 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1394 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1395 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1396 8005258706 Rhizobium sp. R693 Isolate Nodule
1397 8005275841 Rhizobium sp. N4311 Isolate Nodule
1398 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1399 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1400 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1401 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1402 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1403 8005321885 Rhizobium sp. R72 Isolate Nodule
1404 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1405 8005382845 Rhizobium sp. R634 Isolate Nodule
1406 8005395548 Rhizobium sp. R339 Isolate Nodule
1407 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1408 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1409 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1410 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1411 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1412 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1413 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1414 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1415 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1416 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1417 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1418 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1419 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1420 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1421 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1422 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1423 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1424 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1425 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1426 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1427 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1428 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1429 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1430 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1431 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1432 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1433 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1434 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1435 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1436 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1437 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1438 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1439 8018176218 Rhizobium sp. N122 Isolate Nodule
1440 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1441 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1442 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1443 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1444 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1445 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1446 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1447 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1448 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1449 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1450 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1451 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1452 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1453 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1454 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1455 8024501048 Rhizobium sp. H4 Isolate Nodule
1456 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1457 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1458 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1459 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1460 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1461 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1462 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1463 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1464 8056382006 Rhizobium croatiense 13T Isolate Nodule
1465 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1466 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1467 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1468 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.59
Metatranscriptomes 0.15
Isolates 53.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 11.87
Nodule 40.46
Rhizoplane 1.55
Rhizosphere 29.94
Stem 0
Stem Tuber 0
Unclassified 15.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000993 3300000546 Unclassified 4489
2 JGI24740J21852_10001156 3300001979 Bacteria 11909
3 JGI25155J39150_1000012 3300002704 Bacteria 199435
4 JGI25156J39149_1000036 3300002705 Bacteria 110527
5 JGI25162J39368_1000146 3300002737 Bacteria 76858
6 JGI25162J39368_1000616 3300002737 Bacteria 25562
7 JGI25162J39368_1000674 3300002737 Bacteria 23983
8 JGI25154J39366_1000033 3300002738 Bacteria 184379
9 JGI25157J39369_1000457 3300002741 Bacteria 25863
10 JGI25157J39369_1000542 3300002741 Bacteria 22661
11 JGI25152J39213_1001129 3300002773 Bacteria 12423
12 JGI25152J39213_1002051 3300002773 Bacteria 7936
13 JGI25152J39213_1002782 3300002773 Bacteria 6330
14 JGI25152J39213_1002804 3300002773 Bacteria 6296
15 JGI25150J39212_1000063 3300002774 Bacteria 64558
16 JGI25159J45721_1000092 3300002987 Bacteria 42762
17 JGI25159J45721_1000464 3300002987 Bacteria 18764
18 JGI25151J46595_10000140 3300003187 Bacteria 95958
19 JGI25151J46595_10001756 3300003187 Bacteria 14041
20 JGI25151J46595_10004817 3300003187 Bacteria 7061
21 JGI25406J46586_10009739 3300003203 Bacteria 4294
22 JGI25165J46597_1000653 3300003214 Bacteria 28392
23 JGI25165J46597_1000719 3300003214 Bacteria 25974
24 JGI25165J46597_1001438 3300003214 Bacteria 12683
25 JGI25153J46596_10003062 3300003215 Bacteria 9443
26 JGI25153J46596_10003984 3300003215 Bacteria 8073
27 JGI25160J50197_1000006 3300003354 Bacteria 316247
28 JGI25160J50197_1000486 3300003354 Bacteria 23951
29 JGI25160J50197_1000877 3300003354 Bacteria 15856
30 JGI25160J50197_1001286 3300003354 Bacteria 12698
31 JGI25160J50197_1001787 3300003354 Bacteria 10407
32 JGI25161J50226_1000004 3300003374 Bacteria 316212
33 JGI25161J50226_1000103 3300003374 Bacteria 67942
34 JGI25161J50226_1000116 3300003374 Bacteria 62089
35 JGI25161J50226_1001626 3300003374 Bacteria 6515
36 Ga0055542_1001041 3300003762 Bacteria 17269
37 Ga0055526_1001877 3300003771 Bacteria 14557
38 Ga0055526_1002290 3300003771 Bacteria 13070
39 Ga0055526_1016674 3300003771 Bacteria 2857
40 Ga0055524_1000790 3300003775 Bacteria 21100
41 Ga0055524_1001086 3300003775 Bacteria 16609
42 Ga0055524_1001459 3300003775 Bacteria 13514
43 Ga0055524_1022270 3300003775 Bacteria 2075
44 Ga0055536_1014991 3300003781 Bacteria 2681
45 Ga0055528_1000548 3300003790 Bacteria 28660
46 Ga0055528_1000886 3300003790 Bacteria 20225
47 Ga0055528_1003424 3300003790 Bacteria 7967
48 Ga0055528_1011189 3300003790 Bacteria 3586
49 Ga0055540_1000548 3300003792 Bacteria 28000
50 Ga0055540_1010663 3300003792 Bacteria 3037
51 Ga0058692_1008879 3300003856 Bacteria 2571
52 Ga0055543_1000002 3300004625 Bacteria 390020
53 Ga0055543_1000029 3300004625 Bacteria 131452
54 Ga0055543_1000337 3300004625 Bacteria 32032
55 Ga0055543_1001407 3300004625 Bacteria 9571
56 Ga0065165_1000196 3300005262 Bacteria 104569
57 Ga0065165_1001746 3300005262 Bacteria 21666
58 Ga0065165_1001966 3300005262 Bacteria 19466
59 Ga0065165_1004041 3300005262 Bacteria 9536
60 Ga0065165_1005489 3300005262 Bacteria 7096
61 Ga0065165_1017482 3300005262 Bacteria 2640
62 Ga0070670_100006699 3300005331 Bacteria 9760
63 Ga0068869_100115281 3300005334 Bacteria 2049
64 Ga0068868_100176670 3300005338 Bacteria 1770
65 Ga0070660_100054946 3300005339 Bacteria 3076
66 Ga0070689_100000019 3300005340 Bacteria 149968
67 Ga0070689_100063568 3300005340 Bacteria 2872
68 Ga0070668_100044222 3300005347 Bacteria 3416
69 Ga0070669_100041129 3300005353 Bacteria 3361
70 Ga0070669_100158925 3300005353 Bacteria 1755
71 Ga0070675_100112804 3300005354 Bacteria 2302
72 Ga0070671_100004121 3300005355 Bacteria 11476
73 Ga0070671_100057072 3300005355 Bacteria 3248
74 Ga0070674_100011633 3300005356 Bacteria 5362
75 Ga0070659_100027085 3300005366 Bacteria 4413
76 Ga0070659_100121682 3300005366 Bacteria 2115
77 Ga0070667_100019582 3300005367 Bacteria 5615
78 Ga0070709_10030239 3300005434 Bacteria 3248
79 Ga0070710_10000681 3300005437 Bacteria 16105
80 Ga0070701_10021591 3300005438 Bacteria 3076
81 Ga0070711_100001092 3300005439 Bacteria 14495
82 Ga0070705_100145598 3300005440 Bacteria 1565
83 Ga0070694_100101799 3300005444 Bacteria 2033
84 Ga0070708_100000686 3300005445 Bacteria 25748
85 Ga0070708_100188175 3300005445 Bacteria 1931
86 Ga0070678_100209605 3300005456 Bacteria 1614
87 Ga0070662_100003105 3300005457 Bacteria 10320
88 Ga0070681_10004145 3300005458 Bacteria 13714
89 Ga0070681_10089646 3300005458 Bacteria 3027
90 Ga0068867_100004439 3300005459 Bacteria 9865
91 Ga0068867_100197022 3300005459 Bacteria 1611
92 Ga0070706_100000652 3300005467 Bacteria 39619
93 Ga0070707_100008026 3300005468 Bacteria 9807
94 Ga0070707_100050009 3300005468 Bacteria 4007
95 Ga0070707_100268054 3300005468 Bacteria 1661
96 Ga0070698_100231330 3300005471 Bacteria 1782
97 Ga0070698_100310404 3300005471 Bacteria 1508
98 Ga0070699_100187558 3300005518 Bacteria 1836
99 Ga0068853_100024508 3300005539 Bacteria 5059
100 Ga0070696_100008273 3300005546 Bacteria 6963
101 Ga0070696_100025482 3300005546 Bacteria 4022
102 Ga0070693_100070986 3300005547 Bacteria 2051
103 Ga0070665_100042121 3300005548 Bacteria 4589
104 Ga0070665_100097821 3300005548 Bacteria 2939
105 Ga0070665_100133580 3300005548 Bacteria 2483
106 Ga0068855_100002914 3300005563 Bacteria 20938
107 Ga0068855_100102801 3300005563 Bacteria 3288
108 Ga0068857_100065905 3300005577 Bacteria 3222
109 Ga0068854_100031826 3300005578 Bacteria 3668
110 Ga0068854_100061423 3300005578 Bacteria 2722
111 Ga0068854_100121702 3300005578 Bacteria 1982
112 Ga0068856_100180813 3300005614 Bacteria 2122
113 Ga0068852_100004165 3300005616 Bacteria 10188
114 Ga0068859_100091038 3300005617 Bacteria 3101
115 Ga0068861_100006986 3300005719 Bacteria 7714
116 Ga0068861_100109912 3300005719 Bacteria 2207
117 Ga0068858_100243785 3300005842 Bacteria 1706
118 Ga0068862_100110024 3300005844 Bacteria 2418
119 Ga0068862_100235797 3300005844 Bacteria 1661
120 Ga0081455_10001445 3300005937 Bacteria 29401
121 Ga0081455_10051502 3300005937 Bacteria 3531
122 Ga0081540_1003545 3300005983 Bacteria 12297
123 Ga0081540_1028845 3300005983 Bacteria 3105
124 Ga0081539_10001251 3300005985 Bacteria 45062
125 Ga0081539_10001815 3300005985 Bacteria 33742
126 Ga0081539_10004098 3300005985 Bacteria 16635
127 Ga0081539_10018206 3300005985 Bacteria 4888
128 Ga0081539_10034584 3300005985 Bacteria 3053
129 Ga0075365_10002314 3300006038 Bacteria 9271
130 Ga0075365_10010764 3300006038 Bacteria 5345
131 Ga0075365_10015316 3300006038 Bacteria 4635
132 Ga0075365_10061156 3300006038 Bacteria 2514
133 Ga0075365_10067310 3300006038 Bacteria 2404
134 Ga0075365_10070522 3300006038 Bacteria 2351
135 Ga0075365_10122565 3300006038 Bacteria 1794
136 Ga0075365_10124345 3300006038 Bacteria 1781
137 Ga0075365_10202682 3300006038 Bacteria 1390
138 Ga0075363_100005203 3300006048 Bacteria 5762
139 Ga0075363_100032088 3300006048 Bacteria 2726
140 Ga0075363_100057919 3300006048 Bacteria 2080
141 Ga0075364_10001625 3300006051 Bacteria 12311
142 Ga0075364_10023758 3300006051 Bacteria 3884
143 Ga0075364_10135081 3300006051 Bacteria 1657
144 Ga0075362_10001059 3300006177 Bacteria 8507
145 Ga0075362_10005150 3300006177 Bacteria 4762
146 Ga0075362_10009934 3300006177 Bacteria 3698
147 Ga0075362_10015420 3300006177 Bacteria 3109
148 Ga0075362_10029465 3300006177 Bacteria 2365
149 Ga0075362_10041803 3300006177 Bacteria 2023
150 Ga0075367_10004539 3300006178 Bacteria 6791
151 Ga0075367_10018322 3300006178 Bacteria 3861
152 Ga0075367_10056832 3300006178 Bacteria 2325
153 Ga0075367_10072640 3300006178 Bacteria 2072
154 Ga0075367_10080318 3300006178 Bacteria 1972
155 Ga0075366_10073059 3300006195 Bacteria 2044
156 Ga0097621_100113413 3300006237 Bacteria 2293
157 Ga0097621_100137847 3300006237 Bacteria 2083
158 Ga0075370_10000839 3300006353 Bacteria 12435
159 Ga0075370_10041128 3300006353 Bacteria 2609
160 Ga0075370_10092620 3300006353 Bacteria 1744
161 Ga0068871_100025070 3300006358 Bacteria 4635
162 Ga0075428_100005976 3300006844 Bacteria 13521
163 Ga0075428_100107959 3300006844 Bacteria 3033
164 Ga0075428_100136008 3300006844 Bacteria 2672
165 Ga0075430_100000852 3300006846 Bacteria 23928
166 Ga0075430_100008547 3300006846 Bacteria 8642
167 Ga0075431_100084545 3300006847 Bacteria 3276
168 Ga0075429_100000927 3300006880 Bacteria 23245
169 Ga0075429_100143608 3300006880 Bacteria 2089
170 Ga0075436_100116776 3300006914 Bacteria 1865
171 Ga0097620_100091038 3300006931 Bacteria 3101
172 Ga0079104_1000042 3300006946 Bacteria 185991
173 Ga0079104_1009436 3300006946 Bacteria 3306
174 Ga0099826_10003152 3300006948 Bacteria 11065
175 Ga0105251_10026227 3300009011 Bacteria 2969
176 Ga0105240_10000019 3300009093 Bacteria 406211
177 Ga0105240_10000871 3300009093 Bacteria 54379
178 Ga0105240_10001841 3300009093 Bacteria 35533
179 Ga0105240_10002869 3300009093 Bacteria 27260
180 Ga0111539_10001873 3300009094 Bacteria 27932
181 Ga0111539_10004595 3300009094 Bacteria 18041
182 Ga0111539_10021065 3300009094 Bacteria 8029
183 Ga0114129_10000293 3300009147 Bacteria 57817
184 Ga0105243_10036210 3300009148 Bacteria 3829
185 Ga0105243_10054480 3300009148 Bacteria 3176
186 Ga0105241_10099547 3300009174 Bacteria 2309
187 Ga0105241_10135860 3300009174 Bacteria 1997
188 Ga0105242_10048624 3300009176 Bacteria 3448
189 Ga0105242_10244438 3300009176 Bacteria 1615
190 Ga0105248_10034425 3300009177 Bacteria 5663
191 Ga0105248_10071041 3300009177 Bacteria 3909
192 Ga0105237_10000025 3300009545 Bacteria 215920
193 Ga0105237_10006193 3300009545 Bacteria 13347
194 Ga0105237_10033313 3300009545 Bacteria 5219
195 Ga0105237_10033689 3300009545 Bacteria 5189
196 Ga0105237_10101978 3300009545 Bacteria 2861
197 Ga0105238_10001161 3300009551 Bacteria 26564
198 Ga0105238_10075130 3300009551 Bacteria 3371
199 Ga0105238_10200897 3300009551 Bacteria 1969
200 Ga0105249_10017064 3300009553 Bacteria 6443
201 Ga0105249_10181544 3300009553 Bacteria 2048
202 Ga0105249_10238794 3300009553 Bacteria 1796
203 Ga0123341_1000015 3300009765 Bacteria 86184
204 Ga0105239_10092443 3300010375 Bacteria 3339
205 Ga0105239_10193678 3300010375 Bacteria 2276
206 Ga0157371_10000005 3300013102 Bacteria 416456
207 Ga0157370_10000036 3300013104 Bacteria 136933
208 Ga0157370_10002915 3300013104 Bacteria 20380
209 Ga0157370_10293465 3300013104 Bacteria 1502
210 Ga0171463_1014 3300013249 Bacteria 83917
211 Ga0157378_10005765 3300013297 Bacteria 10847
212 Ga0157378_10140250 3300013297 Bacteria 2244
213 Ga0163162_10247511 3300013306 Bacteria 1914
214 Ga0163162_10348125 3300013306 Bacteria 1614
215 Ga0157375_10084111 3300013308 Bacteria 3229
216 Ga0157380_10162421 3300014326 Bacteria 1943
217 Ga0157380_10208691 3300014326 Bacteria 1739
218 Ga0157379_10026503 3300014968 Bacteria 5160
219 Ga0157379_10066537 3300014968 Bacteria 3221
220 Ga0182007_10017364 3300015262 Bacteria 2630
221 Ga0182007_10022122 3300015262 Bacteria 2249
222 Ga0183363_1052 3300015690 Bacteria 37103
223 Ga0163161_10114681 3300017792 Bacteria 2019
224 Ga0214544_1000003 3300021320 Bacteria 643752
225 Ga0214544_1000063 3300021320 Bacteria 129929
226 Ga0214542_1000003 3300021321 Bacteria 435700
227 Ga0214542_1000095 3300021321 Bacteria 116012
228 Ga0214542_1028661 3300021321 Bacteria 2379
229 Ga0214545_1000004 3300021324 Bacteria 453352
230 Ga0214543_1000007 3300021327 Bacteria 414744
231 Ga0214543_1000008 3300021327 Bacteria 385680
232 Ga0214543_1000026 3300021327 Bacteria 220652
233 Ga0213872_10001461 3300021361 Bacteria 15360
234 Ga0213872_10002930 3300021361 Bacteria 9696
235 Ga0213876_10038669 3300021384 Bacteria 2519
236 Ga0213875_10003139 3300021388 Bacteria 9502
237 Ga0228711_1000003 3300022739 Bacteria 258118
238 Ga0228710_1000003 3300022740 Bacteria 262981
239 Ga0209435_100005 3300025206 Bacteria 573745
240 Ga0209436_100041 3300025208 Bacteria 74018
241 Ga0209436_105270 3300025208 Bacteria 3003
242 Ga0209563_100013 3300025230 Bacteria 941463
243 Ga0207427_103198 3300025231 Bacteria 3611
244 Ga0209437_100078 3300025233 Bacteria 278088
245 Ga0209437_100174 3300025233 Bacteria 138811
246 Ga0207425_1000080 3300025245 Bacteria 100578
247 Ga0207425_1003292 3300025245 Bacteria 5244
248 Ga0209646_1000011 3300025246 Bacteria 573745
249 Ga0209646_1006491 3300025246 Bacteria 1963
250 Ga0209026_1000008 3300025250 Bacteria 573745
251 Ga0209026_1000050 3300025250 Bacteria 254994
252 Ga0209677_101144 3300025253 Bacteria 12360
253 Ga0209677_108366 3300025253 Bacteria 2019
254 Ga0209148_1000032 3300025254 Bacteria 557660
255 Ga0209148_1000643 3300025254 Bacteria 30450
256 Ga0209148_1000904 3300025254 Bacteria 20182
257 Ga0209759_1000004 3300025256 Bacteria 573745
258 Ga0209759_1000233 3300025256 Bacteria 83273
259 Ga0209759_1018251 3300025256 Bacteria 1700
260 Ga0209129_1000195 3300025258 Bacteria 80791
261 Ga0209129_1000199 3300025258 Bacteria 77091
262 Ga0209129_1001192 3300025258 Bacteria 14972
263 Ga0209129_1002022 3300025258 Bacteria 10519
264 Ga0209129_1004508 3300025258 Bacteria 5399
265 Ga0209129_1004637 3300025258 Bacteria 5261
266 Ga0209233_1000034 3300025261 Bacteria 578898
267 Ga0209233_1000163 3300025261 Bacteria 152912
268 Ga0209233_1000299 3300025261 Bacteria 60375
269 Ga0209233_1000305 3300025261 Bacteria 58381
270 Ga0209233_1001762 3300025261 Bacteria 8348
271 Ga0209233_1002525 3300025261 Bacteria 6686
272 Ga0209455_1000085 3300025272 Bacteria 247601
273 Ga0209455_1000488 3300025272 Bacteria 29116
274 Ga0209455_1001820 3300025272 Bacteria 8951
275 Ga0209455_1008371 3300025272 Bacteria 2815
276 Ga0209673_1000037 3300025273 Bacteria 313804
277 Ga0209673_1000320 3300025273 Bacteria 88073
278 Ga0209673_1000880 3300025273 Bacteria 38918
279 Ga0209673_1000924 3300025273 Bacteria 37119
280 Ga0209673_1003302 3300025273 Bacteria 9668
281 Ga0209673_1007876 3300025273 Bacteria 4820
282 Ga0209130_1000030 3300025284 Bacteria 323323
283 Ga0209130_1000032 3300025284 Bacteria 316240
284 Ga0209130_1000198 3300025284 Bacteria 82557
285 Ga0209130_1010028 3300025284 Bacteria 2640
286 Ga0209676_1005216 3300025292 Bacteria 6886
287 Ga0209676_1007354 3300025292 Bacteria 5194
288 Ga0209025_1000052 3300025294 Bacteria 324648
289 Ga0209025_1000074 3300025294 Bacteria 277445
290 Ga0209025_1000080 3300025294 Bacteria 267244
291 Ga0209025_1000332 3300025294 Bacteria 104326
292 Ga0209025_1000339 3300025294 Bacteria 103239
293 Ga0209025_1000354 3300025294 Bacteria 98665
294 Ga0209025_1000566 3300025294 Bacteria 67702
295 Ga0209025_1051465 3300025294 Bacteria 1636
296 Ga0209564_1000207 3300025295 Bacteria 135313
297 Ga0209564_1000345 3300025295 Bacteria 88073
298 Ga0209564_1000353 3300025295 Bacteria 85747
299 Ga0209564_1001668 3300025295 Bacteria 21260
300 Ga0209564_1011812 3300025295 Bacteria 3876
301 Ga0209758_1000015 3300025297 Bacteria 851943
302 Ga0209758_1000105 3300025297 Bacteria 221415
303 Ga0209758_1000263 3300025297 Bacteria 104297
304 Ga0209758_1000389 3300025297 Bacteria 75919
305 Ga0209758_1000561 3300025297 Bacteria 58483
306 Ga0209758_1000716 3300025297 Bacteria 48984
307 Ga0209758_1001323 3300025297 Bacteria 30082
308 Ga0209758_1001789 3300025297 Bacteria 23722
309 Ga0209758_1002280 3300025297 Bacteria 19856
310 Ga0209758_1002342 3300025297 Bacteria 19520
311 Ga0209758_1002865 3300025297 Bacteria 16738
312 Ga0209758_1004558 3300025297 Bacteria 11440
313 Ga0209758_1018773 3300025297 Bacteria 3371
314 Ga0209758_1032328 3300025297 Bacteria 2126
315 Ga0209050_1003774 3300025298 Bacteria 10824
316 Ga0209050_1008731 3300025298 Bacteria 5337
317 Ga0209050_1008822 3300025298 Bacteria 5292
318 Ga0209256_1000343 3300025299 Bacteria 75902
319 Ga0209256_1000348 3300025299 Bacteria 75070
320 Ga0209256_1000368 3300025299 Bacteria 72598
321 Ga0209256_1003220 3300025299 Bacteria 11778
322 Ga0209256_1004594 3300025299 Bacteria 8541
323 Ga0209256_1007480 3300025299 Bacteria 5371
324 Ga0207426_1000047 3300025302 Bacteria 417011
325 Ga0207426_1000048 3300025302 Bacteria 409127
326 Ga0207426_1000077 3300025302 Bacteria 316246
327 Ga0207426_1000296 3300025302 Bacteria 98032
328 Ga0207426_1000380 3300025302 Bacteria 76046
329 Ga0207426_1000985 3300025302 Bacteria 27962
330 Ga0207426_1020340 3300025302 Bacteria 2308
331 Ga0209051_1000236 3300025303 Bacteria 92738
332 Ga0209051_1000517 3300025303 Bacteria 48573
333 Ga0209051_1002208 3300025303 Bacteria 14374
334 Ga0209051_1003116 3300025303 Bacteria 11175
335 Ga0209051_1006923 3300025303 Bacteria 6296
336 Ga0209051_1007923 3300025303 Bacteria 5725
337 Ga0209051_1017517 3300025303 Bacteria 3198
338 Ga0209257_1000033 3300025304 Bacteria 671006
339 Ga0209257_1001378 3300025304 Bacteria 29161
340 Ga0209257_1011867 3300025304 Bacteria 4121
341 Ga0209257_1020225 3300025304 Bacteria 2470
342 Ga0207692_10006874 3300025898 Bacteria 4634
343 Ga0207688_10067120 3300025901 Bacteria 2030
344 Ga0207699_10000803 3300025906 Bacteria 14996
345 Ga0207645_10068247 3300025907 Bacteria 2273
346 Ga0207645_10096755 3300025907 Bacteria 1902
347 Ga0207645_10124638 3300025907 Bacteria 1674
348 Ga0207684_10000698 3300025910 Bacteria 39706
349 Ga0207684_10199062 3300025910 Bacteria 1728
350 Ga0207707_10056350 3300025912 Bacteria 3419
351 Ga0207695_10000049 3300025913 Bacteria 406233
352 Ga0207695_10000065 3300025913 Bacteria 336949
353 Ga0207695_10016415 3300025913 Bacteria 8663
354 Ga0207695_10054111 3300025913 Bacteria 4194
355 Ga0207695_10083047 3300025913 Bacteria 3237
356 Ga0207671_10000107 3300025914 Bacteria 128950
357 Ga0207671_10000644 3300025914 Bacteria 45611
358 Ga0207671_10002455 3300025914 Bacteria 19836
359 Ga0207671_10019495 3300025914 Bacteria 5186
360 Ga0207671_10020826 3300025914 Bacteria 4987
361 Ga0207671_10022981 3300025914 Bacteria 4708
362 Ga0207671_10029566 3300025914 Bacteria 4091
363 Ga0207662_10031681 3300025918 Bacteria 3072
364 Ga0207657_10047345 3300025919 Bacteria 3761
365 Ga0207646_10012944 3300025922 Bacteria 7997
366 Ga0207694_10002608 3300025924 Bacteria 14622
367 Ga0207650_10005592 3300025925 Bacteria 8587
368 Ga0207650_10059566 3300025925 Bacteria 2847
369 Ga0207700_10002933 3300025928 Bacteria 9844
370 Ga0207700_10087424 3300025928 Bacteria 2451
371 Ga0207706_10002765 3300025933 Bacteria 17065
372 Ga0207686_10040697 3300025934 Bacteria 2827
373 Ga0207709_10043168 3300025935 Bacteria 2716
374 Ga0207670_10000013 3300025936 Bacteria 211834
375 Ga0207665_10003192 3300025939 Bacteria 10981
376 Ga0207689_10001797 3300025942 Bacteria 20251
377 Ga0207689_10016113 3300025942 Bacteria 6328
378 Ga0207689_10160603 3300025942 Bacteria 1852
379 Ga0207667_10004623 3300025949 Bacteria 16891
380 Ga0207667_10128396 3300025949 Bacteria 2611
381 Ga0207712_10023861 3300025961 Bacteria 4043
382 Ga0207712_10043564 3300025961 Bacteria 3097
383 Ga0207668_10003572 3300025972 Bacteria 9134
384 Ga0207668_10120463 3300025972 Bacteria 1986
385 Ga0207640_10089470 3300025981 Bacteria 2128
386 Ga0207658_10129273 3300025986 Bacteria 2027
387 Ga0207677_10182273 3300026023 Bacteria 1653
388 Ga0207678_10066999 3300026067 Bacteria 3082
389 Ga0207702_10103179 3300026078 Bacteria 2522
390 Ga0207648_10006652 3300026089 Bacteria 11473
391 Ga0207648_10024247 3300026089 Bacteria 5417
392 Ga0207648_10053604 3300026089 Bacteria 3524
393 Ga0207648_10061039 3300026089 Bacteria 3287
394 Ga0207676_10056773 3300026095 Bacteria 3080
395 Ga0207674_10067654 3300026116 Bacteria 3595
396 Ga0207674_10255021 3300026116 Bacteria 1701
397 Ga0207675_100002011 3300026118 Bacteria 20281
398 Ga0207675_100008827 3300026118 Bacteria 9460
399 Ga0207675_100050326 3300026118 Bacteria 3888
400 Ga0207683_10074129 3300026121 Bacteria 3011
401 Ga0207683_10099602 3300026121 Bacteria 2594
402 Ga0207683_10141108 3300026121 Bacteria 2171
403 Ga0207698_10011740 3300026142 Bacteria 5694
404 Ga0207698_10051799 3300026142 Bacteria 3140
405 Ga0207698_10252891 3300026142 Bacteria 1613
406 Ga0209281_1000081 3300027111 Bacteria 258084
407 Ga0209281_1000141 3300027111 Bacteria 175634
408 Ga0209281_1000194 3300027111 Bacteria 139318
409 Ga0209389_1000180 3300027296 Bacteria 49331
410 Ga0209371_1000003 3300027312 Bacteria 1122971
411 Ga0209371_1003578 3300027312 Bacteria 7436
412 Ga0209371_1007496 3300027312 Bacteria 3787
413 Ga0209371_1009533 3300027312 Bacteria 3075
414 Ga0209489_101411 3300027361 Bacteria 49331
415 Ga0209700_101443 3300027363 Bacteria 49345
416 Ga0209282_1000036 3300027666 Bacteria 130242
417 Ga0209282_1000245 3300027666 Bacteria 27454
418 Ga0209813_10008959 3300027866 Bacteria 2544
419 Ga0207428_10024756 3300027907 Bacteria 5038
420 Ga0207428_10159438 3300027907 Bacteria 1714
421 Ga0268266_10059352 3300028379 Bacteria 3296
422 Ga0268265_10066200 3300028380 Bacteria 2792
423 Ga0268265_10139494 3300028380 Bacteria 2028
424 Ga0268264_10020771 3300028381 Bacteria 5366
425 Ga0265337_1005026 3300028556 Bacteria 5356
426 Ga0265337_1007267 3300028556 Bacteria 4157
427 Ga0265326_10001905 3300028558 Bacteria 7139
428 Ga0265326_10004795 3300028558 Bacteria 4293
429 Ga0265326_10016273 3300028558 Bacteria 2151
430 Ga0265319_1000654 3300028563 Bacteria 22839
431 Ga0265319_1026169 3300028563 Bacteria 2081
432 Ga0265334_10002493 3300028573 Bacteria 8604
433 Ga0265318_10000177 3300028577 Bacteria 56517
434 Ga0265318_10000533 3300028577 Bacteria 27256
435 Ga0265318_10004293 3300028577 Bacteria 6940
436 Ga0265318_10033461 3300028577 Bacteria 1984
437 Ga0265323_10000448 3300028653 Bacteria 23600
438 Ga0265323_10002030 3300028653 Bacteria 9530
439 Ga0265323_10004144 3300028653 Bacteria 6280
440 Ga0265322_10029308 3300028654 Bacteria 1573
441 Ga0265336_10002907 3300028666 Bacteria 6882
442 Ga0307515_10000145 3300028794 Bacteria 170814
443 Ga0307515_10001520 3300028794 Bacteria 51901
444 Ga0307515_10006129 3300028794 Bacteria 24187
445 Ga0307515_10011387 3300028794 Bacteria 16883
446 Ga0307515_10100689 3300028794 Bacteria 3496
447 Ga0265338_10000280 3300028800 Bacteria 91942
448 Ga0265338_10021117 3300028800 Bacteria 6806
449 Ga0265338_10078963 3300028800 Bacteria 2772
450 Ga0265324_10000063 3300029957 Bacteria 91952
451 Ga0265324_10005408 3300029957 Bacteria 5520
452 Ga0268256_1000004 3300030500 Bacteria 1122967
453 Ga0268256_1010141 3300030500 Bacteria 3071
454 Ga0268256_1015653 3300030500 Bacteria 2204
455 Ga0316181_1110178 3300030744 Bacteria 3235
456 Ga0265330_10000585 3300031235 Bacteria 23735
457 Ga0265330_10000707 3300031235 Bacteria 21114
458 Ga0265330_10004926 3300031235 Bacteria 6725
459 Ga0265330_10012298 3300031235 Bacteria 4005
460 Ga0265332_10000386 3300031238 Bacteria 32118
461 Ga0265328_10006947 3300031239 Bacteria 4751
462 Ga0265328_10040281 3300031239 Bacteria 1722
463 Ga0265320_10000867 3300031240 Bacteria 22866
464 Ga0265325_10001162 3300031241 Bacteria 18825
465 Ga0265325_10002706 3300031241 Bacteria 11847
466 Ga0265325_10003071 3300031241 Bacteria 11032
467 Ga0265325_10084294 3300031241 Bacteria 1575
468 Ga0265329_10000042 3300031242 Bacteria 53592
469 Ga0265329_10000088 3300031242 Bacteria 42313
470 Ga0265329_10010888 3300031242 Bacteria 3326
471 Ga0265340_10002283 3300031247 Bacteria 10959
472 Ga0265340_10003645 3300031247 Bacteria 8656
473 Ga0265339_10000010 3300031249 Bacteria 214721
474 Ga0265339_10000239 3300031249 Bacteria 44164
475 Ga0265339_10021747 3300031249 Bacteria 3725
476 Ga0265331_10000539 3300031250 Bacteria 34679
477 Ga0265331_10011091 3300031250 Bacteria 4944
478 Ga0265327_10030164 3300031251 Bacteria 3070
479 Ga0265316_10000160 3300031344 Bacteria 75479
480 Ga0265316_10000175 3300031344 Bacteria 72559
481 Ga0265316_10000603 3300031344 Bacteria 40127
482 Ga0265316_10000739 3300031344 Bacteria 36142
483 Ga0265316_10005410 3300031344 Bacteria 12409
484 Ga0265316_10027142 3300031344 Bacteria 4747
485 Ga0265316_10064691 3300031344 Bacteria 2833
486 Ga0265316_10089522 3300031344 Bacteria 2348
487 Ga0265316_10094800 3300031344 Bacteria 2274
488 Ga0265316_10153418 3300031344 Bacteria 1725
489 Ga0307513_10003087 3300031456 Bacteria 22729
490 Ga0307513_10003471 3300031456 Bacteria 21323
491 Ga0307513_10194829 3300031456 Bacteria 1873
492 Ga0307513_10234007 3300031456 Bacteria 1648
493 Ga0307509_10017985 3300031507 Bacteria 8112
494 Ga0307509_10093227 3300031507 Bacteria 3075
495 Ga0265313_10000422 3300031595 Bacteria 45310
496 Ga0265313_10001459 3300031595 Bacteria 22076
497 Ga0265313_10061577 3300031595 Bacteria 1755
498 Ga0307508_10000003 3300031616 Bacteria 321602
499 Ga0307508_10053641 3300031616 Bacteria 3577
500 Ga0307508_10095438 3300031616 Bacteria 2565
501 Ga0265314_10001482 3300031711 Bacteria 26124
502 Ga0265314_10009013 3300031711 Bacteria 8485
503 Ga0265314_10016328 3300031711 Bacteria 5867
504 Ga0265342_10000199 3300031712 Bacteria 67101
505 Ga0265342_10001752 3300031712 Bacteria 19811
506 Ga0265342_10012574 3300031712 Bacteria 5728
507 Ga0265342_10048064 3300031712 Bacteria 2559
508 Ga0265342_10099135 3300031712 Bacteria 1662
509 Ga0265342_10104380 3300031712 Bacteria 1611
510 Ga0316576_10025856 3300031727 Bacteria 4113
511 Ga0316576_10027210 3300031727 Bacteria 4019
512 Ga0316576_10124348 3300031727 Bacteria 1938
513 Ga0316578_10011315 3300031728 Bacteria 4663
514 Ga0316578_10082317 3300031728 Bacteria 1916
515 Ga0307516_10006895 3300031730 Bacteria 13225
516 Ga0307516_10207891 3300031730 Bacteria 1673
517 Ga0307405_10000333 3300031731 Bacteria 17520
518 Ga0307410_10017254 3300031852 Bacteria 4330
519 Ga0307406_10079726 3300031901 Bacteria 2172
520 Ga0307407_10081444 3300031903 Bacteria 1959
521 Ga0307412_10005005 3300031911 Bacteria 7412
522 Ga0315914_1000002 3300031967 Bacteria 365357
523 Ga0307409_100220500 3300031995 Bacteria 1712
524 Ga0307414_10002146 3300032004 Bacteria 10299
525 Ga0307411_10000107 3300032005 Bacteria 26103
526 Ga0316593_10014887 3300032168 Bacteria 2330
527 Ga0307510_10003428 3300033180 Bacteria 18490
528 Ga0315913_1000009 3300033430 Bacteria 149770
529 Ga0315915_1000005 3300033464 Bacteria 397591
530 Ga0316588_1016704 3300033528 Bacteria 1630
531 Ga0316215_1000798 3300033544 Bacteria 3181
532 Ga0373940_0002677 3300035088 Bacteria 3513
533 Ga0373949_0000018 3300035090 Bacteria 59252
534 Ga0373939_0000188 3300035114 Bacteria 17175
535 Ga0373954_0023299 3300035118 Bacteria 2814
536 Ga0373935_0039661 3300035692 Bacteria 2953
537 Ga0373927_0000047 3300035695 Bacteria 87289
538 Ga0373927_0002755 3300035695 Bacteria 12825
539 Ga0373947_0040262 3300035725 Bacteria 2783
540 Ga0373937_0112708 3300036401 Bacteria 2530
541 Ga0316582_0121812 3300036647 Bacteria 1746
542 Ga0316584_0130159 3300036712 Bacteria 1880
543 Ga0316584_0137017 3300036712 Bacteria 1827
544 Ga0373925_0001420 3300037068 Bacteria 20792
545 Ga0395899_0000030 3300037312 Bacteria 329063
546 Ga0395899_0165917 3300037312 Bacteria 1558
547 Ga0395900_0000023 3300037418 Bacteria 336048
548 Ga0395900_0174865 3300037418 Bacteria 2184
549 Ga0395898_0000038 3300037466 Bacteria 329063
550 Ga0395905_0000021 3300037471 Bacteria 329054
551 Ga0395905_0001828 3300037471 Bacteria 24574
552 Ga0395905_0003588 3300037471 Bacteria 16513
553 Ga0395905_0043048 3300037471 Bacteria 4236
554 Ga0395905_0090275 3300037471 Bacteria 2872
555 Ga0395905_0170337 3300037471 Bacteria 2045
556 Ga0436364_0457171 3300037853 Bacteria 14942
557 Ga0395901_0000018 3300038443 Bacteria 336048
558 Ga0395901_0058770 3300038443 Bacteria 3999
559 Ga0400483_018531 3300039062 Bacteria 58611
560 Ga0400483_056535 3300039062 Bacteria 25959
561 Ga0400483_064331 3300039062 Bacteria 5230
562 Ga0400483_064975 3300039062 Bacteria 2330
563 Ga0400483_082204 3300039062 Bacteria 1847
564 Ga0400483_199980 3300039062 Bacteria 12837
565 Ga0400483_219255 3300039062 Bacteria 53229
566 Ga0400483_225954 3300039062 Bacteria 2605
567 Ga0400483_256661 3300039062 Bacteria 1622
568 Ga0436365_0615937 3300039437 Bacteria 5798
569 Ga0436365_0966943 3300039437 Bacteria 2923
570 Ga0436360_0078821 3300039438 Bacteria 2181
571 Ga0436361_0015273 3300039447 Bacteria 10997
572 Ga0436361_0656175 3300039447 Bacteria 4309
573 Ga0436363_1120285 3300039450 Bacteria 2287
574 Ga0436362_0872866 3300039453 Bacteria 3769
575 Ga0439436_0011526 3300041404 Bacteria 2686
576 Ga0439465_0002349 3300041413 Bacteria 6212
577 Ga0451791_1838827 3300041451 Bacteria 1983
578 Ga0451798_0601713 3300041458 Bacteria 1664
579 Ga0451837_0668917 3300041494 Bacteria 2766
580 Ga0451841_0495290 3300041498 Bacteria 4653
581 Ga0439441_010430 3300042001 Bacteria 1558
582 Ga0439449_0004566 3300042007 Bacteria 5353
583 Ga0439449_0030804 3300042007 Bacteria 2000
584 Ga0450888_000097 3300042126 Bacteria 6789
585 Ga0450890_000925 3300042127 Bacteria 4240
586 Ga0450892_000431 3300042130 Bacteria 4916
587 Ga0450893_0002729 3300042532 Bacteria 2761
588 Ga0451577_0005071 3300042876 Bacteria 13595
589 Ga0451577_0147770 3300042876 Bacteria 2114
590 Ga0466966_0036092 3300044684 Bacteria 3193
591 Ga0466963_0021877 3300044694 Bacteria 4041
592 Ga0453684_0048819 3300044712 Bacteria 5589
593 Ga0453684_0054469 3300044712 Bacteria 5209
594 Ga0453684_0202291 3300044712 Bacteria 2314
595 Ga0466968_0003538 3300044735 Bacteria 5782
596 Ga0466970_0007062 3300044765 Bacteria 5617
597 Ga0466957_0107580 3300044842 Bacteria 1765
598 Ga0451576_0000834 3300045051 Bacteria 60105
599 Ga0451576_0007219 3300045051 Bacteria 13384
600 Ga0451576_0010072 3300045051 Bacteria 10882
601 Ga0466967_0004486 3300045976 Bacteria 9423
602 Ga0495629_0096059 3300046459 Bacteria 2067
603 Ga0495638_0076673 3300046460 Bacteria 2037
604 Ga0495605_0025255 3300046474 Bacteria 3097
605 Ga0495664_0044386 3300046477 Bacteria 2634
606 Ga0495585_0018784 3300046492 Bacteria 3987
607 Ga0495607_0000319 3300046501 Bacteria 50035
608 Ga0495606_0000629 3300046507 Bacteria 55524
609 Ga0495606_0002219 3300046507 Bacteria 23170
610 Ga0495606_0013151 3300046507 Bacteria 6568
611 Ga0495616_0000241 3300046513 Bacteria 44479
612 Ga0495616_0093071 3300046513 Bacteria 1424
613 Ga0495631_0013726 3300046518 Bacteria 3925
614 Ga0495632_0025688 3300046519 Bacteria 3112
615 Ga0495632_0061201 3300046519 Bacteria 1827
616 Ga0495632_0088894 3300046519 Bacteria 1467
617 Ga0495643_0023336 3300046522 Bacteria 3518
618 Ga0495643_0023803 3300046522 Bacteria 3477
619 Ga0495643_0024126 3300046522 Bacteria 3452
620 Ga0495643_0028720 3300046522 Bacteria 3115
621 Ga0495648_0016311 3300046524 Bacteria 5360
622 Ga0495648_0055627 3300046524 Bacteria 2385
623 Ga0495654_0001861 3300046530 Bacteria 14052
624 Ga0495587_0072106 3300046536 Bacteria 2008
625 Ga0495597_0016255 3300046542 Bacteria 3516
626 Ga0495645_0022443 3300046543 Bacteria 4566
627 Ga0495633_0088023 3300046558 Bacteria 1444
628 Ga0495667_0106671 3300046559 Bacteria 1810
629 Ga0495625_0015812 3300046660 Bacteria 5957
630 Ga0495625_0031642 3300046660 Bacteria 3932
631 Ga0495625_0087624 3300046660 Bacteria 2158
632 Ga0495661_0006830 3300046665 Bacteria 7991
633 Ga0495661_0060714 3300046665 Bacteria 2245
634 Ga0495588_0001753 3300046674 Bacteria 9238
635 Ga0495588_0032887 3300046674 Bacteria 2616
636 Ga0495669_0005090 3300046684 Bacteria 5472
637 Ga0495600_0031448 3300046809 Bacteria 3439
638 Ga0495674_0017990 3300047319 Bacteria 6578
639 Ga0495687_048323 3300047443 Bacteria 1825
640 Ga0495673_0048594 3300047469 Bacteria 1870
641 Ga0495684_0175369 3300047471 Bacteria 1592
642 Ga0495686_0002643 3300047472 Bacteria 16544
643 Ga0495626_0001302 3300048091 Bacteria 20364
644 Ga0496101_0031137 3300048904 Bacteria 3747
645 Ga0496101_0188164 3300048904 Bacteria 1592
646 Ga0496102_0003383 3300048905 Bacteria 13525
647 Ga0496102_0059349 3300048905 Bacteria 3498
648 Ga0496102_0120362 3300048905 Bacteria 2451
649 Ga0496104_0016934 3300048907 Bacteria 6630
650 Ga0496104_0051606 3300048907 Bacteria 3882
651 Ga0496105_0034708 3300048908 Bacteria 4149
652 Ga0496106_0001659 3300048909 Bacteria 16701
653 Ga0496107_0106317 3300048910 Bacteria 2061
654 Ga0496108_0113512 3300048911 Bacteria 2319
655 Ga0496109_0188238 3300048912 Bacteria 1939
656 Ga0496110_0041076 3300048913 Bacteria 4034
657 Ga0496111_0000570 3300048914 Bacteria 19247
658 Ga0496111_0051207 3300048914 Bacteria 2981
659 Ga0496114_0005571 3300048917 Bacteria 9870
660 Ga0496115_0157199 3300048918 Bacteria 1878
661 Ga0496116_0000097 3300048919 Bacteria 200658
662 Ga0496116_0035905 3300048919 Bacteria 3476
663 Ga0496116_0066736 3300048919 Bacteria 2301
664 Ga0496117_0000030 3300048920 Bacteria 389141
665 Ga0496117_0002458 3300048920 Bacteria 23348
666 Ga0496117_0005055 3300048920 Bacteria 14138
667 Ga0496117_0030483 3300048920 Bacteria 4139
668 Ga0496117_0062045 3300048920 Bacteria 2564
669 Ga0496117_0064820 3300048920 Bacteria 2488
670 Ga0496117_0067662 3300048920 Bacteria 2416
671 Ga0496118_0005475 3300048921 Bacteria 14409
672 Ga0496118_0010916 3300048921 Bacteria 8933
673 Ga0496118_0018933 3300048921 Bacteria 6173
674 Ga0496118_0023602 3300048921 Bacteria 5337
675 Ga0496118_0043627 3300048921 Bacteria 3522
676 Ga0496119_0004065 3300048922 Bacteria 14759
677 Ga0496119_0005138 3300048922 Bacteria 12675
678 Ga0496119_0007759 3300048922 Bacteria 9571
679 Ga0496119_0019969 3300048922 Bacteria 4906
680 Ga0496119_0029278 3300048922 Bacteria 3739
681 Ga0496119_0037868 3300048922 Bacteria 3125
682 Ga0496119_0066315 3300048922 Bacteria 2134
683 Ga0496120_0000148 3300048923 Bacteria 116605
684 Ga0496120_0006073 3300048923 Bacteria 9378
685 Ga0496120_0044423 3300048923 Bacteria 2581
686 Ga0496121_0000003 3300048924 Bacteria 1191431
687 Ga0496121_0000180 3300048924 Bacteria 141128
688 Ga0496121_0000452 3300048924 Bacteria 80796
689 Ga0496121_0003259 3300048924 Bacteria 23331
690 Ga0496121_0005630 3300048924 Bacteria 15952
691 Ga0496121_0020232 3300048924 Bacteria 6601
692 Ga0496121_0023174 3300048924 Bacteria 5993
693 Ga0496121_0027611 3300048924 Bacteria 5307
694 Ga0496122_0000024 3300048925 Bacteria 372400
695 Ga0496122_0000050 3300048925 Bacteria 267874
696 Ga0496122_0000107 3300048925 Bacteria 193163
697 Ga0496122_0001243 3300048925 Bacteria 42828
698 Ga0496122_0003715 3300048925 Bacteria 19733
699 Ga0496122_0008479 3300048925 Bacteria 11071
700 Ga0496122_0009737 3300048925 Bacteria 10041
701 Ga0496122_0010876 3300048925 Bacteria 9316
702 Ga0496122_0021073 3300048925 Bacteria 5854
703 Ga0496122_0029228 3300048925 Bacteria 4654
704 Ga0496122_0055523 3300048925 Bacteria 2962
705 Ga0496122_0096358 3300048925 Bacteria 1995
706 Ga0496123_0000023 3300048926 Bacteria 346894
707 Ga0496123_0000063 3300048926 Bacteria 216072
708 Ga0496123_0000086 3300048926 Bacteria 183266
709 Ga0496123_0003983 3300048926 Bacteria 15996
710 Ga0496123_0008804 3300048926 Bacteria 9202
711 Ga0496123_0009186 3300048926 Bacteria 8935
712 Ga0496123_0052226 3300048926 Bacteria 2714
713 Ga0496123_0084740 3300048926 Bacteria 1910
714 Ga0496124_0000239 3300048927 Bacteria 106633
715 Ga0496124_0000267 3300048927 Bacteria 101138
716 Ga0496124_0001850 3300048927 Bacteria 29217
717 Ga0496124_0003986 3300048927 Bacteria 17602
718 Ga0496124_0005879 3300048927 Bacteria 13582
719 Ga0496124_0010962 3300048927 Bacteria 9114
720 Ga0496124_0015054 3300048927 Bacteria 7438
721 Ga0496124_0030974 3300048927 Bacteria 4738
722 Ga0496124_0049935 3300048927 Bacteria 3566
723 Ga0496125_0000053 3300048928 Bacteria 279909
724 Ga0496125_0000323 3300048928 Bacteria 93243
725 Ga0496125_0000833 3300048928 Bacteria 49770
726 Ga0496125_0000963 3300048928 Bacteria 45208
727 Ga0496125_0003888 3300048928 Bacteria 17657
728 Ga0496125_0043340 3300048928 Bacteria 3821
729 Ga0496125_0048642 3300048928 Bacteria 3534
730 Ga0496125_0088534 3300048928 Bacteria 2332
731 Ga0496125_0096697 3300048928 Bacteria 2191
732 Ga0496126_0000119 3300048929 Bacteria 184211
733 Ga0496126_0000434 3300048929 Bacteria 83949
734 Ga0496126_0048221 3300048929 Bacteria 3894
735 Ga0496126_0064335 3300048929 Bacteria 3286
736 Ga0496126_0140941 3300048929 Bacteria 2075
737 Ga0501304_001476 3300049160 Bacteria 1516
738 Ga0501031_0000006 3300049568 Bacteria 176019
739 Ga0501031_0018057 3300049568 Bacteria 4588
740 Ga0501032_0000013 3300049569 Bacteria 185070
741 Ga0501032_0000016 3300049569 Bacteria 174688
742 Ga0501032_0017003 3300049569 Bacteria 5110
743 Ga0501033_0000101 3300049570 Bacteria 81870
744 Ga0501033_0000361 3300049570 Bacteria 43373
745 Ga0501033_0000660 3300049570 Bacteria 31872
746 Ga0501033_0009148 3300049570 Bacteria 7635
747 Ga0501034_0000054 3300049571 Bacteria 206373
748 Ga0501034_0000168 3300049571 Bacteria 122667
749 Ga0501034_0000606 3300049571 Bacteria 56542
750 Ga0501034_0007494 3300049571 Bacteria 11606
751 Ga0501034_0014819 3300049571 Bacteria 8019
752 Ga0501034_0019998 3300049571 Bacteria 6837
753 Ga0501034_0036336 3300049571 Bacteria 4990
754 Ga0501034_0043477 3300049571 Bacteria 4546
755 Ga0501034_0056012 3300049571 Bacteria 3968
756 Ga0501034_0066655 3300049571 Bacteria 3613
757 Ga0501034_0216430 3300049571 Bacteria 1869
758 Ga0501036_0000019 3300049572 Bacteria 118632
759 Ga0501036_0000828 3300049572 Bacteria 22938
760 Ga0501036_0006703 3300049572 Bacteria 9358
761 Ga0501036_0074452 3300049572 Bacteria 2872
762 Ga0501036_0102684 3300049572 Bacteria 2418
763 Ga0501036_0127063 3300049572 Bacteria 2153
764 Ga0501037_0000013 3300049573 Bacteria 174688
765 Ga0501037_0000105 3300049573 Bacteria 79431
766 Ga0501037_0005064 3300049573 Bacteria 9586
767 Ga0501037_0006338 3300049573 Bacteria 8651
768 Ga0501037_0031629 3300049573 Bacteria 3908
769 Ga0501038_0000012 3300049574 Bacteria 174688
770 Ga0501038_0001713 3300049574 Bacteria 20369
771 Ga0501038_0016274 3300049574 Bacteria 6742
772 Ga0501038_0045286 3300049574 Bacteria 3819
773 Ga0501038_0133243 3300049574 Bacteria 2038
774 Ga0501038_0193044 3300049574 Bacteria 1638
775 Ga0501039_0000019 3300049575 Bacteria 174688
776 Ga0501039_0000152 3300049575 Bacteria 47363
777 Ga0501039_0010051 3300049575 Bacteria 7214
778 Ga0501039_0222261 3300049575 Bacteria 1484
779 Ga0501040_0000768 3300049576 Bacteria 19948
780 Ga0501041_0024119 3300049577 Bacteria 3650
781 Ga0501041_0030414 3300049577 Bacteria 3259
782 Ga0501042_0003664 3300049578 Bacteria 9689
783 Ga0501043_0000014 3300049579 Bacteria 184687
784 Ga0501043_0000020 3300049579 Bacteria 155270
785 Ga0501043_0000055 3300049579 Bacteria 105522
786 Ga0501043_0000209 3300049579 Bacteria 53858
787 Ga0501043_0030311 3300049579 Bacteria 4250
788 Ga0501043_0059365 3300049579 Bacteria 3002
789 Ga0501046_0000039 3300049580 Bacteria 155237
790 Ga0501046_0020472 3300049580 Bacteria 5468
791 Ga0501047_0000028 3300049581 Bacteria 220279
792 Ga0501047_0003446 3300049581 Bacteria 14959
793 Ga0501047_0005984 3300049581 Bacteria 11433
794 Ga0501047_0008929 3300049581 Bacteria 9463
795 Ga0501047_0011138 3300049581 Bacteria 8510
796 Ga0501047_0020376 3300049581 Bacteria 6369
797 Ga0501047_0067229 3300049581 Bacteria 3454
798 Ga0501047_0124293 3300049581 Bacteria 2460
799 Ga0501048_0005288 3300049582 Bacteria 9833
800 Ga0501068_0010106 3300049584 Bacteria 5295
801 Ga0501069_0000106 3300049585 Bacteria 38605
802 Ga0501069_0037080 3300049585 Bacteria 2690
803 Ga0501070_0000781 3300049586 Bacteria 28933
804 Ga0501070_0001320 3300049586 Bacteria 22173
805 Ga0501070_0003394 3300049586 Bacteria 13824
806 Ga0501070_0005494 3300049586 Bacteria 10816
807 Ga0501070_0005565 3300049586 Bacteria 10743
808 Ga0501070_0016146 3300049586 Bacteria 6276
809 Ga0501071_0001762 3300049587 Bacteria 12758
810 Ga0501071_0032434 3300049587 Bacteria 3709
811 Ga0501073_0003088 3300049589 Bacteria 12485
812 Ga0501073_0030633 3300049589 Bacteria 3840
813 Ga0501073_0063110 3300049589 Bacteria 2584
814 Ga0501074_0000072 3300049590 Bacteria 48714
815 Ga0501074_0005586 3300049590 Bacteria 9047
816 Ga0501074_0027619 3300049590 Bacteria 4115
817 Ga0501075_0068634 3300049591 Bacteria 2679
818 Ga0501076_0052220 3300049592 Bacteria 3238
819 Ga0501207_001043 3300049654 Bacteria 3378
820 Ga0501223_008382 3300049663 Bacteria 2108
821 Ga0501221_000258 3300049704 Bacteria 7794
822 Ga0501079_0171358 3300049741 Bacteria 1693
823 Ga0501080_0000168 3300049742 Bacteria 47595
824 Ga0501080_0000878 3300049742 Bacteria 24606
825 Ga0501080_0007242 3300049742 Bacteria 10012
826 Ga0501080_0024475 3300049742 Bacteria 5595
827 Ga0501080_0048583 3300049742 Bacteria 3949
828 Ga0501080_0121692 3300049742 Bacteria 2418
829 Ga0501080_0240990 3300049742 Bacteria 1651
830 Ga0501080_0289743 3300049742 Bacteria 1487
831 Ga0501083_0000484 3300049744 Bacteria 25530
832 Ga0501083_0003518 3300049744 Bacteria 10971
833 Ga0501083_0060413 3300049744 Bacteria 2532
834 Ga0501232_000308 3300049757 Bacteria 3112
835 Ga0501035_0000019 3300049822 Bacteria 241152
836 Ga0501035_0000081 3300049822 Bacteria 117453
837 Ga0501035_0000183 3300049822 Bacteria 76563
838 Ga0501035_0004384 3300049822 Bacteria 13400
839 Ga0501035_0005434 3300049822 Bacteria 12047
840 Ga0501035_0012030 3300049822 Bacteria 8005
841 Ga0501035_0065881 3300049822 Bacteria 3215
842 Ga0501035_0121647 3300049822 Bacteria 2281
843 Ga0501044_0000009 3300049823 Bacteria 270072
844 Ga0501044_0000029 3300049823 Bacteria 176024
845 Ga0501044_0004154 3300049823 Bacteria 16266
846 Ga0501044_0008796 3300049823 Bacteria 11045
847 Ga0501044_0020961 3300049823 Bacteria 6979
848 Ga0501044_0021041 3300049823 Bacteria 6964
849 Ga0501044_0046742 3300049823 Bacteria 4480
850 Ga0501044_0051933 3300049823 Bacteria 4227
851 Ga0501044_0058456 3300049823 Bacteria 3954
852 Ga0501044_0118233 3300049823 Bacteria 2654
853 Ga0501044_0165798 3300049823 Bacteria 2183
854 Ga0501044_0313781 3300049823 Bacteria 1494
855 Ga0501045_0005518 3300049824 Bacteria 8751
856 Ga0501045_0008620 3300049824 Bacteria 7108
857 Ga0501045_0059823 3300049824 Bacteria 2792
858 nmdc:mga03683_12179_c1 3300050489 Bacteria 3135
859 nmdc:mga03683_55260_c1 3300050489 Bacteria 1667
860 nmdc:mga03683_5535_c1 3300050489 Bacteria 4271
861 nmdc:mga03n38_10877_c1 3300050490 Bacteria 3368
862 nmdc:mga00v17_2647_c1 3300050491 Bacteria 9183
863 nmdc:mga00v17_2942_c2 3300050491 Bacteria 5598
864 nmdc:mga00v17_337_c1 3300050491 Bacteria 26383
865 nmdc:mga00v17_67377_c1 3300050491 Bacteria 2212
866 nmdc:mga0yw44_16598_c1 3300050492 Bacteria 3982
867 nmdc:mga0yw44_2133_c1 3300050492 Bacteria 8297
868 nmdc:mga0yw44_44224_c1 3300050492 Bacteria 2663
869 nmdc:mga0k408_50586_c1 3300050493 Bacteria 2406
870 nmdc:mga0k408_7537_c1 3300050493 Bacteria 5813
871 nmdc:mga06z11_40796_c1 3300050494 Bacteria 2319
872 nmdc:mga06z11_51034_c1 3300050494 Bacteria 2116
873 nmdc:mga06z11_63975_c1 3300050494 Bacteria 1926
874 nmdc:mga07m45_37856_c1 3300050496 Bacteria 2691
875 nmdc:mga07m45_39431_c1 3300050496 Bacteria 2067
876 nmdc:mga07m45_5037_c1 3300050496 Bacteria 6529
877 nmdc:mga07m45_57439_c1 3300050496 Bacteria 2200
878 nmdc:mga07m45_62749_c1 3300050496 Bacteria 2107
879 nmdc:mga05p37_227_c1 3300050507 Bacteria 57142
880 nmdc:mga05p37_43104_c1 3300050507 Bacteria 5549
881 nmdc:mga09592_139472_c1 3300050508 Bacteria 2089
882 nmdc:mga09592_578_c1 3300050508 Bacteria 27739
883 nmdc:mga0qj67_12914_c1 3300050509 Bacteria 6302
884 nmdc:mga0qj67_9436_c1 3300050509 Bacteria 7263
885 nmdc:mga06r32_10595_c1 3300050510 Bacteria 8313
886 nmdc:mga08y16_10250_c1 3300050511 Bacteria 9835
887 nmdc:mga08y16_12387_c1 3300050511 Bacteria 8969
888 nmdc:mga08y16_184793_c1 3300050511 Bacteria 2164
889 nmdc:mga0n895_99514_c1 3300050512 Bacteria 2916
890 nmdc:mga08x19_86102_c1 3300050514 Bacteria 2068
891 nmdc:mga0a205_50322_c1 3300050515 Bacteria 4022
892 nmdc:mga0sz30_74_c2 3300050516 Bacteria 23106
893 Ga0500578_0011996 3300053086 Bacteria 5597
894 Ga0500643_000278 3300053087 Bacteria 44354
895 Ga0500647_0012446 3300053091 Bacteria 3831
896 Ga0500647_0031354 3300053091 Bacteria 2530
897 Ga0500583_0056561 3300053092 Bacteria 1839
898 Ga0500566_0000565 3300053094 Bacteria 20802
899 Ga0500555_018996 3300053103 Bacteria 1981
900 Ga0500556_0000148 3300053104 Bacteria 58772
901 Ga0500557_000028 3300053105 Bacteria 78414
902 Ga0500560_000303 3300053107 Bacteria 6267
903 Ga0500595_002261 3300053119 Bacteria 9727
904 Ga0500597_009019 3300053120 Bacteria 3487
905 Ga0500608_002836 3300053122 Bacteria 6402
906 Ga0500618_000109 3300053125 Bacteria 66318
907 Ga0500618_000114 3300053125 Bacteria 65602
908 Ga0500618_000249 3300053125 Bacteria 42747
909 Ga0500618_001997 3300053125 Bacteria 8320
910 Ga0500642_0000189 3300053130 Bacteria 25159
911 Ga0500658_0001045 3300053134 Bacteria 11320
912 Ga0500561_0000118 3300053137 Bacteria 15316
913 Ga0500568_0000035 3300053139 Bacteria 137912
914 Ga0500573_0010491 3300053140 Bacteria 5170
915 Ga0500590_005965 3300053148 Bacteria 5905
916 Ga0500604_0000141 3300053151 Bacteria 21444
917 Ga0500616_0002051 3300053153 Bacteria 17701
918 Ga0500616_0014986 3300053153 Bacteria 4442
919 Ga0500616_0079814 3300053153 Bacteria 1646
920 Ga0500622_0000101 3300053156 Bacteria 86856
921 Ga0500622_0005319 3300053156 Bacteria 7761
922 Ga0500622_0037789 3300053156 Bacteria 2521
923 Ga0500624_000988 3300053157 Bacteria 5766
924 Ga0500634_0000029 3300053161 Bacteria 77702
925 Ga0500634_0011815 3300053161 Bacteria 4522
926 Ga0500636_0000005 3300053177 Bacteria 197561
927 Ga0500636_0003484 3300053177 Bacteria 8862
928 Ga0500636_0007269 3300053177 Bacteria 6401
929 Ga0500637_0063963 3300053178 Bacteria 2110
930 Ga0501084_0013761 3300054114 Bacteria 6695
931 Ga0501082_0020797 3300060353 Bacteria 5659
932 Ga0501082_0082547 3300060353 Bacteria 2773
933 Ga0530510_0004233 3300061734 Bacteria 9919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0171358 Ga0501079_0171358_462_1676 396
2 3300006844 Ga0075428_100136008 Ga0075428_1001360082 399
3 3300025949 Ga0207667_10128396 Ga0207667_101283962 412
4 iso_pu_bacteria 8019638758 8019639748 415
5 3300005339 Ga0070660_100054946 Ga0070660_1000549463 417
6 3300005356 Ga0070674_100011633 Ga0070674_1000116332 417
7 3300005366 Ga0070659_100027085 Ga0070659_1000270851 417
8 3300005366 Ga0070659_100121682 Ga0070659_1001216821 417
9 3300005459 Ga0068867_100197022 Ga0068867_1001970221 417
10 3300005563 Ga0068855_100102801 Ga0068855_1001028012 417
11 3300005578 Ga0068854_100031826 Ga0068854_1000318262 417
12 3300010375 Ga0105239_10193678 Ga0105239_101936781 417
13 3300025907 Ga0207645_10068247 Ga0207645_100682472 417
14 3300025919 Ga0207657_10047345 Ga0207657_100473452 417
15 3300026067 Ga0207678_10066999 Ga0207678_100669994 417
16 3300026089 Ga0207648_10061039 Ga0207648_100610393 417
17 3300026121 Ga0207683_10099602 Ga0207683_100996022 417
18 3300026142 Ga0207698_10011740 Ga0207698_100117402 417
19 3300049822 Ga0501035_0121647 Ga0501035_0121647_81_1388 417
20 3300049823 Ga0501044_0118233 Ga0501044_0118233_829_2136 417
21 3300046684 Ga0495669_0005090 Ga0495669_0005090_448_1710 418
22 iso_pu_bacteria 2510461069 2510843724 418
23 3300039062 Ga0400483_064975 Ga0400483_064975_1016_2302 421
24 3300031995 Ga0307409_100220500 Ga0307409_1002205002 424
25 3300046519 Ga0495632_0088894 Ga0495632_0088894_42_1352 424
26 3300021361 Ga0213872_10001461 Ga0213872_100014616 426
27 3300025256 Ga0209759_1018251 Ga0209759_10182512 426
28 3300035118 Ga0373954_0023299 Ga0373954_0023299_1152_2474 426
29 3300035695 Ga0373927_0002755 Ga0373927_0002755_3768_5090 426
30 3300035725 Ga0373947_0040262 Ga0373947_0040262_993_2315 426
31 3300036401 Ga0373937_0112708 Ga0373937_0112708_890_2212 426
32 3300046477 Ga0495664_0044386 Ga0495664_0044386_1176_2498 426
33 3300047319 Ga0495674_0017990 Ga0495674_0017990_4344_5666 426
34 3300044842 Ga0466957_0107580 Ga0466957_0107580_185_1492 427
35 3300005355 Ga0070671_100004121 Ga0070671_1000041219 428
36 3300005458 Ga0070681_10004145 Ga0070681_1000414512 428
37 3300013306 Ga0163162_10247511 Ga0163162_102475112 428
38 3300017792 Ga0163161_10114681 Ga0163161_101146812 428
39 3300025912 Ga0207707_10056350 Ga0207707_100563502 428
40 3300046522 Ga0495643_0024126 Ga0495643_0024126_267_1556 428
41 3300048904 Ga0496101_0188164 Ga0496101_0188164_226_1515 428
42 3300048905 Ga0496102_0003383 Ga0496102_0003383_10290_11579 428
43 3300048913 Ga0496110_0041076 Ga0496110_0041076_1516_2805 428
44 3300048922 Ga0496119_0007759 Ga0496119_0007759_6767_8056 428
45 3300005434 Ga0070709_10030239 Ga0070709_100302392 429
46 3300046543 Ga0495645_0022443 Ga0495645_0022443_485_1780 429
47 3300046559 Ga0495667_0106671 Ga0495667_0106671_344_1639 429
48 3300047471 Ga0495684_0175369 Ga0495684_0175369_236_1531 429
49 iso_pu_bacteria 2854681122 2854684494 429
50 iso_pu_bacteria 2898795034 2898795579 429
51 iso_pu_bacteria 2899275550 2899279582 429
52 iso_pu_bacteria 2919679072 2919682087 429
53 iso_pu_bacteria 3000017691 3000021180 429
54 iso_pu_bacteria 3000405567 3000406144 429
55 3300009094 Ga0111539_10021065 Ga0111539_100210655 430
56 3300027907 Ga0207428_10024756 Ga0207428_100247563 430
57 3300050511 nmdc:mga08y16_10250_c1 nmdc:mga08y16_10250_c1_2827_4152 430
58 iso_pu_bacteria 2840878972 2840883197 430
59 3300005338 Ga0068868_100176670 Ga0068868_1001766702 431
60 3300026023 Ga0207677_10182273 Ga0207677_101822731 431
61 3300035090 Ga0373949_0000018 Ga0373949_0000018_49039_50355 431
62 3300044712 Ga0453684_0054469 Ga0453684_0054469_1317_2633 431
63 iso_pu_bacteria 2534681786 2535484304 431
64 iso_pu_bacteria 2551306092 2551737937 431
65 iso_pu_bacteria 2558860983 2561468035 431
66 iso_pu_bacteria 2582581283 2585168092 431
67 iso_pu_bacteria 2582581306 2585269700 431
68 iso_pu_bacteria 2582581865 2585388638 431
69 iso_pu_bacteria 2599185156 2599334699 431
70 iso_pu_bacteria 2643221580 2643910958 431
71 iso_pu_bacteria 2643221591 2643966668 431
72 iso_pu_bacteria 2643221607 2644048367 431
73 iso_pu_bacteria 2643221629 2644164613 431
74 iso_pu_bacteria 2643221636 2644201729 431
75 iso_pu_bacteria 2643221637 2644209835 431
76 iso_pu_bacteria 2643221662 2644346115 431
77 iso_pu_bacteria 2643221674 2644412202 431
78 iso_pu_bacteria 2643221686 2644481169 431
79 iso_pu_bacteria 2643221688 2644496425 431
80 iso_pu_bacteria 2643221689 2644500138 431
81 iso_pu_bacteria 2643221718 2644653386 431
82 iso_pu_bacteria 2751185800 2753357627 431
83 iso_pu_bacteria 2758568016 2758640202 431
84 iso_pu_bacteria 2791355092 2792625667 431
85 iso_pu_bacteria 2791355253 2793281580 431
86 iso_pu_bacteria 2842922631 2842925823 431
87 iso_pu_bacteria 2854911287 2854913441 431
88 iso_pu_bacteria 2932401849 2932405585 431
89 iso_pu_bacteria 8005658619 8005661715 431
90 iso_pu_bacteria 8055431914 8055431999 431
91 3300006353 Ga0075370_10041128 Ga0075370_100411282 432
92 3300014968 Ga0157379_10066537 Ga0157379_100665372 432
93 iso_pu_bacteria 2503198000 2503198449 432
94 iso_pu_bacteria 2508501122 2509110212 432
95 iso_pu_bacteria 2508501123 2509114061 432
96 iso_pu_bacteria 2508501127 2509140682 432
97 iso_pu_bacteria 2509276018 2509368469 432
98 iso_pu_bacteria 2509276019 2509378946 432
99 iso_pu_bacteria 2509276021 2509389781 432
100 iso_pu_bacteria 2509276022 2509393565 432
101 iso_pu_bacteria 2509276033 2509447965 432
102 iso_pu_bacteria 2510065019 2510134903 432
103 iso_pu_bacteria 2510065057 2510303744 432
104 iso_pu_bacteria 2510065059 2510314751 432
105 iso_pu_bacteria 2510461076 2510896314 432
106 iso_pu_bacteria 2510917022 2511136506 432
107 iso_pu_bacteria 2510917028 2511187244 432
108 iso_pu_bacteria 2510917030 2511195946 432
109 iso_pu_bacteria 2511231027 2511391679 432
110 iso_pu_bacteria 2511231052 2511503041 432
111 iso_pu_bacteria 2512047086 2512534305 432
112 iso_pu_bacteria 2512875016 2512934087 432
113 iso_pu_bacteria 2512875024 2512960705 432
114 iso_pu_bacteria 2512875024 2512962377 432
115 iso_pu_bacteria 2512875026 2512973874 432
116 iso_pu_bacteria 2513237084 2513572666 432
117 iso_pu_bacteria 2513237085 2513580102 432
118 iso_pu_bacteria 2513237086 2513585986 432
119 iso_pu_bacteria 2513237088 2513599852 432
120 iso_pu_bacteria 2513237089 2513602409 432
121 iso_pu_bacteria 2513237090 2513613455 432
122 iso_pu_bacteria 2513237091 2513617210 432
123 iso_pu_bacteria 2513237093 2513631258 432
124 iso_pu_bacteria 2513237103 2513710847 432
125 iso_pu_bacteria 2513237138 2513867019 432
126 iso_pu_bacteria 2513237140 2513882951 432
127 iso_pu_bacteria 2513237143 2513902980 432
128 iso_pu_bacteria 2513237144 2513908124 432
129 iso_pu_bacteria 2513237146 2513927006 432
130 iso_pu_bacteria 2513237156 2513985719 432
131 iso_pu_bacteria 2513237159 2513998144 432
132 iso_pu_bacteria 2513237160 2514004052 432
133 iso_pu_bacteria 2513237162 2514023204 432
134 iso_pu_bacteria 2513237164 2514038663 432
135 iso_pu_bacteria 2513237305 2514419209 432
136 iso_pu_bacteria 2513237351 2514587318 432
137 iso_pu_bacteria 2515075009 2515113986 432
138 iso_pu_bacteria 2515154107 2515610275 432
139 iso_pu_bacteria 2515154113 2515639179 432
140 iso_pu_bacteria 2515154114 2515642967 432
141 iso_pu_bacteria 2515154116 2515656713 432
142 iso_pu_bacteria 2515154134 2515743656 432
143 iso_pu_bacteria 2516143018 2516205305 432
144 iso_pu_bacteria 2516653046 2516894445 432
145 iso_pu_bacteria 2516653077 2517037618 432
146 iso_pu_bacteria 2516653085 2517077905 432
147 iso_pu_bacteria 2517093000 2517096701 432
148 iso_pu_bacteria 2517287029 2517410416 432
149 iso_pu_bacteria 2517487022 2517571064 432
150 iso_pu_bacteria 2519899620 2520381351 432
151 iso_pu_bacteria 2524023207 2524451928 432
152 iso_pu_bacteria 2524023209 2524460018 432
153 iso_pu_bacteria 2529292951 2530647014 432
154 iso_pu_bacteria 2534681796 2535519357 432
155 iso_pu_bacteria 2537561587 2537876144 432
156 iso_pu_bacteria 2551306084 2551679856 432
157 iso_pu_bacteria 2551306085 2551689726 432
158 iso_pu_bacteria 2551306086 2551692475 432
159 iso_pu_bacteria 2551306087 2551698140 432
160 iso_pu_bacteria 2551306089 2551708896 432
161 iso_pu_bacteria 2551306090 2551717118 432
162 iso_pu_bacteria 2551306091 2551724651 432
163 iso_pu_bacteria 2551306093 2551745716 432
164 iso_pu_bacteria 2554235003 2554244536 432
165 iso_pu_bacteria 2558860100 2558860458 432
166 iso_pu_bacteria 2558860242 2559297622 432
167 iso_pu_bacteria 2582581294 2585202402 432
168 iso_pu_bacteria 2582581298 2585224718 432
169 iso_pu_bacteria 2582581299 2585227892 432
170 iso_pu_bacteria 2582581304 2585255528 432
171 iso_pu_bacteria 2582581307 2585274335 432
172 iso_pu_bacteria 2582581308 2585280252 432
173 iso_pu_bacteria 2582581315 2585322529 432
174 iso_pu_bacteria 2582581316 2585335143 432
175 iso_pu_bacteria 2582581866 2585392486 432
176 iso_pu_bacteria 2582581867 2585402294 432
177 iso_pu_bacteria 2585427526 2585529017 432
178 iso_pu_bacteria 2585427527 2585532481 432
179 iso_pu_bacteria 2585427528 2585540958 432
180 iso_pu_bacteria 2585427529 2585547274 432
181 iso_pu_bacteria 2585427530 2585554502 432
182 iso_pu_bacteria 2585427531 2585560784 432
183 iso_pu_bacteria 2585427590 2585822406 432
184 iso_pu_bacteria 2585427593 2585839720 432
185 iso_pu_bacteria 2585427594 2585845458 432
186 iso_pu_bacteria 2585427608 2585898985 432
187 iso_pu_bacteria 2585427609 2585903421 432
188 iso_pu_bacteria 2585427633 2585997222 432
189 iso_pu_bacteria 2585427634 2586001823 432
190 iso_pu_bacteria 2585428125 2587981460 432
191 iso_pu_bacteria 2588253730 2588520228 432
192 iso_pu_bacteria 2599185170 2599420500 432
193 iso_pu_bacteria 2599185210 2599606206 432
194 iso_pu_bacteria 2599185236 2599720051 432
195 iso_pu_bacteria 2599185301 2599935402 432
196 iso_pu_bacteria 2599185352 2600194145 432
197 iso_pu_bacteria 2600254933 2600373583 432
198 iso_pu_bacteria 2600255279 2601612417 432
199 iso_pu_bacteria 2600255308 2601748958 432
200 iso_pu_bacteria 2615840624 2616295621 432
201 iso_pu_bacteria 2615840626 2616307448 432
202 iso_pu_bacteria 2615840698 2616554992 432
203 iso_pu_bacteria 2617270742 2617383447 432
204 iso_pu_bacteria 2643221550 2643772387 432
205 iso_pu_bacteria 2643221551 2643774494 432
206 iso_pu_bacteria 2643221555 2643792939 432
207 iso_pu_bacteria 2643221557 2643809713 432
208 iso_pu_bacteria 2643221558 2643813296 432
209 iso_pu_bacteria 2643221564 2643838305 432
210 iso_pu_bacteria 2643221568 2643856410 432
211 iso_pu_bacteria 2643221582 2643922259 432
212 iso_pu_bacteria 2643221595 2643983850 432
213 iso_pu_bacteria 2643221599 2644006522 432
214 iso_pu_bacteria 2643221610 2644063893 432
215 iso_pu_bacteria 2643221618 2644106618 432
216 iso_pu_bacteria 2643221623 2644133403 432
217 iso_pu_bacteria 2643221626 2644149590 432
218 iso_pu_bacteria 2643221627 2644155982 432
219 iso_pu_bacteria 2643221634 2644195965 432
220 iso_pu_bacteria 2643221639 2644218088 432
221 iso_pu_bacteria 2643221643 2644241938 432
222 iso_pu_bacteria 2643221646 2644260892 432
223 iso_pu_bacteria 2643221653 2644299303 432
224 iso_pu_bacteria 2643221655 2644309692 432
225 iso_pu_bacteria 2643221659 2644333363 432
226 iso_pu_bacteria 2643221668 2644381415 432
227 iso_pu_bacteria 2643221675 2644415726 432
228 iso_pu_bacteria 2643221680 2644448766 432
229 iso_pu_bacteria 2643221693 2644522724 432
230 iso_pu_bacteria 2643221698 2644543547 432
231 iso_pu_bacteria 2643221712 2644618139 432
232 iso_pu_bacteria 2643221719 2644657531 432
233 iso_pu_bacteria 2643221723 2644676686 432
234 iso_pu_bacteria 2643221726 2644686840 432
235 iso_pu_bacteria 2657244999 2657684463 432
236 iso_pu_bacteria 2667528174 2671112240 432
237 iso_pu_bacteria 2687453392 2688595723 432
238 iso_pu_bacteria 2693429783 2694628110 432
239 iso_pu_bacteria 2693429784 2694641033 432
240 iso_pu_bacteria 2718217882 2719182655 432
241 iso_pu_bacteria 2718217927 2719387326 432
242 iso_pu_bacteria 2718217997 2719666971 432
243 iso_pu_bacteria 2718218009 2719733373 432
244 iso_pu_bacteria 2718218199 2720493391 432
245 iso_pu_bacteria 2718218232 2720614862 432
246 iso_pu_bacteria 2718218233 2720621635 432
247 iso_pu_bacteria 2718218235 2720632963 432
248 iso_pu_bacteria 2718218269 2720776687 432
249 iso_pu_bacteria 2718218363 2721148768 432
250 iso_pu_bacteria 2718218365 2721160152 432
251 iso_pu_bacteria 2718218366 2721165581 432
252 iso_pu_bacteria 2718218423 2721400961 432
253 iso_pu_bacteria 2721755514 2722841751 432
254 iso_pu_bacteria 2721755556 2723028275 432
255 iso_pu_bacteria 2721755684 2723561903 432
256 iso_pu_bacteria 2721755685 2723568535 432
257 iso_pu_bacteria 2721755686 2723572869 432
258 iso_pu_bacteria 2721755809 2724039774 432
259 iso_pu_bacteria 2721755810 2724046129 432
260 iso_pu_bacteria 2721755819 2724091294 432
261 iso_pu_bacteria 2721755822 2724105800 432
262 iso_pu_bacteria 2721755823 2724111626 432
263 iso_pu_bacteria 2724679232 2725945406 432
264 iso_pu_bacteria 2728369352 2730109211 432
265 iso_pu_bacteria 2728369365 2730165890 432
266 iso_pu_bacteria 2728369397 2730299784 432
267 iso_pu_bacteria 2738541293 2738804794 432
268 iso_pu_bacteria 2738541317 2738944564 432
269 iso_pu_bacteria 2738541333 2739035515 432
270 iso_pu_bacteria 2738543024 2739309492 432
271 iso_pu_bacteria 2751185821 2753461031 432
272 iso_pu_bacteria 2756170246 2756674792 432
273 iso_pu_bacteria 2757320392 2757572454 432
274 iso_pu_bacteria 2765235802 2765467761 432
275 iso_pu_bacteria 2765235942 2766065262 432
276 iso_pu_bacteria 2767802442 2770197837 432
277 iso_pu_bacteria 2775506902 2776269087 432
278 iso_pu_bacteria 2775506904 2776283774 432
279 iso_pu_bacteria 2775507049 2776914626 432
280 iso_pu_bacteria 2775507266 2778176059 432
281 iso_pu_bacteria 2791355082 2792582505 432
282 iso_pu_bacteria 2791355091 2792624331 432
283 iso_pu_bacteria 2791355094 2792642777 432
284 iso_pu_bacteria 2791355123 2792746906 432
285 iso_pu_bacteria 2791355256 2793293564 432
286 iso_pu_bacteria 2791355259 2793313017 432
287 iso_pu_bacteria 2791355260 2793319664 432
288 iso_pu_bacteria 2791355261 2793327837 432
289 iso_pu_bacteria 2791355262 2793333451 432
290 iso_pu_bacteria 2791355263 2793342028 432
291 iso_pu_bacteria 2791355264 2793347429 432
292 iso_pu_bacteria 2791355265 2793353760 432
293 iso_pu_bacteria 2791355266 2793359640 432
294 iso_pu_bacteria 2791355267 2793369390 432
295 iso_pu_bacteria 2802428858 2802717846 432
296 iso_pu_bacteria 2802428859 2802725303 432
297 iso_pu_bacteria 2802428860 2802730573 432
298 iso_pu_bacteria 2802428861 2802737920 432
299 iso_pu_bacteria 2802428862 2802744210 432
300 iso_pu_bacteria 2802428863 2802753105 432
301 iso_pu_bacteria 2802429268 2804753366 432
302 iso_pu_bacteria 2802429605 2805929465 432
303 iso_pu_bacteria 2802429606 2805935354 432
304 iso_pu_bacteria 2802429633 2806044501 432
305 iso_pu_bacteria 2802429634 2806052702 432
306 iso_pu_bacteria 2802429635 2806059002 432
307 iso_pu_bacteria 2802429636 2806068335 432
308 iso_pu_bacteria 2802429637 2806074455 432
309 iso_pu_bacteria 2808606387 2808989131 432
310 iso_pu_bacteria 2818991272 2819243872 432
311 iso_pu_bacteria 2818991439 2819557670 432
312 iso_pu_bacteria 2818991448 2819609553 432
313 iso_pu_bacteria 2818991453 2819639651 432
314 iso_pu_bacteria 2818991461 2819686497 432
315 iso_pu_bacteria 2821123053 2821126225 432
316 iso_pu_bacteria 2837651117 2837651873 432
317 iso_pu_bacteria 2837678835 2837681621 432
318 iso_pu_bacteria 2838016132 2838019167 432
319 iso_pu_bacteria 2838022645 2838024242 432
320 iso_pu_bacteria 2838029111 2838033180 432
321 iso_pu_bacteria 2838035591 2838040828 432
322 iso_pu_bacteria 2838042994 2838047418 432
323 iso_pu_bacteria 2838048938 2838051114 432
324 iso_pu_bacteria 2838061910 2838063907 432
325 iso_pu_bacteria 2838068647 2838073392 432
326 iso_pu_bacteria 2838074704 2838077489 432
327 iso_pu_bacteria 2838661181 2838664781 432
328 iso_pu_bacteria 2838668709 2838671075 432
329 iso_pu_bacteria 2838675328 2838679947 432
330 iso_pu_bacteria 2838680041 2838684896 432
331 iso_pu_bacteria 2838686498 2838691259 432
332 iso_pu_bacteria 2838694306 2838699267 432
333 iso_pu_bacteria 2838701080 2838703746 432
334 iso_pu_bacteria 2838707686 2838712748 432
335 iso_pu_bacteria 2838714209 2838717744 432
336 iso_pu_bacteria 2838719591 2838724518 432
337 iso_pu_bacteria 2838724970 2838729540 432
338 iso_pu_bacteria 2838729681 2838735742 432
339 iso_pu_bacteria 2838736955 2838737301 432
340 iso_pu_bacteria 2838742623 2838748644 432
341 iso_pu_bacteria 2839993093 2839993735 432
342 iso_pu_bacteria 2840764183 2840766762 432
343 iso_pu_bacteria 2841734538 2841736143 432
344 iso_pu_bacteria 2841840854 2841842330 432
345 iso_pu_bacteria 2841846520 2841849977 432
346 iso_pu_bacteria 2841851746 2841853921 432
347 iso_pu_bacteria 2841859092 2841864257 432
348 iso_pu_bacteria 2841864319 2841868111 432
349 iso_pu_bacteria 2842077413 2842082225 432
350 iso_pu_bacteria 2842110456 2842113374 432
351 iso_pu_bacteria 2842118031 2842123150 432
352 iso_pu_bacteria 2842124991 2842128449 432
353 iso_pu_bacteria 2842130223 2842134629 432
354 iso_pu_bacteria 2842140634 2842142109 432
355 iso_pu_bacteria 2842146304 2842151255 432
356 iso_pu_bacteria 2842152218 2842156539 432
357 iso_pu_bacteria 2842156927 2842162561 432
358 iso_pu_bacteria 2842163707 2842170011 432
359 iso_pu_bacteria 2842170452 2842173989 432
360 iso_pu_bacteria 2842175837 2842180160 432
361 iso_pu_bacteria 2842180545 2842184998 432
362 iso_pu_bacteria 2842187318 2842192159 432
363 iso_pu_bacteria 2842192696 2842198200 432
364 iso_pu_bacteria 2842198810 2842199784 432
365 iso_pu_bacteria 2842205361 2842208376 432
366 iso_pu_bacteria 2842211629 2842216561 432
367 iso_pu_bacteria 2842217011 2842220016 432
368 iso_pu_bacteria 2842224351 2842229195 432
369 iso_pu_bacteria 2842229732 2842235629 432
370 iso_pu_bacteria 2842237096 2842241950 432
371 iso_pu_bacteria 2842243621 2842249337 432
372 iso_pu_bacteria 2842250916 2842256311 432
373 iso_pu_bacteria 2842257432 2842263526 432
374 iso_pu_bacteria 2842264693 2842266667 432
375 iso_pu_bacteria 2842271015 2842275734 432
376 iso_pu_bacteria 2842278818 2842281615 432
377 iso_pu_bacteria 2842285085 2842288738 432
378 iso_pu_bacteria 2842291075 2842296226 432
379 iso_pu_bacteria 2842298080 2842298758 432
380 iso_pu_bacteria 2842304105 2842308282 432
381 iso_pu_bacteria 2842311132 2842316437 432
382 iso_pu_bacteria 2842317721 2842321324 432
383 iso_pu_bacteria 2842341865 2842345069 432
384 iso_pu_bacteria 2842357229 2842359374 432
385 iso_pu_bacteria 2842363717 2842369185 432
386 iso_pu_bacteria 2842370503 2842375572 432
387 iso_pu_bacteria 2842377471 2842382626 432
388 iso_pu_bacteria 2842384541 2842390027 432
389 iso_pu_bacteria 2842395702 2842398449 432
390 iso_pu_bacteria 2842402390 2842406595 432
391 iso_pu_bacteria 2842409023 2842412978 432
392 iso_pu_bacteria 2842415677 2842419621 432
393 iso_pu_bacteria 2842422224 2842427027 432
394 iso_pu_bacteria 2842428310 2842429986 432
395 iso_pu_bacteria 2842434925 2842436354 432
396 iso_pu_bacteria 2842441272 2842444057 432
397 iso_pu_bacteria 2842447887 2842451090 432
398 iso_pu_bacteria 2842462802 2842464407 432
399 iso_pu_bacteria 2842469257 2842470683 432
400 iso_pu_bacteria 2842475841 2842479913 432
401 iso_pu_bacteria 2842482326 2842483340 432
402 iso_pu_bacteria 2842489311 2842493338 432
403 iso_pu_bacteria 2842495871 2842499090 432
404 iso_pu_bacteria 2842502639 2842507089 432
405 iso_pu_bacteria 2842509118 2842510786 432
406 iso_pu_bacteria 2842515876 2842520996 432
407 iso_pu_bacteria 2842521101 2842523249 432
408 iso_pu_bacteria 2842871566 2842875265 432
409 iso_pu_bacteria 2844002411 2844003732 432
410 iso_pu_bacteria 2844009547 2844010530 432
411 iso_pu_bacteria 2844163670 2844167670 432
412 iso_pu_bacteria 2844454524 2844457433 432
413 iso_pu_bacteria 2847417321 2847420500 432
414 iso_pu_bacteria 2847670302 2847673238 432
415 iso_pu_bacteria 2847686936 2847689749 432
416 iso_pu_bacteria 2848992105 2848995372 432
417 iso_pu_bacteria 2850079185 2850082357 432
418 iso_pu_bacteria 2852387548 2852391273 432
419 iso_pu_bacteria 2854896431 2854897340 432
420 iso_pu_bacteria 2854916844 2854921526 432
421 iso_pu_bacteria 2855825444 2855827081 432
422 iso_pu_bacteria 2855839649 2855842478 432
423 iso_pu_bacteria 2855872281 2855878373 432
424 iso_pu_bacteria 2856314179 2856319293 432
425 iso_pu_bacteria 2856320880 2856322102 432
426 iso_pu_bacteria 2856320880 2856322195 432
427 iso_pu_bacteria 2856328259 2856332790 432
428 iso_pu_bacteria 2856334872 2856335790 432
429 iso_pu_bacteria 2856342000 2856342769 432
430 iso_pu_bacteria 2856349417 2856351911 432
431 iso_pu_bacteria 2856356410 2856363804 432
432 iso_pu_bacteria 2856364286 2856370126 432
433 iso_pu_bacteria 2857349434 2857352690 432
434 iso_pu_bacteria 2857367948 2857369137 432
435 iso_pu_bacteria 2857516855 2857518842 432
436 iso_pu_bacteria 2857531043 2857532786 432
437 iso_pu_bacteria 2858800743 2858803294 432
438 iso_pu_bacteria 2869162929 2869164826 432
439 iso_pu_bacteria 2869169390 2869171999 432
440 iso_pu_bacteria 2869234852 2869242030 432
441 iso_pu_bacteria 2869242130 2869248778 432
442 iso_pu_bacteria 2869249662 2869251596 432
443 iso_pu_bacteria 2869256925 2869259990 432
444 iso_pu_bacteria 2869264136 2869266239 432
445 iso_pu_bacteria 2869271264 2869274101 432
446 iso_pu_bacteria 2869278585 2869284710 432
447 iso_pu_bacteria 2869285874 2869290922 432
448 iso_pu_bacteria 2871429161 2871433204 432
449 iso_pu_bacteria 2871435913 2871441727 432
450 iso_pu_bacteria 2871451962 2871453391 432
451 iso_pu_bacteria 2871459585 2871466710 432
452 iso_pu_bacteria 2871466892 2871470205 432
453 iso_pu_bacteria 2871474448 2871478952 432
454 iso_pu_bacteria 2871488783 2871491097 432
455 iso_pu_bacteria 2871495908 2871500841 432
456 iso_pu_bacteria 2874102143 2874102176 432
457 iso_pu_bacteria 2874109183 2874113427 432
458 iso_pu_bacteria 2874116593 2874123441 432
459 iso_pu_bacteria 2874123672 2874131489 432
460 iso_pu_bacteria 2874131515 2874137401 432
461 iso_pu_bacteria 2874139085 2874139601 432
462 iso_pu_bacteria 2874139085 2874142970 432
463 iso_pu_bacteria 2874146452 2874153635 432
464 iso_pu_bacteria 2874155637 2874160900 432
465 iso_pu_bacteria 2874162495 2874168412 432
466 iso_pu_bacteria 2874168670 2874172132 432
467 iso_pu_bacteria 2876363079 2876363655 432
468 iso_pu_bacteria 2876369609 2876372654 432
469 iso_pu_bacteria 2876377896 2876380127 432
470 iso_pu_bacteria 2876386047 2876391280 432
471 iso_pu_bacteria 2876392853 2876397275 432
472 iso_pu_bacteria 2876399893 2876404107 432
473 iso_pu_bacteria 2876406927 2876412539 432
474 iso_pu_bacteria 2876413966 2876418940 432
475 iso_pu_bacteria 2876420981 2876421441 432
476 iso_pu_bacteria 2878035449 2878039682 432
477 iso_pu_bacteria 2878730984 2878733171 432
478 iso_pu_bacteria 2878738818 2878740961 432
479 iso_pu_bacteria 2878745973 2878750817 432
480 iso_pu_bacteria 2878753008 2878755506 432
481 iso_pu_bacteria 2878760144 2878764910 432
482 iso_pu_bacteria 2878767105 2878772032 432
483 iso_pu_bacteria 2878774303 2878779051 432
484 iso_pu_bacteria 2878781027 2878783684 432
485 iso_pu_bacteria 2881147464 2881147958 432
486 iso_pu_bacteria 2881155292 2881158995 432
487 iso_pu_bacteria 2881161766 2881164742 432
488 iso_pu_bacteria 2881845957 2881847220 432
489 iso_pu_bacteria 2881853255 2881857901 432
490 iso_pu_bacteria 2881861095 2881864017 432
491 iso_pu_bacteria 2882632389 2882634758 432
492 iso_pu_bacteria 2882912400 2882914726 432
493 iso_pu_bacteria 2885305155 2885306575 432
494 iso_pu_bacteria 2885312484 2885314402 432
495 iso_pu_bacteria 2885318864 2885324361 432
496 iso_pu_bacteria 2885326080 2885332383 432
497 iso_pu_bacteria 2885334103 2885336769 432
498 iso_pu_bacteria 2885342637 2885346540 432
499 iso_pu_bacteria 2885350715 2885352488 432
500 iso_pu_bacteria 2888337043 2888343434 432
501 iso_pu_bacteria 2888343758 2888344108 432
502 iso_pu_bacteria 2888350351 2888352876 432
503 iso_pu_bacteria 2889010040 2889014648 432
504 iso_pu_bacteria 2889016732 2889020365 432
505 iso_pu_bacteria 2889790730 2889792612 432
506 iso_pu_bacteria 2889914905 2889919160 432
507 iso_pu_bacteria 2891048133 2891049270 432
508 iso_pu_bacteria 2891373044 2891377467 432
509 iso_pu_bacteria 2894652903 2894653317 432
510 iso_pu_bacteria 2896384573 2896387665 432
511 iso_pu_bacteria 2899792073 2899793140 432
512 iso_pu_bacteria 2899803654 2899805195 432
513 iso_pu_bacteria 2899845264 2899849656 432
514 iso_pu_bacteria 2903448605 2903454260 432
515 iso_pu_bacteria 2903492973 2903499019 432
516 iso_pu_bacteria 2903492973 2903501473 432
517 iso_pu_bacteria 2903513507 2903520959 432
518 iso_pu_bacteria 2903521522 2903523284 432
519 iso_pu_bacteria 2903528002 2903529323 432
520 iso_pu_bacteria 2903540706 2903545654 432
521 iso_pu_bacteria 2904578770 2904579558 432
522 iso_pu_bacteria 2904659560 2904664029 432
523 iso_pu_bacteria 2906308376 2906313742 432
524 iso_pu_bacteria 2906321335 2906326451 432
525 iso_pu_bacteria 2906328253 2906334944 432
526 iso_pu_bacteria 2906354277 2906360214 432
527 iso_pu_bacteria 2906363423 2906369157 432
528 iso_pu_bacteria 2906370794 2906373322 432
529 iso_pu_bacteria 2906378014 2906382074 432
530 iso_pu_bacteria 2906386501 2906388186 432
531 iso_pu_bacteria 2906393657 2906396680 432
532 iso_pu_bacteria 2906401398 2906405255 432
533 iso_pu_bacteria 2906408224 2906409384 432
534 iso_pu_bacteria 2906414383 2906419365 432
535 iso_pu_bacteria 2913295892 2913299883 432
536 iso_pu_bacteria 2913308742 2913309184 432
537 iso_pu_bacteria 2915980308 2915980613 432
538 iso_pu_bacteria 2915986958 2915991089 432
539 iso_pu_bacteria 2915993759 2915994893 432
540 iso_pu_bacteria 2916000859 2916006965 432
541 iso_pu_bacteria 2916007675 2916009498 432
542 iso_pu_bacteria 2916014648 2916016867 432
543 iso_pu_bacteria 2916021584 2916027730 432
544 iso_pu_bacteria 2916028427 2916030257 432
545 iso_pu_bacteria 2916035215 2916036814 432
546 iso_pu_bacteria 2916041962 2916044671 432
547 iso_pu_bacteria 2916048683 2916052619 432
548 iso_pu_bacteria 2916055098 2916058383 432
549 iso_pu_bacteria 2916061851 2916065574 432
550 iso_pu_bacteria 2916068649 2916071481 432
551 iso_pu_bacteria 2916076590 2916080115 432
552 iso_pu_bacteria 2919100787 2919104630 432
553 iso_pu_bacteria 2919114240 2919118026 432
554 iso_pu_bacteria 2919119836 2919120777 432
555 iso_pu_bacteria 2919166419 2919169975 432
556 iso_pu_bacteria 2919171160 2919173517 432
557 iso_pu_bacteria 2919408235 2919410727 432
558 iso_pu_bacteria 2920760137 2920760703 432
559 iso_pu_bacteria 2920822456 2920828430 432
560 iso_pu_bacteria 2921201388 2921201465 432
561 iso_pu_bacteria 2921208531 2921209622 432
562 iso_pu_bacteria 2921237296 2921237548 432
563 iso_pu_bacteria 2921244191 2921244269 432
564 iso_pu_bacteria 2921250672 2921252553 432
565 iso_pu_bacteria 2921257292 2921260691 432
566 iso_pu_bacteria 2921263974 2921265950 432
567 iso_pu_bacteria 2921282425 2921287716 432
568 iso_pu_bacteria 2921289301 2921295721 432
569 iso_pu_bacteria 2921296804 2921302828 432
570 iso_pu_bacteria 2922130491 2922134059 432
571 iso_pu_bacteria 2922151315 2922151425 432
572 iso_pu_bacteria 2922158528 2922163286 432
573 iso_pu_bacteria 2922172374 2922176565 432
574 iso_pu_bacteria 2922185730 2922190900 432
575 iso_pu_bacteria 2923556063 2923558713 432
576 iso_pu_bacteria 2924144063 2924148768 432
577 iso_pu_bacteria 2924150972 2924152189 432
578 iso_pu_bacteria 2924158325 2924164125 432
579 iso_pu_bacteria 2924165586 2924166618 432
580 iso_pu_bacteria 2924172951 2924174407 432
581 iso_pu_bacteria 2924179722 2924183977 432
582 iso_pu_bacteria 2924186466 2924188480 432
583 iso_pu_bacteria 2924193448 2924193825 432
584 iso_pu_bacteria 2924200457 2924206648 432
585 iso_pu_bacteria 2924207177 2924213080 432
586 iso_pu_bacteria 2924214083 2924217162 432
587 iso_pu_bacteria 2924221636 2924224032 432
588 iso_pu_bacteria 2924228884 2924232031 432
589 iso_pu_bacteria 2924710171 2924712028 432
590 iso_pu_bacteria 2924718760 2924722242 432
591 iso_pu_bacteria 2924733363 2924736587 432
592 iso_pu_bacteria 2924741084 2924743244 432
593 iso_pu_bacteria 2924748358 2924752595 432
594 iso_pu_bacteria 2924754689 2924757857 432
595 iso_pu_bacteria 2924762789 2924762973 432
596 iso_pu_bacteria 2924776078 2924778562 432
597 iso_pu_bacteria 2924784321 2924791521 432
598 iso_pu_bacteria 2926754445 2926757791 432
599 iso_pu_bacteria 2926760298 2926764582 432
600 iso_pu_bacteria 2928521798 2928522350 432
601 iso_pu_bacteria 2929138655 2929141420 432
602 iso_pu_bacteria 2933006813 2933010407 432
603 iso_pu_bacteria 2933011516 2933011592 432
604 iso_pu_bacteria 2933016740 2933019914 432
605 iso_pu_bacteria 2933570622 2933574731 432
606 iso_pu_bacteria 2933586486 2933589336 432
607 iso_pu_bacteria 2933594066 2933597275 432
608 iso_pu_bacteria 2933599457 2933603478 432
609 iso_pu_bacteria 2935894831 2935901221 432
610 iso_pu_bacteria 2935901341 2935907494 432
611 iso_pu_bacteria 2936367885 2936374810 432
612 iso_pu_bacteria 2936375103 2936380502 432
613 iso_pu_bacteria 2936381700 2936382330 432
614 iso_pu_bacteria 2936996657 2937000113 432
615 iso_pu_bacteria 2937002841 2937006938 432
616 iso_pu_bacteria 2937009748 2937015408 432
617 iso_pu_bacteria 2937016420 2937018127 432
618 iso_pu_bacteria 2937023124 2937024331 432
619 iso_pu_bacteria 2937029754 2937032944 432
620 iso_pu_bacteria 2937036028 2937042274 432
621 iso_pu_bacteria 2937042894 2937046678 432
622 iso_pu_bacteria 2937049772 2937052294 432
623 iso_pu_bacteria 2937056579 2937063103 432
624 iso_pu_bacteria 2937063883 2937067538 432
625 iso_pu_bacteria 2937071275 2937071352 432
626 iso_pu_bacteria 2937078374 2937078680 432
627 iso_pu_bacteria 2937084907 2937090055 432
628 iso_pu_bacteria 2937091812 2937092941 432
629 iso_pu_bacteria 2937098957 2937104763 432
630 iso_pu_bacteria 2937106411 2937109918 432
631 iso_pu_bacteria 2937113482 2937114525 432
632 iso_pu_bacteria 2937119839 2937123747 432
633 iso_pu_bacteria 2937126314 2937129275 432
634 iso_pu_bacteria 2937813078 2937819953 432
635 iso_pu_bacteria 2937822353 2937826451 432
636 iso_pu_bacteria 2937836603 2937836624 432
637 iso_pu_bacteria 2937843397 2937847758 432
638 iso_pu_bacteria 2937848649 2937849602 432
639 iso_pu_bacteria 2937861824 2937864319 432
640 iso_pu_bacteria 2937868953 2937875696 432
641 iso_pu_bacteria 2937877337 2937878803 432
642 iso_pu_bacteria 2937891427 2937892019 432
643 iso_pu_bacteria 2937972304 2937974415 432
644 iso_pu_bacteria 2937980651 2937981635 432
645 iso_pu_bacteria 2937994558 2937999507 432
646 iso_pu_bacteria 2938014810 2938017737 432
647 iso_pu_bacteria 2941499720 2941501636 432
648 iso_pu_bacteria 2954011201 2954014228 432
649 iso_pu_bacteria 2957375807 2957376882 432
650 iso_pu_bacteria 2957382221 2957386036 432
651 iso_pu_bacteria 2957388812 2957390120 432
652 iso_pu_bacteria 2957395598 2957396816 432
653 iso_pu_bacteria 2957402308 2957406217 432
654 iso_pu_bacteria 2957408893 2957408970 432
655 iso_pu_bacteria 2957415311 2957422011 432
656 iso_pu_bacteria 2957422303 2957425565 432
657 iso_pu_bacteria 2957430029 2957430580 432
658 iso_pu_bacteria 2957437181 2957443178 432
659 iso_pu_bacteria 2957443900 2957444394 432
660 iso_pu_bacteria 2957450854 2957452731 432
661 iso_pu_bacteria 2957457609 2957459403 432
662 iso_pu_bacteria 2957464669 2957468244 432
663 iso_pu_bacteria 2957471148 2957471910 432
664 iso_pu_bacteria 2957478035 2957480971 432
665 iso_pu_bacteria 2957484790 2957485545 432
666 iso_pu_bacteria 2957491536 2957495224 432
667 iso_pu_bacteria 2957498199 2957500275 432
668 iso_pu_bacteria 2957505466 2957507007 432
669 iso_pu_bacteria 2958034702 2958041435 432
670 iso_pu_bacteria 2958041894 2958042409 432
671 iso_pu_bacteria 2958041894 2958045906 432
672 iso_pu_bacteria 2958064165 2958065263 432
673 iso_pu_bacteria 2958071322 2958077105 432
674 iso_pu_bacteria 2958084443 2958085954 432
675 iso_pu_bacteria 2958100919 2958107942 432
676 iso_pu_bacteria 2958108152 2958112737 432
677 iso_pu_bacteria 2958115193 2958119363 432
678 iso_pu_bacteria 2958122699 2958129023 432
679 iso_pu_bacteria 2958130278 2958135322 432
680 iso_pu_bacteria 2958137437 2958141240 432
681 iso_pu_bacteria 2958144490 2958147625 432
682 iso_pu_bacteria 2958158011 2958160900 432
683 iso_pu_bacteria 2958165035 2958169980 432
684 iso_pu_bacteria 2958172287 2958174218 432
685 iso_pu_bacteria 2958179912 2958184351 432
686 iso_pu_bacteria 2960584000 2960584744 432
687 iso_pu_bacteria 2960591022 2960591328 432
688 iso_pu_bacteria 2960597568 2960598729 432
689 iso_pu_bacteria 2960603979 2960610167 432
690 iso_pu_bacteria 2960610863 2960617298 432
691 iso_pu_bacteria 2960617483 2960618710 432
692 iso_pu_bacteria 2960624210 2960629573 432
693 iso_pu_bacteria 2960631154 2960632580 432
694 iso_pu_bacteria 2960637947 2960641432 432
695 iso_pu_bacteria 2960645483 2960646699 432
696 iso_pu_bacteria 2960652885 2960653075 432
697 iso_pu_bacteria 2960660292 2960662907 432
698 iso_pu_bacteria 2960667422 2960671449 432
699 iso_pu_bacteria 2960674078 2960675437 432
700 iso_pu_bacteria 2960680706 2960681410 432
701 iso_pu_bacteria 2960687367 2960687885 432
702 iso_pu_bacteria 2960693952 2960695163 432
703 iso_pu_bacteria 2961077736 2961082406 432
704 iso_pu_bacteria 2961114664 2961118831 432
705 iso_pu_bacteria 2961127735 2961135872 432
706 iso_pu_bacteria 2961136820 2961137889 432
707 iso_pu_bacteria 2961163497 2961168437 432
708 iso_pu_bacteria 2961170736 2961176550 432
709 iso_pu_bacteria 2961183825 2961184425 432
710 iso_pu_bacteria 2963644680 2963645115 432
711 iso_pu_bacteria 2964607997 2964612396 432
712 iso_pu_bacteria 2964615318 2964620355 432
713 iso_pu_bacteria 2964621998 2964625960 432
714 iso_pu_bacteria 2964628898 2964631437 432
715 iso_pu_bacteria 2964636051 2964640487 432
716 iso_pu_bacteria 2964643177 2964647194 432
717 iso_pu_bacteria 2964649959 2964650909 432
718 iso_pu_bacteria 2964656573 2964659021 432
719 iso_pu_bacteria 2964663802 2964668810 432
720 iso_pu_bacteria 2964670856 2964674564 432
721 iso_pu_bacteria 2964678106 2964681744 432
722 iso_pu_bacteria 2964685014 2964688683 432
723 iso_pu_bacteria 2964691889 2964693247 432
724 iso_pu_bacteria 2964698721 2964705145 432
725 iso_pu_bacteria 2964705432 2964706241 432
726 iso_pu_bacteria 2964712639 2964719068 432
727 iso_pu_bacteria 2964719344 2964725642 432
728 iso_pu_bacteria 2965018300 2965023256 432
729 iso_pu_bacteria 2965025482 2965030238 432
730 iso_pu_bacteria 2965040258 2965043183 432
731 iso_pu_bacteria 2965047637 2965049204 432
732 iso_pu_bacteria 2965062239 2965064892 432
733 iso_pu_bacteria 2965089291 2965096570 432
734 iso_pu_bacteria 2965102966 2965103991 432
735 iso_pu_bacteria 2965110997 2965113973 432
736 iso_pu_bacteria 2965119406 2965123345 432
737 iso_pu_bacteria 2967664464 2967670976 432
738 iso_pu_bacteria 2967671571 2967673131 432
739 iso_pu_bacteria 2967678726 2967683038 432
740 iso_pu_bacteria 2967686174 2967686559 432
741 iso_pu_bacteria 2967693043 2967696112 432
742 iso_pu_bacteria 2967699805 2967700483 432
743 iso_pu_bacteria 2967706974 2967708431 432
744 iso_pu_bacteria 2967714385 2967715828 432
745 iso_pu_bacteria 2967721400 2967722017 432
746 iso_pu_bacteria 2967728569 2967732436 432
747 iso_pu_bacteria 2967735183 2967735434 432
748 iso_pu_bacteria 2967742019 2967742338 432
749 iso_pu_bacteria 2967748971 2967750141 432
750 iso_pu_bacteria 2967755722 2967760061 432
751 iso_pu_bacteria 2967762386 2967769071 432
752 iso_pu_bacteria 2967769361 2967774540 432
753 iso_pu_bacteria 2967775926 2967781317 432
754 iso_pu_bacteria 2967996073 2968001433 432
755 iso_pu_bacteria 2968003550 2968007486 432
756 iso_pu_bacteria 2968016561 2968022955 432
757 iso_pu_bacteria 2968016561 2968023702 432
758 iso_pu_bacteria 2968083720 2968089986 432
759 iso_pu_bacteria 2968091066 2968093795 432
760 iso_pu_bacteria 2968097103 2968097780 432
761 iso_pu_bacteria 2968110612 2968115168 432
762 iso_pu_bacteria 2968117919 2968122036 432
763 iso_pu_bacteria 2968128360 2968131234 432
764 iso_pu_bacteria 2968138860 2968142116 432
765 iso_pu_bacteria 2968171901 2968176839 432
766 iso_pu_bacteria 2970019648 2970024982 432
767 iso_pu_bacteria 2970026789 2970029361 432
768 iso_pu_bacteria 2970033650 2970040664 432
769 iso_pu_bacteria 2970040964 2970041773 432
770 iso_pu_bacteria 2970047711 2970054531 432
771 iso_pu_bacteria 2970054988 2970061045 432
772 iso_pu_bacteria 2970061556 2970068136 432
773 iso_pu_bacteria 2970068827 2970069434 432
774 iso_pu_bacteria 2970076120 2970079069 432
775 iso_pu_bacteria 2970082768 2970084242 432
776 iso_pu_bacteria 2970088815 2970095490 432
777 iso_pu_bacteria 2970095765 2970099073 432
778 iso_pu_bacteria 2970102677 2970108818 432
779 iso_pu_bacteria 2970109326 2970115245 432
780 iso_pu_bacteria 2970116247 2970119547 432
781 iso_pu_bacteria 2970122695 2970126414 432
782 iso_pu_bacteria 2970129317 2970134287 432
783 iso_pu_bacteria 2970136068 2970140662 432
784 iso_pu_bacteria 2970143518 2970144593 432
785 iso_pu_bacteria 2970149975 2970155658 432
786 iso_pu_bacteria 2970156795 2970163241 432
787 iso_pu_bacteria 2970164137 2970165903 432
788 iso_pu_bacteria 2970170962 2970173335 432
789 iso_pu_bacteria 2970177841 2970179828 432
790 iso_pu_bacteria 2970184632 2970186514 432
791 iso_pu_bacteria 2970191845 2970194498 432
792 iso_pu_bacteria 2970469710 2970469743 432
793 iso_pu_bacteria 2970469710 2970475540 432
794 iso_pu_bacteria 2970489779 2970490090 432
795 iso_pu_bacteria 2970503327 2970509221 432
796 iso_pu_bacteria 2970510686 2970517490 432
797 iso_pu_bacteria 2970524798 2970525814 432
798 iso_pu_bacteria 2970532167 2970537485 432
799 iso_pu_bacteria 2970540015 2970542599 432
800 iso_pu_bacteria 2970547951 2970552191 432
801 iso_pu_bacteria 2970554993 2970559757 432
802 iso_pu_bacteria 2970593180 2970599321 432
803 iso_pu_bacteria 2970619444 2970624282 432
804 iso_pu_bacteria 2970627176 2970634051 432
805 iso_pu_bacteria 2977516862 2977520772 432
806 iso_pu_bacteria 2977523885 2977530096 432
807 iso_pu_bacteria 2977530762 2977532426 432
808 iso_pu_bacteria 2977537788 2977540957 432
809 iso_pu_bacteria 2977544691 2977551135 432
810 iso_pu_bacteria 2977551784 2977556837 432
811 iso_pu_bacteria 2977558990 2977565586 432
812 iso_pu_bacteria 2977565890 2977569099 432
813 iso_pu_bacteria 2977572785 2977578022 432
814 iso_pu_bacteria 2977579622 2977579700 432
815 iso_pu_bacteria 2977821940 2977824646 432
816 iso_pu_bacteria 2977828996 2977830374 432
817 iso_pu_bacteria 2977843712 2977850503 432
818 iso_pu_bacteria 2977851361 2977852809 432
819 iso_pu_bacteria 2977858184 2977859753 432
820 iso_pu_bacteria 2977864932 2977871567 432
821 iso_pu_bacteria 2977872689 2977879720 432
822 iso_pu_bacteria 2977898635 2977903853 432
823 iso_pu_bacteria 2977915119 2977919373 432
824 iso_pu_bacteria 2977922695 2977925756 432
825 iso_pu_bacteria 2977935797 2977939194 432
826 iso_pu_bacteria 2977942078 2977944213 432
827 iso_pu_bacteria 2977950692 2977950968 432
828 iso_pu_bacteria 2977957713 2977958216 432
829 iso_pu_bacteria 2977971508 2977974074 432
830 iso_pu_bacteria 2977986579 2977986740 432
831 iso_pu_bacteria 2978969890 2978972424 432
832 iso_pu_bacteria 2979089926 2979090308 432
833 iso_pu_bacteria 2979095461 2979095837 432
834 iso_pu_bacteria 2979100975 2979102710 432
835 iso_pu_bacteria 2979710463 2979712073 432
836 iso_pu_bacteria 2979742915 2979744022 432
837 iso_pu_bacteria 2979764755 2979769792 432
838 iso_pu_bacteria 2979772303 2979779786 432
839 iso_pu_bacteria 2979779861 2979781842 432
840 iso_pu_bacteria 2979808191 2979813900 432
841 iso_pu_bacteria 2984509177 2984509402 432
842 iso_pu_bacteria 2984537506 2984537734 432
843 iso_pu_bacteria 2984587000 2984590675 432
844 iso_pu_bacteria 2984601300 2984604479 432
845 iso_pu_bacteria 2987636660 2987641283 432
846 iso_pu_bacteria 2987645492 2987647614 432
847 iso_pu_bacteria 2987652177 2987653724 432
848 iso_pu_bacteria 2987659509 2987664454 432
849 iso_pu_bacteria 2987666974 2987667304 432
850 iso_pu_bacteria 2987673487 2987680136 432
851 iso_pu_bacteria 2989349275 2989354586 432
852 iso_pu_bacteria 2989771324 2989775192 432
853 iso_pu_bacteria 2989776772 2989780408 432
854 iso_pu_bacteria 2995392953 2995394161 432
855 iso_pu_bacteria 2996310559 2996311785 432
856 iso_pu_bacteria 2996336353 2996338502 432
857 iso_pu_bacteria 2996341866 2996347627 432
858 iso_pu_bacteria 2996348954 2996355850 432
859 iso_pu_bacteria 2996386984 2996387590 432
860 iso_pu_bacteria 2996887358 2996889271 432
861 iso_pu_bacteria 2996893221 2996894673 432
862 iso_pu_bacteria 3000135777 3000142508 432
863 iso_pu_bacteria 3002141150 3002142158 432
864 iso_pu_bacteria 3003930520 3003930563 432
865 iso_pu_bacteria 3004167301 3004172946 432
866 iso_pu_bacteria 3004188549 3004193510 432
867 iso_pu_bacteria 3004195979 3004202213 432
868 iso_pu_bacteria 3004211236 3004217294 432
869 iso_pu_bacteria 3004218560 3004220439 432
870 iso_pu_bacteria 3004232784 3004232795 432
871 iso_pu_bacteria 3004239961 3004241039 432
872 iso_pu_bacteria 3004248173 3004248486 432
873 iso_pu_bacteria 3004268573 3004272479 432
874 iso_pu_bacteria 3004275668 3004282276 432
875 iso_pu_bacteria 3004289098 3004293701 432
876 iso_pu_bacteria 3004334049 3004337620 432
877 iso_pu_bacteria 3005409236 3005415425 432
878 iso_pu_bacteria 3005416602 3005418436 432
879 iso_pu_bacteria 3005445848 3005449337 432
880 iso_pu_bacteria 3005452660 3005455640 432
881 iso_pu_bacteria 637000159 637077237 432
882 iso_pu_bacteria 639633055 639650055 432
883 iso_pu_bacteria 643692032 643827137 432
884 iso_pu_bacteria 648276728 648735797 432
885 iso_pu_bacteria 649633066 649870292 432
886 iso_pu_bacteria 650716007 650844063 432
887 iso_pu_bacteria 8002285264 8002287066 432
888 iso_pu_bacteria 8003570095 8003574373 432
889 iso_pu_bacteria 8003992118 8003995019 432
890 iso_pu_bacteria 8003999396 8004002781 432
891 iso_pu_bacteria 8004300914 8004304873 432
892 iso_pu_bacteria 8004312739 8004316633 432
893 iso_pu_bacteria 8004361976 8004362035 432
894 iso_pu_bacteria 8004374579 8004377085 432
895 iso_pu_bacteria 8004387939 8004393211 432
896 iso_pu_bacteria 8004445564 8004448960 432
897 iso_pu_bacteria 8004633249 8004637290 432
898 iso_pu_bacteria 8004640170 8004644171 432
899 iso_pu_bacteria 8004703790 8004706947 432
900 iso_pu_bacteria 8004714634 8004719998 432
901 iso_pu_bacteria 8004727605 8004729458 432
902 iso_pu_bacteria 8005246636 8005249505 432
903 iso_pu_bacteria 8005258706 8005264151 432
904 iso_pu_bacteria 8005275841 8005282073 432
905 iso_pu_bacteria 8005282627 8005285111 432
906 iso_pu_bacteria 8005289223 8005294206 432
907 iso_pu_bacteria 8005301065 8005306619 432
908 iso_pu_bacteria 8005307578 8005309447 432
909 iso_pu_bacteria 8005314921 8005318672 432
910 iso_pu_bacteria 8005321885 8005323798 432
911 iso_pu_bacteria 8005376324 8005382727 432
912 iso_pu_bacteria 8005382845 8005383784 432
913 iso_pu_bacteria 8005395548 8005401110 432
914 iso_pu_bacteria 8005430974 8005434064 432
915 iso_pu_bacteria 8005460587 8005464674 432
916 iso_pu_bacteria 8005484373 8005488444 432
917 iso_pu_bacteria 8005497431 8005501723 432
918 iso_pu_bacteria 8005542996 8005547035 432
919 iso_pu_bacteria 8005556819 8005559106 432
920 iso_pu_bacteria 8005563573 8005566835 432
921 iso_pu_bacteria 8005570704 8005574887 432
922 iso_pu_bacteria 8005619151 8005623077 432
923 iso_pu_bacteria 8005626139 8005631615 432
924 iso_pu_bacteria 8005645114 8005648913 432
925 iso_pu_bacteria 8005668836 8005673145 432
926 iso_pu_bacteria 8005682033 8005682152 432
927 iso_pu_bacteria 8005688590 8005693685 432
928 iso_pu_bacteria 8005695170 8005700925 432
929 iso_pu_bacteria 8018127388 8018133558 432
930 iso_pu_bacteria 8018150411 8018152086 432
931 iso_pu_bacteria 8018163183 8018170278 432
932 iso_pu_bacteria 8018176218 8018178407 432
933 iso_pu_bacteria 8023680758 8023687488 432
934 iso_pu_bacteria 8024479707 8024482010 432
935 iso_pu_bacteria 8024486573 8024486963 432
936 iso_pu_bacteria 8024501048 8024505878 432
937 iso_pu_bacteria 8046767195 8046773171 432
938 iso_pu_bacteria 8049293176 8049295983 432
939 iso_pu_bacteria 8054460903 8054463510 432
940 iso_pu_bacteria 8054558443 8054559488 432
941 iso_pu_bacteria 8055617313 8055617630 432
942 iso_pu_bacteria 8056375014 8056381646 432
943 iso_pu_bacteria 8056382006 8056387083 432
944 iso_pu_bacteria 8056875544 8056876224 432
945 iso_pu_bacteria 8057575449 8057581092 432
946 iso_pu_bacteria 8057874678 8057877050 432
947 3300014326 Ga0157380_10208691 Ga0157380_102086911 433
948 3300032168 Ga0316593_10014887 Ga0316593_100148872 433
949 3300039062 Ga0400483_018531 Ga0400483_018531_21236_22564 433
950 3300039062 Ga0400483_082204 Ga0400483_082204_195_1499 433
951 3300039062 Ga0400483_219255 Ga0400483_219255_30751_32079 433
952 3300045051 Ga0451576_0000834 Ga0451576_0000834_17010_18311 433
953 3300049571 Ga0501034_0000606 Ga0501034_0000606_24742_26043 433
954 iso_pu_bacteria 2510065055 2510293710 433
955 iso_pu_bacteria 2523231067 2523466209 433
956 iso_pu_bacteria 2738543031 2739347068 433
957 3300005459 Ga0068867_100004439 Ga0068867_1000044396 434
958 3300005563 Ga0068855_100002914 Ga0068855_1000029142 434
959 3300005578 Ga0068854_100121702 Ga0068854_1001217022 434
960 3300006353 Ga0075370_10092620 Ga0075370_100926201 434
961 3300006358 Ga0068871_100025070 Ga0068871_1000250704 434
962 3300009093 Ga0105240_10000871 Ga0105240_100008717 434
963 3300009148 Ga0105243_10036210 Ga0105243_100362102 434
964 3300009176 Ga0105242_10048624 Ga0105242_100486242 434
965 3300009545 Ga0105237_10033313 Ga0105237_100333132 434
966 3300009551 Ga0105238_10200897 Ga0105238_102008972 434
967 3300013297 Ga0157378_10005765 Ga0157378_100057657 434
968 3300013308 Ga0157375_10084111 Ga0157375_100841112 434
969 3300025230 Ga0209563_100013 Ga0209563_100013592 434
970 3300025298 Ga0209050_1008731 Ga0209050_10087312 434
971 3300025303 Ga0209051_1002208 Ga0209051_10022086 434
972 3300025304 Ga0209257_1000033 Ga0209257_1000033417 434
973 3300025913 Ga0207695_10016415 Ga0207695_100164152 434
974 3300025914 Ga0207671_10020826 Ga0207671_100208262 434
975 3300025934 Ga0207686_10040697 Ga0207686_100406972 434
976 3300025949 Ga0207667_10004623 Ga0207667_1000462311 434
977 3300026089 Ga0207648_10006652 Ga0207648_100066524 434
978 3300026116 Ga0207674_10255021 Ga0207674_102550212 434
979 3300028577 Ga0265318_10004293 Ga0265318_100042932 434
980 3300031344 Ga0265316_10153418 Ga0265316_101534182 434
981 3300031711 Ga0265314_10016328 Ga0265314_100163284 434
982 3300032004 Ga0307414_10002146 Ga0307414_100021464 434
983 3300032005 Ga0307411_10000107 Ga0307411_100001078 434
984 3300035088 Ga0373940_0002677 Ga0373940_0002677_1737_3053 434
985 3300035114 Ga0373939_0000188 Ga0373939_0000188_9615_10931 434
986 3300042126 Ga0450888_000097 Ga0450888_000097_475_1791 434
987 3300042127 Ga0450890_000925 Ga0450890_000925_2893_4209 434
988 3300042130 Ga0450892_000431 Ga0450892_000431_26_1342 434
989 3300042532 Ga0450893_0002729 Ga0450893_0002729_863_2179 434
990 3300048905 Ga0496102_0120362 Ga0496102_0120362_977_2308 434
991 3300048907 Ga0496104_0051606 Ga0496104_0051606_1291_2622 434
992 3300048917 Ga0496114_0005571 Ga0496114_0005571_7913_9244 434
993 3300049160 Ga0501304_001476 Ga0501304_001476_175_1491 434
994 3300049581 Ga0501047_0008929 Ga0501047_0008929_4874_6178 434
995 3300049586 Ga0501070_0005494 Ga0501070_0005494_2039_3343 434
996 3300049654 Ga0501207_001043 Ga0501207_001043_183_1499 434
997 3300049663 Ga0501223_008382 Ga0501223_008382_77_1393 434
998 3300049704 Ga0501221_000258 Ga0501221_000258_2529_3845 434
999 3300049742 Ga0501080_0048583 Ga0501080_0048583_28_1347 434
1000 3300049742 Ga0501080_0121692 Ga0501080_0121692_262_1566 434
1001 3300049757 Ga0501232_000308 Ga0501232_000308_52_1368 434
1002 3300050496 nmdc:mga07m45_5037_c1 nmdc:mga07m45_5037_c1_946_2262 434
1003 3300053122 Ga0500608_002836 Ga0500608_002836_739_2043 434
1004 3300053156 Ga0500622_0000101 Ga0500622_0000101_20534_21838 434
1005 iso_pu_bacteria 2791354903 2791922117 434
1006 3300005354 Ga0070675_100112804 Ga0070675_1001128042 435
1007 3300005548 Ga0070665_100097821 Ga0070665_1000978212 435
1008 3300005578 Ga0068854_100061423 Ga0068854_1000614232 435
1009 3300006048 Ga0075363_100032088 Ga0075363_1000320882 435
1010 3300006051 Ga0075364_10135081 Ga0075364_101350812 435
1011 3300006177 Ga0075362_10001059 Ga0075362_100010593 435
1012 3300006177 Ga0075362_10029465 Ga0075362_100294652 435
1013 3300006178 Ga0075367_10056832 Ga0075367_100568322 435
1014 3300006237 Ga0097621_100113413 Ga0097621_1001134133 435
1015 3300013297 Ga0157378_10140250 Ga0157378_101402502 435
1016 3300025231 Ga0207427_103198 Ga0207427_1031981 435
1017 3300025261 Ga0209233_1001762 Ga0209233_10017627 435
1018 3300025913 Ga0207695_10054111 Ga0207695_100541114 435
1019 3300025913 Ga0207695_10083047 Ga0207695_100830475 435
1020 3300025914 Ga0207671_10029566 Ga0207671_100295661 435
1021 3300025925 Ga0207650_10059566 Ga0207650_100595661 435
1022 3300028379 Ga0268266_10059352 Ga0268266_100593522 435
1023 3300028794 Ga0307515_10000145 Ga0307515_100001459 435
1024 3300031241 Ga0265325_10001162 Ga0265325_1000116210 435
1025 3300031241 Ga0265325_10003071 Ga0265325_100030716 435
1026 3300031249 Ga0265339_10000239 Ga0265339_1000023925 435
1027 3300031250 Ga0265331_10011091 Ga0265331_100110913 435
1028 3300031344 Ga0265316_10027142 Ga0265316_100271423 435
1029 3300031344 Ga0265316_10064691 Ga0265316_100646912 435
1030 3300031456 Ga0307513_10194829 Ga0307513_101948292 435
1031 3300031711 Ga0265314_10009013 Ga0265314_100090134 435
1032 3300031712 Ga0265342_10048064 Ga0265342_100480642 435
1033 3300031730 Ga0307516_10207891 Ga0307516_102078911 435
1034 3300037312 Ga0395899_0165917 Ga0395899_0165917_93_1409 435
1035 3300038443 Ga0395901_0058770 Ga0395901_0058770_2363_3670 435
1036 3300039062 Ga0400483_256661 Ga0400483_256661_28_1335 435
1037 3300046518 Ga0495631_0013726 Ga0495631_0013726_806_2119 435
1038 3300046660 Ga0495625_0087624 Ga0495625_0087624_603_1910 435
1039 3300048914 Ga0496111_0051207 Ga0496111_0051207_967_2274 435
1040 3300048919 Ga0496116_0066736 Ga0496116_0066736_618_1925 435
1041 3300048922 Ga0496119_0004065 Ga0496119_0004065_3352_4662 435
1042 3300048925 Ga0496122_0009737 Ga0496122_0009737_6914_8224 435
1043 3300048925 Ga0496122_0096358 Ga0496122_0096358_590_1900 435
1044 3300048928 Ga0496125_0000053 Ga0496125_0000053_63400_64707 435
1045 3300048928 Ga0496125_0000323 Ga0496125_0000323_49586_50896 435
1046 3300048928 Ga0496125_0088534 Ga0496125_0088534_744_2054 435
1047 3300049570 Ga0501033_0000361 Ga0501033_0000361_32089_33396 435
1048 3300049571 Ga0501034_0007494 Ga0501034_0007494_4260_5567 435
1049 3300049571 Ga0501034_0019998 Ga0501034_0019998_1403_2713 435
1050 3300049571 Ga0501034_0056012 Ga0501034_0056012_960_2267 435
1051 3300049571 Ga0501034_0066655 Ga0501034_0066655_268_1575 435
1052 3300049571 Ga0501034_0216430 Ga0501034_0216430_230_1537 435
1053 3300049572 Ga0501036_0102684 Ga0501036_0102684_417_1724 435
1054 3300049572 Ga0501036_0127063 Ga0501036_0127063_17_1324 435
1055 3300049574 Ga0501038_0045286 Ga0501038_0045286_1018_2325 435
1056 3300049581 Ga0501047_0124293 Ga0501047_0124293_674_1981 435
1057 3300049589 Ga0501073_0063110 Ga0501073_0063110_369_1688 435
1058 3300049742 Ga0501080_0240990 Ga0501080_0240990_181_1488 435
1059 3300049823 Ga0501044_0165798 Ga0501044_0165798_133_1440 435
1060 3300050489 nmdc:mga03683_12179_c1 nmdc:mga03683_12179_c1_900_2207 435
1061 3300050493 nmdc:mga0k408_50586_c1 nmdc:mga0k408_50586_c1_460_1767 435
1062 3300050496 nmdc:mga07m45_57439_c1 nmdc:mga07m45_57439_c1_177_1484 435
1063 3300053151 Ga0500604_0000141 Ga0500604_0000141_5044_6351 435
1064 3300053161 Ga0500634_0000029 Ga0500634_0000029_45644_46951 435
1065 iso_pu_bacteria 2507262055 2507504739 435
1066 iso_pu_bacteria 2508501009 2508539845 435
1067 iso_pu_bacteria 2508501042 2508695024 435
1068 iso_pu_bacteria 2511231028 2511397016 435
1069 iso_pu_bacteria 2513237092 2513626669 435
1070 iso_pu_bacteria 2513237095 2513648119 435
1071 iso_pu_bacteria 2513237101 2513693865 435
1072 iso_pu_bacteria 2513237102 2513704766 435
1073 iso_pu_bacteria 2513237104 2513715585 435
1074 iso_pu_bacteria 2513237139 2513875710 435
1075 iso_pu_bacteria 2513237161 2514016376 435
1076 iso_pu_bacteria 2515154112 2515627823 435
1077 iso_pu_bacteria 2517093001 2517106978 435
1078 iso_pu_bacteria 2524023205 2524435629 435
1079 iso_pu_bacteria 2528768022 2528850282 435
1080 iso_pu_bacteria 2617270735 2617352941 435
1081 iso_pu_bacteria 2617270741 2617374242 435
1082 iso_pu_bacteria 2744054633 2745079886 435
1083 iso_pu_bacteria 2791355196 2793063216 435
1084 iso_pu_bacteria 2802429603 2805919386 435
1085 iso_pu_bacteria 2816332527 2818237165 435
1086 iso_pu_bacteria 2824617872 2824625085 435
1087 iso_pu_bacteria 2824626560 2824632498 435
1088 iso_pu_bacteria 2824635225 2824642306 435
1089 iso_pu_bacteria 2824644064 2824649663 435
1090 iso_pu_bacteria 2824661429 2824670675 435
1091 iso_pu_bacteria 2824671348 2824679132 435
1092 iso_pu_bacteria 2824679649 2824685459 435
1093 iso_pu_bacteria 2824687955 2824695754 435
1094 iso_pu_bacteria 2824696289 2824702105 435
1095 iso_pu_bacteria 2824704595 2824712237 435
1096 iso_pu_bacteria 2824714736 2824719610 435
1097 iso_pu_bacteria 2824723954 2824730071 435
1098 iso_pu_bacteria 2824732956 2824738107 435
1099 iso_pu_bacteria 2824746037 2824752991 435
1100 iso_pu_bacteria 2824753945 2824760639 435
1101 iso_pu_bacteria 2824763712 2824773057 435
1102 iso_pu_bacteria 2824773399 2824779860 435
1103 iso_pu_bacteria 2838122688 2838129422 435
1104 iso_pu_bacteria 2841941048 2841944341 435
1105 iso_pu_bacteria 2841949485 2841954482 435
1106 iso_pu_bacteria 2841957949 2841966000 435
1107 iso_pu_bacteria 2841966195 2841969118 435
1108 iso_pu_bacteria 2841974524 2841979892 435
1109 iso_pu_bacteria 2841983080 2841990927 435
1110 iso_pu_bacteria 2842038055 2842044003 435
1111 iso_pu_bacteria 2842045827 2842052008 435
1112 iso_pu_bacteria 2844315083 2844321686 435
1113 iso_pu_bacteria 2847930680 2847939682 435
1114 iso_pu_bacteria 2847939898 2847941637 435
1115 iso_pu_bacteria 2849076700 2849082559 435
1116 iso_pu_bacteria 2857509624 2857511454 435
1117 iso_pu_bacteria 2874590934 2874591481 435
1118 iso_pu_bacteria 2874604998 2874611752 435
1119 iso_pu_bacteria 2874620515 2874624314 435
1120 iso_pu_bacteria 2874628541 2874634076 435
1121 iso_pu_bacteria 2874645413 2874647731 435
1122 iso_pu_bacteria 2876771140 2876771623 435
1123 iso_pu_bacteria 2876808645 2876814129 435
1124 iso_pu_bacteria 2876818435 2876826516 435
1125 iso_pu_bacteria 2879074833 2879075437 435
1126 iso_pu_bacteria 2879083081 2879090515 435
1127 iso_pu_bacteria 2879099564 2879101856 435
1128 iso_pu_bacteria 2879110137 2879111809 435
1129 iso_pu_bacteria 2879127579 2879130665 435
1130 iso_pu_bacteria 2879142872 2879142979 435
1131 iso_pu_bacteria 2881364244 2881364980 435
1132 iso_pu_bacteria 2885366525 2885368113 435
1133 iso_pu_bacteria 2888378607 2888380126 435
1134 iso_pu_bacteria 2888388044 2888391141 435
1135 iso_pu_bacteria 2903727486 2903727739 435
1136 iso_pu_bacteria 2904666416 2904672347 435
1137 iso_pu_bacteria 2904711408 2904717933 435
1138 iso_pu_bacteria 2906602504 2906602775 435
1139 iso_pu_bacteria 2906626472 2906632418 435
1140 iso_pu_bacteria 2906643746 2906645054 435
1141 iso_pu_bacteria 2908775508 2908776717 435
1142 iso_pu_bacteria 2919450847 2919451848 435
1143 iso_pu_bacteria 2922361189 2922362739 435
1144 iso_pu_bacteria 2922368715 2922378479 435
1145 iso_pu_bacteria 2922386360 2922390396 435
1146 iso_pu_bacteria 2922393267 2922400248 435
1147 iso_pu_bacteria 2929615660 2929622433 435
1148 iso_pu_bacteria 2929624759 2929631350 435
1149 iso_pu_bacteria 2932784394 2932786233 435
1150 iso_pu_bacteria 2932809354 2932812693 435
1151 iso_pu_bacteria 2932818245 2932823055 435
1152 iso_pu_bacteria 2932828146 2932829471 435
1153 iso_pu_bacteria 2933577622 2933584487 435
1154 iso_pu_bacteria 2935608549 2935615064 435
1155 iso_pu_bacteria 2935616580 2935617903 435
1156 iso_pu_bacteria 2935638405 2935641613 435
1157 iso_pu_bacteria 2935648319 2935651584 435
1158 iso_pu_bacteria 2935656913 2935659648 435
1159 iso_pu_bacteria 2935665750 2935669329 435
1160 iso_pu_bacteria 2935675223 2935678075 435
1161 iso_pu_bacteria 2935684952 2935693606 435
1162 iso_pu_bacteria 2935694250 2935702926 435
1163 iso_pu_bacteria 2935703347 2935707152 435
1164 iso_pu_bacteria 2935713505 2935716970 435
1165 iso_pu_bacteria 2935722832 2935730196 435
1166 iso_pu_bacteria 2935732158 2935738409 435
1167 iso_pu_bacteria 2935741537 2935750197 435
1168 iso_pu_bacteria 2935750917 2935759791 435
1169 iso_pu_bacteria 2935760218 2935764558 435
1170 iso_pu_bacteria 2935785616 2935787188 435
1171 iso_pu_bacteria 2935793552 2935796024 435
1172 iso_pu_bacteria 2935801545 2935804467 435
1173 iso_pu_bacteria 2935810662 2935819132 435
1174 iso_pu_bacteria 2935819856 2935825898 435
1175 iso_pu_bacteria 2935827899 2935831344 435
1176 iso_pu_bacteria 2935837841 2935841953 435
1177 iso_pu_bacteria 2935847175 2935851517 435
1178 iso_pu_bacteria 2935855204 2935856598 435
1179 iso_pu_bacteria 2935864058 2935870213 435
1180 iso_pu_bacteria 2935873716 2935874462 435
1181 iso_pu_bacteria 2935908558 2935910462 435
1182 iso_pu_bacteria 2935916978 2935918136 435
1183 iso_pu_bacteria 2935926038 2935927627 435
1184 iso_pu_bacteria 2935934488 2935936501 435
1185 iso_pu_bacteria 2935942939 2935943946 435
1186 iso_pu_bacteria 2935951376 2935952383 435
1187 iso_pu_bacteria 2935959822 2935964259 435
1188 iso_pu_bacteria 2935967501 2935969223 435
1189 iso_pu_bacteria 2935975950 2935978016 435
1190 iso_pu_bacteria 2935984226 2935984684 435
1191 iso_pu_bacteria 2935992306 2935993923 435
1192 iso_pu_bacteria 2936002035 2936005066 435
1193 iso_pu_bacteria 2936011229 2936014064 435
1194 iso_pu_bacteria 2936019824 2936023027 435
1195 iso_pu_bacteria 2936028420 2936031163 435
1196 iso_pu_bacteria 2936037263 2936045717 435
1197 iso_pu_bacteria 2936046547 2936049285 435
1198 iso_pu_bacteria 2936055302 2936055827 435
1199 iso_pu_bacteria 2940556831 2940565755 435
1200 iso_pu_bacteria 2941538514 2941544026 435
1201 iso_pu_bacteria 3005483717 3005490978 435
1202 iso_pu_bacteria 3005506211 3005509656 435
1203 iso_pu_bacteria 3005587118 3005594262 435
1204 iso_pu_bacteria 3005710791 3005717796 435
1205 iso_pu_bacteria 3005718088 3005724849 435
1206 iso_pu_bacteria 8001845381 8001850055 435
1207 iso_pu_bacteria 8006926726 8006932415 435
1208 iso_pu_bacteria 8006964411 8006969954 435
1209 iso_pu_bacteria 8006984368 8006985673 435
1210 iso_pu_bacteria 8006994254 8006994763 435
1211 iso_pu_bacteria 8016511872 8016518762 435
1212 iso_pu_bacteria 8016522445 8016526713 435
1213 iso_pu_bacteria 8016566248 8016570078 435
1214 iso_pu_bacteria 8016595262 8016603057 435
1215 iso_pu_bacteria 8016603502 8016605958 435
1216 iso_pu_bacteria 8016613128 8016617844 435
1217 iso_pu_bacteria 8016622563 8016623730 435
1218 iso_pu_bacteria 8016630954 8016636408 435
1219 iso_pu_bacteria 8017057580 8017057915 435
1220 iso_pu_bacteria 8019547302 8019550749 435
1221 iso_pu_bacteria 8019576017 8019577809 435
1222 iso_pu_bacteria 8019586578 8019595912 435
1223 iso_pu_bacteria 8019597564 8019605844 435
1224 iso_pu_bacteria 8019608314 8019612689 435
1225 iso_pu_bacteria 8019619141 8019622431 435
1226 iso_pu_bacteria 8019629233 8019630848 435
1227 iso_pu_bacteria 8019648815 8019651936 435
1228 iso_pu_bacteria 8019659431 8019667865 435
1229 iso_pu_bacteria 8019678201 8019678703 435
1230 iso_pu_bacteria 8019687851 8019696813 435
1231 iso_pu_bacteria 8055742211 8055750884 435
1232 iso_pu_bacteria 8056967851 8056975567 435
1233 3300001979 JGI24740J21852_10001156 JGI24740J21852_100011568 436
1234 3300002704 JGI25155J39150_1000012 JGI25155J39150_1000012107 436
1235 3300002705 JGI25156J39149_1000036 JGI25156J39149_100003674 436
1236 3300002737 JGI25162J39368_1000146 JGI25162J39368_100014661 436
1237 3300002737 JGI25162J39368_1000616 JGI25162J39368_10006164 436
1238 3300002737 JGI25162J39368_1000674 JGI25162J39368_10006741 436
1239 3300002738 JGI25154J39366_1000033 JGI25154J39366_100003366 436
1240 3300002741 JGI25157J39369_1000457 JGI25157J39369_100045727 436
1241 3300002741 JGI25157J39369_1000542 JGI25157J39369_100054217 436
1242 3300002773 JGI25152J39213_1001129 JGI25152J39213_10011294 436
1243 3300002773 JGI25152J39213_1002051 JGI25152J39213_10020514 436
1244 3300002773 JGI25152J39213_1002782 JGI25152J39213_10027823 436
1245 3300002773 JGI25152J39213_1002804 JGI25152J39213_10028046 436
1246 3300002774 JGI25150J39212_1000063 JGI25150J39212_100006337 436
1247 3300002987 JGI25159J45721_1000092 JGI25159J45721_100009240 436
1248 3300002987 JGI25159J45721_1000464 JGI25159J45721_10004646 436
1249 3300003187 JGI25151J46595_10000140 JGI25151J46595_1000014070 436
1250 3300003187 JGI25151J46595_10001756 JGI25151J46595_100017566 436
1251 3300003187 JGI25151J46595_10004817 JGI25151J46595_100048175 436
1252 3300003203 JGI25406J46586_10009739 JGI25406J46586_100097392 436
1253 3300003214 JGI25165J46597_1000653 JGI25165J46597_10006534 436
1254 3300003214 JGI25165J46597_1000719 JGI25165J46597_100071914 436
1255 3300003214 JGI25165J46597_1001438 JGI25165J46597_10014386 436
1256 3300003215 JGI25153J46596_10003062 JGI25153J46596_100030626 436
1257 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006138 436
1258 3300003354 JGI25160J50197_1000877 JGI25160J50197_10008772 436
1259 3300003354 JGI25160J50197_1001286 JGI25160J50197_100128612 436
1260 3300003354 JGI25160J50197_1001787 JGI25160J50197_10017872 436
1261 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004138 436
1262 3300003374 JGI25161J50226_1000103 JGI25161J50226_100010347 436
1263 3300003374 JGI25161J50226_1000116 JGI25161J50226_10001162 436
1264 3300003374 JGI25161J50226_1001626 JGI25161J50226_10016265 436
1265 3300003762 Ga0055542_1001041 Ga0055542_10010415 436
1266 3300003771 Ga0055526_1001877 Ga0055526_10018778 436
1267 3300003771 Ga0055526_1002290 Ga0055526_10022902 436
1268 3300003771 Ga0055526_1016674 Ga0055526_10166743 436
1269 3300003775 Ga0055524_1000790 Ga0055524_100079016 436
1270 3300003775 Ga0055524_1001459 Ga0055524_10014599 436
1271 3300003781 Ga0055536_1014991 Ga0055536_10149912 436
1272 3300003790 Ga0055528_1000548 Ga0055528_100054818 436
1273 3300003790 Ga0055528_1000886 Ga0055528_100088614 436
1274 3300003790 Ga0055528_1003424 Ga0055528_10034242 436
1275 3300003790 Ga0055528_1011189 Ga0055528_10111892 436
1276 3300003792 Ga0055540_1000548 Ga0055540_10005485 436
1277 3300003792 Ga0055540_1010663 Ga0055540_10106634 436
1278 3300003856 Ga0058692_1008879 Ga0058692_10088792 436
1279 3300004625 Ga0055543_1000002 Ga0055543_1000002197 436
1280 3300004625 Ga0055543_1000029 Ga0055543_100002924 436
1281 3300004625 Ga0055543_1000337 Ga0055543_10003372 436
1282 3300004625 Ga0055543_1001407 Ga0055543_10014075 436
1283 3300005262 Ga0065165_1000196 Ga0065165_100019622 436
1284 3300005262 Ga0065165_1001746 Ga0065165_100174613 436
1285 3300005262 Ga0065165_1004041 Ga0065165_10040418 436
1286 3300005262 Ga0065165_1005489 Ga0065165_10054895 436
1287 3300005262 Ga0065165_1017482 Ga0065165_10174821 436
1288 3300005331 Ga0070670_100006699 Ga0070670_1000066998 436
1289 3300005340 Ga0070689_100063568 Ga0070689_1000635681 436
1290 3300005347 Ga0070668_100044222 Ga0070668_1000442222 436
1291 3300005353 Ga0070669_100158925 Ga0070669_1001589252 436
1292 3300005355 Ga0070671_100057072 Ga0070671_1000570724 436
1293 3300005438 Ga0070701_10021591 Ga0070701_100215912 436
1294 3300005440 Ga0070705_100145598 Ga0070705_1001455982 436
1295 3300005445 Ga0070708_100188175 Ga0070708_1001881751 436
1296 3300005468 Ga0070707_100268054 Ga0070707_1002680542 436
1297 3300005539 Ga0068853_100024508 Ga0068853_1000245083 436
1298 3300005548 Ga0070665_100042121 Ga0070665_1000421212 436
1299 3300005548 Ga0070665_100133580 Ga0070665_1001335802 436
1300 3300005614 Ga0068856_100180813 Ga0068856_1001808133 436
1301 3300005617 Ga0068859_100091038 Ga0068859_1000910382 436
1302 3300005844 Ga0068862_100110024 Ga0068862_1001100242 436
1303 3300005937 Ga0081455_10051502 Ga0081455_100515023 436
1304 3300005985 Ga0081539_10001815 Ga0081539_100018158 436
1305 3300006038 Ga0075365_10010764 Ga0075365_100107642 436
1306 3300006038 Ga0075365_10015316 Ga0075365_100153164 436
1307 3300006038 Ga0075365_10061156 Ga0075365_100611562 436
1308 3300006038 Ga0075365_10067310 Ga0075365_100673102 436
1309 3300006038 Ga0075365_10070522 Ga0075365_100705222 436
1310 3300006038 Ga0075365_10124345 Ga0075365_101243452 436
1311 3300006038 Ga0075365_10202682 Ga0075365_102026821 436
1312 3300006048 Ga0075363_100005203 Ga0075363_1000052034 436
1313 3300006048 Ga0075363_100057919 Ga0075363_1000579192 436
1314 3300006051 Ga0075364_10001625 Ga0075364_100016254 436
1315 3300006051 Ga0075364_10023758 Ga0075364_100237583 436
1316 3300006177 Ga0075362_10009934 Ga0075362_100099343 436
1317 3300006177 Ga0075362_10041803 Ga0075362_100418031 436
1318 3300006178 Ga0075367_10004539 Ga0075367_100045392 436
1319 3300006178 Ga0075367_10018322 Ga0075367_100183222 436
1320 3300006178 Ga0075367_10072640 Ga0075367_100726403 436
1321 3300006178 Ga0075367_10080318 Ga0075367_100803182 436
1322 3300006195 Ga0075366_10073059 Ga0075366_100730592 436
1323 3300006353 Ga0075370_10000839 Ga0075370_100008395 436
1324 3300006844 Ga0075428_100005976 Ga0075428_1000059769 436
1325 3300006846 Ga0075430_100000852 Ga0075430_1000008529 436
1326 3300006846 Ga0075430_100008547 Ga0075430_1000085473 436
1327 3300006847 Ga0075431_100084545 Ga0075431_1000845452 436
1328 3300006880 Ga0075429_100000927 Ga0075429_1000009272 436
1329 3300006880 Ga0075429_100143608 Ga0075429_1001436082 436
1330 3300006931 Ga0097620_100091038 Ga0097620_1000910382 436
1331 3300006946 Ga0079104_1000042 Ga0079104_100004228 436
1332 3300006946 Ga0079104_1009436 Ga0079104_10094361 436
1333 3300006948 Ga0099826_10003152 Ga0099826_100031524 436
1334 3300009011 Ga0105251_10026227 Ga0105251_100262272 436
1335 3300009093 Ga0105240_10000019 Ga0105240_10000019112 436
1336 3300009094 Ga0111539_10001873 Ga0111539_100018737 436
1337 3300009094 Ga0111539_10004595 Ga0111539_1000459510 436
1338 3300009147 Ga0114129_10000293 Ga0114129_1000029329 436
1339 3300009148 Ga0105243_10054480 Ga0105243_100544802 436
1340 3300009177 Ga0105248_10071041 Ga0105248_100710412 436
1341 3300009545 Ga0105237_10033689 Ga0105237_100336893 436
1342 3300009545 Ga0105237_10101978 Ga0105237_101019783 436
1343 3300009553 Ga0105249_10017064 Ga0105249_100170643 436
1344 3300009553 Ga0105249_10181544 Ga0105249_101815442 436
1345 3300009765 Ga0123341_1000015 Ga0123341_100001520 436
1346 3300013102 Ga0157371_10000005 Ga0157371_10000005350 436
1347 3300013104 Ga0157370_10000036 Ga0157370_1000003630 436
1348 3300013104 Ga0157370_10002915 Ga0157370_1000291510 436
1349 3300013104 Ga0157370_10293465 Ga0157370_102934651 436
1350 3300013249 Ga0171463_1014 Ga0171463_101472 436
1351 3300015262 Ga0182007_10017364 Ga0182007_100173643 436
1352 3300015262 Ga0182007_10022122 Ga0182007_100221222 436
1353 3300015690 Ga0183363_1052 Ga0183363_105227 436
1354 3300021320 Ga0214544_1000063 Ga0214544_100006369 436
1355 3300021321 Ga0214542_1000095 Ga0214542_100009559 436
1356 3300021327 Ga0214543_1000008 Ga0214543_1000008269 436
1357 3300021327 Ga0214543_1000026 Ga0214543_100002659 436
1358 3300021384 Ga0213876_10038669 Ga0213876_100386691 436
1359 3300022739 Ga0228711_1000003 Ga0228711_1000003195 436
1360 3300022740 Ga0228710_1000003 Ga0228710_1000003201 436
1361 3300025206 Ga0209435_100005 Ga0209435_100005107 436
1362 3300025208 Ga0209436_100041 Ga0209436_10004157 436
1363 3300025208 Ga0209436_105270 Ga0209436_1052703 436
1364 3300025233 Ga0209437_100078 Ga0209437_100078133 436
1365 3300025233 Ga0209437_100174 Ga0209437_10017446 436
1366 3300025245 Ga0207425_1000080 Ga0207425_100008070 436
1367 3300025245 Ga0207425_1003292 Ga0207425_10032923 436
1368 3300025246 Ga0209646_1000011 Ga0209646_1000011107 436
1369 3300025246 Ga0209646_1006491 Ga0209646_10064912 436
1370 3300025250 Ga0209026_1000008 Ga0209026_1000008107 436
1371 3300025250 Ga0209026_1000050 Ga0209026_1000050200 436
1372 3300025253 Ga0209677_101144 Ga0209677_1011447 436
1373 3300025254 Ga0209148_1000032 Ga0209148_1000032458 436
1374 3300025256 Ga0209759_1000004 Ga0209759_1000004107 436
1375 3300025256 Ga0209759_1000233 Ga0209759_100023371 436
1376 3300025258 Ga0209129_1000195 Ga0209129_100019531 436
1377 3300025258 Ga0209129_1000199 Ga0209129_100019954 436
1378 3300025258 Ga0209129_1001192 Ga0209129_10011929 436
1379 3300025258 Ga0209129_1002022 Ga0209129_10020227 436
1380 3300025258 Ga0209129_1004508 Ga0209129_10045084 436
1381 3300025258 Ga0209129_1004637 Ga0209129_10046374 436
1382 3300025261 Ga0209233_1000034 Ga0209233_100003417 436
1383 3300025261 Ga0209233_1000163 Ga0209233_1000163133 436
1384 3300025261 Ga0209233_1000299 Ga0209233_100029931 436
1385 3300025261 Ga0209233_1000305 Ga0209233_100030530 436
1386 3300025272 Ga0209455_1000085 Ga0209455_1000085214 436
1387 3300025272 Ga0209455_1008371 Ga0209455_10083712 436
1388 3300025273 Ga0209673_1000037 Ga0209673_100003783 436
1389 3300025273 Ga0209673_1000320 Ga0209673_100032019 436
1390 3300025273 Ga0209673_1000880 Ga0209673_100088030 436
1391 3300025273 Ga0209673_1000924 Ga0209673_100092418 436
1392 3300025273 Ga0209673_1003302 Ga0209673_10033023 436
1393 3300025273 Ga0209673_1007876 Ga0209673_10078763 436
1394 3300025284 Ga0209130_1000030 Ga0209130_1000030102 436
1395 3300025284 Ga0209130_1000032 Ga0209130_1000032132 436
1396 3300025284 Ga0209130_1000198 Ga0209130_100019871 436
1397 3300025284 Ga0209130_1010028 Ga0209130_10100281 436
1398 3300025292 Ga0209676_1005216 Ga0209676_10052162 436
1399 3300025292 Ga0209676_1007354 Ga0209676_10073543 436
1400 3300025294 Ga0209025_1000052 Ga0209025_1000052207 436
1401 3300025294 Ga0209025_1000074 Ga0209025_100007456 436
1402 3300025294 Ga0209025_1000080 Ga0209025_1000080237 436
1403 3300025294 Ga0209025_1000332 Ga0209025_100033270 436
1404 3300025294 Ga0209025_1000339 Ga0209025_100033920 436
1405 3300025294 Ga0209025_1000354 Ga0209025_100035421 436
1406 3300025294 Ga0209025_1000566 Ga0209025_100056623 436
1407 3300025294 Ga0209025_1051465 Ga0209025_10514651 436
1408 3300025295 Ga0209564_1000207 Ga0209564_100020727 436
1409 3300025295 Ga0209564_1000345 Ga0209564_100034519 436
1410 3300025295 Ga0209564_1000353 Ga0209564_10003532 436
1411 3300025295 Ga0209564_1001668 Ga0209564_100166817 436
1412 3300025295 Ga0209564_1011812 Ga0209564_10118123 436
1413 3300025297 Ga0209758_1000105 Ga0209758_100010527 436
1414 3300025297 Ga0209758_1000263 Ga0209758_100026370 436
1415 3300025297 Ga0209758_1000561 Ga0209758_100056144 436
1416 3300025297 Ga0209758_1001323 Ga0209758_100132322 436
1417 3300025297 Ga0209758_1001789 Ga0209758_100178913 436
1418 3300025297 Ga0209758_1002280 Ga0209758_10022809 436
1419 3300025297 Ga0209758_1002342 Ga0209758_10023429 436
1420 3300025297 Ga0209758_1018773 Ga0209758_10187733 436
1421 3300025297 Ga0209758_1032328 Ga0209758_10323281 436
1422 3300025298 Ga0209050_1003774 Ga0209050_10037746 436
1423 3300025298 Ga0209050_1008822 Ga0209050_10088224 436
1424 3300025299 Ga0209256_1000343 Ga0209256_100034366 436
1425 3300025299 Ga0209256_1000348 Ga0209256_100034859 436
1426 3300025299 Ga0209256_1000368 Ga0209256_100036831 436
1427 3300025299 Ga0209256_1003220 Ga0209256_100322010 436
1428 3300025299 Ga0209256_1004594 Ga0209256_10045947 436
1429 3300025299 Ga0209256_1007480 Ga0209256_10074802 436
1430 3300025302 Ga0207426_1000047 Ga0207426_1000047298 436
1431 3300025302 Ga0207426_1000048 Ga0207426_1000048308 436
1432 3300025302 Ga0207426_1000077 Ga0207426_1000077132 436
1433 3300025302 Ga0207426_1000296 Ga0207426_100029621 436
1434 3300025302 Ga0207426_1000985 Ga0207426_10009859 436
1435 3300025303 Ga0209051_1000236 Ga0209051_100023637 436
1436 3300025303 Ga0209051_1000517 Ga0209051_100051729 436
1437 3300025303 Ga0209051_1003116 Ga0209051_10031162 436
1438 3300025303 Ga0209051_1006923 Ga0209051_10069234 436
1439 3300025303 Ga0209051_1007923 Ga0209051_10079232 436
1440 3300025303 Ga0209051_1017517 Ga0209051_10175172 436
1441 3300025304 Ga0209257_1011867 Ga0209257_10118671 436
1442 3300025901 Ga0207688_10067120 Ga0207688_100671202 436
1443 3300025907 Ga0207645_10096755 Ga0207645_100967551 436
1444 3300025913 Ga0207695_10000049 Ga0207695_10000049114 436
1445 3300025914 Ga0207671_10000107 Ga0207671_1000010755 436
1446 3300025914 Ga0207671_10019495 Ga0207671_100194953 436
1447 3300025925 Ga0207650_10005592 Ga0207650_100055921 436
1448 3300025935 Ga0207709_10043168 Ga0207709_100431682 436
1449 3300025961 Ga0207712_10023861 Ga0207712_100238613 436
1450 3300025972 Ga0207668_10120463 Ga0207668_101204631 436
1451 3300025981 Ga0207640_10089470 Ga0207640_100894701 436
1452 3300026078 Ga0207702_10103179 Ga0207702_101031792 436
1453 3300026089 Ga0207648_10053604 Ga0207648_100536044 436
1454 3300026118 Ga0207675_100050326 Ga0207675_1000503262 436
1455 3300026142 Ga0207698_10252891 Ga0207698_102528911 436
1456 3300027111 Ga0209281_1000081 Ga0209281_1000081195 436
1457 3300027111 Ga0209281_1000141 Ga0209281_100014183 436
1458 3300027111 Ga0209281_1000194 Ga0209281_100019428 436
1459 3300027312 Ga0209371_1000003 Ga0209371_1000003304 436
1460 3300027312 Ga0209371_1003578 Ga0209371_10035783 436
1461 3300027312 Ga0209371_1007496 Ga0209371_10074962 436
1462 3300027312 Ga0209371_1009533 Ga0209371_10095333 436
1463 3300027666 Ga0209282_1000036 Ga0209282_100003643 436
1464 3300027666 Ga0209282_1000245 Ga0209282_100024524 436
1465 3300027866 Ga0209813_10008959 Ga0209813_100089591 436
1466 3300027907 Ga0207428_10159438 Ga0207428_101594382 436
1467 3300028380 Ga0268265_10066200 Ga0268265_100662002 436
1468 3300028380 Ga0268265_10139494 Ga0268265_101394942 436
1469 3300028381 Ga0268264_10020771 Ga0268264_100207713 436
1470 3300028563 Ga0265319_1026169 Ga0265319_10261692 436
1471 3300028577 Ga0265318_10033461 Ga0265318_100334612 436
1472 3300028794 Ga0307515_10001520 Ga0307515_1000152043 436
1473 3300028794 Ga0307515_10006129 Ga0307515_100061296 436
1474 3300028794 Ga0307515_10100689 Ga0307515_101006893 436
1475 3300030500 Ga0268256_1000004 Ga0268256_1000004747 436
1476 3300030500 Ga0268256_1010141 Ga0268256_10101412 436
1477 3300030500 Ga0268256_1015653 Ga0268256_10156532 436
1478 3300030744 Ga0316181_1110178 Ga0316181_11101782 436
1479 3300031241 Ga0265325_10084294 Ga0265325_100842941 436
1480 3300031456 Ga0307513_10003087 Ga0307513_100030879 436
1481 3300031456 Ga0307513_10003471 Ga0307513_1000347120 436
1482 3300031712 Ga0265342_10104380 Ga0265342_101043802 436
1483 3300031731 Ga0307405_10000333 Ga0307405_1000033316 436
1484 3300031852 Ga0307410_10017254 Ga0307410_100172543 436
1485 3300031901 Ga0307406_10079726 Ga0307406_100797262 436
1486 3300031911 Ga0307412_10005005 Ga0307412_100050055 436
1487 3300031967 Ga0315914_1000002 Ga0315914_1000002301 436
1488 3300033430 Ga0315913_1000009 Ga0315913_100000943 436
1489 3300033464 Ga0315915_1000005 Ga0315915_1000005301 436
1490 3300035692 Ga0373935_0039661 Ga0373935_0039661_35_1345 436
1491 3300035695 Ga0373927_0000047 Ga0373927_0000047_39617_40927 436
1492 3300036712 Ga0316584_0130159 Ga0316584_0130159_204_1517 436
1493 3300037068 Ga0373925_0001420 Ga0373925_0001420_7575_8885 436
1494 3300037312 Ga0395899_0000030 Ga0395899_0000030_114099_115409 436
1495 3300037418 Ga0395900_0000023 Ga0395900_0000023_120505_121815 436
1496 3300037418 Ga0395900_0174865 Ga0395900_0174865_324_1649 436
1497 3300037466 Ga0395898_0000038 Ga0395898_0000038_114099_115409 436
1498 3300037471 Ga0395905_0000021 Ga0395905_0000021_114099_115409 436
1499 3300037471 Ga0395905_0001828 Ga0395905_0001828_17438_18748 436
1500 3300037471 Ga0395905_0043048 Ga0395905_0043048_483_1808 436
1501 3300037471 Ga0395905_0090275 Ga0395905_0090275_777_2102 436
1502 3300037471 Ga0395905_0170337 Ga0395905_0170337_612_1937 436
1503 3300038443 Ga0395901_0000018 Ga0395901_0000018_120505_121815 436
1504 3300039062 Ga0400483_056535 Ga0400483_056535_22717_24039 436
1505 3300039062 Ga0400483_064331 Ga0400483_064331_588_1910 436
1506 3300039062 Ga0400483_225954 Ga0400483_225954_1066_2388 436
1507 3300039437 Ga0436365_0966943 Ga0436365_0966943_1422_2732 436
1508 3300039438 Ga0436360_0078821 Ga0436360_0078821_772_2085 436
1509 3300039447 Ga0436361_0656175 Ga0436361_0656175_2462_3772 436
1510 3300041404 Ga0439436_0011526 Ga0439436_0011526_1099_2409 436
1511 3300041413 Ga0439465_0002349 Ga0439465_0002349_3046_4356 436
1512 3300041451 Ga0451791_1838827 Ga0451791_1838827_90_1400 436
1513 3300041458 Ga0451798_0601713 Ga0451798_0601713_258_1568 436
1514 3300041494 Ga0451837_0668917 Ga0451837_0668917_1102_2412 436
1515 3300041498 Ga0451841_0495290 Ga0451841_0495290_1088_2398 436
1516 3300042001 Ga0439441_010430 Ga0439441_010430_166_1476 436
1517 3300042007 Ga0439449_0004566 Ga0439449_0004566_3697_5007 436
1518 3300042007 Ga0439449_0030804 Ga0439449_0030804_473_1783 436
1519 3300044684 Ga0466966_0036092 Ga0466966_0036092_1796_3106 436
1520 3300044712 Ga0453684_0048819 Ga0453684_0048819_2354_3667 436
1521 3300044765 Ga0466970_0007062 Ga0466970_0007062_412_1722 436
1522 3300046459 Ga0495629_0096059 Ga0495629_0096059_146_1456 436
1523 3300046460 Ga0495638_0076673 Ga0495638_0076673_169_1479 436
1524 3300046474 Ga0495605_0025255 Ga0495605_0025255_690_2006 436
1525 3300046492 Ga0495585_0018784 Ga0495585_0018784_1783_3093 436
1526 3300046507 Ga0495606_0000629 Ga0495606_0000629_1168_2478 436
1527 3300046507 Ga0495606_0002219 Ga0495606_0002219_8087_9397 436
1528 3300046507 Ga0495606_0013151 Ga0495606_0013151_4068_5378 436
1529 3300046513 Ga0495616_0093071 Ga0495616_0093071_60_1370 436
1530 3300046519 Ga0495632_0025688 Ga0495632_0025688_1224_2534 436
1531 3300046519 Ga0495632_0061201 Ga0495632_0061201_488_1798 436
1532 3300046522 Ga0495643_0023336 Ga0495643_0023336_1169_2479 436
1533 3300046522 Ga0495643_0023803 Ga0495643_0023803_669_1979 436
1534 3300046522 Ga0495643_0028720 Ga0495643_0028720_1196_2521 436
1535 3300046524 Ga0495648_0016311 Ga0495648_0016311_807_2117 436
1536 3300046530 Ga0495654_0001861 Ga0495654_0001861_9087_10412 436
1537 3300046536 Ga0495587_0072106 Ga0495587_0072106_454_1764 436
1538 3300046558 Ga0495633_0088023 Ga0495633_0088023_16_1326 436
1539 3300046660 Ga0495625_0015812 Ga0495625_0015812_577_1887 436
1540 3300046660 Ga0495625_0031642 Ga0495625_0031642_2391_3701 436
1541 3300046665 Ga0495661_0060714 Ga0495661_0060714_241_1551 436
1542 3300046674 Ga0495588_0032887 Ga0495588_0032887_531_1841 436
1543 3300047443 Ga0495687_048323 Ga0495687_048323_383_1693 436
1544 3300047472 Ga0495686_0002643 Ga0495686_0002643_7822_9132 436
1545 3300048904 Ga0496101_0031137 Ga0496101_0031137_418_1734 436
1546 3300048905 Ga0496102_0059349 Ga0496102_0059349_666_1982 436
1547 3300048907 Ga0496104_0016934 Ga0496104_0016934_4892_6208 436
1548 3300048908 Ga0496105_0034708 Ga0496105_0034708_1018_2334 436
1549 3300048910 Ga0496107_0106317 Ga0496107_0106317_53_1363 436
1550 3300048912 Ga0496109_0188238 Ga0496109_0188238_85_1401 436
1551 3300048914 Ga0496111_0000570 Ga0496111_0000570_2963_4273 436
1552 3300048919 Ga0496116_0000097 Ga0496116_0000097_168525_169835 436
1553 3300048919 Ga0496116_0035905 Ga0496116_0035905_1472_2782 436
1554 3300048920 Ga0496117_0000030 Ga0496117_0000030_124835_126145 436
1555 3300048920 Ga0496117_0002458 Ga0496117_0002458_6867_8177 436
1556 3300048920 Ga0496117_0005055 Ga0496117_0005055_2304_3614 436
1557 3300048920 Ga0496117_0030483 Ga0496117_0030483_2772_4082 436
1558 3300048920 Ga0496117_0062045 Ga0496117_0062045_929_2239 436
1559 3300048920 Ga0496117_0067662 Ga0496117_0067662_541_1851 436
1560 3300048921 Ga0496118_0005475 Ga0496118_0005475_2569_3879 436
1561 3300048921 Ga0496118_0010916 Ga0496118_0010916_1977_3287 436
1562 3300048921 Ga0496118_0018933 Ga0496118_0018933_693_2003 436
1563 3300048921 Ga0496118_0023602 Ga0496118_0023602_3414_4724 436
1564 3300048922 Ga0496119_0019969 Ga0496119_0019969_2840_4150 436
1565 3300048922 Ga0496119_0029278 Ga0496119_0029278_509_1825 436
1566 3300048922 Ga0496119_0037868 Ga0496119_0037868_649_1959 436
1567 3300048922 Ga0496119_0066315 Ga0496119_0066315_550_1875 436
1568 3300048923 Ga0496120_0000148 Ga0496120_0000148_82408_83718 436
1569 3300048923 Ga0496120_0006073 Ga0496120_0006073_5194_6504 436
1570 3300048923 Ga0496120_0044423 Ga0496120_0044423_715_2040 436
1571 3300048924 Ga0496121_0000003 Ga0496121_0000003_1043157_1044467 436
1572 3300048924 Ga0496121_0000180 Ga0496121_0000180_12027_13337 436
1573 3300048924 Ga0496121_0003259 Ga0496121_0003259_3655_4965 436
1574 3300048924 Ga0496121_0020232 Ga0496121_0020232_913_2223 436
1575 3300048924 Ga0496121_0023174 Ga0496121_0023174_3270_4580 436
1576 3300048924 Ga0496121_0027611 Ga0496121_0027611_2947_4257 436
1577 3300048925 Ga0496122_0000024 Ga0496122_0000024_150694_152004 436
1578 3300048925 Ga0496122_0000050 Ga0496122_0000050_45418_46728 436
1579 3300048925 Ga0496122_0000107 Ga0496122_0000107_101755_103065 436
1580 3300048925 Ga0496122_0001243 Ga0496122_0001243_12089_13405 436
1581 3300048925 Ga0496122_0008479 Ga0496122_0008479_5783_7093 436
1582 3300048925 Ga0496122_0010876 Ga0496122_0010876_7674_8984 436
1583 3300048925 Ga0496122_0021073 Ga0496122_0021073_689_1999 436
1584 3300048925 Ga0496122_0029228 Ga0496122_0029228_404_1714 436
1585 3300048925 Ga0496122_0055523 Ga0496122_0055523_709_2019 436
1586 3300048926 Ga0496123_0000023 Ga0496123_0000023_81604_82914 436
1587 3300048926 Ga0496123_0000063 Ga0496123_0000063_90044_91354 436
1588 3300048926 Ga0496123_0000086 Ga0496123_0000086_74293_75603 436
1589 3300048926 Ga0496123_0003983 Ga0496123_0003983_8125_9441 436
1590 3300048926 Ga0496123_0009186 Ga0496123_0009186_2817_4127 436
1591 3300048926 Ga0496123_0052226 Ga0496123_0052226_648_1958 436
1592 3300048926 Ga0496123_0084740 Ga0496123_0084740_515_1825 436
1593 3300048927 Ga0496124_0000239 Ga0496124_0000239_85916_87226 436
1594 3300048927 Ga0496124_0001850 Ga0496124_0001850_8961_10271 436
1595 3300048927 Ga0496124_0003986 Ga0496124_0003986_12314_13624 436
1596 3300048927 Ga0496124_0005879 Ga0496124_0005879_11522_12838 436
1597 3300048927 Ga0496124_0010962 Ga0496124_0010962_2634_3944 436
1598 3300048927 Ga0496124_0015054 Ga0496124_0015054_3640_4950 436
1599 3300048927 Ga0496124_0030974 Ga0496124_0030974_1584_2894 436
1600 3300048928 Ga0496125_0000833 Ga0496125_0000833_17312_18622 436
1601 3300048928 Ga0496125_0000963 Ga0496125_0000963_19461_20771 436
1602 3300048928 Ga0496125_0003888 Ga0496125_0003888_4014_5324 436
1603 3300048928 Ga0496125_0048642 Ga0496125_0048642_778_2088 436
1604 3300048928 Ga0496125_0096697 Ga0496125_0096697_430_1746 436
1605 3300048929 Ga0496126_0000119 Ga0496126_0000119_12018_13328 436
1606 3300048929 Ga0496126_0000434 Ga0496126_0000434_18978_20288 436
1607 3300048929 Ga0496126_0048221 Ga0496126_0048221_228_1538 436
1608 3300048929 Ga0496126_0064335 Ga0496126_0064335_60_1376 436
1609 3300048929 Ga0496126_0140941 Ga0496126_0140941_361_1671 436
1610 3300049568 Ga0501031_0000006 Ga0501031_0000006_120970_122280 436
1611 3300049568 Ga0501031_0018057 Ga0501031_0018057_2029_3339 436
1612 3300049569 Ga0501032_0000013 Ga0501032_0000013_98542_99852 436
1613 3300049569 Ga0501032_0000016 Ga0501032_0000016_120975_122285 436
1614 3300049569 Ga0501032_0017003 Ga0501032_0017003_148_1458 436
1615 3300049570 Ga0501033_0000101 Ga0501033_0000101_68954_70264 436
1616 3300049570 Ga0501033_0000660 Ga0501033_0000660_21499_22824 436
1617 3300049570 Ga0501033_0009148 Ga0501033_0009148_640_1950 436
1618 3300049571 Ga0501034_0000054 Ga0501034_0000054_202924_204234 436
1619 3300049571 Ga0501034_0000168 Ga0501034_0000168_52404_53714 436
1620 3300049571 Ga0501034_0014819 Ga0501034_0014819_3653_4963 436
1621 3300049571 Ga0501034_0036336 Ga0501034_0036336_511_1824 436
1622 3300049571 Ga0501034_0043477 Ga0501034_0043477_1835_3160 436
1623 3300049572 Ga0501036_0000019 Ga0501036_0000019_64930_66240 436
1624 3300049572 Ga0501036_0000828 Ga0501036_0000828_14347_15657 436
1625 3300049572 Ga0501036_0006703 Ga0501036_0006703_4094_5404 436
1626 3300049573 Ga0501037_0000013 Ga0501037_0000013_52404_53714 436
1627 3300049573 Ga0501037_0000105 Ga0501037_0000105_24966_26291 436
1628 3300049573 Ga0501037_0005064 Ga0501037_0005064_2716_4026 436
1629 3300049573 Ga0501037_0006338 Ga0501037_0006338_5421_6731 436
1630 3300049573 Ga0501037_0031629 Ga0501037_0031629_2020_3345 436
1631 3300049574 Ga0501038_0000012 Ga0501038_0000012_52404_53714 436
1632 3300049574 Ga0501038_0001713 Ga0501038_0001713_19033_20343 436
1633 3300049574 Ga0501038_0016274 Ga0501038_0016274_1339_2649 436
1634 3300049574 Ga0501038_0133243 Ga0501038_0133243_455_1765 436
1635 3300049574 Ga0501038_0193044 Ga0501038_0193044_215_1540 436
1636 3300049575 Ga0501039_0000019 Ga0501039_0000019_52404_53714 436
1637 3300049575 Ga0501039_0000152 Ga0501039_0000152_40563_41873 436
1638 3300049575 Ga0501039_0222261 Ga0501039_0222261_148_1458 436
1639 3300049576 Ga0501040_0000768 Ga0501040_0000768_17458_18768 436
1640 3300049577 Ga0501041_0030414 Ga0501041_0030414_1319_2629 436
1641 3300049578 Ga0501042_0003664 Ga0501042_0003664_4484_5794 436
1642 3300049579 Ga0501043_0000014 Ga0501043_0000014_6117_7427 436
1643 3300049579 Ga0501043_0000055 Ga0501043_0000055_41323_42648 436
1644 3300049579 Ga0501043_0000209 Ga0501043_0000209_2591_3901 436
1645 3300049579 Ga0501043_0030311 Ga0501043_0030311_2793_4103 436
1646 3300049579 Ga0501043_0059365 Ga0501043_0059365_1442_2752 436
1647 3300049580 Ga0501046_0020472 Ga0501046_0020472_2928_4238 436
1648 3300049581 Ga0501047_0003446 Ga0501047_0003446_7837_9147 436
1649 3300049581 Ga0501047_0005984 Ga0501047_0005984_5362_6672 436
1650 3300049581 Ga0501047_0011138 Ga0501047_0011138_5504_6829 436
1651 3300049581 Ga0501047_0020376 Ga0501047_0020376_1454_2764 436
1652 3300049582 Ga0501048_0005288 Ga0501048_0005288_3485_4795 436
1653 3300049584 Ga0501068_0010106 Ga0501068_0010106_3806_5116 436
1654 3300049585 Ga0501069_0000106 Ga0501069_0000106_25519_26844 436
1655 3300049585 Ga0501069_0037080 Ga0501069_0037080_1061_2386 436
1656 3300049586 Ga0501070_0001320 Ga0501070_0001320_748_2073 436
1657 3300049586 Ga0501070_0003394 Ga0501070_0003394_7981_9291 436
1658 3300049586 Ga0501070_0005565 Ga0501070_0005565_7992_9317 436
1659 3300049586 Ga0501070_0016146 Ga0501070_0016146_1492_2802 436
1660 3300049587 Ga0501071_0001762 Ga0501071_0001762_2467_3792 436
1661 3300049587 Ga0501071_0032434 Ga0501071_0032434_1079_2389 436
1662 3300049589 Ga0501073_0030633 Ga0501073_0030633_608_1918 436
1663 3300049590 Ga0501074_0000072 Ga0501074_0000072_15047_16372 436
1664 3300049590 Ga0501074_0027619 Ga0501074_0027619_2103_3413 436
1665 3300049742 Ga0501080_0000878 Ga0501080_0000878_9033_10358 436
1666 3300049742 Ga0501080_0007242 Ga0501080_0007242_4760_6070 436
1667 3300049744 Ga0501083_0000484 Ga0501083_0000484_12488_13813 436
1668 3300049744 Ga0501083_0060413 Ga0501083_0060413_522_1832 436
1669 3300049822 Ga0501035_0000019 Ga0501035_0000019_38167_39477 436
1670 3300049822 Ga0501035_0000081 Ga0501035_0000081_63740_65050 436
1671 3300049822 Ga0501035_0000183 Ga0501035_0000183_62347_63672 436
1672 3300049822 Ga0501035_0004384 Ga0501035_0004384_9431_10756 436
1673 3300049822 Ga0501035_0012030 Ga0501035_0012030_1934_3244 436
1674 3300049822 Ga0501035_0065881 Ga0501035_0065881_1503_2813 436
1675 3300049823 Ga0501044_0000009 Ga0501044_0000009_205182_206507 436
1676 3300049823 Ga0501044_0000029 Ga0501044_0000029_120975_122285 436
1677 3300049823 Ga0501044_0004154 Ga0501044_0004154_2802_4127 436
1678 3300049823 Ga0501044_0008796 Ga0501044_0008796_4762_6072 436
1679 3300049823 Ga0501044_0020961 Ga0501044_0020961_5600_6910 436
1680 3300049823 Ga0501044_0021041 Ga0501044_0021041_2502_3827 436
1681 3300049823 Ga0501044_0046742 Ga0501044_0046742_2801_4126 436
1682 3300049823 Ga0501044_0051933 Ga0501044_0051933_697_2034 436
1683 3300049823 Ga0501044_0058456 Ga0501044_0058456_930_2240 436
1684 3300049824 Ga0501045_0005518 Ga0501045_0005518_3971_5281 436
1685 3300049824 Ga0501045_0059823 Ga0501045_0059823_1358_2668 436
1686 3300050489 nmdc:mga03683_55260_c1 nmdc:mga03683_55260_c1_291_1616 436
1687 3300050490 nmdc:mga03n38_10877_c1 nmdc:mga03n38_10877_c1_970_2295 436
1688 3300050491 nmdc:mga00v17_2647_c1 nmdc:mga00v17_2647_c1_5406_6716 436
1689 3300050491 nmdc:mga00v17_2942_c2 nmdc:mga00v17_2942_c2_1009_2334 436
1690 3300050491 nmdc:mga00v17_337_c1 nmdc:mga00v17_337_c1_21255_22565 436
1691 3300050491 nmdc:mga00v17_67377_c1 nmdc:mga00v17_67377_c1_104_1414 436
1692 3300050492 nmdc:mga0yw44_2133_c1 nmdc:mga0yw44_2133_c1_3231_4556 436
1693 3300050492 nmdc:mga0yw44_44224_c1 nmdc:mga0yw44_44224_c1_1182_2534 436
1694 3300050493 nmdc:mga0k408_7537_c1 nmdc:mga0k408_7537_c1_4228_5538 436
1695 3300050494 nmdc:mga06z11_40796_c1 nmdc:mga06z11_40796_c1_262_1572 436
1696 3300050494 nmdc:mga06z11_51034_c1 nmdc:mga06z11_51034_c1_87_1397 436
1697 3300050494 nmdc:mga06z11_63975_c1 nmdc:mga06z11_63975_c1_164_1489 436
1698 3300050496 nmdc:mga07m45_37856_c1 nmdc:mga07m45_37856_c1_168_1478 436
1699 3300050496 nmdc:mga07m45_39431_c1 nmdc:mga07m45_39431_c1_549_1874 436
1700 3300050496 nmdc:mga07m45_62749_c1 nmdc:mga07m45_62749_c1_389_1699 436
1701 3300050507 nmdc:mga05p37_227_c1 nmdc:mga05p37_227_c1_36652_37989 436
1702 3300050508 nmdc:mga09592_139472_c1 nmdc:mga09592_139472_c1_106_1416 436
1703 3300050508 nmdc:mga09592_578_c1 nmdc:mga09592_578_c1_21439_22776 436
1704 3300050509 nmdc:mga0qj67_12914_c1 nmdc:mga0qj67_12914_c1_1743_3080 436
1705 3300050509 nmdc:mga0qj67_9436_c1 nmdc:mga0qj67_9436_c1_1601_2911 436
1706 3300050510 nmdc:mga06r32_10595_c1 nmdc:mga06r32_10595_c1_3012_4349 436
1707 3300050511 nmdc:mga08y16_12387_c1 nmdc:mga08y16_12387_c1_6269_7579 436
1708 3300050511 nmdc:mga08y16_184793_c1 nmdc:mga08y16_184793_c1_260_1600 436
1709 3300050516 nmdc:mga0sz30_74_c2 nmdc:mga0sz30_74_c2_21749_23059 436
1710 3300053086 Ga0500578_0011996 Ga0500578_0011996_2660_3970 436
1711 3300053107 Ga0500560_000303 Ga0500560_000303_586_1896 436
1712 3300053125 Ga0500618_000109 Ga0500618_000109_24598_25908 436
1713 3300053125 Ga0500618_000114 Ga0500618_000114_22225_23535 436
1714 3300053125 Ga0500618_000249 Ga0500618_000249_1883_3202 436
1715 3300053125 Ga0500618_001997 Ga0500618_001997_6275_7585 436
1716 3300053134 Ga0500658_0001045 Ga0500658_0001045_5474_6784 436
1717 3300053137 Ga0500561_0000118 Ga0500561_0000118_2631_3941 436
1718 3300053139 Ga0500568_0000035 Ga0500568_0000035_38959_40269 436
1719 3300053140 Ga0500573_0010491 Ga0500573_0010491_3397_4707 436
1720 3300053148 Ga0500590_005965 Ga0500590_005965_4075_5385 436
1721 3300053153 Ga0500616_0002051 Ga0500616_0002051_5664_6974 436
1722 3300053153 Ga0500616_0014986 Ga0500616_0014986_21_1337 436
1723 3300053153 Ga0500616_0079814 Ga0500616_0079814_61_1371 436
1724 3300053156 Ga0500622_0005319 Ga0500622_0005319_5486_6796 436
1725 3300053157 Ga0500624_000988 Ga0500624_000988_962_2272 436
1726 3300053177 Ga0500636_0000005 Ga0500636_0000005_153758_155068 436
1727 3300053177 Ga0500636_0003484 Ga0500636_0003484_7105_8415 436
1728 3300060353 Ga0501082_0082547 Ga0501082_0082547_557_1882 436
1729 3300003775 Ga0055524_1022270 Ga0055524_10222701 437
1730 3300005334 Ga0068869_100115281 Ga0068869_1001152812 437
1731 3300005444 Ga0070694_100101799 Ga0070694_1001017992 437
1732 3300005445 Ga0070708_100000686 Ga0070708_1000006868 437
1733 3300005457 Ga0070662_100003105 Ga0070662_1000031057 437
1734 3300005458 Ga0070681_10089646 Ga0070681_100896462 437
1735 3300005467 Ga0070706_100000652 Ga0070706_1000006522 437
1736 3300005468 Ga0070707_100008026 Ga0070707_1000080265 437
1737 3300005468 Ga0070707_100050009 Ga0070707_1000500092 437
1738 3300005471 Ga0070698_100231330 Ga0070698_1002313302 437
1739 3300005471 Ga0070698_100310404 Ga0070698_1003104041 437
1740 3300005518 Ga0070699_100187558 Ga0070699_1001875582 437
1741 3300005546 Ga0070696_100008273 Ga0070696_1000082734 437
1742 3300005719 Ga0068861_100006986 Ga0068861_1000069865 437
1743 3300005985 Ga0081539_10004098 Ga0081539_1000409817 437
1744 3300005985 Ga0081539_10034584 Ga0081539_100345842 437
1745 3300014968 Ga0157379_10026503 Ga0157379_100265032 437
1746 3300021361 Ga0213872_10002930 Ga0213872_100029306 437
1747 3300021388 Ga0213875_10003139 Ga0213875_100031393 437
1748 3300025910 Ga0207684_10000698 Ga0207684_100006982 437
1749 3300025910 Ga0207684_10199062 Ga0207684_101990621 437
1750 3300025918 Ga0207662_10031681 Ga0207662_100316812 437
1751 3300025922 Ga0207646_10012944 Ga0207646_100129442 437
1752 3300025933 Ga0207706_10002765 Ga0207706_1000276515 437
1753 3300025942 Ga0207689_10016113 Ga0207689_100161133 437
1754 3300026089 Ga0207648_10024247 Ga0207648_100242471 437
1755 3300026118 Ga0207675_100008827 Ga0207675_1000088272 437
1756 3300026121 Ga0207683_10074129 Ga0207683_100741292 437
1757 3300028558 Ga0265326_10016273 Ga0265326_100162732 437
1758 3300028794 Ga0307515_10011387 Ga0307515_100113872 437
1759 3300031251 Ga0265327_10030164 Ga0265327_100301642 437
1760 3300037853 Ga0436364_0457171 Ga0436364_0457171_9179_10495 437
1761 3300039447 Ga0436361_0015273 Ga0436361_0015273_6210_7529 437
1762 3300042876 Ga0451577_0005071 Ga0451577_0005071_4748_6067 437
1763 3300042876 Ga0451577_0147770 Ga0451577_0147770_91_1407 437
1764 3300049572 Ga0501036_0074452 Ga0501036_0074452_714_2078 437
1765 3300049575 Ga0501039_0010051 Ga0501039_0010051_1514_2878 437
1766 3300049577 Ga0501041_0024119 Ga0501041_0024119_342_1706 437
1767 3300049589 Ga0501073_0003088 Ga0501073_0003088_5980_7308 437
1768 3300049590 Ga0501074_0005586 Ga0501074_0005586_3561_4889 437
1769 3300049591 Ga0501075_0068634 Ga0501075_0068634_866_2230 437
1770 3300049592 Ga0501076_0052220 Ga0501076_0052220_1092_2456 437
1771 3300049742 Ga0501080_0024475 Ga0501080_0024475_1018_2346 437
1772 3300049742 Ga0501080_0289743 Ga0501080_0289743_67_1431 437
1773 3300049744 Ga0501083_0003518 Ga0501083_0003518_2975_4303 437
1774 3300049823 Ga0501044_0313781 Ga0501044_0313781_39_1367 437
1775 3300053092 Ga0500583_0056561 Ga0500583_0056561_69_1385 437
1776 3300053120 Ga0500597_009019 Ga0500597_009019_775_2091 437
1777 3300054114 Ga0501084_0013761 Ga0501084_0013761_3940_5268 437
1778 3300060353 Ga0501082_0020797 Ga0501082_0020797_601_1929 437
1779 3300061734 Ga0530510_0004233 Ga0530510_0004233_6336_7700 437
1780 3300003215 JGI25153J46596_10003984 JGI25153J46596_100039848 438
1781 3300005340 Ga0070689_100000019 Ga0070689_10000001973 438
1782 3300005577 Ga0068857_100065905 Ga0068857_1000659054 438
1783 3300005844 Ga0068862_100235797 Ga0068862_1002357971 438
1784 3300006914 Ga0075436_100116776 Ga0075436_1001167761 438
1785 3300009093 Ga0105240_10001841 Ga0105240_1000184122 438
1786 3300009545 Ga0105237_10000025 Ga0105237_1000002511 438
1787 3300009551 Ga0105238_10001161 Ga0105238_1000116125 438
1788 3300014326 Ga0157380_10162421 Ga0157380_101624211 438
1789 3300025297 Ga0209758_1000015 Ga0209758_1000015284 438
1790 3300025304 Ga0209257_1001378 Ga0209257_100137824 438
1791 3300025914 Ga0207671_10000644 Ga0207671_1000064411 438
1792 3300025924 Ga0207694_10002608 Ga0207694_100026083 438
1793 3300025936 Ga0207670_10000013 Ga0207670_10000013111 438
1794 3300028556 Ga0265337_1007267 Ga0265337_10072673 438
1795 3300028558 Ga0265326_10004795 Ga0265326_100047953 438
1796 3300028563 Ga0265319_1000654 Ga0265319_10006542 438
1797 3300028577 Ga0265318_10000177 Ga0265318_1000017725 438
1798 3300028577 Ga0265318_10000533 Ga0265318_1000053321 438
1799 3300028653 Ga0265323_10000448 Ga0265323_1000044818 438
1800 3300028653 Ga0265323_10004144 Ga0265323_100041443 438
1801 3300028654 Ga0265322_10029308 Ga0265322_100293081 438
1802 3300028800 Ga0265338_10021117 Ga0265338_100211171 438
1803 3300028800 Ga0265338_10078963 Ga0265338_100789631 438
1804 3300029957 Ga0265324_10000063 Ga0265324_100000635 438
1805 3300031235 Ga0265330_10000585 Ga0265330_1000058512 438
1806 3300031235 Ga0265330_10000707 Ga0265330_100007073 438
1807 3300031235 Ga0265330_10004926 Ga0265330_100049263 438
1808 3300031235 Ga0265330_10012298 Ga0265330_100122982 438
1809 3300031238 Ga0265332_10000386 Ga0265332_1000038629 438
1810 3300031239 Ga0265328_10006947 Ga0265328_100069472 438
1811 3300031240 Ga0265320_10000867 Ga0265320_1000086723 438
1812 3300031241 Ga0265325_10002706 Ga0265325_100027068 438
1813 3300031242 Ga0265329_10000042 Ga0265329_1000004229 438
1814 3300031242 Ga0265329_10000088 Ga0265329_100000888 438
1815 3300031242 Ga0265329_10010888 Ga0265329_100108882 438
1816 3300031247 Ga0265340_10002283 Ga0265340_100022839 438
1817 3300031247 Ga0265340_10003645 Ga0265340_100036454 438
1818 3300031249 Ga0265339_10000010 Ga0265339_10000010123 438
1819 3300031249 Ga0265339_10021747 Ga0265339_100217472 438
1820 3300031250 Ga0265331_10000539 Ga0265331_1000053923 438
1821 3300031344 Ga0265316_10000160 Ga0265316_1000016017 438
1822 3300031344 Ga0265316_10000175 Ga0265316_1000017522 438
1823 3300031344 Ga0265316_10000603 Ga0265316_1000060327 438
1824 3300031344 Ga0265316_10000739 Ga0265316_1000073910 438
1825 3300031344 Ga0265316_10005410 Ga0265316_100054106 438
1826 3300031344 Ga0265316_10089522 Ga0265316_100895222 438
1827 3300031595 Ga0265313_10000422 Ga0265313_100004227 438
1828 3300031595 Ga0265313_10001459 Ga0265313_1000145912 438
1829 3300031595 Ga0265313_10061577 Ga0265313_100615772 438
1830 3300031711 Ga0265314_10001482 Ga0265314_1000148225 438
1831 3300031712 Ga0265342_10000199 Ga0265342_1000019929 438
1832 3300031712 Ga0265342_10001752 Ga0265342_100017529 438
1833 3300031712 Ga0265342_10012574 Ga0265342_100125742 438
1834 3300031712 Ga0265342_10099135 Ga0265342_100991351 438
1835 3300031727 Ga0316576_10025856 Ga0316576_100258562 438
1836 3300031727 Ga0316576_10027210 Ga0316576_100272101 438
1837 3300031727 Ga0316576_10124348 Ga0316576_101243482 438
1838 3300031728 Ga0316578_10011315 Ga0316578_100113151 438
1839 3300031728 Ga0316578_10082317 Ga0316578_100823172 438
1840 3300031903 Ga0307407_10081444 Ga0307407_100814442 438
1841 3300033528 Ga0316588_1016704 Ga0316588_10167041 438
1842 3300036647 Ga0316582_0121812 Ga0316582_0121812_354_1673 438
1843 3300036712 Ga0316584_0137017 Ga0316584_0137017_352_1671 438
1844 3300039062 Ga0400483_199980 Ga0400483_199980_3258_4574 438
1845 3300039437 Ga0436365_0615937 Ga0436365_0615937_816_2138 438
1846 3300049581 Ga0501047_0067229 Ga0501047_0067229_1920_3314 438
1847 3300049586 Ga0501070_0000781 Ga0501070_0000781_27070_28464 438
1848 3300049742 Ga0501080_0000168 Ga0501080_0000168_43222_44616 438
1849 3300049822 Ga0501035_0005434 Ga0501035_0005434_6564_7958 438
1850 3300050512 nmdc:mga0n895_99514_c1 nmdc:mga0n895_99514_c1_1245_2564 438
1851 3300050514 nmdc:mga08x19_86102_c1 nmdc:mga08x19_86102_c1_429_1748 438
1852 3300053161 Ga0500634_0011815 Ga0500634_0011815_1863_3266 438
1853 iso_pu_bacteria 2690316117 2692314447 438
1854 3300003354 JGI25160J50197_1000486 JGI25160J50197_100048620 439
1855 3300003775 Ga0055524_1001086 Ga0055524_10010861 439
1856 3300005262 Ga0065165_1001966 Ga0065165_10019668 439
1857 3300005353 Ga0070669_100041129 Ga0070669_1000411293 439
1858 3300005367 Ga0070667_100019582 Ga0070667_1000195824 439
1859 3300005437 Ga0070710_10000681 Ga0070710_100006815 439
1860 3300005439 Ga0070711_100001092 Ga0070711_10000109211 439
1861 3300005546 Ga0070696_100025482 Ga0070696_1000254822 439
1862 3300005616 Ga0068852_100004165 Ga0068852_10000416510 439
1863 3300005719 Ga0068861_100109912 Ga0068861_1001099122 439
1864 3300005842 Ga0068858_100243785 Ga0068858_1002437852 439
1865 3300005937 Ga0081455_10001445 Ga0081455_1000144516 439
1866 3300005983 Ga0081540_1003545 Ga0081540_10035457 439
1867 3300005983 Ga0081540_1028845 Ga0081540_10288453 439
1868 3300005985 Ga0081539_10001251 Ga0081539_1000125116 439
1869 3300005985 Ga0081539_10018206 Ga0081539_100182063 439
1870 3300006038 Ga0075365_10002314 Ga0075365_100023145 439
1871 3300006038 Ga0075365_10122565 Ga0075365_101225651 439
1872 3300006177 Ga0075362_10005150 Ga0075362_100051502 439
1873 3300006177 Ga0075362_10015420 Ga0075362_100154202 439
1874 3300006844 Ga0075428_100107959 Ga0075428_1001079593 439
1875 3300009093 Ga0105240_10002869 Ga0105240_1000286915 439
1876 3300009174 Ga0105241_10099547 Ga0105241_100995472 439
1877 3300009174 Ga0105241_10135860 Ga0105241_101358602 439
1878 3300009176 Ga0105242_10244438 Ga0105242_102444382 439
1879 3300009177 Ga0105248_10034425 Ga0105248_100344256 439
1880 3300009545 Ga0105237_10006193 Ga0105237_1000619310 439
1881 3300009551 Ga0105238_10075130 Ga0105238_100751302 439
1882 3300009553 Ga0105249_10238794 Ga0105249_102387942 439
1883 3300010375 Ga0105239_10092443 Ga0105239_100924433 439
1884 3300013306 Ga0163162_10348125 Ga0163162_103481252 439
1885 3300021320 Ga0214544_1000003 Ga0214544_1000003242 439
1886 3300021321 Ga0214542_1000003 Ga0214542_1000003232 439
1887 3300021321 Ga0214542_1028661 Ga0214542_10286612 439
1888 3300021324 Ga0214545_1000004 Ga0214545_1000004245 439
1889 3300021327 Ga0214543_1000007 Ga0214543_1000007172 439
1890 3300025253 Ga0209677_108366 Ga0209677_1083662 439
1891 3300025254 Ga0209148_1000904 Ga0209148_10009047 439
1892 3300025261 Ga0209233_1002525 Ga0209233_10025256 439
1893 3300025272 Ga0209455_1001820 Ga0209455_100182010 439
1894 3300025297 Ga0209758_1000389 Ga0209758_100038922 439
1895 3300025297 Ga0209758_1000716 Ga0209758_100071633 439
1896 3300025297 Ga0209758_1002865 Ga0209758_100286510 439
1897 3300025297 Ga0209758_1004558 Ga0209758_10045582 439
1898 3300025302 Ga0207426_1000380 Ga0207426_100038052 439
1899 3300025302 Ga0207426_1020340 Ga0207426_10203401 439
1900 3300025304 Ga0209257_1020225 Ga0209257_10202253 439
1901 3300025898 Ga0207692_10006874 Ga0207692_100068743 439
1902 3300025906 Ga0207699_10000803 Ga0207699_100008039 439
1903 3300025907 Ga0207645_10124638 Ga0207645_101246382 439
1904 3300025913 Ga0207695_10000065 Ga0207695_1000006574 439
1905 3300025914 Ga0207671_10002455 Ga0207671_1000245513 439
1906 3300025914 Ga0207671_10022981 Ga0207671_100229813 439
1907 3300025928 Ga0207700_10002933 Ga0207700_100029334 439
1908 3300025928 Ga0207700_10087424 Ga0207700_100874241 439
1909 3300025939 Ga0207665_10003192 Ga0207665_100031924 439
1910 3300025942 Ga0207689_10001797 Ga0207689_100017974 439
1911 3300025942 Ga0207689_10160603 Ga0207689_101606032 439
1912 3300025961 Ga0207712_10043564 Ga0207712_100435642 439
1913 3300025972 Ga0207668_10003572 Ga0207668_100035723 439
1914 3300025986 Ga0207658_10129273 Ga0207658_101292732 439
1915 3300026095 Ga0207676_10056773 Ga0207676_100567732 439
1916 3300026116 Ga0207674_10067654 Ga0207674_100676543 439
1917 3300026118 Ga0207675_100002011 Ga0207675_1000020113 439
1918 3300026121 Ga0207683_10141108 Ga0207683_101411082 439
1919 3300026142 Ga0207698_10051799 Ga0207698_100517992 439
1920 3300027296 Ga0209389_1000180 Ga0209389_100018029 439
1921 3300027361 Ga0209489_101411 Ga0209489_10141129 439
1922 3300027363 Ga0209700_101443 Ga0209700_10144330 439
1923 3300028556 Ga0265337_1005026 Ga0265337_10050264 439
1924 3300028558 Ga0265326_10001905 Ga0265326_100019051 439
1925 3300028573 Ga0265334_10002493 Ga0265334_100024936 439
1926 3300028653 Ga0265323_10002030 Ga0265323_100020308 439
1927 3300028666 Ga0265336_10002907 Ga0265336_100029073 439
1928 3300028800 Ga0265338_10000280 Ga0265338_100002802 439
1929 3300029957 Ga0265324_10005408 Ga0265324_100054082 439
1930 3300031456 Ga0307513_10234007 Ga0307513_102340072 439
1931 3300031507 Ga0307509_10017985 Ga0307509_100179852 439
1932 3300031616 Ga0307508_10000003 Ga0307508_1000000340 439
1933 3300031616 Ga0307508_10053641 Ga0307508_100536412 439
1934 3300031616 Ga0307508_10095438 Ga0307508_100954382 439
1935 3300031730 Ga0307516_10006895 Ga0307516_100068956 439
1936 3300033180 Ga0307510_10003428 Ga0307510_1000342813 439
1937 3300033544 Ga0316215_1000798 Ga0316215_10007982 439
1938 3300037471 Ga0395905_0003588 Ga0395905_0003588_2481_3803 439
1939 3300039450 Ga0436363_1120285 Ga0436363_1120285_27_1349 439
1940 3300039453 Ga0436362_0872866 Ga0436362_0872866_501_1823 439
1941 3300044694 Ga0466963_0021877 Ga0466963_0021877_498_1820 439
1942 3300044735 Ga0466968_0003538 Ga0466968_0003538_3106_4428 439
1943 3300045051 Ga0451576_0007219 Ga0451576_0007219_981_2303 439
1944 3300045976 Ga0466967_0004486 Ga0466967_0004486_4158_5480 439
1945 3300046524 Ga0495648_0055627 Ga0495648_0055627_700_2022 439
1946 3300046542 Ga0495597_0016255 Ga0495597_0016255_2052_3374 439
1947 3300046674 Ga0495588_0001753 Ga0495588_0001753_1841_3163 439
1948 3300046809 Ga0495600_0031448 Ga0495600_0031448_1700_3025 439
1949 3300047469 Ga0495673_0048594 Ga0495673_0048594_323_1645 439
1950 3300048909 Ga0496106_0001659 Ga0496106_0001659_1938_3260 439
1951 3300048911 Ga0496108_0113512 Ga0496108_0113512_73_1395 439
1952 3300048918 Ga0496115_0157199 Ga0496115_0157199_298_1620 439
1953 3300048920 Ga0496117_0064820 Ga0496117_0064820_229_1551 439
1954 3300048921 Ga0496118_0043627 Ga0496118_0043627_2150_3472 439
1955 3300048922 Ga0496119_0005138 Ga0496119_0005138_6429_7751 439
1956 3300048924 Ga0496121_0000452 Ga0496121_0000452_55201_56523 439
1957 3300048924 Ga0496121_0005630 Ga0496121_0005630_6371_7693 439
1958 3300048925 Ga0496122_0003715 Ga0496122_0003715_6224_7546 439
1959 3300048926 Ga0496123_0008804 Ga0496123_0008804_6577_7899 439
1960 3300048927 Ga0496124_0000267 Ga0496124_0000267_35952_37274 439
1961 3300048927 Ga0496124_0049935 Ga0496124_0049935_935_2257 439
1962 3300048928 Ga0496125_0043340 Ga0496125_0043340_691_2013 439
1963 3300050489 nmdc:mga03683_5535_c1 nmdc:mga03683_5535_c1_1147_2469 439
1964 3300050492 nmdc:mga0yw44_16598_c1 nmdc:mga0yw44_16598_c1_1317_2639 439
1965 3300050507 nmdc:mga05p37_43104_c1 nmdc:mga05p37_43104_c1_3596_4918 439
1966 3300053087 Ga0500643_000278 Ga0500643_000278_38434_39756 439
1967 3300053091 Ga0500647_0012446 Ga0500647_0012446_2292_3614 439
1968 3300053091 Ga0500647_0031354 Ga0500647_0031354_327_1649 439
1969 3300053094 Ga0500566_0000565 Ga0500566_0000565_5077_6399 439
1970 3300053103 Ga0500555_018996 Ga0500555_018996_360_1682 439
1971 3300053104 Ga0500556_0000148 Ga0500556_0000148_36586_37908 439
1972 3300053105 Ga0500557_000028 Ga0500557_000028_35075_36397 439
1973 3300053119 Ga0500595_002261 Ga0500595_002261_5927_7249 439
1974 3300053130 Ga0500642_0000189 Ga0500642_0000189_15207_16529 439
1975 3300053156 Ga0500622_0037789 Ga0500622_0037789_623_1945 439
1976 3300053177 Ga0500636_0007269 Ga0500636_0007269_3299_4621 439
1977 3300053178 Ga0500637_0063963 Ga0500637_0063963_731_2053 439
1978 3300005547 Ga0070693_100070986 Ga0070693_1000709861 440
1979 3300031239 Ga0265328_10040281 Ga0265328_100402812 440
1980 3300031344 Ga0265316_10094800 Ga0265316_100948001 440
1981 3300031507 Ga0307509_10093227 Ga0307509_100932274 440
1982 3300044712 Ga0453684_0202291 Ga0453684_0202291_129_1466 440
1983 3300045051 Ga0451576_0010072 Ga0451576_0010072_1807_3144 440
1984 3300046501 Ga0495607_0000319 Ga0495607_0000319_3872_5200 440
1985 3300046513 Ga0495616_0000241 Ga0495616_0000241_1663_2991 440
1986 3300046665 Ga0495661_0006830 Ga0495661_0006830_4604_5932 440
1987 3300048091 Ga0495626_0001302 Ga0495626_0001302_5420_6748 440
1988 3300049579 Ga0501043_0000020 Ga0501043_0000020_91618_92991 440
1989 3300049580 Ga0501046_0000039 Ga0501046_0000039_91656_93029 440
1990 3300049581 Ga0501047_0000028 Ga0501047_0000028_91630_93003 440
1991 3300049824 Ga0501045_0008620 Ga0501045_0008620_861_2321 440
1992 3300050515 nmdc:mga0a205_50322_c1 nmdc:mga0a205_50322_c1_2162_3604 440
1993 3300005456 Ga0070678_100209605 Ga0070678_1002096051 441
1994 3300006237 Ga0097621_100137847 Ga0097621_1001378472 441
1995 3300025254 Ga0209148_1000643 Ga0209148_100064312 441
1996 3300025272 Ga0209455_1000488 Ga0209455_10004883 441
1997 3300000546 LJNas_1000993 LJNas_10009932 444

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a0c-assembly1.cif.gz_A xylose isomerase from thermoanaerobacterium thermosulfurigenes 0.9743 11 443
1a0d-assembly1.cif.gz_A xylose isomerase from bacillus stearothermophilus 0.9743 14 443
4xkm-assembly2.cif.gz_E crystal structure of xylose isomerase from an human intestinal tract microbe bacteroides thetaiotaomicron 0.973 8 442
1a0e-assembly1.cif.gz_A xylose isomerase from thermotoga neapolitana 0.9715 11 443
6t8f-assembly1.cif.gz_D crystal structure of mutant xylose isomerase (v270a/a273g) from piromyces e2 grown in yeast, in complex with xylose 0.9698 7 442
ID Description Score Start End Superfamily
af_A0A1D6QER4_85_310_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9819 48 283 3.20.20.150
1a0dA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9743 14 443 3.20.20.150
af_A0A1D6QER4_85_310_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9733 48 283 3.20.20.150
1a0dA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9525 14 443 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8021 48 369 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2X3DHG8-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 1.001 213 299 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A0E4B177-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9992 200 276 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A656GL89-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9988 240 312 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A376ML40-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.998 203 297 GO:0005737
GO:0009045
GO:0016020
GO:0042732
GO:0046872
AF-A0A0E4B207-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.998 200 276 GO:0005737
GO:0009045
GO:0042732
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map