F496223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1997 | 1468 | 933 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1022270|Ga0055524_10222701 |
| Length | 519 |
| Sequence | MSTGFFGDIAKIKYEGPDSTNPLAFRHYNKDEVVLGKRMEDHLRFAVAYWHTFVWPGGDPFGGQTFERPWFKDTMDAAKLKADVAFEFFDLLGVPFYCFHDADVRPEGKSFAENTKNLNEIVDHFEKKQAETGVNLLWGTANLFSNRRYMSGAATNPDPDVFAFAAATVKTCLDATKRLGGQNYVLWGGREGYETLLNTDLKRELDQLGRFVNLVVEYKHKIGFKGAILIEPKPQEPTKHQYDYDVATVYGFLKNYGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRNDYQSGWDTDQFPNNVPEMALAYYQVLAGGGFKTGGTNFDAKLRRQSIDPEDLLIGHIGGMDCCARGLKAAAKMIEDKALSAPLNQRYAGWQVPEAKKMLDGGFSLEEIEAWVLKSDLNPQPKSGKQELLENVVNRYVXALSRGCSRRPGLSGPSVCDDCVVPARQVGLPHEIDYKSLGNLRLRQLPPVKNLLALAPATFQVRQLWRKQGAIVPPCRRLTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 6 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 7 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 8 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 9 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 10 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 11 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 12 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 13 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 14 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 15 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 16 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 17 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 18 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 19 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 20 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 21 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 22 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 23 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 24 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 25 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 26 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 27 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 28 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 29 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 30 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 31 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 32 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 33 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 34 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 35 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 36 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 37 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 38 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 39 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 40 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 41 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 42 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 43 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 44 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 45 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 46 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 47 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 48 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 49 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 50 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 51 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 52 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 53 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 54 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 55 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 56 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 57 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 58 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 59 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 60 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 61 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 62 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 63 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 64 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 65 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 66 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 67 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 68 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 69 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 70 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 71 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 72 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 73 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 74 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 75 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 76 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 77 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 78 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 79 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 80 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 81 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 82 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 83 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 84 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 85 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 86 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 87 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 88 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 89 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 90 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 91 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 92 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 93 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 94 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 95 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 96 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 97 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 98 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 99 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 100 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 101 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 102 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 103 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 104 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 105 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 106 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 107 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 108 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 109 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 110 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 111 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 112 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 113 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 114 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 115 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 116 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 117 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 118 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 119 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 120 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 121 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 122 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 123 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 124 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 125 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 126 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 127 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 128 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 129 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 130 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 131 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 132 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 133 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 134 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 135 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 136 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 137 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 138 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 139 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 140 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 141 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 142 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 143 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 144 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 145 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 146 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 147 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 148 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 149 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 150 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 151 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 152 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 153 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 154 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 155 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 156 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 157 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 158 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 159 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 160 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 161 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 162 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 163 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 164 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 165 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 166 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 167 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 168 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 169 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 170 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 171 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 172 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 173 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 174 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 175 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 176 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 177 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 178 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 179 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 180 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 181 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 182 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 183 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 184 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 185 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 186 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 187 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 188 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 189 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 190 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 191 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 192 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 193 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 194 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 195 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 196 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 197 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 198 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 199 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 200 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 201 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 202 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 203 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 204 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 205 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 206 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 207 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 208 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 209 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 210 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 211 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 212 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 213 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 214 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 215 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 216 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 217 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 218 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 219 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 220 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 221 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 222 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 223 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 224 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 225 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 226 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 227 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 228 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 229 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 230 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 231 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 232 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 233 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 234 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 235 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 236 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 237 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 238 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 239 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 240 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 241 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 242 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 243 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 244 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 245 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 246 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 247 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 248 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 249 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 250 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 251 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 252 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 253 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 254 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 255 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 256 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 257 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 258 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 259 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 260 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 261 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 262 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 263 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 264 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 265 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 266 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 267 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 268 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 269 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 270 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 271 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 272 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 273 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 274 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 275 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 276 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 277 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 278 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 279 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 280 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 281 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 282 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 283 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 284 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 285 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 286 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 287 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 288 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 289 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 290 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 291 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 292 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 293 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 294 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 295 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 296 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 297 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 298 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 299 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 300 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 301 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 302 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 303 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 304 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 305 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 306 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 307 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 308 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 309 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 310 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 311 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 312 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 313 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 314 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 315 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 316 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 317 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 318 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 319 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 320 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 321 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 322 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 323 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 324 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 325 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 326 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 327 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 328 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 329 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 330 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 331 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 332 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 333 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 334 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 335 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 336 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 337 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 338 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 339 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 340 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 341 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 342 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 343 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 344 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 345 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 346 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 347 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 348 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 349 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 350 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 351 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 352 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 353 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 354 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 355 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 356 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 357 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 358 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 359 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 360 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 361 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 362 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 363 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 364 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 365 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 366 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 367 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 368 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 369 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 370 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 371 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 372 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 373 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 374 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 375 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 376 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 377 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 378 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 379 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 380 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 381 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 382 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 383 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 384 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 385 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 386 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 387 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 388 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 389 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 390 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 391 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 392 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 393 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 394 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 395 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 396 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 397 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 398 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 399 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 400 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 401 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 402 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 403 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 404 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 405 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 406 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 407 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 408 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 409 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 410 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 411 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 412 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 413 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 414 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 415 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 416 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 417 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 418 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 419 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 420 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 421 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 422 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 423 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 424 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 425 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 426 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 427 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 428 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 429 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 430 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 431 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 432 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 433 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 434 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 435 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 436 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 437 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 438 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 439 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 440 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 441 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 442 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 443 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 444 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 445 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 446 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 447 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 448 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 449 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 450 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 451 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 452 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 453 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 454 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 455 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 456 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 457 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 458 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 459 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 460 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 461 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 462 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 463 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 464 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 465 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 466 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 467 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 468 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 469 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 470 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 471 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 472 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 473 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 474 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 475 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 476 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 477 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 478 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 479 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 480 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 481 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 482 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 483 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 484 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 485 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 486 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 487 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 488 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 489 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 490 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 491 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 492 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 493 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 494 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 495 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 496 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 497 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 498 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 499 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 500 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 501 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 502 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 503 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 504 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 505 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 506 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 507 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 508 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 509 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 510 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 511 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 512 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 513 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 514 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 515 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 516 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 517 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 518 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 519 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 520 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 521 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 522 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 523 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 524 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 525 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 526 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 527 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 528 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 529 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 530 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 531 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 532 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 533 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 534 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 535 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 536 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 537 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 538 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 539 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 540 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 541 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 542 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 543 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 544 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 545 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 546 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 547 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 548 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 549 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 550 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 551 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 552 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 553 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 554 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 555 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 556 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 557 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 558 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 559 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 560 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 561 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 562 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 563 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 564 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 565 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 566 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 567 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 568 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 569 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 570 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 571 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 572 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 573 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 574 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 575 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 576 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 577 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 578 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 579 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 580 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 581 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 582 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 583 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 584 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 585 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 586 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 587 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 588 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 589 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 590 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 591 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 592 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 593 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 594 | 2922368715 | |||
| 595 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 596 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 597 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 598 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 599 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 600 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 601 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 602 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 603 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 604 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 605 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 606 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 607 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 608 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 609 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 610 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 611 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 612 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 613 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 614 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 615 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 616 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 617 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 618 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 619 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 620 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 621 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 622 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 623 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 624 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 625 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 626 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 627 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 628 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 629 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 630 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 631 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 632 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 633 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 634 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 635 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 636 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 637 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 638 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 639 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 640 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 641 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 642 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 643 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 644 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 645 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 646 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 647 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 648 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 649 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 650 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 651 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 652 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 653 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 654 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 655 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 656 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 657 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 658 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 659 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 660 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 661 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 662 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 663 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 664 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 665 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 666 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 667 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 668 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 669 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 670 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 671 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 672 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 673 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 674 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 675 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 676 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 677 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 678 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 679 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 680 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 681 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 682 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 683 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 684 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 685 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 686 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 687 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 688 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 689 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 690 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 691 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 692 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 693 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 694 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 695 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 696 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 697 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 698 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 699 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 700 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 701 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 702 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 703 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 704 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 705 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 706 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 707 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 708 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 709 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 710 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 711 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 712 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 713 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 714 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 715 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 716 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 717 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 718 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 719 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 720 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 721 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 722 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 723 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 724 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 725 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 726 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 727 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 728 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 729 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 730 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 731 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 732 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 733 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 734 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 735 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 736 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 737 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 738 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 739 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 740 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 741 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 742 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 743 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 744 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 745 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 746 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 747 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 748 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 749 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 750 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 751 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 752 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 753 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 754 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 755 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 756 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 757 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 758 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 759 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 760 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 761 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 762 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 763 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 764 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 765 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 766 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 767 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 768 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 769 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 770 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 771 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 772 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 773 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 774 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 775 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 776 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 777 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 778 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 779 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 780 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 781 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 782 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 783 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 784 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 785 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 786 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 787 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 788 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 789 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 790 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 791 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 792 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 793 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 794 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 795 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 796 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 797 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 798 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 799 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 800 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 801 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 802 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 803 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 804 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 805 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 806 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 807 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 808 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 809 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 810 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 811 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 812 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 813 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 814 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 815 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 816 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 817 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 818 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 819 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 820 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 821 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 822 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 823 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 824 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 825 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 826 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 827 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 828 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 829 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 830 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 831 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 832 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 833 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 834 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 835 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 836 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 837 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 838 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 839 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 840 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 841 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 842 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 843 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 844 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 845 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 846 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 847 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 848 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 849 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 850 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 851 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 852 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 853 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 854 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 855 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 856 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 857 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 858 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 859 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 860 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 861 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 862 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 863 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 864 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 865 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 866 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 867 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 868 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 869 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 870 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 871 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 872 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 873 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 874 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 875 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 876 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 877 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 878 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 879 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 880 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 881 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 882 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 883 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 884 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 885 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 886 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 887 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 888 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 889 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 890 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 891 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 892 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 893 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 894 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 895 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 896 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 897 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 898 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 899 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 900 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 901 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 902 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 903 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 904 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 905 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 906 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 907 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 908 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 909 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 910 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 911 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 912 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 913 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 914 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 915 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 916 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 917 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 918 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 919 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 920 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 921 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 922 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 923 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 924 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 925 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 926 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 927 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 928 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 929 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 930 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 931 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 932 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 933 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 934 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 935 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 936 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 937 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 938 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 939 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 940 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 941 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 942 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 943 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 944 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 945 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 946 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 947 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 948 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 949 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 950 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 951 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 952 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 953 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 954 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 955 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 956 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 957 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 958 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 959 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 960 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 961 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 962 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 963 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 964 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 965 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 966 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 967 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 968 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 969 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 970 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 971 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 972 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 973 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 974 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 975 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 976 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 977 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 978 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 979 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 980 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 981 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 982 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 983 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 984 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 985 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 986 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 987 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 988 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 989 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 990 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 991 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 992 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 993 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 994 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 995 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 996 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 997 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 998 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 999 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 1000 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 1001 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 1002 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 1003 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 1004 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 1005 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 1006 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 1007 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 1008 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 1009 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 1010 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 1011 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 1012 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 1013 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 1014 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 1015 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 1016 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 1017 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 1018 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 1019 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 1020 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 1021 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 1022 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 1023 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 1024 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 1025 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 1026 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 1027 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 1028 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 1029 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 1030 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 1031 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 1032 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 1033 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 1034 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 1035 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 1036 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1037 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 1038 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 1039 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 1040 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 1041 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 1042 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 1043 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 1044 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1045 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 1046 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 1047 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 1048 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 1049 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1050 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1051 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 1052 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 1053 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 1054 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 1055 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 1056 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 1057 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 1058 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 1059 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 1060 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 1061 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 1062 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 1063 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 1064 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 1065 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 1066 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 1067 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 1068 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 1069 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 1070 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 1071 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 1072 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 1073 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 1074 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 1075 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 1076 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 1077 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 1078 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 1079 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 1080 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 1081 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 1082 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1083 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 1084 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 1085 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 1086 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 1087 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 1088 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1089 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1090 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 1091 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 1092 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 1093 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1094 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1095 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1096 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1097 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1098 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1099 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 1100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1101 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1102 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 1103 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1139 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 1140 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1141 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1142 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1143 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1144 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1145 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 1147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1150 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 1151 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 1152 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 1153 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 1154 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 1155 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 1156 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 1157 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 1158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1160 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 1161 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1162 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 1163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 1165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 1166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 1167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 1168 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 1169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 1170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 1171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 1172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 1173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 1174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 1176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 1177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 1178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1180 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 1181 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 1182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 1183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 1187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1188 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 1192 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 1194 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1195 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1196 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1197 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 1198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 1199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 1200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 1201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 1202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1206 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 1207 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1215 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 1221 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1222 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1223 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 1224 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 1225 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1226 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1227 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 1228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1229 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 1230 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 1231 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 1232 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 1233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 1234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 1235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 1237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1244 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1246 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1247 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1248 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1249 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1253 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1256 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1266 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1267 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1270 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1294 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1318 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 1319 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 1320 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 1321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1324 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 1325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1329 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1344 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1345 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1346 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 1347 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 1348 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1349 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 1350 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1351 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1352 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1353 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1354 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 1355 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1356 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1357 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1359 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1361 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1362 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1363 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1365 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1366 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1367 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1368 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1369 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1373 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1374 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1375 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1376 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1377 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1378 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1379 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1380 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1381 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1382 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1383 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1384 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1385 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1386 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1387 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1388 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1389 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1390 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1391 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1392 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1393 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1394 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1395 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1396 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1397 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1398 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1399 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1400 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1401 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1402 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1403 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1404 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1405 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1406 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1407 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1408 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1409 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1410 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1411 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1412 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1413 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1414 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1415 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1416 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1417 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1418 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1419 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1420 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1421 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1422 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1423 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 1424 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 1425 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 1426 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 1427 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1428 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1429 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1430 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1431 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1432 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1433 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1434 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1435 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1436 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1437 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1438 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1439 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1440 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1441 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1442 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 1443 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1444 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1445 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1446 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1447 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1448 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1449 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 1450 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 1451 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 1452 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1453 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1454 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1455 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1456 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1457 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1458 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1459 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1460 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1461 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1462 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1463 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1464 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1465 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1466 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1467 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1468 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 46.59 |
| Metatranscriptomes | 0.15 |
| Isolates | 53.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 11.87 |
| Nodule | 40.46 |
| Rhizoplane | 1.55 |
| Rhizosphere | 29.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000993 | 3300000546 | Unclassified | 4489 |
| 2 | JGI24740J21852_10001156 | 3300001979 | Bacteria | 11909 |
| 3 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 4 | JGI25156J39149_1000036 | 3300002705 | Bacteria | 110527 |
| 5 | JGI25162J39368_1000146 | 3300002737 | Bacteria | 76858 |
| 6 | JGI25162J39368_1000616 | 3300002737 | Bacteria | 25562 |
| 7 | JGI25162J39368_1000674 | 3300002737 | Bacteria | 23983 |
| 8 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 9 | JGI25157J39369_1000457 | 3300002741 | Bacteria | 25863 |
| 10 | JGI25157J39369_1000542 | 3300002741 | Bacteria | 22661 |
| 11 | JGI25152J39213_1001129 | 3300002773 | Bacteria | 12423 |
| 12 | JGI25152J39213_1002051 | 3300002773 | Bacteria | 7936 |
| 13 | JGI25152J39213_1002782 | 3300002773 | Bacteria | 6330 |
| 14 | JGI25152J39213_1002804 | 3300002773 | Bacteria | 6296 |
| 15 | JGI25150J39212_1000063 | 3300002774 | Bacteria | 64558 |
| 16 | JGI25159J45721_1000092 | 3300002987 | Bacteria | 42762 |
| 17 | JGI25159J45721_1000464 | 3300002987 | Bacteria | 18764 |
| 18 | JGI25151J46595_10000140 | 3300003187 | Bacteria | 95958 |
| 19 | JGI25151J46595_10001756 | 3300003187 | Bacteria | 14041 |
| 20 | JGI25151J46595_10004817 | 3300003187 | Bacteria | 7061 |
| 21 | JGI25406J46586_10009739 | 3300003203 | Bacteria | 4294 |
| 22 | JGI25165J46597_1000653 | 3300003214 | Bacteria | 28392 |
| 23 | JGI25165J46597_1000719 | 3300003214 | Bacteria | 25974 |
| 24 | JGI25165J46597_1001438 | 3300003214 | Bacteria | 12683 |
| 25 | JGI25153J46596_10003062 | 3300003215 | Bacteria | 9443 |
| 26 | JGI25153J46596_10003984 | 3300003215 | Bacteria | 8073 |
| 27 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 28 | JGI25160J50197_1000486 | 3300003354 | Bacteria | 23951 |
| 29 | JGI25160J50197_1000877 | 3300003354 | Bacteria | 15856 |
| 30 | JGI25160J50197_1001286 | 3300003354 | Bacteria | 12698 |
| 31 | JGI25160J50197_1001787 | 3300003354 | Bacteria | 10407 |
| 32 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 33 | JGI25161J50226_1000103 | 3300003374 | Bacteria | 67942 |
| 34 | JGI25161J50226_1000116 | 3300003374 | Bacteria | 62089 |
| 35 | JGI25161J50226_1001626 | 3300003374 | Bacteria | 6515 |
| 36 | Ga0055542_1001041 | 3300003762 | Bacteria | 17269 |
| 37 | Ga0055526_1001877 | 3300003771 | Bacteria | 14557 |
| 38 | Ga0055526_1002290 | 3300003771 | Bacteria | 13070 |
| 39 | Ga0055526_1016674 | 3300003771 | Bacteria | 2857 |
| 40 | Ga0055524_1000790 | 3300003775 | Bacteria | 21100 |
| 41 | Ga0055524_1001086 | 3300003775 | Bacteria | 16609 |
| 42 | Ga0055524_1001459 | 3300003775 | Bacteria | 13514 |
| 43 | Ga0055524_1022270 | 3300003775 | Bacteria | 2075 |
| 44 | Ga0055536_1014991 | 3300003781 | Bacteria | 2681 |
| 45 | Ga0055528_1000548 | 3300003790 | Bacteria | 28660 |
| 46 | Ga0055528_1000886 | 3300003790 | Bacteria | 20225 |
| 47 | Ga0055528_1003424 | 3300003790 | Bacteria | 7967 |
| 48 | Ga0055528_1011189 | 3300003790 | Bacteria | 3586 |
| 49 | Ga0055540_1000548 | 3300003792 | Bacteria | 28000 |
| 50 | Ga0055540_1010663 | 3300003792 | Bacteria | 3037 |
| 51 | Ga0058692_1008879 | 3300003856 | Bacteria | 2571 |
| 52 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 53 | Ga0055543_1000029 | 3300004625 | Bacteria | 131452 |
| 54 | Ga0055543_1000337 | 3300004625 | Bacteria | 32032 |
| 55 | Ga0055543_1001407 | 3300004625 | Bacteria | 9571 |
| 56 | Ga0065165_1000196 | 3300005262 | Bacteria | 104569 |
| 57 | Ga0065165_1001746 | 3300005262 | Bacteria | 21666 |
| 58 | Ga0065165_1001966 | 3300005262 | Bacteria | 19466 |
| 59 | Ga0065165_1004041 | 3300005262 | Bacteria | 9536 |
| 60 | Ga0065165_1005489 | 3300005262 | Bacteria | 7096 |
| 61 | Ga0065165_1017482 | 3300005262 | Bacteria | 2640 |
| 62 | Ga0070670_100006699 | 3300005331 | Bacteria | 9760 |
| 63 | Ga0068869_100115281 | 3300005334 | Bacteria | 2049 |
| 64 | Ga0068868_100176670 | 3300005338 | Bacteria | 1770 |
| 65 | Ga0070660_100054946 | 3300005339 | Bacteria | 3076 |
| 66 | Ga0070689_100000019 | 3300005340 | Bacteria | 149968 |
| 67 | Ga0070689_100063568 | 3300005340 | Bacteria | 2872 |
| 68 | Ga0070668_100044222 | 3300005347 | Bacteria | 3416 |
| 69 | Ga0070669_100041129 | 3300005353 | Bacteria | 3361 |
| 70 | Ga0070669_100158925 | 3300005353 | Bacteria | 1755 |
| 71 | Ga0070675_100112804 | 3300005354 | Bacteria | 2302 |
| 72 | Ga0070671_100004121 | 3300005355 | Bacteria | 11476 |
| 73 | Ga0070671_100057072 | 3300005355 | Bacteria | 3248 |
| 74 | Ga0070674_100011633 | 3300005356 | Bacteria | 5362 |
| 75 | Ga0070659_100027085 | 3300005366 | Bacteria | 4413 |
| 76 | Ga0070659_100121682 | 3300005366 | Bacteria | 2115 |
| 77 | Ga0070667_100019582 | 3300005367 | Bacteria | 5615 |
| 78 | Ga0070709_10030239 | 3300005434 | Bacteria | 3248 |
| 79 | Ga0070710_10000681 | 3300005437 | Bacteria | 16105 |
| 80 | Ga0070701_10021591 | 3300005438 | Bacteria | 3076 |
| 81 | Ga0070711_100001092 | 3300005439 | Bacteria | 14495 |
| 82 | Ga0070705_100145598 | 3300005440 | Bacteria | 1565 |
| 83 | Ga0070694_100101799 | 3300005444 | Bacteria | 2033 |
| 84 | Ga0070708_100000686 | 3300005445 | Bacteria | 25748 |
| 85 | Ga0070708_100188175 | 3300005445 | Bacteria | 1931 |
| 86 | Ga0070678_100209605 | 3300005456 | Bacteria | 1614 |
| 87 | Ga0070662_100003105 | 3300005457 | Bacteria | 10320 |
| 88 | Ga0070681_10004145 | 3300005458 | Bacteria | 13714 |
| 89 | Ga0070681_10089646 | 3300005458 | Bacteria | 3027 |
| 90 | Ga0068867_100004439 | 3300005459 | Bacteria | 9865 |
| 91 | Ga0068867_100197022 | 3300005459 | Bacteria | 1611 |
| 92 | Ga0070706_100000652 | 3300005467 | Bacteria | 39619 |
| 93 | Ga0070707_100008026 | 3300005468 | Bacteria | 9807 |
| 94 | Ga0070707_100050009 | 3300005468 | Bacteria | 4007 |
| 95 | Ga0070707_100268054 | 3300005468 | Bacteria | 1661 |
| 96 | Ga0070698_100231330 | 3300005471 | Bacteria | 1782 |
| 97 | Ga0070698_100310404 | 3300005471 | Bacteria | 1508 |
| 98 | Ga0070699_100187558 | 3300005518 | Bacteria | 1836 |
| 99 | Ga0068853_100024508 | 3300005539 | Bacteria | 5059 |
| 100 | Ga0070696_100008273 | 3300005546 | Bacteria | 6963 |
| 101 | Ga0070696_100025482 | 3300005546 | Bacteria | 4022 |
| 102 | Ga0070693_100070986 | 3300005547 | Bacteria | 2051 |
| 103 | Ga0070665_100042121 | 3300005548 | Bacteria | 4589 |
| 104 | Ga0070665_100097821 | 3300005548 | Bacteria | 2939 |
| 105 | Ga0070665_100133580 | 3300005548 | Bacteria | 2483 |
| 106 | Ga0068855_100002914 | 3300005563 | Bacteria | 20938 |
| 107 | Ga0068855_100102801 | 3300005563 | Bacteria | 3288 |
| 108 | Ga0068857_100065905 | 3300005577 | Bacteria | 3222 |
| 109 | Ga0068854_100031826 | 3300005578 | Bacteria | 3668 |
| 110 | Ga0068854_100061423 | 3300005578 | Bacteria | 2722 |
| 111 | Ga0068854_100121702 | 3300005578 | Bacteria | 1982 |
| 112 | Ga0068856_100180813 | 3300005614 | Bacteria | 2122 |
| 113 | Ga0068852_100004165 | 3300005616 | Bacteria | 10188 |
| 114 | Ga0068859_100091038 | 3300005617 | Bacteria | 3101 |
| 115 | Ga0068861_100006986 | 3300005719 | Bacteria | 7714 |
| 116 | Ga0068861_100109912 | 3300005719 | Bacteria | 2207 |
| 117 | Ga0068858_100243785 | 3300005842 | Bacteria | 1706 |
| 118 | Ga0068862_100110024 | 3300005844 | Bacteria | 2418 |
| 119 | Ga0068862_100235797 | 3300005844 | Bacteria | 1661 |
| 120 | Ga0081455_10001445 | 3300005937 | Bacteria | 29401 |
| 121 | Ga0081455_10051502 | 3300005937 | Bacteria | 3531 |
| 122 | Ga0081540_1003545 | 3300005983 | Bacteria | 12297 |
| 123 | Ga0081540_1028845 | 3300005983 | Bacteria | 3105 |
| 124 | Ga0081539_10001251 | 3300005985 | Bacteria | 45062 |
| 125 | Ga0081539_10001815 | 3300005985 | Bacteria | 33742 |
| 126 | Ga0081539_10004098 | 3300005985 | Bacteria | 16635 |
| 127 | Ga0081539_10018206 | 3300005985 | Bacteria | 4888 |
| 128 | Ga0081539_10034584 | 3300005985 | Bacteria | 3053 |
| 129 | Ga0075365_10002314 | 3300006038 | Bacteria | 9271 |
| 130 | Ga0075365_10010764 | 3300006038 | Bacteria | 5345 |
| 131 | Ga0075365_10015316 | 3300006038 | Bacteria | 4635 |
| 132 | Ga0075365_10061156 | 3300006038 | Bacteria | 2514 |
| 133 | Ga0075365_10067310 | 3300006038 | Bacteria | 2404 |
| 134 | Ga0075365_10070522 | 3300006038 | Bacteria | 2351 |
| 135 | Ga0075365_10122565 | 3300006038 | Bacteria | 1794 |
| 136 | Ga0075365_10124345 | 3300006038 | Bacteria | 1781 |
| 137 | Ga0075365_10202682 | 3300006038 | Bacteria | 1390 |
| 138 | Ga0075363_100005203 | 3300006048 | Bacteria | 5762 |
| 139 | Ga0075363_100032088 | 3300006048 | Bacteria | 2726 |
| 140 | Ga0075363_100057919 | 3300006048 | Bacteria | 2080 |
| 141 | Ga0075364_10001625 | 3300006051 | Bacteria | 12311 |
| 142 | Ga0075364_10023758 | 3300006051 | Bacteria | 3884 |
| 143 | Ga0075364_10135081 | 3300006051 | Bacteria | 1657 |
| 144 | Ga0075362_10001059 | 3300006177 | Bacteria | 8507 |
| 145 | Ga0075362_10005150 | 3300006177 | Bacteria | 4762 |
| 146 | Ga0075362_10009934 | 3300006177 | Bacteria | 3698 |
| 147 | Ga0075362_10015420 | 3300006177 | Bacteria | 3109 |
| 148 | Ga0075362_10029465 | 3300006177 | Bacteria | 2365 |
| 149 | Ga0075362_10041803 | 3300006177 | Bacteria | 2023 |
| 150 | Ga0075367_10004539 | 3300006178 | Bacteria | 6791 |
| 151 | Ga0075367_10018322 | 3300006178 | Bacteria | 3861 |
| 152 | Ga0075367_10056832 | 3300006178 | Bacteria | 2325 |
| 153 | Ga0075367_10072640 | 3300006178 | Bacteria | 2072 |
| 154 | Ga0075367_10080318 | 3300006178 | Bacteria | 1972 |
| 155 | Ga0075366_10073059 | 3300006195 | Bacteria | 2044 |
| 156 | Ga0097621_100113413 | 3300006237 | Bacteria | 2293 |
| 157 | Ga0097621_100137847 | 3300006237 | Bacteria | 2083 |
| 158 | Ga0075370_10000839 | 3300006353 | Bacteria | 12435 |
| 159 | Ga0075370_10041128 | 3300006353 | Bacteria | 2609 |
| 160 | Ga0075370_10092620 | 3300006353 | Bacteria | 1744 |
| 161 | Ga0068871_100025070 | 3300006358 | Bacteria | 4635 |
| 162 | Ga0075428_100005976 | 3300006844 | Bacteria | 13521 |
| 163 | Ga0075428_100107959 | 3300006844 | Bacteria | 3033 |
| 164 | Ga0075428_100136008 | 3300006844 | Bacteria | 2672 |
| 165 | Ga0075430_100000852 | 3300006846 | Bacteria | 23928 |
| 166 | Ga0075430_100008547 | 3300006846 | Bacteria | 8642 |
| 167 | Ga0075431_100084545 | 3300006847 | Bacteria | 3276 |
| 168 | Ga0075429_100000927 | 3300006880 | Bacteria | 23245 |
| 169 | Ga0075429_100143608 | 3300006880 | Bacteria | 2089 |
| 170 | Ga0075436_100116776 | 3300006914 | Bacteria | 1865 |
| 171 | Ga0097620_100091038 | 3300006931 | Bacteria | 3101 |
| 172 | Ga0079104_1000042 | 3300006946 | Bacteria | 185991 |
| 173 | Ga0079104_1009436 | 3300006946 | Bacteria | 3306 |
| 174 | Ga0099826_10003152 | 3300006948 | Bacteria | 11065 |
| 175 | Ga0105251_10026227 | 3300009011 | Bacteria | 2969 |
| 176 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 177 | Ga0105240_10000871 | 3300009093 | Bacteria | 54379 |
| 178 | Ga0105240_10001841 | 3300009093 | Bacteria | 35533 |
| 179 | Ga0105240_10002869 | 3300009093 | Bacteria | 27260 |
| 180 | Ga0111539_10001873 | 3300009094 | Bacteria | 27932 |
| 181 | Ga0111539_10004595 | 3300009094 | Bacteria | 18041 |
| 182 | Ga0111539_10021065 | 3300009094 | Bacteria | 8029 |
| 183 | Ga0114129_10000293 | 3300009147 | Bacteria | 57817 |
| 184 | Ga0105243_10036210 | 3300009148 | Bacteria | 3829 |
| 185 | Ga0105243_10054480 | 3300009148 | Bacteria | 3176 |
| 186 | Ga0105241_10099547 | 3300009174 | Bacteria | 2309 |
| 187 | Ga0105241_10135860 | 3300009174 | Bacteria | 1997 |
| 188 | Ga0105242_10048624 | 3300009176 | Bacteria | 3448 |
| 189 | Ga0105242_10244438 | 3300009176 | Bacteria | 1615 |
| 190 | Ga0105248_10034425 | 3300009177 | Bacteria | 5663 |
| 191 | Ga0105248_10071041 | 3300009177 | Bacteria | 3909 |
| 192 | Ga0105237_10000025 | 3300009545 | Bacteria | 215920 |
| 193 | Ga0105237_10006193 | 3300009545 | Bacteria | 13347 |
| 194 | Ga0105237_10033313 | 3300009545 | Bacteria | 5219 |
| 195 | Ga0105237_10033689 | 3300009545 | Bacteria | 5189 |
| 196 | Ga0105237_10101978 | 3300009545 | Bacteria | 2861 |
| 197 | Ga0105238_10001161 | 3300009551 | Bacteria | 26564 |
| 198 | Ga0105238_10075130 | 3300009551 | Bacteria | 3371 |
| 199 | Ga0105238_10200897 | 3300009551 | Bacteria | 1969 |
| 200 | Ga0105249_10017064 | 3300009553 | Bacteria | 6443 |
| 201 | Ga0105249_10181544 | 3300009553 | Bacteria | 2048 |
| 202 | Ga0105249_10238794 | 3300009553 | Bacteria | 1796 |
| 203 | Ga0123341_1000015 | 3300009765 | Bacteria | 86184 |
| 204 | Ga0105239_10092443 | 3300010375 | Bacteria | 3339 |
| 205 | Ga0105239_10193678 | 3300010375 | Bacteria | 2276 |
| 206 | Ga0157371_10000005 | 3300013102 | Bacteria | 416456 |
| 207 | Ga0157370_10000036 | 3300013104 | Bacteria | 136933 |
| 208 | Ga0157370_10002915 | 3300013104 | Bacteria | 20380 |
| 209 | Ga0157370_10293465 | 3300013104 | Bacteria | 1502 |
| 210 | Ga0171463_1014 | 3300013249 | Bacteria | 83917 |
| 211 | Ga0157378_10005765 | 3300013297 | Bacteria | 10847 |
| 212 | Ga0157378_10140250 | 3300013297 | Bacteria | 2244 |
| 213 | Ga0163162_10247511 | 3300013306 | Bacteria | 1914 |
| 214 | Ga0163162_10348125 | 3300013306 | Bacteria | 1614 |
| 215 | Ga0157375_10084111 | 3300013308 | Bacteria | 3229 |
| 216 | Ga0157380_10162421 | 3300014326 | Bacteria | 1943 |
| 217 | Ga0157380_10208691 | 3300014326 | Bacteria | 1739 |
| 218 | Ga0157379_10026503 | 3300014968 | Bacteria | 5160 |
| 219 | Ga0157379_10066537 | 3300014968 | Bacteria | 3221 |
| 220 | Ga0182007_10017364 | 3300015262 | Bacteria | 2630 |
| 221 | Ga0182007_10022122 | 3300015262 | Bacteria | 2249 |
| 222 | Ga0183363_1052 | 3300015690 | Bacteria | 37103 |
| 223 | Ga0163161_10114681 | 3300017792 | Bacteria | 2019 |
| 224 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 225 | Ga0214544_1000063 | 3300021320 | Bacteria | 129929 |
| 226 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 227 | Ga0214542_1000095 | 3300021321 | Bacteria | 116012 |
| 228 | Ga0214542_1028661 | 3300021321 | Bacteria | 2379 |
| 229 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 230 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 231 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 232 | Ga0214543_1000026 | 3300021327 | Bacteria | 220652 |
| 233 | Ga0213872_10001461 | 3300021361 | Bacteria | 15360 |
| 234 | Ga0213872_10002930 | 3300021361 | Bacteria | 9696 |
| 235 | Ga0213876_10038669 | 3300021384 | Bacteria | 2519 |
| 236 | Ga0213875_10003139 | 3300021388 | Bacteria | 9502 |
| 237 | Ga0228711_1000003 | 3300022739 | Bacteria | 258118 |
| 238 | Ga0228710_1000003 | 3300022740 | Bacteria | 262981 |
| 239 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 240 | Ga0209436_100041 | 3300025208 | Bacteria | 74018 |
| 241 | Ga0209436_105270 | 3300025208 | Bacteria | 3003 |
| 242 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 243 | Ga0207427_103198 | 3300025231 | Bacteria | 3611 |
| 244 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 245 | Ga0209437_100174 | 3300025233 | Bacteria | 138811 |
| 246 | Ga0207425_1000080 | 3300025245 | Bacteria | 100578 |
| 247 | Ga0207425_1003292 | 3300025245 | Bacteria | 5244 |
| 248 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 249 | Ga0209646_1006491 | 3300025246 | Bacteria | 1963 |
| 250 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 251 | Ga0209026_1000050 | 3300025250 | Bacteria | 254994 |
| 252 | Ga0209677_101144 | 3300025253 | Bacteria | 12360 |
| 253 | Ga0209677_108366 | 3300025253 | Bacteria | 2019 |
| 254 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 255 | Ga0209148_1000643 | 3300025254 | Bacteria | 30450 |
| 256 | Ga0209148_1000904 | 3300025254 | Bacteria | 20182 |
| 257 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 258 | Ga0209759_1000233 | 3300025256 | Bacteria | 83273 |
| 259 | Ga0209759_1018251 | 3300025256 | Bacteria | 1700 |
| 260 | Ga0209129_1000195 | 3300025258 | Bacteria | 80791 |
| 261 | Ga0209129_1000199 | 3300025258 | Bacteria | 77091 |
| 262 | Ga0209129_1001192 | 3300025258 | Bacteria | 14972 |
| 263 | Ga0209129_1002022 | 3300025258 | Bacteria | 10519 |
| 264 | Ga0209129_1004508 | 3300025258 | Bacteria | 5399 |
| 265 | Ga0209129_1004637 | 3300025258 | Bacteria | 5261 |
| 266 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 267 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 268 | Ga0209233_1000299 | 3300025261 | Bacteria | 60375 |
| 269 | Ga0209233_1000305 | 3300025261 | Bacteria | 58381 |
| 270 | Ga0209233_1001762 | 3300025261 | Bacteria | 8348 |
| 271 | Ga0209233_1002525 | 3300025261 | Bacteria | 6686 |
| 272 | Ga0209455_1000085 | 3300025272 | Bacteria | 247601 |
| 273 | Ga0209455_1000488 | 3300025272 | Bacteria | 29116 |
| 274 | Ga0209455_1001820 | 3300025272 | Bacteria | 8951 |
| 275 | Ga0209455_1008371 | 3300025272 | Bacteria | 2815 |
| 276 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 277 | Ga0209673_1000320 | 3300025273 | Bacteria | 88073 |
| 278 | Ga0209673_1000880 | 3300025273 | Bacteria | 38918 |
| 279 | Ga0209673_1000924 | 3300025273 | Bacteria | 37119 |
| 280 | Ga0209673_1003302 | 3300025273 | Bacteria | 9668 |
| 281 | Ga0209673_1007876 | 3300025273 | Bacteria | 4820 |
| 282 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 283 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 284 | Ga0209130_1000198 | 3300025284 | Bacteria | 82557 |
| 285 | Ga0209130_1010028 | 3300025284 | Bacteria | 2640 |
| 286 | Ga0209676_1005216 | 3300025292 | Bacteria | 6886 |
| 287 | Ga0209676_1007354 | 3300025292 | Bacteria | 5194 |
| 288 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 289 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 290 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 291 | Ga0209025_1000332 | 3300025294 | Bacteria | 104326 |
| 292 | Ga0209025_1000339 | 3300025294 | Bacteria | 103239 |
| 293 | Ga0209025_1000354 | 3300025294 | Bacteria | 98665 |
| 294 | Ga0209025_1000566 | 3300025294 | Bacteria | 67702 |
| 295 | Ga0209025_1051465 | 3300025294 | Bacteria | 1636 |
| 296 | Ga0209564_1000207 | 3300025295 | Bacteria | 135313 |
| 297 | Ga0209564_1000345 | 3300025295 | Bacteria | 88073 |
| 298 | Ga0209564_1000353 | 3300025295 | Bacteria | 85747 |
| 299 | Ga0209564_1001668 | 3300025295 | Bacteria | 21260 |
| 300 | Ga0209564_1011812 | 3300025295 | Bacteria | 3876 |
| 301 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 302 | Ga0209758_1000105 | 3300025297 | Bacteria | 221415 |
| 303 | Ga0209758_1000263 | 3300025297 | Bacteria | 104297 |
| 304 | Ga0209758_1000389 | 3300025297 | Bacteria | 75919 |
| 305 | Ga0209758_1000561 | 3300025297 | Bacteria | 58483 |
| 306 | Ga0209758_1000716 | 3300025297 | Bacteria | 48984 |
| 307 | Ga0209758_1001323 | 3300025297 | Bacteria | 30082 |
| 308 | Ga0209758_1001789 | 3300025297 | Bacteria | 23722 |
| 309 | Ga0209758_1002280 | 3300025297 | Bacteria | 19856 |
| 310 | Ga0209758_1002342 | 3300025297 | Bacteria | 19520 |
| 311 | Ga0209758_1002865 | 3300025297 | Bacteria | 16738 |
| 312 | Ga0209758_1004558 | 3300025297 | Bacteria | 11440 |
| 313 | Ga0209758_1018773 | 3300025297 | Bacteria | 3371 |
| 314 | Ga0209758_1032328 | 3300025297 | Bacteria | 2126 |
| 315 | Ga0209050_1003774 | 3300025298 | Bacteria | 10824 |
| 316 | Ga0209050_1008731 | 3300025298 | Bacteria | 5337 |
| 317 | Ga0209050_1008822 | 3300025298 | Bacteria | 5292 |
| 318 | Ga0209256_1000343 | 3300025299 | Bacteria | 75902 |
| 319 | Ga0209256_1000348 | 3300025299 | Bacteria | 75070 |
| 320 | Ga0209256_1000368 | 3300025299 | Bacteria | 72598 |
| 321 | Ga0209256_1003220 | 3300025299 | Bacteria | 11778 |
| 322 | Ga0209256_1004594 | 3300025299 | Bacteria | 8541 |
| 323 | Ga0209256_1007480 | 3300025299 | Bacteria | 5371 |
| 324 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 325 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 326 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 327 | Ga0207426_1000296 | 3300025302 | Bacteria | 98032 |
| 328 | Ga0207426_1000380 | 3300025302 | Bacteria | 76046 |
| 329 | Ga0207426_1000985 | 3300025302 | Bacteria | 27962 |
| 330 | Ga0207426_1020340 | 3300025302 | Bacteria | 2308 |
| 331 | Ga0209051_1000236 | 3300025303 | Bacteria | 92738 |
| 332 | Ga0209051_1000517 | 3300025303 | Bacteria | 48573 |
| 333 | Ga0209051_1002208 | 3300025303 | Bacteria | 14374 |
| 334 | Ga0209051_1003116 | 3300025303 | Bacteria | 11175 |
| 335 | Ga0209051_1006923 | 3300025303 | Bacteria | 6296 |
| 336 | Ga0209051_1007923 | 3300025303 | Bacteria | 5725 |
| 337 | Ga0209051_1017517 | 3300025303 | Bacteria | 3198 |
| 338 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 339 | Ga0209257_1001378 | 3300025304 | Bacteria | 29161 |
| 340 | Ga0209257_1011867 | 3300025304 | Bacteria | 4121 |
| 341 | Ga0209257_1020225 | 3300025304 | Bacteria | 2470 |
| 342 | Ga0207692_10006874 | 3300025898 | Bacteria | 4634 |
| 343 | Ga0207688_10067120 | 3300025901 | Bacteria | 2030 |
| 344 | Ga0207699_10000803 | 3300025906 | Bacteria | 14996 |
| 345 | Ga0207645_10068247 | 3300025907 | Bacteria | 2273 |
| 346 | Ga0207645_10096755 | 3300025907 | Bacteria | 1902 |
| 347 | Ga0207645_10124638 | 3300025907 | Bacteria | 1674 |
| 348 | Ga0207684_10000698 | 3300025910 | Bacteria | 39706 |
| 349 | Ga0207684_10199062 | 3300025910 | Bacteria | 1728 |
| 350 | Ga0207707_10056350 | 3300025912 | Bacteria | 3419 |
| 351 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 352 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 353 | Ga0207695_10016415 | 3300025913 | Bacteria | 8663 |
| 354 | Ga0207695_10054111 | 3300025913 | Bacteria | 4194 |
| 355 | Ga0207695_10083047 | 3300025913 | Bacteria | 3237 |
| 356 | Ga0207671_10000107 | 3300025914 | Bacteria | 128950 |
| 357 | Ga0207671_10000644 | 3300025914 | Bacteria | 45611 |
| 358 | Ga0207671_10002455 | 3300025914 | Bacteria | 19836 |
| 359 | Ga0207671_10019495 | 3300025914 | Bacteria | 5186 |
| 360 | Ga0207671_10020826 | 3300025914 | Bacteria | 4987 |
| 361 | Ga0207671_10022981 | 3300025914 | Bacteria | 4708 |
| 362 | Ga0207671_10029566 | 3300025914 | Bacteria | 4091 |
| 363 | Ga0207662_10031681 | 3300025918 | Bacteria | 3072 |
| 364 | Ga0207657_10047345 | 3300025919 | Bacteria | 3761 |
| 365 | Ga0207646_10012944 | 3300025922 | Bacteria | 7997 |
| 366 | Ga0207694_10002608 | 3300025924 | Bacteria | 14622 |
| 367 | Ga0207650_10005592 | 3300025925 | Bacteria | 8587 |
| 368 | Ga0207650_10059566 | 3300025925 | Bacteria | 2847 |
| 369 | Ga0207700_10002933 | 3300025928 | Bacteria | 9844 |
| 370 | Ga0207700_10087424 | 3300025928 | Bacteria | 2451 |
| 371 | Ga0207706_10002765 | 3300025933 | Bacteria | 17065 |
| 372 | Ga0207686_10040697 | 3300025934 | Bacteria | 2827 |
| 373 | Ga0207709_10043168 | 3300025935 | Bacteria | 2716 |
| 374 | Ga0207670_10000013 | 3300025936 | Bacteria | 211834 |
| 375 | Ga0207665_10003192 | 3300025939 | Bacteria | 10981 |
| 376 | Ga0207689_10001797 | 3300025942 | Bacteria | 20251 |
| 377 | Ga0207689_10016113 | 3300025942 | Bacteria | 6328 |
| 378 | Ga0207689_10160603 | 3300025942 | Bacteria | 1852 |
| 379 | Ga0207667_10004623 | 3300025949 | Bacteria | 16891 |
| 380 | Ga0207667_10128396 | 3300025949 | Bacteria | 2611 |
| 381 | Ga0207712_10023861 | 3300025961 | Bacteria | 4043 |
| 382 | Ga0207712_10043564 | 3300025961 | Bacteria | 3097 |
| 383 | Ga0207668_10003572 | 3300025972 | Bacteria | 9134 |
| 384 | Ga0207668_10120463 | 3300025972 | Bacteria | 1986 |
| 385 | Ga0207640_10089470 | 3300025981 | Bacteria | 2128 |
| 386 | Ga0207658_10129273 | 3300025986 | Bacteria | 2027 |
| 387 | Ga0207677_10182273 | 3300026023 | Bacteria | 1653 |
| 388 | Ga0207678_10066999 | 3300026067 | Bacteria | 3082 |
| 389 | Ga0207702_10103179 | 3300026078 | Bacteria | 2522 |
| 390 | Ga0207648_10006652 | 3300026089 | Bacteria | 11473 |
| 391 | Ga0207648_10024247 | 3300026089 | Bacteria | 5417 |
| 392 | Ga0207648_10053604 | 3300026089 | Bacteria | 3524 |
| 393 | Ga0207648_10061039 | 3300026089 | Bacteria | 3287 |
| 394 | Ga0207676_10056773 | 3300026095 | Bacteria | 3080 |
| 395 | Ga0207674_10067654 | 3300026116 | Bacteria | 3595 |
| 396 | Ga0207674_10255021 | 3300026116 | Bacteria | 1701 |
| 397 | Ga0207675_100002011 | 3300026118 | Bacteria | 20281 |
| 398 | Ga0207675_100008827 | 3300026118 | Bacteria | 9460 |
| 399 | Ga0207675_100050326 | 3300026118 | Bacteria | 3888 |
| 400 | Ga0207683_10074129 | 3300026121 | Bacteria | 3011 |
| 401 | Ga0207683_10099602 | 3300026121 | Bacteria | 2594 |
| 402 | Ga0207683_10141108 | 3300026121 | Bacteria | 2171 |
| 403 | Ga0207698_10011740 | 3300026142 | Bacteria | 5694 |
| 404 | Ga0207698_10051799 | 3300026142 | Bacteria | 3140 |
| 405 | Ga0207698_10252891 | 3300026142 | Bacteria | 1613 |
| 406 | Ga0209281_1000081 | 3300027111 | Bacteria | 258084 |
| 407 | Ga0209281_1000141 | 3300027111 | Bacteria | 175634 |
| 408 | Ga0209281_1000194 | 3300027111 | Bacteria | 139318 |
| 409 | Ga0209389_1000180 | 3300027296 | Bacteria | 49331 |
| 410 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 411 | Ga0209371_1003578 | 3300027312 | Bacteria | 7436 |
| 412 | Ga0209371_1007496 | 3300027312 | Bacteria | 3787 |
| 413 | Ga0209371_1009533 | 3300027312 | Bacteria | 3075 |
| 414 | Ga0209489_101411 | 3300027361 | Bacteria | 49331 |
| 415 | Ga0209700_101443 | 3300027363 | Bacteria | 49345 |
| 416 | Ga0209282_1000036 | 3300027666 | Bacteria | 130242 |
| 417 | Ga0209282_1000245 | 3300027666 | Bacteria | 27454 |
| 418 | Ga0209813_10008959 | 3300027866 | Bacteria | 2544 |
| 419 | Ga0207428_10024756 | 3300027907 | Bacteria | 5038 |
| 420 | Ga0207428_10159438 | 3300027907 | Bacteria | 1714 |
| 421 | Ga0268266_10059352 | 3300028379 | Bacteria | 3296 |
| 422 | Ga0268265_10066200 | 3300028380 | Bacteria | 2792 |
| 423 | Ga0268265_10139494 | 3300028380 | Bacteria | 2028 |
| 424 | Ga0268264_10020771 | 3300028381 | Bacteria | 5366 |
| 425 | Ga0265337_1005026 | 3300028556 | Bacteria | 5356 |
| 426 | Ga0265337_1007267 | 3300028556 | Bacteria | 4157 |
| 427 | Ga0265326_10001905 | 3300028558 | Bacteria | 7139 |
| 428 | Ga0265326_10004795 | 3300028558 | Bacteria | 4293 |
| 429 | Ga0265326_10016273 | 3300028558 | Bacteria | 2151 |
| 430 | Ga0265319_1000654 | 3300028563 | Bacteria | 22839 |
| 431 | Ga0265319_1026169 | 3300028563 | Bacteria | 2081 |
| 432 | Ga0265334_10002493 | 3300028573 | Bacteria | 8604 |
| 433 | Ga0265318_10000177 | 3300028577 | Bacteria | 56517 |
| 434 | Ga0265318_10000533 | 3300028577 | Bacteria | 27256 |
| 435 | Ga0265318_10004293 | 3300028577 | Bacteria | 6940 |
| 436 | Ga0265318_10033461 | 3300028577 | Bacteria | 1984 |
| 437 | Ga0265323_10000448 | 3300028653 | Bacteria | 23600 |
| 438 | Ga0265323_10002030 | 3300028653 | Bacteria | 9530 |
| 439 | Ga0265323_10004144 | 3300028653 | Bacteria | 6280 |
| 440 | Ga0265322_10029308 | 3300028654 | Bacteria | 1573 |
| 441 | Ga0265336_10002907 | 3300028666 | Bacteria | 6882 |
| 442 | Ga0307515_10000145 | 3300028794 | Bacteria | 170814 |
| 443 | Ga0307515_10001520 | 3300028794 | Bacteria | 51901 |
| 444 | Ga0307515_10006129 | 3300028794 | Bacteria | 24187 |
| 445 | Ga0307515_10011387 | 3300028794 | Bacteria | 16883 |
| 446 | Ga0307515_10100689 | 3300028794 | Bacteria | 3496 |
| 447 | Ga0265338_10000280 | 3300028800 | Bacteria | 91942 |
| 448 | Ga0265338_10021117 | 3300028800 | Bacteria | 6806 |
| 449 | Ga0265338_10078963 | 3300028800 | Bacteria | 2772 |
| 450 | Ga0265324_10000063 | 3300029957 | Bacteria | 91952 |
| 451 | Ga0265324_10005408 | 3300029957 | Bacteria | 5520 |
| 452 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 453 | Ga0268256_1010141 | 3300030500 | Bacteria | 3071 |
| 454 | Ga0268256_1015653 | 3300030500 | Bacteria | 2204 |
| 455 | Ga0316181_1110178 | 3300030744 | Bacteria | 3235 |
| 456 | Ga0265330_10000585 | 3300031235 | Bacteria | 23735 |
| 457 | Ga0265330_10000707 | 3300031235 | Bacteria | 21114 |
| 458 | Ga0265330_10004926 | 3300031235 | Bacteria | 6725 |
| 459 | Ga0265330_10012298 | 3300031235 | Bacteria | 4005 |
| 460 | Ga0265332_10000386 | 3300031238 | Bacteria | 32118 |
| 461 | Ga0265328_10006947 | 3300031239 | Bacteria | 4751 |
| 462 | Ga0265328_10040281 | 3300031239 | Bacteria | 1722 |
| 463 | Ga0265320_10000867 | 3300031240 | Bacteria | 22866 |
| 464 | Ga0265325_10001162 | 3300031241 | Bacteria | 18825 |
| 465 | Ga0265325_10002706 | 3300031241 | Bacteria | 11847 |
| 466 | Ga0265325_10003071 | 3300031241 | Bacteria | 11032 |
| 467 | Ga0265325_10084294 | 3300031241 | Bacteria | 1575 |
| 468 | Ga0265329_10000042 | 3300031242 | Bacteria | 53592 |
| 469 | Ga0265329_10000088 | 3300031242 | Bacteria | 42313 |
| 470 | Ga0265329_10010888 | 3300031242 | Bacteria | 3326 |
| 471 | Ga0265340_10002283 | 3300031247 | Bacteria | 10959 |
| 472 | Ga0265340_10003645 | 3300031247 | Bacteria | 8656 |
| 473 | Ga0265339_10000010 | 3300031249 | Bacteria | 214721 |
| 474 | Ga0265339_10000239 | 3300031249 | Bacteria | 44164 |
| 475 | Ga0265339_10021747 | 3300031249 | Bacteria | 3725 |
| 476 | Ga0265331_10000539 | 3300031250 | Bacteria | 34679 |
| 477 | Ga0265331_10011091 | 3300031250 | Bacteria | 4944 |
| 478 | Ga0265327_10030164 | 3300031251 | Bacteria | 3070 |
| 479 | Ga0265316_10000160 | 3300031344 | Bacteria | 75479 |
| 480 | Ga0265316_10000175 | 3300031344 | Bacteria | 72559 |
| 481 | Ga0265316_10000603 | 3300031344 | Bacteria | 40127 |
| 482 | Ga0265316_10000739 | 3300031344 | Bacteria | 36142 |
| 483 | Ga0265316_10005410 | 3300031344 | Bacteria | 12409 |
| 484 | Ga0265316_10027142 | 3300031344 | Bacteria | 4747 |
| 485 | Ga0265316_10064691 | 3300031344 | Bacteria | 2833 |
| 486 | Ga0265316_10089522 | 3300031344 | Bacteria | 2348 |
| 487 | Ga0265316_10094800 | 3300031344 | Bacteria | 2274 |
| 488 | Ga0265316_10153418 | 3300031344 | Bacteria | 1725 |
| 489 | Ga0307513_10003087 | 3300031456 | Bacteria | 22729 |
| 490 | Ga0307513_10003471 | 3300031456 | Bacteria | 21323 |
| 491 | Ga0307513_10194829 | 3300031456 | Bacteria | 1873 |
| 492 | Ga0307513_10234007 | 3300031456 | Bacteria | 1648 |
| 493 | Ga0307509_10017985 | 3300031507 | Bacteria | 8112 |
| 494 | Ga0307509_10093227 | 3300031507 | Bacteria | 3075 |
| 495 | Ga0265313_10000422 | 3300031595 | Bacteria | 45310 |
| 496 | Ga0265313_10001459 | 3300031595 | Bacteria | 22076 |
| 497 | Ga0265313_10061577 | 3300031595 | Bacteria | 1755 |
| 498 | Ga0307508_10000003 | 3300031616 | Bacteria | 321602 |
| 499 | Ga0307508_10053641 | 3300031616 | Bacteria | 3577 |
| 500 | Ga0307508_10095438 | 3300031616 | Bacteria | 2565 |
| 501 | Ga0265314_10001482 | 3300031711 | Bacteria | 26124 |
| 502 | Ga0265314_10009013 | 3300031711 | Bacteria | 8485 |
| 503 | Ga0265314_10016328 | 3300031711 | Bacteria | 5867 |
| 504 | Ga0265342_10000199 | 3300031712 | Bacteria | 67101 |
| 505 | Ga0265342_10001752 | 3300031712 | Bacteria | 19811 |
| 506 | Ga0265342_10012574 | 3300031712 | Bacteria | 5728 |
| 507 | Ga0265342_10048064 | 3300031712 | Bacteria | 2559 |
| 508 | Ga0265342_10099135 | 3300031712 | Bacteria | 1662 |
| 509 | Ga0265342_10104380 | 3300031712 | Bacteria | 1611 |
| 510 | Ga0316576_10025856 | 3300031727 | Bacteria | 4113 |
| 511 | Ga0316576_10027210 | 3300031727 | Bacteria | 4019 |
| 512 | Ga0316576_10124348 | 3300031727 | Bacteria | 1938 |
| 513 | Ga0316578_10011315 | 3300031728 | Bacteria | 4663 |
| 514 | Ga0316578_10082317 | 3300031728 | Bacteria | 1916 |
| 515 | Ga0307516_10006895 | 3300031730 | Bacteria | 13225 |
| 516 | Ga0307516_10207891 | 3300031730 | Bacteria | 1673 |
| 517 | Ga0307405_10000333 | 3300031731 | Bacteria | 17520 |
| 518 | Ga0307410_10017254 | 3300031852 | Bacteria | 4330 |
| 519 | Ga0307406_10079726 | 3300031901 | Bacteria | 2172 |
| 520 | Ga0307407_10081444 | 3300031903 | Bacteria | 1959 |
| 521 | Ga0307412_10005005 | 3300031911 | Bacteria | 7412 |
| 522 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 523 | Ga0307409_100220500 | 3300031995 | Bacteria | 1712 |
| 524 | Ga0307414_10002146 | 3300032004 | Bacteria | 10299 |
| 525 | Ga0307411_10000107 | 3300032005 | Bacteria | 26103 |
| 526 | Ga0316593_10014887 | 3300032168 | Bacteria | 2330 |
| 527 | Ga0307510_10003428 | 3300033180 | Bacteria | 18490 |
| 528 | Ga0315913_1000009 | 3300033430 | Bacteria | 149770 |
| 529 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 530 | Ga0316588_1016704 | 3300033528 | Bacteria | 1630 |
| 531 | Ga0316215_1000798 | 3300033544 | Bacteria | 3181 |
| 532 | Ga0373940_0002677 | 3300035088 | Bacteria | 3513 |
| 533 | Ga0373949_0000018 | 3300035090 | Bacteria | 59252 |
| 534 | Ga0373939_0000188 | 3300035114 | Bacteria | 17175 |
| 535 | Ga0373954_0023299 | 3300035118 | Bacteria | 2814 |
| 536 | Ga0373935_0039661 | 3300035692 | Bacteria | 2953 |
| 537 | Ga0373927_0000047 | 3300035695 | Bacteria | 87289 |
| 538 | Ga0373927_0002755 | 3300035695 | Bacteria | 12825 |
| 539 | Ga0373947_0040262 | 3300035725 | Bacteria | 2783 |
| 540 | Ga0373937_0112708 | 3300036401 | Bacteria | 2530 |
| 541 | Ga0316582_0121812 | 3300036647 | Bacteria | 1746 |
| 542 | Ga0316584_0130159 | 3300036712 | Bacteria | 1880 |
| 543 | Ga0316584_0137017 | 3300036712 | Bacteria | 1827 |
| 544 | Ga0373925_0001420 | 3300037068 | Bacteria | 20792 |
| 545 | Ga0395899_0000030 | 3300037312 | Bacteria | 329063 |
| 546 | Ga0395899_0165917 | 3300037312 | Bacteria | 1558 |
| 547 | Ga0395900_0000023 | 3300037418 | Bacteria | 336048 |
| 548 | Ga0395900_0174865 | 3300037418 | Bacteria | 2184 |
| 549 | Ga0395898_0000038 | 3300037466 | Bacteria | 329063 |
| 550 | Ga0395905_0000021 | 3300037471 | Bacteria | 329054 |
| 551 | Ga0395905_0001828 | 3300037471 | Bacteria | 24574 |
| 552 | Ga0395905_0003588 | 3300037471 | Bacteria | 16513 |
| 553 | Ga0395905_0043048 | 3300037471 | Bacteria | 4236 |
| 554 | Ga0395905_0090275 | 3300037471 | Bacteria | 2872 |
| 555 | Ga0395905_0170337 | 3300037471 | Bacteria | 2045 |
| 556 | Ga0436364_0457171 | 3300037853 | Bacteria | 14942 |
| 557 | Ga0395901_0000018 | 3300038443 | Bacteria | 336048 |
| 558 | Ga0395901_0058770 | 3300038443 | Bacteria | 3999 |
| 559 | Ga0400483_018531 | 3300039062 | Bacteria | 58611 |
| 560 | Ga0400483_056535 | 3300039062 | Bacteria | 25959 |
| 561 | Ga0400483_064331 | 3300039062 | Bacteria | 5230 |
| 562 | Ga0400483_064975 | 3300039062 | Bacteria | 2330 |
| 563 | Ga0400483_082204 | 3300039062 | Bacteria | 1847 |
| 564 | Ga0400483_199980 | 3300039062 | Bacteria | 12837 |
| 565 | Ga0400483_219255 | 3300039062 | Bacteria | 53229 |
| 566 | Ga0400483_225954 | 3300039062 | Bacteria | 2605 |
| 567 | Ga0400483_256661 | 3300039062 | Bacteria | 1622 |
| 568 | Ga0436365_0615937 | 3300039437 | Bacteria | 5798 |
| 569 | Ga0436365_0966943 | 3300039437 | Bacteria | 2923 |
| 570 | Ga0436360_0078821 | 3300039438 | Bacteria | 2181 |
| 571 | Ga0436361_0015273 | 3300039447 | Bacteria | 10997 |
| 572 | Ga0436361_0656175 | 3300039447 | Bacteria | 4309 |
| 573 | Ga0436363_1120285 | 3300039450 | Bacteria | 2287 |
| 574 | Ga0436362_0872866 | 3300039453 | Bacteria | 3769 |
| 575 | Ga0439436_0011526 | 3300041404 | Bacteria | 2686 |
| 576 | Ga0439465_0002349 | 3300041413 | Bacteria | 6212 |
| 577 | Ga0451791_1838827 | 3300041451 | Bacteria | 1983 |
| 578 | Ga0451798_0601713 | 3300041458 | Bacteria | 1664 |
| 579 | Ga0451837_0668917 | 3300041494 | Bacteria | 2766 |
| 580 | Ga0451841_0495290 | 3300041498 | Bacteria | 4653 |
| 581 | Ga0439441_010430 | 3300042001 | Bacteria | 1558 |
| 582 | Ga0439449_0004566 | 3300042007 | Bacteria | 5353 |
| 583 | Ga0439449_0030804 | 3300042007 | Bacteria | 2000 |
| 584 | Ga0450888_000097 | 3300042126 | Bacteria | 6789 |
| 585 | Ga0450890_000925 | 3300042127 | Bacteria | 4240 |
| 586 | Ga0450892_000431 | 3300042130 | Bacteria | 4916 |
| 587 | Ga0450893_0002729 | 3300042532 | Bacteria | 2761 |
| 588 | Ga0451577_0005071 | 3300042876 | Bacteria | 13595 |
| 589 | Ga0451577_0147770 | 3300042876 | Bacteria | 2114 |
| 590 | Ga0466966_0036092 | 3300044684 | Bacteria | 3193 |
| 591 | Ga0466963_0021877 | 3300044694 | Bacteria | 4041 |
| 592 | Ga0453684_0048819 | 3300044712 | Bacteria | 5589 |
| 593 | Ga0453684_0054469 | 3300044712 | Bacteria | 5209 |
| 594 | Ga0453684_0202291 | 3300044712 | Bacteria | 2314 |
| 595 | Ga0466968_0003538 | 3300044735 | Bacteria | 5782 |
| 596 | Ga0466970_0007062 | 3300044765 | Bacteria | 5617 |
| 597 | Ga0466957_0107580 | 3300044842 | Bacteria | 1765 |
| 598 | Ga0451576_0000834 | 3300045051 | Bacteria | 60105 |
| 599 | Ga0451576_0007219 | 3300045051 | Bacteria | 13384 |
| 600 | Ga0451576_0010072 | 3300045051 | Bacteria | 10882 |
| 601 | Ga0466967_0004486 | 3300045976 | Bacteria | 9423 |
| 602 | Ga0495629_0096059 | 3300046459 | Bacteria | 2067 |
| 603 | Ga0495638_0076673 | 3300046460 | Bacteria | 2037 |
| 604 | Ga0495605_0025255 | 3300046474 | Bacteria | 3097 |
| 605 | Ga0495664_0044386 | 3300046477 | Bacteria | 2634 |
| 606 | Ga0495585_0018784 | 3300046492 | Bacteria | 3987 |
| 607 | Ga0495607_0000319 | 3300046501 | Bacteria | 50035 |
| 608 | Ga0495606_0000629 | 3300046507 | Bacteria | 55524 |
| 609 | Ga0495606_0002219 | 3300046507 | Bacteria | 23170 |
| 610 | Ga0495606_0013151 | 3300046507 | Bacteria | 6568 |
| 611 | Ga0495616_0000241 | 3300046513 | Bacteria | 44479 |
| 612 | Ga0495616_0093071 | 3300046513 | Bacteria | 1424 |
| 613 | Ga0495631_0013726 | 3300046518 | Bacteria | 3925 |
| 614 | Ga0495632_0025688 | 3300046519 | Bacteria | 3112 |
| 615 | Ga0495632_0061201 | 3300046519 | Bacteria | 1827 |
| 616 | Ga0495632_0088894 | 3300046519 | Bacteria | 1467 |
| 617 | Ga0495643_0023336 | 3300046522 | Bacteria | 3518 |
| 618 | Ga0495643_0023803 | 3300046522 | Bacteria | 3477 |
| 619 | Ga0495643_0024126 | 3300046522 | Bacteria | 3452 |
| 620 | Ga0495643_0028720 | 3300046522 | Bacteria | 3115 |
| 621 | Ga0495648_0016311 | 3300046524 | Bacteria | 5360 |
| 622 | Ga0495648_0055627 | 3300046524 | Bacteria | 2385 |
| 623 | Ga0495654_0001861 | 3300046530 | Bacteria | 14052 |
| 624 | Ga0495587_0072106 | 3300046536 | Bacteria | 2008 |
| 625 | Ga0495597_0016255 | 3300046542 | Bacteria | 3516 |
| 626 | Ga0495645_0022443 | 3300046543 | Bacteria | 4566 |
| 627 | Ga0495633_0088023 | 3300046558 | Bacteria | 1444 |
| 628 | Ga0495667_0106671 | 3300046559 | Bacteria | 1810 |
| 629 | Ga0495625_0015812 | 3300046660 | Bacteria | 5957 |
| 630 | Ga0495625_0031642 | 3300046660 | Bacteria | 3932 |
| 631 | Ga0495625_0087624 | 3300046660 | Bacteria | 2158 |
| 632 | Ga0495661_0006830 | 3300046665 | Bacteria | 7991 |
| 633 | Ga0495661_0060714 | 3300046665 | Bacteria | 2245 |
| 634 | Ga0495588_0001753 | 3300046674 | Bacteria | 9238 |
| 635 | Ga0495588_0032887 | 3300046674 | Bacteria | 2616 |
| 636 | Ga0495669_0005090 | 3300046684 | Bacteria | 5472 |
| 637 | Ga0495600_0031448 | 3300046809 | Bacteria | 3439 |
| 638 | Ga0495674_0017990 | 3300047319 | Bacteria | 6578 |
| 639 | Ga0495687_048323 | 3300047443 | Bacteria | 1825 |
| 640 | Ga0495673_0048594 | 3300047469 | Bacteria | 1870 |
| 641 | Ga0495684_0175369 | 3300047471 | Bacteria | 1592 |
| 642 | Ga0495686_0002643 | 3300047472 | Bacteria | 16544 |
| 643 | Ga0495626_0001302 | 3300048091 | Bacteria | 20364 |
| 644 | Ga0496101_0031137 | 3300048904 | Bacteria | 3747 |
| 645 | Ga0496101_0188164 | 3300048904 | Bacteria | 1592 |
| 646 | Ga0496102_0003383 | 3300048905 | Bacteria | 13525 |
| 647 | Ga0496102_0059349 | 3300048905 | Bacteria | 3498 |
| 648 | Ga0496102_0120362 | 3300048905 | Bacteria | 2451 |
| 649 | Ga0496104_0016934 | 3300048907 | Bacteria | 6630 |
| 650 | Ga0496104_0051606 | 3300048907 | Bacteria | 3882 |
| 651 | Ga0496105_0034708 | 3300048908 | Bacteria | 4149 |
| 652 | Ga0496106_0001659 | 3300048909 | Bacteria | 16701 |
| 653 | Ga0496107_0106317 | 3300048910 | Bacteria | 2061 |
| 654 | Ga0496108_0113512 | 3300048911 | Bacteria | 2319 |
| 655 | Ga0496109_0188238 | 3300048912 | Bacteria | 1939 |
| 656 | Ga0496110_0041076 | 3300048913 | Bacteria | 4034 |
| 657 | Ga0496111_0000570 | 3300048914 | Bacteria | 19247 |
| 658 | Ga0496111_0051207 | 3300048914 | Bacteria | 2981 |
| 659 | Ga0496114_0005571 | 3300048917 | Bacteria | 9870 |
| 660 | Ga0496115_0157199 | 3300048918 | Bacteria | 1878 |
| 661 | Ga0496116_0000097 | 3300048919 | Bacteria | 200658 |
| 662 | Ga0496116_0035905 | 3300048919 | Bacteria | 3476 |
| 663 | Ga0496116_0066736 | 3300048919 | Bacteria | 2301 |
| 664 | Ga0496117_0000030 | 3300048920 | Bacteria | 389141 |
| 665 | Ga0496117_0002458 | 3300048920 | Bacteria | 23348 |
| 666 | Ga0496117_0005055 | 3300048920 | Bacteria | 14138 |
| 667 | Ga0496117_0030483 | 3300048920 | Bacteria | 4139 |
| 668 | Ga0496117_0062045 | 3300048920 | Bacteria | 2564 |
| 669 | Ga0496117_0064820 | 3300048920 | Bacteria | 2488 |
| 670 | Ga0496117_0067662 | 3300048920 | Bacteria | 2416 |
| 671 | Ga0496118_0005475 | 3300048921 | Bacteria | 14409 |
| 672 | Ga0496118_0010916 | 3300048921 | Bacteria | 8933 |
| 673 | Ga0496118_0018933 | 3300048921 | Bacteria | 6173 |
| 674 | Ga0496118_0023602 | 3300048921 | Bacteria | 5337 |
| 675 | Ga0496118_0043627 | 3300048921 | Bacteria | 3522 |
| 676 | Ga0496119_0004065 | 3300048922 | Bacteria | 14759 |
| 677 | Ga0496119_0005138 | 3300048922 | Bacteria | 12675 |
| 678 | Ga0496119_0007759 | 3300048922 | Bacteria | 9571 |
| 679 | Ga0496119_0019969 | 3300048922 | Bacteria | 4906 |
| 680 | Ga0496119_0029278 | 3300048922 | Bacteria | 3739 |
| 681 | Ga0496119_0037868 | 3300048922 | Bacteria | 3125 |
| 682 | Ga0496119_0066315 | 3300048922 | Bacteria | 2134 |
| 683 | Ga0496120_0000148 | 3300048923 | Bacteria | 116605 |
| 684 | Ga0496120_0006073 | 3300048923 | Bacteria | 9378 |
| 685 | Ga0496120_0044423 | 3300048923 | Bacteria | 2581 |
| 686 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 687 | Ga0496121_0000180 | 3300048924 | Bacteria | 141128 |
| 688 | Ga0496121_0000452 | 3300048924 | Bacteria | 80796 |
| 689 | Ga0496121_0003259 | 3300048924 | Bacteria | 23331 |
| 690 | Ga0496121_0005630 | 3300048924 | Bacteria | 15952 |
| 691 | Ga0496121_0020232 | 3300048924 | Bacteria | 6601 |
| 692 | Ga0496121_0023174 | 3300048924 | Bacteria | 5993 |
| 693 | Ga0496121_0027611 | 3300048924 | Bacteria | 5307 |
| 694 | Ga0496122_0000024 | 3300048925 | Bacteria | 372400 |
| 695 | Ga0496122_0000050 | 3300048925 | Bacteria | 267874 |
| 696 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 697 | Ga0496122_0001243 | 3300048925 | Bacteria | 42828 |
| 698 | Ga0496122_0003715 | 3300048925 | Bacteria | 19733 |
| 699 | Ga0496122_0008479 | 3300048925 | Bacteria | 11071 |
| 700 | Ga0496122_0009737 | 3300048925 | Bacteria | 10041 |
| 701 | Ga0496122_0010876 | 3300048925 | Bacteria | 9316 |
| 702 | Ga0496122_0021073 | 3300048925 | Bacteria | 5854 |
| 703 | Ga0496122_0029228 | 3300048925 | Bacteria | 4654 |
| 704 | Ga0496122_0055523 | 3300048925 | Bacteria | 2962 |
| 705 | Ga0496122_0096358 | 3300048925 | Bacteria | 1995 |
| 706 | Ga0496123_0000023 | 3300048926 | Bacteria | 346894 |
| 707 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 708 | Ga0496123_0000086 | 3300048926 | Bacteria | 183266 |
| 709 | Ga0496123_0003983 | 3300048926 | Bacteria | 15996 |
| 710 | Ga0496123_0008804 | 3300048926 | Bacteria | 9202 |
| 711 | Ga0496123_0009186 | 3300048926 | Bacteria | 8935 |
| 712 | Ga0496123_0052226 | 3300048926 | Bacteria | 2714 |
| 713 | Ga0496123_0084740 | 3300048926 | Bacteria | 1910 |
| 714 | Ga0496124_0000239 | 3300048927 | Bacteria | 106633 |
| 715 | Ga0496124_0000267 | 3300048927 | Bacteria | 101138 |
| 716 | Ga0496124_0001850 | 3300048927 | Bacteria | 29217 |
| 717 | Ga0496124_0003986 | 3300048927 | Bacteria | 17602 |
| 718 | Ga0496124_0005879 | 3300048927 | Bacteria | 13582 |
| 719 | Ga0496124_0010962 | 3300048927 | Bacteria | 9114 |
| 720 | Ga0496124_0015054 | 3300048927 | Bacteria | 7438 |
| 721 | Ga0496124_0030974 | 3300048927 | Bacteria | 4738 |
| 722 | Ga0496124_0049935 | 3300048927 | Bacteria | 3566 |
| 723 | Ga0496125_0000053 | 3300048928 | Bacteria | 279909 |
| 724 | Ga0496125_0000323 | 3300048928 | Bacteria | 93243 |
| 725 | Ga0496125_0000833 | 3300048928 | Bacteria | 49770 |
| 726 | Ga0496125_0000963 | 3300048928 | Bacteria | 45208 |
| 727 | Ga0496125_0003888 | 3300048928 | Bacteria | 17657 |
| 728 | Ga0496125_0043340 | 3300048928 | Bacteria | 3821 |
| 729 | Ga0496125_0048642 | 3300048928 | Bacteria | 3534 |
| 730 | Ga0496125_0088534 | 3300048928 | Bacteria | 2332 |
| 731 | Ga0496125_0096697 | 3300048928 | Bacteria | 2191 |
| 732 | Ga0496126_0000119 | 3300048929 | Bacteria | 184211 |
| 733 | Ga0496126_0000434 | 3300048929 | Bacteria | 83949 |
| 734 | Ga0496126_0048221 | 3300048929 | Bacteria | 3894 |
| 735 | Ga0496126_0064335 | 3300048929 | Bacteria | 3286 |
| 736 | Ga0496126_0140941 | 3300048929 | Bacteria | 2075 |
| 737 | Ga0501304_001476 | 3300049160 | Bacteria | 1516 |
| 738 | Ga0501031_0000006 | 3300049568 | Bacteria | 176019 |
| 739 | Ga0501031_0018057 | 3300049568 | Bacteria | 4588 |
| 740 | Ga0501032_0000013 | 3300049569 | Bacteria | 185070 |
| 741 | Ga0501032_0000016 | 3300049569 | Bacteria | 174688 |
| 742 | Ga0501032_0017003 | 3300049569 | Bacteria | 5110 |
| 743 | Ga0501033_0000101 | 3300049570 | Bacteria | 81870 |
| 744 | Ga0501033_0000361 | 3300049570 | Bacteria | 43373 |
| 745 | Ga0501033_0000660 | 3300049570 | Bacteria | 31872 |
| 746 | Ga0501033_0009148 | 3300049570 | Bacteria | 7635 |
| 747 | Ga0501034_0000054 | 3300049571 | Bacteria | 206373 |
| 748 | Ga0501034_0000168 | 3300049571 | Bacteria | 122667 |
| 749 | Ga0501034_0000606 | 3300049571 | Bacteria | 56542 |
| 750 | Ga0501034_0007494 | 3300049571 | Bacteria | 11606 |
| 751 | Ga0501034_0014819 | 3300049571 | Bacteria | 8019 |
| 752 | Ga0501034_0019998 | 3300049571 | Bacteria | 6837 |
| 753 | Ga0501034_0036336 | 3300049571 | Bacteria | 4990 |
| 754 | Ga0501034_0043477 | 3300049571 | Bacteria | 4546 |
| 755 | Ga0501034_0056012 | 3300049571 | Bacteria | 3968 |
| 756 | Ga0501034_0066655 | 3300049571 | Bacteria | 3613 |
| 757 | Ga0501034_0216430 | 3300049571 | Bacteria | 1869 |
| 758 | Ga0501036_0000019 | 3300049572 | Bacteria | 118632 |
| 759 | Ga0501036_0000828 | 3300049572 | Bacteria | 22938 |
| 760 | Ga0501036_0006703 | 3300049572 | Bacteria | 9358 |
| 761 | Ga0501036_0074452 | 3300049572 | Bacteria | 2872 |
| 762 | Ga0501036_0102684 | 3300049572 | Bacteria | 2418 |
| 763 | Ga0501036_0127063 | 3300049572 | Bacteria | 2153 |
| 764 | Ga0501037_0000013 | 3300049573 | Bacteria | 174688 |
| 765 | Ga0501037_0000105 | 3300049573 | Bacteria | 79431 |
| 766 | Ga0501037_0005064 | 3300049573 | Bacteria | 9586 |
| 767 | Ga0501037_0006338 | 3300049573 | Bacteria | 8651 |
| 768 | Ga0501037_0031629 | 3300049573 | Bacteria | 3908 |
| 769 | Ga0501038_0000012 | 3300049574 | Bacteria | 174688 |
| 770 | Ga0501038_0001713 | 3300049574 | Bacteria | 20369 |
| 771 | Ga0501038_0016274 | 3300049574 | Bacteria | 6742 |
| 772 | Ga0501038_0045286 | 3300049574 | Bacteria | 3819 |
| 773 | Ga0501038_0133243 | 3300049574 | Bacteria | 2038 |
| 774 | Ga0501038_0193044 | 3300049574 | Bacteria | 1638 |
| 775 | Ga0501039_0000019 | 3300049575 | Bacteria | 174688 |
| 776 | Ga0501039_0000152 | 3300049575 | Bacteria | 47363 |
| 777 | Ga0501039_0010051 | 3300049575 | Bacteria | 7214 |
| 778 | Ga0501039_0222261 | 3300049575 | Bacteria | 1484 |
| 779 | Ga0501040_0000768 | 3300049576 | Bacteria | 19948 |
| 780 | Ga0501041_0024119 | 3300049577 | Bacteria | 3650 |
| 781 | Ga0501041_0030414 | 3300049577 | Bacteria | 3259 |
| 782 | Ga0501042_0003664 | 3300049578 | Bacteria | 9689 |
| 783 | Ga0501043_0000014 | 3300049579 | Bacteria | 184687 |
| 784 | Ga0501043_0000020 | 3300049579 | Bacteria | 155270 |
| 785 | Ga0501043_0000055 | 3300049579 | Bacteria | 105522 |
| 786 | Ga0501043_0000209 | 3300049579 | Bacteria | 53858 |
| 787 | Ga0501043_0030311 | 3300049579 | Bacteria | 4250 |
| 788 | Ga0501043_0059365 | 3300049579 | Bacteria | 3002 |
| 789 | Ga0501046_0000039 | 3300049580 | Bacteria | 155237 |
| 790 | Ga0501046_0020472 | 3300049580 | Bacteria | 5468 |
| 791 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 792 | Ga0501047_0003446 | 3300049581 | Bacteria | 14959 |
| 793 | Ga0501047_0005984 | 3300049581 | Bacteria | 11433 |
| 794 | Ga0501047_0008929 | 3300049581 | Bacteria | 9463 |
| 795 | Ga0501047_0011138 | 3300049581 | Bacteria | 8510 |
| 796 | Ga0501047_0020376 | 3300049581 | Bacteria | 6369 |
| 797 | Ga0501047_0067229 | 3300049581 | Bacteria | 3454 |
| 798 | Ga0501047_0124293 | 3300049581 | Bacteria | 2460 |
| 799 | Ga0501048_0005288 | 3300049582 | Bacteria | 9833 |
| 800 | Ga0501068_0010106 | 3300049584 | Bacteria | 5295 |
| 801 | Ga0501069_0000106 | 3300049585 | Bacteria | 38605 |
| 802 | Ga0501069_0037080 | 3300049585 | Bacteria | 2690 |
| 803 | Ga0501070_0000781 | 3300049586 | Bacteria | 28933 |
| 804 | Ga0501070_0001320 | 3300049586 | Bacteria | 22173 |
| 805 | Ga0501070_0003394 | 3300049586 | Bacteria | 13824 |
| 806 | Ga0501070_0005494 | 3300049586 | Bacteria | 10816 |
| 807 | Ga0501070_0005565 | 3300049586 | Bacteria | 10743 |
| 808 | Ga0501070_0016146 | 3300049586 | Bacteria | 6276 |
| 809 | Ga0501071_0001762 | 3300049587 | Bacteria | 12758 |
| 810 | Ga0501071_0032434 | 3300049587 | Bacteria | 3709 |
| 811 | Ga0501073_0003088 | 3300049589 | Bacteria | 12485 |
| 812 | Ga0501073_0030633 | 3300049589 | Bacteria | 3840 |
| 813 | Ga0501073_0063110 | 3300049589 | Bacteria | 2584 |
| 814 | Ga0501074_0000072 | 3300049590 | Bacteria | 48714 |
| 815 | Ga0501074_0005586 | 3300049590 | Bacteria | 9047 |
| 816 | Ga0501074_0027619 | 3300049590 | Bacteria | 4115 |
| 817 | Ga0501075_0068634 | 3300049591 | Bacteria | 2679 |
| 818 | Ga0501076_0052220 | 3300049592 | Bacteria | 3238 |
| 819 | Ga0501207_001043 | 3300049654 | Bacteria | 3378 |
| 820 | Ga0501223_008382 | 3300049663 | Bacteria | 2108 |
| 821 | Ga0501221_000258 | 3300049704 | Bacteria | 7794 |
| 822 | Ga0501079_0171358 | 3300049741 | Bacteria | 1693 |
| 823 | Ga0501080_0000168 | 3300049742 | Bacteria | 47595 |
| 824 | Ga0501080_0000878 | 3300049742 | Bacteria | 24606 |
| 825 | Ga0501080_0007242 | 3300049742 | Bacteria | 10012 |
| 826 | Ga0501080_0024475 | 3300049742 | Bacteria | 5595 |
| 827 | Ga0501080_0048583 | 3300049742 | Bacteria | 3949 |
| 828 | Ga0501080_0121692 | 3300049742 | Bacteria | 2418 |
| 829 | Ga0501080_0240990 | 3300049742 | Bacteria | 1651 |
| 830 | Ga0501080_0289743 | 3300049742 | Bacteria | 1487 |
| 831 | Ga0501083_0000484 | 3300049744 | Bacteria | 25530 |
| 832 | Ga0501083_0003518 | 3300049744 | Bacteria | 10971 |
| 833 | Ga0501083_0060413 | 3300049744 | Bacteria | 2532 |
| 834 | Ga0501232_000308 | 3300049757 | Bacteria | 3112 |
| 835 | Ga0501035_0000019 | 3300049822 | Bacteria | 241152 |
| 836 | Ga0501035_0000081 | 3300049822 | Bacteria | 117453 |
| 837 | Ga0501035_0000183 | 3300049822 | Bacteria | 76563 |
| 838 | Ga0501035_0004384 | 3300049822 | Bacteria | 13400 |
| 839 | Ga0501035_0005434 | 3300049822 | Bacteria | 12047 |
| 840 | Ga0501035_0012030 | 3300049822 | Bacteria | 8005 |
| 841 | Ga0501035_0065881 | 3300049822 | Bacteria | 3215 |
| 842 | Ga0501035_0121647 | 3300049822 | Bacteria | 2281 |
| 843 | Ga0501044_0000009 | 3300049823 | Bacteria | 270072 |
| 844 | Ga0501044_0000029 | 3300049823 | Bacteria | 176024 |
| 845 | Ga0501044_0004154 | 3300049823 | Bacteria | 16266 |
| 846 | Ga0501044_0008796 | 3300049823 | Bacteria | 11045 |
| 847 | Ga0501044_0020961 | 3300049823 | Bacteria | 6979 |
| 848 | Ga0501044_0021041 | 3300049823 | Bacteria | 6964 |
| 849 | Ga0501044_0046742 | 3300049823 | Bacteria | 4480 |
| 850 | Ga0501044_0051933 | 3300049823 | Bacteria | 4227 |
| 851 | Ga0501044_0058456 | 3300049823 | Bacteria | 3954 |
| 852 | Ga0501044_0118233 | 3300049823 | Bacteria | 2654 |
| 853 | Ga0501044_0165798 | 3300049823 | Bacteria | 2183 |
| 854 | Ga0501044_0313781 | 3300049823 | Bacteria | 1494 |
| 855 | Ga0501045_0005518 | 3300049824 | Bacteria | 8751 |
| 856 | Ga0501045_0008620 | 3300049824 | Bacteria | 7108 |
| 857 | Ga0501045_0059823 | 3300049824 | Bacteria | 2792 |
| 858 | nmdc:mga03683_12179_c1 | 3300050489 | Bacteria | 3135 |
| 859 | nmdc:mga03683_55260_c1 | 3300050489 | Bacteria | 1667 |
| 860 | nmdc:mga03683_5535_c1 | 3300050489 | Bacteria | 4271 |
| 861 | nmdc:mga03n38_10877_c1 | 3300050490 | Bacteria | 3368 |
| 862 | nmdc:mga00v17_2647_c1 | 3300050491 | Bacteria | 9183 |
| 863 | nmdc:mga00v17_2942_c2 | 3300050491 | Bacteria | 5598 |
| 864 | nmdc:mga00v17_337_c1 | 3300050491 | Bacteria | 26383 |
| 865 | nmdc:mga00v17_67377_c1 | 3300050491 | Bacteria | 2212 |
| 866 | nmdc:mga0yw44_16598_c1 | 3300050492 | Bacteria | 3982 |
| 867 | nmdc:mga0yw44_2133_c1 | 3300050492 | Bacteria | 8297 |
| 868 | nmdc:mga0yw44_44224_c1 | 3300050492 | Bacteria | 2663 |
| 869 | nmdc:mga0k408_50586_c1 | 3300050493 | Bacteria | 2406 |
| 870 | nmdc:mga0k408_7537_c1 | 3300050493 | Bacteria | 5813 |
| 871 | nmdc:mga06z11_40796_c1 | 3300050494 | Bacteria | 2319 |
| 872 | nmdc:mga06z11_51034_c1 | 3300050494 | Bacteria | 2116 |
| 873 | nmdc:mga06z11_63975_c1 | 3300050494 | Bacteria | 1926 |
| 874 | nmdc:mga07m45_37856_c1 | 3300050496 | Bacteria | 2691 |
| 875 | nmdc:mga07m45_39431_c1 | 3300050496 | Bacteria | 2067 |
| 876 | nmdc:mga07m45_5037_c1 | 3300050496 | Bacteria | 6529 |
| 877 | nmdc:mga07m45_57439_c1 | 3300050496 | Bacteria | 2200 |
| 878 | nmdc:mga07m45_62749_c1 | 3300050496 | Bacteria | 2107 |
| 879 | nmdc:mga05p37_227_c1 | 3300050507 | Bacteria | 57142 |
| 880 | nmdc:mga05p37_43104_c1 | 3300050507 | Bacteria | 5549 |
| 881 | nmdc:mga09592_139472_c1 | 3300050508 | Bacteria | 2089 |
| 882 | nmdc:mga09592_578_c1 | 3300050508 | Bacteria | 27739 |
| 883 | nmdc:mga0qj67_12914_c1 | 3300050509 | Bacteria | 6302 |
| 884 | nmdc:mga0qj67_9436_c1 | 3300050509 | Bacteria | 7263 |
| 885 | nmdc:mga06r32_10595_c1 | 3300050510 | Bacteria | 8313 |
| 886 | nmdc:mga08y16_10250_c1 | 3300050511 | Bacteria | 9835 |
| 887 | nmdc:mga08y16_12387_c1 | 3300050511 | Bacteria | 8969 |
| 888 | nmdc:mga08y16_184793_c1 | 3300050511 | Bacteria | 2164 |
| 889 | nmdc:mga0n895_99514_c1 | 3300050512 | Bacteria | 2916 |
| 890 | nmdc:mga08x19_86102_c1 | 3300050514 | Bacteria | 2068 |
| 891 | nmdc:mga0a205_50322_c1 | 3300050515 | Bacteria | 4022 |
| 892 | nmdc:mga0sz30_74_c2 | 3300050516 | Bacteria | 23106 |
| 893 | Ga0500578_0011996 | 3300053086 | Bacteria | 5597 |
| 894 | Ga0500643_000278 | 3300053087 | Bacteria | 44354 |
| 895 | Ga0500647_0012446 | 3300053091 | Bacteria | 3831 |
| 896 | Ga0500647_0031354 | 3300053091 | Bacteria | 2530 |
| 897 | Ga0500583_0056561 | 3300053092 | Bacteria | 1839 |
| 898 | Ga0500566_0000565 | 3300053094 | Bacteria | 20802 |
| 899 | Ga0500555_018996 | 3300053103 | Bacteria | 1981 |
| 900 | Ga0500556_0000148 | 3300053104 | Bacteria | 58772 |
| 901 | Ga0500557_000028 | 3300053105 | Bacteria | 78414 |
| 902 | Ga0500560_000303 | 3300053107 | Bacteria | 6267 |
| 903 | Ga0500595_002261 | 3300053119 | Bacteria | 9727 |
| 904 | Ga0500597_009019 | 3300053120 | Bacteria | 3487 |
| 905 | Ga0500608_002836 | 3300053122 | Bacteria | 6402 |
| 906 | Ga0500618_000109 | 3300053125 | Bacteria | 66318 |
| 907 | Ga0500618_000114 | 3300053125 | Bacteria | 65602 |
| 908 | Ga0500618_000249 | 3300053125 | Bacteria | 42747 |
| 909 | Ga0500618_001997 | 3300053125 | Bacteria | 8320 |
| 910 | Ga0500642_0000189 | 3300053130 | Bacteria | 25159 |
| 911 | Ga0500658_0001045 | 3300053134 | Bacteria | 11320 |
| 912 | Ga0500561_0000118 | 3300053137 | Bacteria | 15316 |
| 913 | Ga0500568_0000035 | 3300053139 | Bacteria | 137912 |
| 914 | Ga0500573_0010491 | 3300053140 | Bacteria | 5170 |
| 915 | Ga0500590_005965 | 3300053148 | Bacteria | 5905 |
| 916 | Ga0500604_0000141 | 3300053151 | Bacteria | 21444 |
| 917 | Ga0500616_0002051 | 3300053153 | Bacteria | 17701 |
| 918 | Ga0500616_0014986 | 3300053153 | Bacteria | 4442 |
| 919 | Ga0500616_0079814 | 3300053153 | Bacteria | 1646 |
| 920 | Ga0500622_0000101 | 3300053156 | Bacteria | 86856 |
| 921 | Ga0500622_0005319 | 3300053156 | Bacteria | 7761 |
| 922 | Ga0500622_0037789 | 3300053156 | Bacteria | 2521 |
| 923 | Ga0500624_000988 | 3300053157 | Bacteria | 5766 |
| 924 | Ga0500634_0000029 | 3300053161 | Bacteria | 77702 |
| 925 | Ga0500634_0011815 | 3300053161 | Bacteria | 4522 |
| 926 | Ga0500636_0000005 | 3300053177 | Bacteria | 197561 |
| 927 | Ga0500636_0003484 | 3300053177 | Bacteria | 8862 |
| 928 | Ga0500636_0007269 | 3300053177 | Bacteria | 6401 |
| 929 | Ga0500637_0063963 | 3300053178 | Bacteria | 2110 |
| 930 | Ga0501084_0013761 | 3300054114 | Bacteria | 6695 |
| 931 | Ga0501082_0020797 | 3300060353 | Bacteria | 5659 |
| 932 | Ga0501082_0082547 | 3300060353 | Bacteria | 2773 |
| 933 | Ga0530510_0004233 | 3300061734 | Bacteria | 9919 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0171358 | Ga0501079_0171358_462_1676 | 396 |
| 2 | 3300006844 | Ga0075428_100136008 | Ga0075428_1001360082 | 399 |
| 3 | 3300025949 | Ga0207667_10128396 | Ga0207667_101283962 | 412 |
| 4 | iso_pu_bacteria | 8019638758 | 8019639748 | 415 |
| 5 | 3300005339 | Ga0070660_100054946 | Ga0070660_1000549463 | 417 |
| 6 | 3300005356 | Ga0070674_100011633 | Ga0070674_1000116332 | 417 |
| 7 | 3300005366 | Ga0070659_100027085 | Ga0070659_1000270851 | 417 |
| 8 | 3300005366 | Ga0070659_100121682 | Ga0070659_1001216821 | 417 |
| 9 | 3300005459 | Ga0068867_100197022 | Ga0068867_1001970221 | 417 |
| 10 | 3300005563 | Ga0068855_100102801 | Ga0068855_1001028012 | 417 |
| 11 | 3300005578 | Ga0068854_100031826 | Ga0068854_1000318262 | 417 |
| 12 | 3300010375 | Ga0105239_10193678 | Ga0105239_101936781 | 417 |
| 13 | 3300025907 | Ga0207645_10068247 | Ga0207645_100682472 | 417 |
| 14 | 3300025919 | Ga0207657_10047345 | Ga0207657_100473452 | 417 |
| 15 | 3300026067 | Ga0207678_10066999 | Ga0207678_100669994 | 417 |
| 16 | 3300026089 | Ga0207648_10061039 | Ga0207648_100610393 | 417 |
| 17 | 3300026121 | Ga0207683_10099602 | Ga0207683_100996022 | 417 |
| 18 | 3300026142 | Ga0207698_10011740 | Ga0207698_100117402 | 417 |
| 19 | 3300049822 | Ga0501035_0121647 | Ga0501035_0121647_81_1388 | 417 |
| 20 | 3300049823 | Ga0501044_0118233 | Ga0501044_0118233_829_2136 | 417 |
| 21 | 3300046684 | Ga0495669_0005090 | Ga0495669_0005090_448_1710 | 418 |
| 22 | iso_pu_bacteria | 2510461069 | 2510843724 | 418 |
| 23 | 3300039062 | Ga0400483_064975 | Ga0400483_064975_1016_2302 | 421 |
| 24 | 3300031995 | Ga0307409_100220500 | Ga0307409_1002205002 | 424 |
| 25 | 3300046519 | Ga0495632_0088894 | Ga0495632_0088894_42_1352 | 424 |
| 26 | 3300021361 | Ga0213872_10001461 | Ga0213872_100014616 | 426 |
| 27 | 3300025256 | Ga0209759_1018251 | Ga0209759_10182512 | 426 |
| 28 | 3300035118 | Ga0373954_0023299 | Ga0373954_0023299_1152_2474 | 426 |
| 29 | 3300035695 | Ga0373927_0002755 | Ga0373927_0002755_3768_5090 | 426 |
| 30 | 3300035725 | Ga0373947_0040262 | Ga0373947_0040262_993_2315 | 426 |
| 31 | 3300036401 | Ga0373937_0112708 | Ga0373937_0112708_890_2212 | 426 |
| 32 | 3300046477 | Ga0495664_0044386 | Ga0495664_0044386_1176_2498 | 426 |
| 33 | 3300047319 | Ga0495674_0017990 | Ga0495674_0017990_4344_5666 | 426 |
| 34 | 3300044842 | Ga0466957_0107580 | Ga0466957_0107580_185_1492 | 427 |
| 35 | 3300005355 | Ga0070671_100004121 | Ga0070671_1000041219 | 428 |
| 36 | 3300005458 | Ga0070681_10004145 | Ga0070681_1000414512 | 428 |
| 37 | 3300013306 | Ga0163162_10247511 | Ga0163162_102475112 | 428 |
| 38 | 3300017792 | Ga0163161_10114681 | Ga0163161_101146812 | 428 |
| 39 | 3300025912 | Ga0207707_10056350 | Ga0207707_100563502 | 428 |
| 40 | 3300046522 | Ga0495643_0024126 | Ga0495643_0024126_267_1556 | 428 |
| 41 | 3300048904 | Ga0496101_0188164 | Ga0496101_0188164_226_1515 | 428 |
| 42 | 3300048905 | Ga0496102_0003383 | Ga0496102_0003383_10290_11579 | 428 |
| 43 | 3300048913 | Ga0496110_0041076 | Ga0496110_0041076_1516_2805 | 428 |
| 44 | 3300048922 | Ga0496119_0007759 | Ga0496119_0007759_6767_8056 | 428 |
| 45 | 3300005434 | Ga0070709_10030239 | Ga0070709_100302392 | 429 |
| 46 | 3300046543 | Ga0495645_0022443 | Ga0495645_0022443_485_1780 | 429 |
| 47 | 3300046559 | Ga0495667_0106671 | Ga0495667_0106671_344_1639 | 429 |
| 48 | 3300047471 | Ga0495684_0175369 | Ga0495684_0175369_236_1531 | 429 |
| 49 | iso_pu_bacteria | 2854681122 | 2854684494 | 429 |
| 50 | iso_pu_bacteria | 2898795034 | 2898795579 | 429 |
| 51 | iso_pu_bacteria | 2899275550 | 2899279582 | 429 |
| 52 | iso_pu_bacteria | 2919679072 | 2919682087 | 429 |
| 53 | iso_pu_bacteria | 3000017691 | 3000021180 | 429 |
| 54 | iso_pu_bacteria | 3000405567 | 3000406144 | 429 |
| 55 | 3300009094 | Ga0111539_10021065 | Ga0111539_100210655 | 430 |
| 56 | 3300027907 | Ga0207428_10024756 | Ga0207428_100247563 | 430 |
| 57 | 3300050511 | nmdc:mga08y16_10250_c1 | nmdc:mga08y16_10250_c1_2827_4152 | 430 |
| 58 | iso_pu_bacteria | 2840878972 | 2840883197 | 430 |
| 59 | 3300005338 | Ga0068868_100176670 | Ga0068868_1001766702 | 431 |
| 60 | 3300026023 | Ga0207677_10182273 | Ga0207677_101822731 | 431 |
| 61 | 3300035090 | Ga0373949_0000018 | Ga0373949_0000018_49039_50355 | 431 |
| 62 | 3300044712 | Ga0453684_0054469 | Ga0453684_0054469_1317_2633 | 431 |
| 63 | iso_pu_bacteria | 2534681786 | 2535484304 | 431 |
| 64 | iso_pu_bacteria | 2551306092 | 2551737937 | 431 |
| 65 | iso_pu_bacteria | 2558860983 | 2561468035 | 431 |
| 66 | iso_pu_bacteria | 2582581283 | 2585168092 | 431 |
| 67 | iso_pu_bacteria | 2582581306 | 2585269700 | 431 |
| 68 | iso_pu_bacteria | 2582581865 | 2585388638 | 431 |
| 69 | iso_pu_bacteria | 2599185156 | 2599334699 | 431 |
| 70 | iso_pu_bacteria | 2643221580 | 2643910958 | 431 |
| 71 | iso_pu_bacteria | 2643221591 | 2643966668 | 431 |
| 72 | iso_pu_bacteria | 2643221607 | 2644048367 | 431 |
| 73 | iso_pu_bacteria | 2643221629 | 2644164613 | 431 |
| 74 | iso_pu_bacteria | 2643221636 | 2644201729 | 431 |
| 75 | iso_pu_bacteria | 2643221637 | 2644209835 | 431 |
| 76 | iso_pu_bacteria | 2643221662 | 2644346115 | 431 |
| 77 | iso_pu_bacteria | 2643221674 | 2644412202 | 431 |
| 78 | iso_pu_bacteria | 2643221686 | 2644481169 | 431 |
| 79 | iso_pu_bacteria | 2643221688 | 2644496425 | 431 |
| 80 | iso_pu_bacteria | 2643221689 | 2644500138 | 431 |
| 81 | iso_pu_bacteria | 2643221718 | 2644653386 | 431 |
| 82 | iso_pu_bacteria | 2751185800 | 2753357627 | 431 |
| 83 | iso_pu_bacteria | 2758568016 | 2758640202 | 431 |
| 84 | iso_pu_bacteria | 2791355092 | 2792625667 | 431 |
| 85 | iso_pu_bacteria | 2791355253 | 2793281580 | 431 |
| 86 | iso_pu_bacteria | 2842922631 | 2842925823 | 431 |
| 87 | iso_pu_bacteria | 2854911287 | 2854913441 | 431 |
| 88 | iso_pu_bacteria | 2932401849 | 2932405585 | 431 |
| 89 | iso_pu_bacteria | 8005658619 | 8005661715 | 431 |
| 90 | iso_pu_bacteria | 8055431914 | 8055431999 | 431 |
| 91 | 3300006353 | Ga0075370_10041128 | Ga0075370_100411282 | 432 |
| 92 | 3300014968 | Ga0157379_10066537 | Ga0157379_100665372 | 432 |
| 93 | iso_pu_bacteria | 2503198000 | 2503198449 | 432 |
| 94 | iso_pu_bacteria | 2508501122 | 2509110212 | 432 |
| 95 | iso_pu_bacteria | 2508501123 | 2509114061 | 432 |
| 96 | iso_pu_bacteria | 2508501127 | 2509140682 | 432 |
| 97 | iso_pu_bacteria | 2509276018 | 2509368469 | 432 |
| 98 | iso_pu_bacteria | 2509276019 | 2509378946 | 432 |
| 99 | iso_pu_bacteria | 2509276021 | 2509389781 | 432 |
| 100 | iso_pu_bacteria | 2509276022 | 2509393565 | 432 |
| 101 | iso_pu_bacteria | 2509276033 | 2509447965 | 432 |
| 102 | iso_pu_bacteria | 2510065019 | 2510134903 | 432 |
| 103 | iso_pu_bacteria | 2510065057 | 2510303744 | 432 |
| 104 | iso_pu_bacteria | 2510065059 | 2510314751 | 432 |
| 105 | iso_pu_bacteria | 2510461076 | 2510896314 | 432 |
| 106 | iso_pu_bacteria | 2510917022 | 2511136506 | 432 |
| 107 | iso_pu_bacteria | 2510917028 | 2511187244 | 432 |
| 108 | iso_pu_bacteria | 2510917030 | 2511195946 | 432 |
| 109 | iso_pu_bacteria | 2511231027 | 2511391679 | 432 |
| 110 | iso_pu_bacteria | 2511231052 | 2511503041 | 432 |
| 111 | iso_pu_bacteria | 2512047086 | 2512534305 | 432 |
| 112 | iso_pu_bacteria | 2512875016 | 2512934087 | 432 |
| 113 | iso_pu_bacteria | 2512875024 | 2512960705 | 432 |
| 114 | iso_pu_bacteria | 2512875024 | 2512962377 | 432 |
| 115 | iso_pu_bacteria | 2512875026 | 2512973874 | 432 |
| 116 | iso_pu_bacteria | 2513237084 | 2513572666 | 432 |
| 117 | iso_pu_bacteria | 2513237085 | 2513580102 | 432 |
| 118 | iso_pu_bacteria | 2513237086 | 2513585986 | 432 |
| 119 | iso_pu_bacteria | 2513237088 | 2513599852 | 432 |
| 120 | iso_pu_bacteria | 2513237089 | 2513602409 | 432 |
| 121 | iso_pu_bacteria | 2513237090 | 2513613455 | 432 |
| 122 | iso_pu_bacteria | 2513237091 | 2513617210 | 432 |
| 123 | iso_pu_bacteria | 2513237093 | 2513631258 | 432 |
| 124 | iso_pu_bacteria | 2513237103 | 2513710847 | 432 |
| 125 | iso_pu_bacteria | 2513237138 | 2513867019 | 432 |
| 126 | iso_pu_bacteria | 2513237140 | 2513882951 | 432 |
| 127 | iso_pu_bacteria | 2513237143 | 2513902980 | 432 |
| 128 | iso_pu_bacteria | 2513237144 | 2513908124 | 432 |
| 129 | iso_pu_bacteria | 2513237146 | 2513927006 | 432 |
| 130 | iso_pu_bacteria | 2513237156 | 2513985719 | 432 |
| 131 | iso_pu_bacteria | 2513237159 | 2513998144 | 432 |
| 132 | iso_pu_bacteria | 2513237160 | 2514004052 | 432 |
| 133 | iso_pu_bacteria | 2513237162 | 2514023204 | 432 |
| 134 | iso_pu_bacteria | 2513237164 | 2514038663 | 432 |
| 135 | iso_pu_bacteria | 2513237305 | 2514419209 | 432 |
| 136 | iso_pu_bacteria | 2513237351 | 2514587318 | 432 |
| 137 | iso_pu_bacteria | 2515075009 | 2515113986 | 432 |
| 138 | iso_pu_bacteria | 2515154107 | 2515610275 | 432 |
| 139 | iso_pu_bacteria | 2515154113 | 2515639179 | 432 |
| 140 | iso_pu_bacteria | 2515154114 | 2515642967 | 432 |
| 141 | iso_pu_bacteria | 2515154116 | 2515656713 | 432 |
| 142 | iso_pu_bacteria | 2515154134 | 2515743656 | 432 |
| 143 | iso_pu_bacteria | 2516143018 | 2516205305 | 432 |
| 144 | iso_pu_bacteria | 2516653046 | 2516894445 | 432 |
| 145 | iso_pu_bacteria | 2516653077 | 2517037618 | 432 |
| 146 | iso_pu_bacteria | 2516653085 | 2517077905 | 432 |
| 147 | iso_pu_bacteria | 2517093000 | 2517096701 | 432 |
| 148 | iso_pu_bacteria | 2517287029 | 2517410416 | 432 |
| 149 | iso_pu_bacteria | 2517487022 | 2517571064 | 432 |
| 150 | iso_pu_bacteria | 2519899620 | 2520381351 | 432 |
| 151 | iso_pu_bacteria | 2524023207 | 2524451928 | 432 |
| 152 | iso_pu_bacteria | 2524023209 | 2524460018 | 432 |
| 153 | iso_pu_bacteria | 2529292951 | 2530647014 | 432 |
| 154 | iso_pu_bacteria | 2534681796 | 2535519357 | 432 |
| 155 | iso_pu_bacteria | 2537561587 | 2537876144 | 432 |
| 156 | iso_pu_bacteria | 2551306084 | 2551679856 | 432 |
| 157 | iso_pu_bacteria | 2551306085 | 2551689726 | 432 |
| 158 | iso_pu_bacteria | 2551306086 | 2551692475 | 432 |
| 159 | iso_pu_bacteria | 2551306087 | 2551698140 | 432 |
| 160 | iso_pu_bacteria | 2551306089 | 2551708896 | 432 |
| 161 | iso_pu_bacteria | 2551306090 | 2551717118 | 432 |
| 162 | iso_pu_bacteria | 2551306091 | 2551724651 | 432 |
| 163 | iso_pu_bacteria | 2551306093 | 2551745716 | 432 |
| 164 | iso_pu_bacteria | 2554235003 | 2554244536 | 432 |
| 165 | iso_pu_bacteria | 2558860100 | 2558860458 | 432 |
| 166 | iso_pu_bacteria | 2558860242 | 2559297622 | 432 |
| 167 | iso_pu_bacteria | 2582581294 | 2585202402 | 432 |
| 168 | iso_pu_bacteria | 2582581298 | 2585224718 | 432 |
| 169 | iso_pu_bacteria | 2582581299 | 2585227892 | 432 |
| 170 | iso_pu_bacteria | 2582581304 | 2585255528 | 432 |
| 171 | iso_pu_bacteria | 2582581307 | 2585274335 | 432 |
| 172 | iso_pu_bacteria | 2582581308 | 2585280252 | 432 |
| 173 | iso_pu_bacteria | 2582581315 | 2585322529 | 432 |
| 174 | iso_pu_bacteria | 2582581316 | 2585335143 | 432 |
| 175 | iso_pu_bacteria | 2582581866 | 2585392486 | 432 |
| 176 | iso_pu_bacteria | 2582581867 | 2585402294 | 432 |
| 177 | iso_pu_bacteria | 2585427526 | 2585529017 | 432 |
| 178 | iso_pu_bacteria | 2585427527 | 2585532481 | 432 |
| 179 | iso_pu_bacteria | 2585427528 | 2585540958 | 432 |
| 180 | iso_pu_bacteria | 2585427529 | 2585547274 | 432 |
| 181 | iso_pu_bacteria | 2585427530 | 2585554502 | 432 |
| 182 | iso_pu_bacteria | 2585427531 | 2585560784 | 432 |
| 183 | iso_pu_bacteria | 2585427590 | 2585822406 | 432 |
| 184 | iso_pu_bacteria | 2585427593 | 2585839720 | 432 |
| 185 | iso_pu_bacteria | 2585427594 | 2585845458 | 432 |
| 186 | iso_pu_bacteria | 2585427608 | 2585898985 | 432 |
| 187 | iso_pu_bacteria | 2585427609 | 2585903421 | 432 |
| 188 | iso_pu_bacteria | 2585427633 | 2585997222 | 432 |
| 189 | iso_pu_bacteria | 2585427634 | 2586001823 | 432 |
| 190 | iso_pu_bacteria | 2585428125 | 2587981460 | 432 |
| 191 | iso_pu_bacteria | 2588253730 | 2588520228 | 432 |
| 192 | iso_pu_bacteria | 2599185170 | 2599420500 | 432 |
| 193 | iso_pu_bacteria | 2599185210 | 2599606206 | 432 |
| 194 | iso_pu_bacteria | 2599185236 | 2599720051 | 432 |
| 195 | iso_pu_bacteria | 2599185301 | 2599935402 | 432 |
| 196 | iso_pu_bacteria | 2599185352 | 2600194145 | 432 |
| 197 | iso_pu_bacteria | 2600254933 | 2600373583 | 432 |
| 198 | iso_pu_bacteria | 2600255279 | 2601612417 | 432 |
| 199 | iso_pu_bacteria | 2600255308 | 2601748958 | 432 |
| 200 | iso_pu_bacteria | 2615840624 | 2616295621 | 432 |
| 201 | iso_pu_bacteria | 2615840626 | 2616307448 | 432 |
| 202 | iso_pu_bacteria | 2615840698 | 2616554992 | 432 |
| 203 | iso_pu_bacteria | 2617270742 | 2617383447 | 432 |
| 204 | iso_pu_bacteria | 2643221550 | 2643772387 | 432 |
| 205 | iso_pu_bacteria | 2643221551 | 2643774494 | 432 |
| 206 | iso_pu_bacteria | 2643221555 | 2643792939 | 432 |
| 207 | iso_pu_bacteria | 2643221557 | 2643809713 | 432 |
| 208 | iso_pu_bacteria | 2643221558 | 2643813296 | 432 |
| 209 | iso_pu_bacteria | 2643221564 | 2643838305 | 432 |
| 210 | iso_pu_bacteria | 2643221568 | 2643856410 | 432 |
| 211 | iso_pu_bacteria | 2643221582 | 2643922259 | 432 |
| 212 | iso_pu_bacteria | 2643221595 | 2643983850 | 432 |
| 213 | iso_pu_bacteria | 2643221599 | 2644006522 | 432 |
| 214 | iso_pu_bacteria | 2643221610 | 2644063893 | 432 |
| 215 | iso_pu_bacteria | 2643221618 | 2644106618 | 432 |
| 216 | iso_pu_bacteria | 2643221623 | 2644133403 | 432 |
| 217 | iso_pu_bacteria | 2643221626 | 2644149590 | 432 |
| 218 | iso_pu_bacteria | 2643221627 | 2644155982 | 432 |
| 219 | iso_pu_bacteria | 2643221634 | 2644195965 | 432 |
| 220 | iso_pu_bacteria | 2643221639 | 2644218088 | 432 |
| 221 | iso_pu_bacteria | 2643221643 | 2644241938 | 432 |
| 222 | iso_pu_bacteria | 2643221646 | 2644260892 | 432 |
| 223 | iso_pu_bacteria | 2643221653 | 2644299303 | 432 |
| 224 | iso_pu_bacteria | 2643221655 | 2644309692 | 432 |
| 225 | iso_pu_bacteria | 2643221659 | 2644333363 | 432 |
| 226 | iso_pu_bacteria | 2643221668 | 2644381415 | 432 |
| 227 | iso_pu_bacteria | 2643221675 | 2644415726 | 432 |
| 228 | iso_pu_bacteria | 2643221680 | 2644448766 | 432 |
| 229 | iso_pu_bacteria | 2643221693 | 2644522724 | 432 |
| 230 | iso_pu_bacteria | 2643221698 | 2644543547 | 432 |
| 231 | iso_pu_bacteria | 2643221712 | 2644618139 | 432 |
| 232 | iso_pu_bacteria | 2643221719 | 2644657531 | 432 |
| 233 | iso_pu_bacteria | 2643221723 | 2644676686 | 432 |
| 234 | iso_pu_bacteria | 2643221726 | 2644686840 | 432 |
| 235 | iso_pu_bacteria | 2657244999 | 2657684463 | 432 |
| 236 | iso_pu_bacteria | 2667528174 | 2671112240 | 432 |
| 237 | iso_pu_bacteria | 2687453392 | 2688595723 | 432 |
| 238 | iso_pu_bacteria | 2693429783 | 2694628110 | 432 |
| 239 | iso_pu_bacteria | 2693429784 | 2694641033 | 432 |
| 240 | iso_pu_bacteria | 2718217882 | 2719182655 | 432 |
| 241 | iso_pu_bacteria | 2718217927 | 2719387326 | 432 |
| 242 | iso_pu_bacteria | 2718217997 | 2719666971 | 432 |
| 243 | iso_pu_bacteria | 2718218009 | 2719733373 | 432 |
| 244 | iso_pu_bacteria | 2718218199 | 2720493391 | 432 |
| 245 | iso_pu_bacteria | 2718218232 | 2720614862 | 432 |
| 246 | iso_pu_bacteria | 2718218233 | 2720621635 | 432 |
| 247 | iso_pu_bacteria | 2718218235 | 2720632963 | 432 |
| 248 | iso_pu_bacteria | 2718218269 | 2720776687 | 432 |
| 249 | iso_pu_bacteria | 2718218363 | 2721148768 | 432 |
| 250 | iso_pu_bacteria | 2718218365 | 2721160152 | 432 |
| 251 | iso_pu_bacteria | 2718218366 | 2721165581 | 432 |
| 252 | iso_pu_bacteria | 2718218423 | 2721400961 | 432 |
| 253 | iso_pu_bacteria | 2721755514 | 2722841751 | 432 |
| 254 | iso_pu_bacteria | 2721755556 | 2723028275 | 432 |
| 255 | iso_pu_bacteria | 2721755684 | 2723561903 | 432 |
| 256 | iso_pu_bacteria | 2721755685 | 2723568535 | 432 |
| 257 | iso_pu_bacteria | 2721755686 | 2723572869 | 432 |
| 258 | iso_pu_bacteria | 2721755809 | 2724039774 | 432 |
| 259 | iso_pu_bacteria | 2721755810 | 2724046129 | 432 |
| 260 | iso_pu_bacteria | 2721755819 | 2724091294 | 432 |
| 261 | iso_pu_bacteria | 2721755822 | 2724105800 | 432 |
| 262 | iso_pu_bacteria | 2721755823 | 2724111626 | 432 |
| 263 | iso_pu_bacteria | 2724679232 | 2725945406 | 432 |
| 264 | iso_pu_bacteria | 2728369352 | 2730109211 | 432 |
| 265 | iso_pu_bacteria | 2728369365 | 2730165890 | 432 |
| 266 | iso_pu_bacteria | 2728369397 | 2730299784 | 432 |
| 267 | iso_pu_bacteria | 2738541293 | 2738804794 | 432 |
| 268 | iso_pu_bacteria | 2738541317 | 2738944564 | 432 |
| 269 | iso_pu_bacteria | 2738541333 | 2739035515 | 432 |
| 270 | iso_pu_bacteria | 2738543024 | 2739309492 | 432 |
| 271 | iso_pu_bacteria | 2751185821 | 2753461031 | 432 |
| 272 | iso_pu_bacteria | 2756170246 | 2756674792 | 432 |
| 273 | iso_pu_bacteria | 2757320392 | 2757572454 | 432 |
| 274 | iso_pu_bacteria | 2765235802 | 2765467761 | 432 |
| 275 | iso_pu_bacteria | 2765235942 | 2766065262 | 432 |
| 276 | iso_pu_bacteria | 2767802442 | 2770197837 | 432 |
| 277 | iso_pu_bacteria | 2775506902 | 2776269087 | 432 |
| 278 | iso_pu_bacteria | 2775506904 | 2776283774 | 432 |
| 279 | iso_pu_bacteria | 2775507049 | 2776914626 | 432 |
| 280 | iso_pu_bacteria | 2775507266 | 2778176059 | 432 |
| 281 | iso_pu_bacteria | 2791355082 | 2792582505 | 432 |
| 282 | iso_pu_bacteria | 2791355091 | 2792624331 | 432 |
| 283 | iso_pu_bacteria | 2791355094 | 2792642777 | 432 |
| 284 | iso_pu_bacteria | 2791355123 | 2792746906 | 432 |
| 285 | iso_pu_bacteria | 2791355256 | 2793293564 | 432 |
| 286 | iso_pu_bacteria | 2791355259 | 2793313017 | 432 |
| 287 | iso_pu_bacteria | 2791355260 | 2793319664 | 432 |
| 288 | iso_pu_bacteria | 2791355261 | 2793327837 | 432 |
| 289 | iso_pu_bacteria | 2791355262 | 2793333451 | 432 |
| 290 | iso_pu_bacteria | 2791355263 | 2793342028 | 432 |
| 291 | iso_pu_bacteria | 2791355264 | 2793347429 | 432 |
| 292 | iso_pu_bacteria | 2791355265 | 2793353760 | 432 |
| 293 | iso_pu_bacteria | 2791355266 | 2793359640 | 432 |
| 294 | iso_pu_bacteria | 2791355267 | 2793369390 | 432 |
| 295 | iso_pu_bacteria | 2802428858 | 2802717846 | 432 |
| 296 | iso_pu_bacteria | 2802428859 | 2802725303 | 432 |
| 297 | iso_pu_bacteria | 2802428860 | 2802730573 | 432 |
| 298 | iso_pu_bacteria | 2802428861 | 2802737920 | 432 |
| 299 | iso_pu_bacteria | 2802428862 | 2802744210 | 432 |
| 300 | iso_pu_bacteria | 2802428863 | 2802753105 | 432 |
| 301 | iso_pu_bacteria | 2802429268 | 2804753366 | 432 |
| 302 | iso_pu_bacteria | 2802429605 | 2805929465 | 432 |
| 303 | iso_pu_bacteria | 2802429606 | 2805935354 | 432 |
| 304 | iso_pu_bacteria | 2802429633 | 2806044501 | 432 |
| 305 | iso_pu_bacteria | 2802429634 | 2806052702 | 432 |
| 306 | iso_pu_bacteria | 2802429635 | 2806059002 | 432 |
| 307 | iso_pu_bacteria | 2802429636 | 2806068335 | 432 |
| 308 | iso_pu_bacteria | 2802429637 | 2806074455 | 432 |
| 309 | iso_pu_bacteria | 2808606387 | 2808989131 | 432 |
| 310 | iso_pu_bacteria | 2818991272 | 2819243872 | 432 |
| 311 | iso_pu_bacteria | 2818991439 | 2819557670 | 432 |
| 312 | iso_pu_bacteria | 2818991448 | 2819609553 | 432 |
| 313 | iso_pu_bacteria | 2818991453 | 2819639651 | 432 |
| 314 | iso_pu_bacteria | 2818991461 | 2819686497 | 432 |
| 315 | iso_pu_bacteria | 2821123053 | 2821126225 | 432 |
| 316 | iso_pu_bacteria | 2837651117 | 2837651873 | 432 |
| 317 | iso_pu_bacteria | 2837678835 | 2837681621 | 432 |
| 318 | iso_pu_bacteria | 2838016132 | 2838019167 | 432 |
| 319 | iso_pu_bacteria | 2838022645 | 2838024242 | 432 |
| 320 | iso_pu_bacteria | 2838029111 | 2838033180 | 432 |
| 321 | iso_pu_bacteria | 2838035591 | 2838040828 | 432 |
| 322 | iso_pu_bacteria | 2838042994 | 2838047418 | 432 |
| 323 | iso_pu_bacteria | 2838048938 | 2838051114 | 432 |
| 324 | iso_pu_bacteria | 2838061910 | 2838063907 | 432 |
| 325 | iso_pu_bacteria | 2838068647 | 2838073392 | 432 |
| 326 | iso_pu_bacteria | 2838074704 | 2838077489 | 432 |
| 327 | iso_pu_bacteria | 2838661181 | 2838664781 | 432 |
| 328 | iso_pu_bacteria | 2838668709 | 2838671075 | 432 |
| 329 | iso_pu_bacteria | 2838675328 | 2838679947 | 432 |
| 330 | iso_pu_bacteria | 2838680041 | 2838684896 | 432 |
| 331 | iso_pu_bacteria | 2838686498 | 2838691259 | 432 |
| 332 | iso_pu_bacteria | 2838694306 | 2838699267 | 432 |
| 333 | iso_pu_bacteria | 2838701080 | 2838703746 | 432 |
| 334 | iso_pu_bacteria | 2838707686 | 2838712748 | 432 |
| 335 | iso_pu_bacteria | 2838714209 | 2838717744 | 432 |
| 336 | iso_pu_bacteria | 2838719591 | 2838724518 | 432 |
| 337 | iso_pu_bacteria | 2838724970 | 2838729540 | 432 |
| 338 | iso_pu_bacteria | 2838729681 | 2838735742 | 432 |
| 339 | iso_pu_bacteria | 2838736955 | 2838737301 | 432 |
| 340 | iso_pu_bacteria | 2838742623 | 2838748644 | 432 |
| 341 | iso_pu_bacteria | 2839993093 | 2839993735 | 432 |
| 342 | iso_pu_bacteria | 2840764183 | 2840766762 | 432 |
| 343 | iso_pu_bacteria | 2841734538 | 2841736143 | 432 |
| 344 | iso_pu_bacteria | 2841840854 | 2841842330 | 432 |
| 345 | iso_pu_bacteria | 2841846520 | 2841849977 | 432 |
| 346 | iso_pu_bacteria | 2841851746 | 2841853921 | 432 |
| 347 | iso_pu_bacteria | 2841859092 | 2841864257 | 432 |
| 348 | iso_pu_bacteria | 2841864319 | 2841868111 | 432 |
| 349 | iso_pu_bacteria | 2842077413 | 2842082225 | 432 |
| 350 | iso_pu_bacteria | 2842110456 | 2842113374 | 432 |
| 351 | iso_pu_bacteria | 2842118031 | 2842123150 | 432 |
| 352 | iso_pu_bacteria | 2842124991 | 2842128449 | 432 |
| 353 | iso_pu_bacteria | 2842130223 | 2842134629 | 432 |
| 354 | iso_pu_bacteria | 2842140634 | 2842142109 | 432 |
| 355 | iso_pu_bacteria | 2842146304 | 2842151255 | 432 |
| 356 | iso_pu_bacteria | 2842152218 | 2842156539 | 432 |
| 357 | iso_pu_bacteria | 2842156927 | 2842162561 | 432 |
| 358 | iso_pu_bacteria | 2842163707 | 2842170011 | 432 |
| 359 | iso_pu_bacteria | 2842170452 | 2842173989 | 432 |
| 360 | iso_pu_bacteria | 2842175837 | 2842180160 | 432 |
| 361 | iso_pu_bacteria | 2842180545 | 2842184998 | 432 |
| 362 | iso_pu_bacteria | 2842187318 | 2842192159 | 432 |
| 363 | iso_pu_bacteria | 2842192696 | 2842198200 | 432 |
| 364 | iso_pu_bacteria | 2842198810 | 2842199784 | 432 |
| 365 | iso_pu_bacteria | 2842205361 | 2842208376 | 432 |
| 366 | iso_pu_bacteria | 2842211629 | 2842216561 | 432 |
| 367 | iso_pu_bacteria | 2842217011 | 2842220016 | 432 |
| 368 | iso_pu_bacteria | 2842224351 | 2842229195 | 432 |
| 369 | iso_pu_bacteria | 2842229732 | 2842235629 | 432 |
| 370 | iso_pu_bacteria | 2842237096 | 2842241950 | 432 |
| 371 | iso_pu_bacteria | 2842243621 | 2842249337 | 432 |
| 372 | iso_pu_bacteria | 2842250916 | 2842256311 | 432 |
| 373 | iso_pu_bacteria | 2842257432 | 2842263526 | 432 |
| 374 | iso_pu_bacteria | 2842264693 | 2842266667 | 432 |
| 375 | iso_pu_bacteria | 2842271015 | 2842275734 | 432 |
| 376 | iso_pu_bacteria | 2842278818 | 2842281615 | 432 |
| 377 | iso_pu_bacteria | 2842285085 | 2842288738 | 432 |
| 378 | iso_pu_bacteria | 2842291075 | 2842296226 | 432 |
| 379 | iso_pu_bacteria | 2842298080 | 2842298758 | 432 |
| 380 | iso_pu_bacteria | 2842304105 | 2842308282 | 432 |
| 381 | iso_pu_bacteria | 2842311132 | 2842316437 | 432 |
| 382 | iso_pu_bacteria | 2842317721 | 2842321324 | 432 |
| 383 | iso_pu_bacteria | 2842341865 | 2842345069 | 432 |
| 384 | iso_pu_bacteria | 2842357229 | 2842359374 | 432 |
| 385 | iso_pu_bacteria | 2842363717 | 2842369185 | 432 |
| 386 | iso_pu_bacteria | 2842370503 | 2842375572 | 432 |
| 387 | iso_pu_bacteria | 2842377471 | 2842382626 | 432 |
| 388 | iso_pu_bacteria | 2842384541 | 2842390027 | 432 |
| 389 | iso_pu_bacteria | 2842395702 | 2842398449 | 432 |
| 390 | iso_pu_bacteria | 2842402390 | 2842406595 | 432 |
| 391 | iso_pu_bacteria | 2842409023 | 2842412978 | 432 |
| 392 | iso_pu_bacteria | 2842415677 | 2842419621 | 432 |
| 393 | iso_pu_bacteria | 2842422224 | 2842427027 | 432 |
| 394 | iso_pu_bacteria | 2842428310 | 2842429986 | 432 |
| 395 | iso_pu_bacteria | 2842434925 | 2842436354 | 432 |
| 396 | iso_pu_bacteria | 2842441272 | 2842444057 | 432 |
| 397 | iso_pu_bacteria | 2842447887 | 2842451090 | 432 |
| 398 | iso_pu_bacteria | 2842462802 | 2842464407 | 432 |
| 399 | iso_pu_bacteria | 2842469257 | 2842470683 | 432 |
| 400 | iso_pu_bacteria | 2842475841 | 2842479913 | 432 |
| 401 | iso_pu_bacteria | 2842482326 | 2842483340 | 432 |
| 402 | iso_pu_bacteria | 2842489311 | 2842493338 | 432 |
| 403 | iso_pu_bacteria | 2842495871 | 2842499090 | 432 |
| 404 | iso_pu_bacteria | 2842502639 | 2842507089 | 432 |
| 405 | iso_pu_bacteria | 2842509118 | 2842510786 | 432 |
| 406 | iso_pu_bacteria | 2842515876 | 2842520996 | 432 |
| 407 | iso_pu_bacteria | 2842521101 | 2842523249 | 432 |
| 408 | iso_pu_bacteria | 2842871566 | 2842875265 | 432 |
| 409 | iso_pu_bacteria | 2844002411 | 2844003732 | 432 |
| 410 | iso_pu_bacteria | 2844009547 | 2844010530 | 432 |
| 411 | iso_pu_bacteria | 2844163670 | 2844167670 | 432 |
| 412 | iso_pu_bacteria | 2844454524 | 2844457433 | 432 |
| 413 | iso_pu_bacteria | 2847417321 | 2847420500 | 432 |
| 414 | iso_pu_bacteria | 2847670302 | 2847673238 | 432 |
| 415 | iso_pu_bacteria | 2847686936 | 2847689749 | 432 |
| 416 | iso_pu_bacteria | 2848992105 | 2848995372 | 432 |
| 417 | iso_pu_bacteria | 2850079185 | 2850082357 | 432 |
| 418 | iso_pu_bacteria | 2852387548 | 2852391273 | 432 |
| 419 | iso_pu_bacteria | 2854896431 | 2854897340 | 432 |
| 420 | iso_pu_bacteria | 2854916844 | 2854921526 | 432 |
| 421 | iso_pu_bacteria | 2855825444 | 2855827081 | 432 |
| 422 | iso_pu_bacteria | 2855839649 | 2855842478 | 432 |
| 423 | iso_pu_bacteria | 2855872281 | 2855878373 | 432 |
| 424 | iso_pu_bacteria | 2856314179 | 2856319293 | 432 |
| 425 | iso_pu_bacteria | 2856320880 | 2856322102 | 432 |
| 426 | iso_pu_bacteria | 2856320880 | 2856322195 | 432 |
| 427 | iso_pu_bacteria | 2856328259 | 2856332790 | 432 |
| 428 | iso_pu_bacteria | 2856334872 | 2856335790 | 432 |
| 429 | iso_pu_bacteria | 2856342000 | 2856342769 | 432 |
| 430 | iso_pu_bacteria | 2856349417 | 2856351911 | 432 |
| 431 | iso_pu_bacteria | 2856356410 | 2856363804 | 432 |
| 432 | iso_pu_bacteria | 2856364286 | 2856370126 | 432 |
| 433 | iso_pu_bacteria | 2857349434 | 2857352690 | 432 |
| 434 | iso_pu_bacteria | 2857367948 | 2857369137 | 432 |
| 435 | iso_pu_bacteria | 2857516855 | 2857518842 | 432 |
| 436 | iso_pu_bacteria | 2857531043 | 2857532786 | 432 |
| 437 | iso_pu_bacteria | 2858800743 | 2858803294 | 432 |
| 438 | iso_pu_bacteria | 2869162929 | 2869164826 | 432 |
| 439 | iso_pu_bacteria | 2869169390 | 2869171999 | 432 |
| 440 | iso_pu_bacteria | 2869234852 | 2869242030 | 432 |
| 441 | iso_pu_bacteria | 2869242130 | 2869248778 | 432 |
| 442 | iso_pu_bacteria | 2869249662 | 2869251596 | 432 |
| 443 | iso_pu_bacteria | 2869256925 | 2869259990 | 432 |
| 444 | iso_pu_bacteria | 2869264136 | 2869266239 | 432 |
| 445 | iso_pu_bacteria | 2869271264 | 2869274101 | 432 |
| 446 | iso_pu_bacteria | 2869278585 | 2869284710 | 432 |
| 447 | iso_pu_bacteria | 2869285874 | 2869290922 | 432 |
| 448 | iso_pu_bacteria | 2871429161 | 2871433204 | 432 |
| 449 | iso_pu_bacteria | 2871435913 | 2871441727 | 432 |
| 450 | iso_pu_bacteria | 2871451962 | 2871453391 | 432 |
| 451 | iso_pu_bacteria | 2871459585 | 2871466710 | 432 |
| 452 | iso_pu_bacteria | 2871466892 | 2871470205 | 432 |
| 453 | iso_pu_bacteria | 2871474448 | 2871478952 | 432 |
| 454 | iso_pu_bacteria | 2871488783 | 2871491097 | 432 |
| 455 | iso_pu_bacteria | 2871495908 | 2871500841 | 432 |
| 456 | iso_pu_bacteria | 2874102143 | 2874102176 | 432 |
| 457 | iso_pu_bacteria | 2874109183 | 2874113427 | 432 |
| 458 | iso_pu_bacteria | 2874116593 | 2874123441 | 432 |
| 459 | iso_pu_bacteria | 2874123672 | 2874131489 | 432 |
| 460 | iso_pu_bacteria | 2874131515 | 2874137401 | 432 |
| 461 | iso_pu_bacteria | 2874139085 | 2874139601 | 432 |
| 462 | iso_pu_bacteria | 2874139085 | 2874142970 | 432 |
| 463 | iso_pu_bacteria | 2874146452 | 2874153635 | 432 |
| 464 | iso_pu_bacteria | 2874155637 | 2874160900 | 432 |
| 465 | iso_pu_bacteria | 2874162495 | 2874168412 | 432 |
| 466 | iso_pu_bacteria | 2874168670 | 2874172132 | 432 |
| 467 | iso_pu_bacteria | 2876363079 | 2876363655 | 432 |
| 468 | iso_pu_bacteria | 2876369609 | 2876372654 | 432 |
| 469 | iso_pu_bacteria | 2876377896 | 2876380127 | 432 |
| 470 | iso_pu_bacteria | 2876386047 | 2876391280 | 432 |
| 471 | iso_pu_bacteria | 2876392853 | 2876397275 | 432 |
| 472 | iso_pu_bacteria | 2876399893 | 2876404107 | 432 |
| 473 | iso_pu_bacteria | 2876406927 | 2876412539 | 432 |
| 474 | iso_pu_bacteria | 2876413966 | 2876418940 | 432 |
| 475 | iso_pu_bacteria | 2876420981 | 2876421441 | 432 |
| 476 | iso_pu_bacteria | 2878035449 | 2878039682 | 432 |
| 477 | iso_pu_bacteria | 2878730984 | 2878733171 | 432 |
| 478 | iso_pu_bacteria | 2878738818 | 2878740961 | 432 |
| 479 | iso_pu_bacteria | 2878745973 | 2878750817 | 432 |
| 480 | iso_pu_bacteria | 2878753008 | 2878755506 | 432 |
| 481 | iso_pu_bacteria | 2878760144 | 2878764910 | 432 |
| 482 | iso_pu_bacteria | 2878767105 | 2878772032 | 432 |
| 483 | iso_pu_bacteria | 2878774303 | 2878779051 | 432 |
| 484 | iso_pu_bacteria | 2878781027 | 2878783684 | 432 |
| 485 | iso_pu_bacteria | 2881147464 | 2881147958 | 432 |
| 486 | iso_pu_bacteria | 2881155292 | 2881158995 | 432 |
| 487 | iso_pu_bacteria | 2881161766 | 2881164742 | 432 |
| 488 | iso_pu_bacteria | 2881845957 | 2881847220 | 432 |
| 489 | iso_pu_bacteria | 2881853255 | 2881857901 | 432 |
| 490 | iso_pu_bacteria | 2881861095 | 2881864017 | 432 |
| 491 | iso_pu_bacteria | 2882632389 | 2882634758 | 432 |
| 492 | iso_pu_bacteria | 2882912400 | 2882914726 | 432 |
| 493 | iso_pu_bacteria | 2885305155 | 2885306575 | 432 |
| 494 | iso_pu_bacteria | 2885312484 | 2885314402 | 432 |
| 495 | iso_pu_bacteria | 2885318864 | 2885324361 | 432 |
| 496 | iso_pu_bacteria | 2885326080 | 2885332383 | 432 |
| 497 | iso_pu_bacteria | 2885334103 | 2885336769 | 432 |
| 498 | iso_pu_bacteria | 2885342637 | 2885346540 | 432 |
| 499 | iso_pu_bacteria | 2885350715 | 2885352488 | 432 |
| 500 | iso_pu_bacteria | 2888337043 | 2888343434 | 432 |
| 501 | iso_pu_bacteria | 2888343758 | 2888344108 | 432 |
| 502 | iso_pu_bacteria | 2888350351 | 2888352876 | 432 |
| 503 | iso_pu_bacteria | 2889010040 | 2889014648 | 432 |
| 504 | iso_pu_bacteria | 2889016732 | 2889020365 | 432 |
| 505 | iso_pu_bacteria | 2889790730 | 2889792612 | 432 |
| 506 | iso_pu_bacteria | 2889914905 | 2889919160 | 432 |
| 507 | iso_pu_bacteria | 2891048133 | 2891049270 | 432 |
| 508 | iso_pu_bacteria | 2891373044 | 2891377467 | 432 |
| 509 | iso_pu_bacteria | 2894652903 | 2894653317 | 432 |
| 510 | iso_pu_bacteria | 2896384573 | 2896387665 | 432 |
| 511 | iso_pu_bacteria | 2899792073 | 2899793140 | 432 |
| 512 | iso_pu_bacteria | 2899803654 | 2899805195 | 432 |
| 513 | iso_pu_bacteria | 2899845264 | 2899849656 | 432 |
| 514 | iso_pu_bacteria | 2903448605 | 2903454260 | 432 |
| 515 | iso_pu_bacteria | 2903492973 | 2903499019 | 432 |
| 516 | iso_pu_bacteria | 2903492973 | 2903501473 | 432 |
| 517 | iso_pu_bacteria | 2903513507 | 2903520959 | 432 |
| 518 | iso_pu_bacteria | 2903521522 | 2903523284 | 432 |
| 519 | iso_pu_bacteria | 2903528002 | 2903529323 | 432 |
| 520 | iso_pu_bacteria | 2903540706 | 2903545654 | 432 |
| 521 | iso_pu_bacteria | 2904578770 | 2904579558 | 432 |
| 522 | iso_pu_bacteria | 2904659560 | 2904664029 | 432 |
| 523 | iso_pu_bacteria | 2906308376 | 2906313742 | 432 |
| 524 | iso_pu_bacteria | 2906321335 | 2906326451 | 432 |
| 525 | iso_pu_bacteria | 2906328253 | 2906334944 | 432 |
| 526 | iso_pu_bacteria | 2906354277 | 2906360214 | 432 |
| 527 | iso_pu_bacteria | 2906363423 | 2906369157 | 432 |
| 528 | iso_pu_bacteria | 2906370794 | 2906373322 | 432 |
| 529 | iso_pu_bacteria | 2906378014 | 2906382074 | 432 |
| 530 | iso_pu_bacteria | 2906386501 | 2906388186 | 432 |
| 531 | iso_pu_bacteria | 2906393657 | 2906396680 | 432 |
| 532 | iso_pu_bacteria | 2906401398 | 2906405255 | 432 |
| 533 | iso_pu_bacteria | 2906408224 | 2906409384 | 432 |
| 534 | iso_pu_bacteria | 2906414383 | 2906419365 | 432 |
| 535 | iso_pu_bacteria | 2913295892 | 2913299883 | 432 |
| 536 | iso_pu_bacteria | 2913308742 | 2913309184 | 432 |
| 537 | iso_pu_bacteria | 2915980308 | 2915980613 | 432 |
| 538 | iso_pu_bacteria | 2915986958 | 2915991089 | 432 |
| 539 | iso_pu_bacteria | 2915993759 | 2915994893 | 432 |
| 540 | iso_pu_bacteria | 2916000859 | 2916006965 | 432 |
| 541 | iso_pu_bacteria | 2916007675 | 2916009498 | 432 |
| 542 | iso_pu_bacteria | 2916014648 | 2916016867 | 432 |
| 543 | iso_pu_bacteria | 2916021584 | 2916027730 | 432 |
| 544 | iso_pu_bacteria | 2916028427 | 2916030257 | 432 |
| 545 | iso_pu_bacteria | 2916035215 | 2916036814 | 432 |
| 546 | iso_pu_bacteria | 2916041962 | 2916044671 | 432 |
| 547 | iso_pu_bacteria | 2916048683 | 2916052619 | 432 |
| 548 | iso_pu_bacteria | 2916055098 | 2916058383 | 432 |
| 549 | iso_pu_bacteria | 2916061851 | 2916065574 | 432 |
| 550 | iso_pu_bacteria | 2916068649 | 2916071481 | 432 |
| 551 | iso_pu_bacteria | 2916076590 | 2916080115 | 432 |
| 552 | iso_pu_bacteria | 2919100787 | 2919104630 | 432 |
| 553 | iso_pu_bacteria | 2919114240 | 2919118026 | 432 |
| 554 | iso_pu_bacteria | 2919119836 | 2919120777 | 432 |
| 555 | iso_pu_bacteria | 2919166419 | 2919169975 | 432 |
| 556 | iso_pu_bacteria | 2919171160 | 2919173517 | 432 |
| 557 | iso_pu_bacteria | 2919408235 | 2919410727 | 432 |
| 558 | iso_pu_bacteria | 2920760137 | 2920760703 | 432 |
| 559 | iso_pu_bacteria | 2920822456 | 2920828430 | 432 |
| 560 | iso_pu_bacteria | 2921201388 | 2921201465 | 432 |
| 561 | iso_pu_bacteria | 2921208531 | 2921209622 | 432 |
| 562 | iso_pu_bacteria | 2921237296 | 2921237548 | 432 |
| 563 | iso_pu_bacteria | 2921244191 | 2921244269 | 432 |
| 564 | iso_pu_bacteria | 2921250672 | 2921252553 | 432 |
| 565 | iso_pu_bacteria | 2921257292 | 2921260691 | 432 |
| 566 | iso_pu_bacteria | 2921263974 | 2921265950 | 432 |
| 567 | iso_pu_bacteria | 2921282425 | 2921287716 | 432 |
| 568 | iso_pu_bacteria | 2921289301 | 2921295721 | 432 |
| 569 | iso_pu_bacteria | 2921296804 | 2921302828 | 432 |
| 570 | iso_pu_bacteria | 2922130491 | 2922134059 | 432 |
| 571 | iso_pu_bacteria | 2922151315 | 2922151425 | 432 |
| 572 | iso_pu_bacteria | 2922158528 | 2922163286 | 432 |
| 573 | iso_pu_bacteria | 2922172374 | 2922176565 | 432 |
| 574 | iso_pu_bacteria | 2922185730 | 2922190900 | 432 |
| 575 | iso_pu_bacteria | 2923556063 | 2923558713 | 432 |
| 576 | iso_pu_bacteria | 2924144063 | 2924148768 | 432 |
| 577 | iso_pu_bacteria | 2924150972 | 2924152189 | 432 |
| 578 | iso_pu_bacteria | 2924158325 | 2924164125 | 432 |
| 579 | iso_pu_bacteria | 2924165586 | 2924166618 | 432 |
| 580 | iso_pu_bacteria | 2924172951 | 2924174407 | 432 |
| 581 | iso_pu_bacteria | 2924179722 | 2924183977 | 432 |
| 582 | iso_pu_bacteria | 2924186466 | 2924188480 | 432 |
| 583 | iso_pu_bacteria | 2924193448 | 2924193825 | 432 |
| 584 | iso_pu_bacteria | 2924200457 | 2924206648 | 432 |
| 585 | iso_pu_bacteria | 2924207177 | 2924213080 | 432 |
| 586 | iso_pu_bacteria | 2924214083 | 2924217162 | 432 |
| 587 | iso_pu_bacteria | 2924221636 | 2924224032 | 432 |
| 588 | iso_pu_bacteria | 2924228884 | 2924232031 | 432 |
| 589 | iso_pu_bacteria | 2924710171 | 2924712028 | 432 |
| 590 | iso_pu_bacteria | 2924718760 | 2924722242 | 432 |
| 591 | iso_pu_bacteria | 2924733363 | 2924736587 | 432 |
| 592 | iso_pu_bacteria | 2924741084 | 2924743244 | 432 |
| 593 | iso_pu_bacteria | 2924748358 | 2924752595 | 432 |
| 594 | iso_pu_bacteria | 2924754689 | 2924757857 | 432 |
| 595 | iso_pu_bacteria | 2924762789 | 2924762973 | 432 |
| 596 | iso_pu_bacteria | 2924776078 | 2924778562 | 432 |
| 597 | iso_pu_bacteria | 2924784321 | 2924791521 | 432 |
| 598 | iso_pu_bacteria | 2926754445 | 2926757791 | 432 |
| 599 | iso_pu_bacteria | 2926760298 | 2926764582 | 432 |
| 600 | iso_pu_bacteria | 2928521798 | 2928522350 | 432 |
| 601 | iso_pu_bacteria | 2929138655 | 2929141420 | 432 |
| 602 | iso_pu_bacteria | 2933006813 | 2933010407 | 432 |
| 603 | iso_pu_bacteria | 2933011516 | 2933011592 | 432 |
| 604 | iso_pu_bacteria | 2933016740 | 2933019914 | 432 |
| 605 | iso_pu_bacteria | 2933570622 | 2933574731 | 432 |
| 606 | iso_pu_bacteria | 2933586486 | 2933589336 | 432 |
| 607 | iso_pu_bacteria | 2933594066 | 2933597275 | 432 |
| 608 | iso_pu_bacteria | 2933599457 | 2933603478 | 432 |
| 609 | iso_pu_bacteria | 2935894831 | 2935901221 | 432 |
| 610 | iso_pu_bacteria | 2935901341 | 2935907494 | 432 |
| 611 | iso_pu_bacteria | 2936367885 | 2936374810 | 432 |
| 612 | iso_pu_bacteria | 2936375103 | 2936380502 | 432 |
| 613 | iso_pu_bacteria | 2936381700 | 2936382330 | 432 |
| 614 | iso_pu_bacteria | 2936996657 | 2937000113 | 432 |
| 615 | iso_pu_bacteria | 2937002841 | 2937006938 | 432 |
| 616 | iso_pu_bacteria | 2937009748 | 2937015408 | 432 |
| 617 | iso_pu_bacteria | 2937016420 | 2937018127 | 432 |
| 618 | iso_pu_bacteria | 2937023124 | 2937024331 | 432 |
| 619 | iso_pu_bacteria | 2937029754 | 2937032944 | 432 |
| 620 | iso_pu_bacteria | 2937036028 | 2937042274 | 432 |
| 621 | iso_pu_bacteria | 2937042894 | 2937046678 | 432 |
| 622 | iso_pu_bacteria | 2937049772 | 2937052294 | 432 |
| 623 | iso_pu_bacteria | 2937056579 | 2937063103 | 432 |
| 624 | iso_pu_bacteria | 2937063883 | 2937067538 | 432 |
| 625 | iso_pu_bacteria | 2937071275 | 2937071352 | 432 |
| 626 | iso_pu_bacteria | 2937078374 | 2937078680 | 432 |
| 627 | iso_pu_bacteria | 2937084907 | 2937090055 | 432 |
| 628 | iso_pu_bacteria | 2937091812 | 2937092941 | 432 |
| 629 | iso_pu_bacteria | 2937098957 | 2937104763 | 432 |
| 630 | iso_pu_bacteria | 2937106411 | 2937109918 | 432 |
| 631 | iso_pu_bacteria | 2937113482 | 2937114525 | 432 |
| 632 | iso_pu_bacteria | 2937119839 | 2937123747 | 432 |
| 633 | iso_pu_bacteria | 2937126314 | 2937129275 | 432 |
| 634 | iso_pu_bacteria | 2937813078 | 2937819953 | 432 |
| 635 | iso_pu_bacteria | 2937822353 | 2937826451 | 432 |
| 636 | iso_pu_bacteria | 2937836603 | 2937836624 | 432 |
| 637 | iso_pu_bacteria | 2937843397 | 2937847758 | 432 |
| 638 | iso_pu_bacteria | 2937848649 | 2937849602 | 432 |
| 639 | iso_pu_bacteria | 2937861824 | 2937864319 | 432 |
| 640 | iso_pu_bacteria | 2937868953 | 2937875696 | 432 |
| 641 | iso_pu_bacteria | 2937877337 | 2937878803 | 432 |
| 642 | iso_pu_bacteria | 2937891427 | 2937892019 | 432 |
| 643 | iso_pu_bacteria | 2937972304 | 2937974415 | 432 |
| 644 | iso_pu_bacteria | 2937980651 | 2937981635 | 432 |
| 645 | iso_pu_bacteria | 2937994558 | 2937999507 | 432 |
| 646 | iso_pu_bacteria | 2938014810 | 2938017737 | 432 |
| 647 | iso_pu_bacteria | 2941499720 | 2941501636 | 432 |
| 648 | iso_pu_bacteria | 2954011201 | 2954014228 | 432 |
| 649 | iso_pu_bacteria | 2957375807 | 2957376882 | 432 |
| 650 | iso_pu_bacteria | 2957382221 | 2957386036 | 432 |
| 651 | iso_pu_bacteria | 2957388812 | 2957390120 | 432 |
| 652 | iso_pu_bacteria | 2957395598 | 2957396816 | 432 |
| 653 | iso_pu_bacteria | 2957402308 | 2957406217 | 432 |
| 654 | iso_pu_bacteria | 2957408893 | 2957408970 | 432 |
| 655 | iso_pu_bacteria | 2957415311 | 2957422011 | 432 |
| 656 | iso_pu_bacteria | 2957422303 | 2957425565 | 432 |
| 657 | iso_pu_bacteria | 2957430029 | 2957430580 | 432 |
| 658 | iso_pu_bacteria | 2957437181 | 2957443178 | 432 |
| 659 | iso_pu_bacteria | 2957443900 | 2957444394 | 432 |
| 660 | iso_pu_bacteria | 2957450854 | 2957452731 | 432 |
| 661 | iso_pu_bacteria | 2957457609 | 2957459403 | 432 |
| 662 | iso_pu_bacteria | 2957464669 | 2957468244 | 432 |
| 663 | iso_pu_bacteria | 2957471148 | 2957471910 | 432 |
| 664 | iso_pu_bacteria | 2957478035 | 2957480971 | 432 |
| 665 | iso_pu_bacteria | 2957484790 | 2957485545 | 432 |
| 666 | iso_pu_bacteria | 2957491536 | 2957495224 | 432 |
| 667 | iso_pu_bacteria | 2957498199 | 2957500275 | 432 |
| 668 | iso_pu_bacteria | 2957505466 | 2957507007 | 432 |
| 669 | iso_pu_bacteria | 2958034702 | 2958041435 | 432 |
| 670 | iso_pu_bacteria | 2958041894 | 2958042409 | 432 |
| 671 | iso_pu_bacteria | 2958041894 | 2958045906 | 432 |
| 672 | iso_pu_bacteria | 2958064165 | 2958065263 | 432 |
| 673 | iso_pu_bacteria | 2958071322 | 2958077105 | 432 |
| 674 | iso_pu_bacteria | 2958084443 | 2958085954 | 432 |
| 675 | iso_pu_bacteria | 2958100919 | 2958107942 | 432 |
| 676 | iso_pu_bacteria | 2958108152 | 2958112737 | 432 |
| 677 | iso_pu_bacteria | 2958115193 | 2958119363 | 432 |
| 678 | iso_pu_bacteria | 2958122699 | 2958129023 | 432 |
| 679 | iso_pu_bacteria | 2958130278 | 2958135322 | 432 |
| 680 | iso_pu_bacteria | 2958137437 | 2958141240 | 432 |
| 681 | iso_pu_bacteria | 2958144490 | 2958147625 | 432 |
| 682 | iso_pu_bacteria | 2958158011 | 2958160900 | 432 |
| 683 | iso_pu_bacteria | 2958165035 | 2958169980 | 432 |
| 684 | iso_pu_bacteria | 2958172287 | 2958174218 | 432 |
| 685 | iso_pu_bacteria | 2958179912 | 2958184351 | 432 |
| 686 | iso_pu_bacteria | 2960584000 | 2960584744 | 432 |
| 687 | iso_pu_bacteria | 2960591022 | 2960591328 | 432 |
| 688 | iso_pu_bacteria | 2960597568 | 2960598729 | 432 |
| 689 | iso_pu_bacteria | 2960603979 | 2960610167 | 432 |
| 690 | iso_pu_bacteria | 2960610863 | 2960617298 | 432 |
| 691 | iso_pu_bacteria | 2960617483 | 2960618710 | 432 |
| 692 | iso_pu_bacteria | 2960624210 | 2960629573 | 432 |
| 693 | iso_pu_bacteria | 2960631154 | 2960632580 | 432 |
| 694 | iso_pu_bacteria | 2960637947 | 2960641432 | 432 |
| 695 | iso_pu_bacteria | 2960645483 | 2960646699 | 432 |
| 696 | iso_pu_bacteria | 2960652885 | 2960653075 | 432 |
| 697 | iso_pu_bacteria | 2960660292 | 2960662907 | 432 |
| 698 | iso_pu_bacteria | 2960667422 | 2960671449 | 432 |
| 699 | iso_pu_bacteria | 2960674078 | 2960675437 | 432 |
| 700 | iso_pu_bacteria | 2960680706 | 2960681410 | 432 |
| 701 | iso_pu_bacteria | 2960687367 | 2960687885 | 432 |
| 702 | iso_pu_bacteria | 2960693952 | 2960695163 | 432 |
| 703 | iso_pu_bacteria | 2961077736 | 2961082406 | 432 |
| 704 | iso_pu_bacteria | 2961114664 | 2961118831 | 432 |
| 705 | iso_pu_bacteria | 2961127735 | 2961135872 | 432 |
| 706 | iso_pu_bacteria | 2961136820 | 2961137889 | 432 |
| 707 | iso_pu_bacteria | 2961163497 | 2961168437 | 432 |
| 708 | iso_pu_bacteria | 2961170736 | 2961176550 | 432 |
| 709 | iso_pu_bacteria | 2961183825 | 2961184425 | 432 |
| 710 | iso_pu_bacteria | 2963644680 | 2963645115 | 432 |
| 711 | iso_pu_bacteria | 2964607997 | 2964612396 | 432 |
| 712 | iso_pu_bacteria | 2964615318 | 2964620355 | 432 |
| 713 | iso_pu_bacteria | 2964621998 | 2964625960 | 432 |
| 714 | iso_pu_bacteria | 2964628898 | 2964631437 | 432 |
| 715 | iso_pu_bacteria | 2964636051 | 2964640487 | 432 |
| 716 | iso_pu_bacteria | 2964643177 | 2964647194 | 432 |
| 717 | iso_pu_bacteria | 2964649959 | 2964650909 | 432 |
| 718 | iso_pu_bacteria | 2964656573 | 2964659021 | 432 |
| 719 | iso_pu_bacteria | 2964663802 | 2964668810 | 432 |
| 720 | iso_pu_bacteria | 2964670856 | 2964674564 | 432 |
| 721 | iso_pu_bacteria | 2964678106 | 2964681744 | 432 |
| 722 | iso_pu_bacteria | 2964685014 | 2964688683 | 432 |
| 723 | iso_pu_bacteria | 2964691889 | 2964693247 | 432 |
| 724 | iso_pu_bacteria | 2964698721 | 2964705145 | 432 |
| 725 | iso_pu_bacteria | 2964705432 | 2964706241 | 432 |
| 726 | iso_pu_bacteria | 2964712639 | 2964719068 | 432 |
| 727 | iso_pu_bacteria | 2964719344 | 2964725642 | 432 |
| 728 | iso_pu_bacteria | 2965018300 | 2965023256 | 432 |
| 729 | iso_pu_bacteria | 2965025482 | 2965030238 | 432 |
| 730 | iso_pu_bacteria | 2965040258 | 2965043183 | 432 |
| 731 | iso_pu_bacteria | 2965047637 | 2965049204 | 432 |
| 732 | iso_pu_bacteria | 2965062239 | 2965064892 | 432 |
| 733 | iso_pu_bacteria | 2965089291 | 2965096570 | 432 |
| 734 | iso_pu_bacteria | 2965102966 | 2965103991 | 432 |
| 735 | iso_pu_bacteria | 2965110997 | 2965113973 | 432 |
| 736 | iso_pu_bacteria | 2965119406 | 2965123345 | 432 |
| 737 | iso_pu_bacteria | 2967664464 | 2967670976 | 432 |
| 738 | iso_pu_bacteria | 2967671571 | 2967673131 | 432 |
| 739 | iso_pu_bacteria | 2967678726 | 2967683038 | 432 |
| 740 | iso_pu_bacteria | 2967686174 | 2967686559 | 432 |
| 741 | iso_pu_bacteria | 2967693043 | 2967696112 | 432 |
| 742 | iso_pu_bacteria | 2967699805 | 2967700483 | 432 |
| 743 | iso_pu_bacteria | 2967706974 | 2967708431 | 432 |
| 744 | iso_pu_bacteria | 2967714385 | 2967715828 | 432 |
| 745 | iso_pu_bacteria | 2967721400 | 2967722017 | 432 |
| 746 | iso_pu_bacteria | 2967728569 | 2967732436 | 432 |
| 747 | iso_pu_bacteria | 2967735183 | 2967735434 | 432 |
| 748 | iso_pu_bacteria | 2967742019 | 2967742338 | 432 |
| 749 | iso_pu_bacteria | 2967748971 | 2967750141 | 432 |
| 750 | iso_pu_bacteria | 2967755722 | 2967760061 | 432 |
| 751 | iso_pu_bacteria | 2967762386 | 2967769071 | 432 |
| 752 | iso_pu_bacteria | 2967769361 | 2967774540 | 432 |
| 753 | iso_pu_bacteria | 2967775926 | 2967781317 | 432 |
| 754 | iso_pu_bacteria | 2967996073 | 2968001433 | 432 |
| 755 | iso_pu_bacteria | 2968003550 | 2968007486 | 432 |
| 756 | iso_pu_bacteria | 2968016561 | 2968022955 | 432 |
| 757 | iso_pu_bacteria | 2968016561 | 2968023702 | 432 |
| 758 | iso_pu_bacteria | 2968083720 | 2968089986 | 432 |
| 759 | iso_pu_bacteria | 2968091066 | 2968093795 | 432 |
| 760 | iso_pu_bacteria | 2968097103 | 2968097780 | 432 |
| 761 | iso_pu_bacteria | 2968110612 | 2968115168 | 432 |
| 762 | iso_pu_bacteria | 2968117919 | 2968122036 | 432 |
| 763 | iso_pu_bacteria | 2968128360 | 2968131234 | 432 |
| 764 | iso_pu_bacteria | 2968138860 | 2968142116 | 432 |
| 765 | iso_pu_bacteria | 2968171901 | 2968176839 | 432 |
| 766 | iso_pu_bacteria | 2970019648 | 2970024982 | 432 |
| 767 | iso_pu_bacteria | 2970026789 | 2970029361 | 432 |
| 768 | iso_pu_bacteria | 2970033650 | 2970040664 | 432 |
| 769 | iso_pu_bacteria | 2970040964 | 2970041773 | 432 |
| 770 | iso_pu_bacteria | 2970047711 | 2970054531 | 432 |
| 771 | iso_pu_bacteria | 2970054988 | 2970061045 | 432 |
| 772 | iso_pu_bacteria | 2970061556 | 2970068136 | 432 |
| 773 | iso_pu_bacteria | 2970068827 | 2970069434 | 432 |
| 774 | iso_pu_bacteria | 2970076120 | 2970079069 | 432 |
| 775 | iso_pu_bacteria | 2970082768 | 2970084242 | 432 |
| 776 | iso_pu_bacteria | 2970088815 | 2970095490 | 432 |
| 777 | iso_pu_bacteria | 2970095765 | 2970099073 | 432 |
| 778 | iso_pu_bacteria | 2970102677 | 2970108818 | 432 |
| 779 | iso_pu_bacteria | 2970109326 | 2970115245 | 432 |
| 780 | iso_pu_bacteria | 2970116247 | 2970119547 | 432 |
| 781 | iso_pu_bacteria | 2970122695 | 2970126414 | 432 |
| 782 | iso_pu_bacteria | 2970129317 | 2970134287 | 432 |
| 783 | iso_pu_bacteria | 2970136068 | 2970140662 | 432 |
| 784 | iso_pu_bacteria | 2970143518 | 2970144593 | 432 |
| 785 | iso_pu_bacteria | 2970149975 | 2970155658 | 432 |
| 786 | iso_pu_bacteria | 2970156795 | 2970163241 | 432 |
| 787 | iso_pu_bacteria | 2970164137 | 2970165903 | 432 |
| 788 | iso_pu_bacteria | 2970170962 | 2970173335 | 432 |
| 789 | iso_pu_bacteria | 2970177841 | 2970179828 | 432 |
| 790 | iso_pu_bacteria | 2970184632 | 2970186514 | 432 |
| 791 | iso_pu_bacteria | 2970191845 | 2970194498 | 432 |
| 792 | iso_pu_bacteria | 2970469710 | 2970469743 | 432 |
| 793 | iso_pu_bacteria | 2970469710 | 2970475540 | 432 |
| 794 | iso_pu_bacteria | 2970489779 | 2970490090 | 432 |
| 795 | iso_pu_bacteria | 2970503327 | 2970509221 | 432 |
| 796 | iso_pu_bacteria | 2970510686 | 2970517490 | 432 |
| 797 | iso_pu_bacteria | 2970524798 | 2970525814 | 432 |
| 798 | iso_pu_bacteria | 2970532167 | 2970537485 | 432 |
| 799 | iso_pu_bacteria | 2970540015 | 2970542599 | 432 |
| 800 | iso_pu_bacteria | 2970547951 | 2970552191 | 432 |
| 801 | iso_pu_bacteria | 2970554993 | 2970559757 | 432 |
| 802 | iso_pu_bacteria | 2970593180 | 2970599321 | 432 |
| 803 | iso_pu_bacteria | 2970619444 | 2970624282 | 432 |
| 804 | iso_pu_bacteria | 2970627176 | 2970634051 | 432 |
| 805 | iso_pu_bacteria | 2977516862 | 2977520772 | 432 |
| 806 | iso_pu_bacteria | 2977523885 | 2977530096 | 432 |
| 807 | iso_pu_bacteria | 2977530762 | 2977532426 | 432 |
| 808 | iso_pu_bacteria | 2977537788 | 2977540957 | 432 |
| 809 | iso_pu_bacteria | 2977544691 | 2977551135 | 432 |
| 810 | iso_pu_bacteria | 2977551784 | 2977556837 | 432 |
| 811 | iso_pu_bacteria | 2977558990 | 2977565586 | 432 |
| 812 | iso_pu_bacteria | 2977565890 | 2977569099 | 432 |
| 813 | iso_pu_bacteria | 2977572785 | 2977578022 | 432 |
| 814 | iso_pu_bacteria | 2977579622 | 2977579700 | 432 |
| 815 | iso_pu_bacteria | 2977821940 | 2977824646 | 432 |
| 816 | iso_pu_bacteria | 2977828996 | 2977830374 | 432 |
| 817 | iso_pu_bacteria | 2977843712 | 2977850503 | 432 |
| 818 | iso_pu_bacteria | 2977851361 | 2977852809 | 432 |
| 819 | iso_pu_bacteria | 2977858184 | 2977859753 | 432 |
| 820 | iso_pu_bacteria | 2977864932 | 2977871567 | 432 |
| 821 | iso_pu_bacteria | 2977872689 | 2977879720 | 432 |
| 822 | iso_pu_bacteria | 2977898635 | 2977903853 | 432 |
| 823 | iso_pu_bacteria | 2977915119 | 2977919373 | 432 |
| 824 | iso_pu_bacteria | 2977922695 | 2977925756 | 432 |
| 825 | iso_pu_bacteria | 2977935797 | 2977939194 | 432 |
| 826 | iso_pu_bacteria | 2977942078 | 2977944213 | 432 |
| 827 | iso_pu_bacteria | 2977950692 | 2977950968 | 432 |
| 828 | iso_pu_bacteria | 2977957713 | 2977958216 | 432 |
| 829 | iso_pu_bacteria | 2977971508 | 2977974074 | 432 |
| 830 | iso_pu_bacteria | 2977986579 | 2977986740 | 432 |
| 831 | iso_pu_bacteria | 2978969890 | 2978972424 | 432 |
| 832 | iso_pu_bacteria | 2979089926 | 2979090308 | 432 |
| 833 | iso_pu_bacteria | 2979095461 | 2979095837 | 432 |
| 834 | iso_pu_bacteria | 2979100975 | 2979102710 | 432 |
| 835 | iso_pu_bacteria | 2979710463 | 2979712073 | 432 |
| 836 | iso_pu_bacteria | 2979742915 | 2979744022 | 432 |
| 837 | iso_pu_bacteria | 2979764755 | 2979769792 | 432 |
| 838 | iso_pu_bacteria | 2979772303 | 2979779786 | 432 |
| 839 | iso_pu_bacteria | 2979779861 | 2979781842 | 432 |
| 840 | iso_pu_bacteria | 2979808191 | 2979813900 | 432 |
| 841 | iso_pu_bacteria | 2984509177 | 2984509402 | 432 |
| 842 | iso_pu_bacteria | 2984537506 | 2984537734 | 432 |
| 843 | iso_pu_bacteria | 2984587000 | 2984590675 | 432 |
| 844 | iso_pu_bacteria | 2984601300 | 2984604479 | 432 |
| 845 | iso_pu_bacteria | 2987636660 | 2987641283 | 432 |
| 846 | iso_pu_bacteria | 2987645492 | 2987647614 | 432 |
| 847 | iso_pu_bacteria | 2987652177 | 2987653724 | 432 |
| 848 | iso_pu_bacteria | 2987659509 | 2987664454 | 432 |
| 849 | iso_pu_bacteria | 2987666974 | 2987667304 | 432 |
| 850 | iso_pu_bacteria | 2987673487 | 2987680136 | 432 |
| 851 | iso_pu_bacteria | 2989349275 | 2989354586 | 432 |
| 852 | iso_pu_bacteria | 2989771324 | 2989775192 | 432 |
| 853 | iso_pu_bacteria | 2989776772 | 2989780408 | 432 |
| 854 | iso_pu_bacteria | 2995392953 | 2995394161 | 432 |
| 855 | iso_pu_bacteria | 2996310559 | 2996311785 | 432 |
| 856 | iso_pu_bacteria | 2996336353 | 2996338502 | 432 |
| 857 | iso_pu_bacteria | 2996341866 | 2996347627 | 432 |
| 858 | iso_pu_bacteria | 2996348954 | 2996355850 | 432 |
| 859 | iso_pu_bacteria | 2996386984 | 2996387590 | 432 |
| 860 | iso_pu_bacteria | 2996887358 | 2996889271 | 432 |
| 861 | iso_pu_bacteria | 2996893221 | 2996894673 | 432 |
| 862 | iso_pu_bacteria | 3000135777 | 3000142508 | 432 |
| 863 | iso_pu_bacteria | 3002141150 | 3002142158 | 432 |
| 864 | iso_pu_bacteria | 3003930520 | 3003930563 | 432 |
| 865 | iso_pu_bacteria | 3004167301 | 3004172946 | 432 |
| 866 | iso_pu_bacteria | 3004188549 | 3004193510 | 432 |
| 867 | iso_pu_bacteria | 3004195979 | 3004202213 | 432 |
| 868 | iso_pu_bacteria | 3004211236 | 3004217294 | 432 |
| 869 | iso_pu_bacteria | 3004218560 | 3004220439 | 432 |
| 870 | iso_pu_bacteria | 3004232784 | 3004232795 | 432 |
| 871 | iso_pu_bacteria | 3004239961 | 3004241039 | 432 |
| 872 | iso_pu_bacteria | 3004248173 | 3004248486 | 432 |
| 873 | iso_pu_bacteria | 3004268573 | 3004272479 | 432 |
| 874 | iso_pu_bacteria | 3004275668 | 3004282276 | 432 |
| 875 | iso_pu_bacteria | 3004289098 | 3004293701 | 432 |
| 876 | iso_pu_bacteria | 3004334049 | 3004337620 | 432 |
| 877 | iso_pu_bacteria | 3005409236 | 3005415425 | 432 |
| 878 | iso_pu_bacteria | 3005416602 | 3005418436 | 432 |
| 879 | iso_pu_bacteria | 3005445848 | 3005449337 | 432 |
| 880 | iso_pu_bacteria | 3005452660 | 3005455640 | 432 |
| 881 | iso_pu_bacteria | 637000159 | 637077237 | 432 |
| 882 | iso_pu_bacteria | 639633055 | 639650055 | 432 |
| 883 | iso_pu_bacteria | 643692032 | 643827137 | 432 |
| 884 | iso_pu_bacteria | 648276728 | 648735797 | 432 |
| 885 | iso_pu_bacteria | 649633066 | 649870292 | 432 |
| 886 | iso_pu_bacteria | 650716007 | 650844063 | 432 |
| 887 | iso_pu_bacteria | 8002285264 | 8002287066 | 432 |
| 888 | iso_pu_bacteria | 8003570095 | 8003574373 | 432 |
| 889 | iso_pu_bacteria | 8003992118 | 8003995019 | 432 |
| 890 | iso_pu_bacteria | 8003999396 | 8004002781 | 432 |
| 891 | iso_pu_bacteria | 8004300914 | 8004304873 | 432 |
| 892 | iso_pu_bacteria | 8004312739 | 8004316633 | 432 |
| 893 | iso_pu_bacteria | 8004361976 | 8004362035 | 432 |
| 894 | iso_pu_bacteria | 8004374579 | 8004377085 | 432 |
| 895 | iso_pu_bacteria | 8004387939 | 8004393211 | 432 |
| 896 | iso_pu_bacteria | 8004445564 | 8004448960 | 432 |
| 897 | iso_pu_bacteria | 8004633249 | 8004637290 | 432 |
| 898 | iso_pu_bacteria | 8004640170 | 8004644171 | 432 |
| 899 | iso_pu_bacteria | 8004703790 | 8004706947 | 432 |
| 900 | iso_pu_bacteria | 8004714634 | 8004719998 | 432 |
| 901 | iso_pu_bacteria | 8004727605 | 8004729458 | 432 |
| 902 | iso_pu_bacteria | 8005246636 | 8005249505 | 432 |
| 903 | iso_pu_bacteria | 8005258706 | 8005264151 | 432 |
| 904 | iso_pu_bacteria | 8005275841 | 8005282073 | 432 |
| 905 | iso_pu_bacteria | 8005282627 | 8005285111 | 432 |
| 906 | iso_pu_bacteria | 8005289223 | 8005294206 | 432 |
| 907 | iso_pu_bacteria | 8005301065 | 8005306619 | 432 |
| 908 | iso_pu_bacteria | 8005307578 | 8005309447 | 432 |
| 909 | iso_pu_bacteria | 8005314921 | 8005318672 | 432 |
| 910 | iso_pu_bacteria | 8005321885 | 8005323798 | 432 |
| 911 | iso_pu_bacteria | 8005376324 | 8005382727 | 432 |
| 912 | iso_pu_bacteria | 8005382845 | 8005383784 | 432 |
| 913 | iso_pu_bacteria | 8005395548 | 8005401110 | 432 |
| 914 | iso_pu_bacteria | 8005430974 | 8005434064 | 432 |
| 915 | iso_pu_bacteria | 8005460587 | 8005464674 | 432 |
| 916 | iso_pu_bacteria | 8005484373 | 8005488444 | 432 |
| 917 | iso_pu_bacteria | 8005497431 | 8005501723 | 432 |
| 918 | iso_pu_bacteria | 8005542996 | 8005547035 | 432 |
| 919 | iso_pu_bacteria | 8005556819 | 8005559106 | 432 |
| 920 | iso_pu_bacteria | 8005563573 | 8005566835 | 432 |
| 921 | iso_pu_bacteria | 8005570704 | 8005574887 | 432 |
| 922 | iso_pu_bacteria | 8005619151 | 8005623077 | 432 |
| 923 | iso_pu_bacteria | 8005626139 | 8005631615 | 432 |
| 924 | iso_pu_bacteria | 8005645114 | 8005648913 | 432 |
| 925 | iso_pu_bacteria | 8005668836 | 8005673145 | 432 |
| 926 | iso_pu_bacteria | 8005682033 | 8005682152 | 432 |
| 927 | iso_pu_bacteria | 8005688590 | 8005693685 | 432 |
| 928 | iso_pu_bacteria | 8005695170 | 8005700925 | 432 |
| 929 | iso_pu_bacteria | 8018127388 | 8018133558 | 432 |
| 930 | iso_pu_bacteria | 8018150411 | 8018152086 | 432 |
| 931 | iso_pu_bacteria | 8018163183 | 8018170278 | 432 |
| 932 | iso_pu_bacteria | 8018176218 | 8018178407 | 432 |
| 933 | iso_pu_bacteria | 8023680758 | 8023687488 | 432 |
| 934 | iso_pu_bacteria | 8024479707 | 8024482010 | 432 |
| 935 | iso_pu_bacteria | 8024486573 | 8024486963 | 432 |
| 936 | iso_pu_bacteria | 8024501048 | 8024505878 | 432 |
| 937 | iso_pu_bacteria | 8046767195 | 8046773171 | 432 |
| 938 | iso_pu_bacteria | 8049293176 | 8049295983 | 432 |
| 939 | iso_pu_bacteria | 8054460903 | 8054463510 | 432 |
| 940 | iso_pu_bacteria | 8054558443 | 8054559488 | 432 |
| 941 | iso_pu_bacteria | 8055617313 | 8055617630 | 432 |
| 942 | iso_pu_bacteria | 8056375014 | 8056381646 | 432 |
| 943 | iso_pu_bacteria | 8056382006 | 8056387083 | 432 |
| 944 | iso_pu_bacteria | 8056875544 | 8056876224 | 432 |
| 945 | iso_pu_bacteria | 8057575449 | 8057581092 | 432 |
| 946 | iso_pu_bacteria | 8057874678 | 8057877050 | 432 |
| 947 | 3300014326 | Ga0157380_10208691 | Ga0157380_102086911 | 433 |
| 948 | 3300032168 | Ga0316593_10014887 | Ga0316593_100148872 | 433 |
| 949 | 3300039062 | Ga0400483_018531 | Ga0400483_018531_21236_22564 | 433 |
| 950 | 3300039062 | Ga0400483_082204 | Ga0400483_082204_195_1499 | 433 |
| 951 | 3300039062 | Ga0400483_219255 | Ga0400483_219255_30751_32079 | 433 |
| 952 | 3300045051 | Ga0451576_0000834 | Ga0451576_0000834_17010_18311 | 433 |
| 953 | 3300049571 | Ga0501034_0000606 | Ga0501034_0000606_24742_26043 | 433 |
| 954 | iso_pu_bacteria | 2510065055 | 2510293710 | 433 |
| 955 | iso_pu_bacteria | 2523231067 | 2523466209 | 433 |
| 956 | iso_pu_bacteria | 2738543031 | 2739347068 | 433 |
| 957 | 3300005459 | Ga0068867_100004439 | Ga0068867_1000044396 | 434 |
| 958 | 3300005563 | Ga0068855_100002914 | Ga0068855_1000029142 | 434 |
| 959 | 3300005578 | Ga0068854_100121702 | Ga0068854_1001217022 | 434 |
| 960 | 3300006353 | Ga0075370_10092620 | Ga0075370_100926201 | 434 |
| 961 | 3300006358 | Ga0068871_100025070 | Ga0068871_1000250704 | 434 |
| 962 | 3300009093 | Ga0105240_10000871 | Ga0105240_100008717 | 434 |
| 963 | 3300009148 | Ga0105243_10036210 | Ga0105243_100362102 | 434 |
| 964 | 3300009176 | Ga0105242_10048624 | Ga0105242_100486242 | 434 |
| 965 | 3300009545 | Ga0105237_10033313 | Ga0105237_100333132 | 434 |
| 966 | 3300009551 | Ga0105238_10200897 | Ga0105238_102008972 | 434 |
| 967 | 3300013297 | Ga0157378_10005765 | Ga0157378_100057657 | 434 |
| 968 | 3300013308 | Ga0157375_10084111 | Ga0157375_100841112 | 434 |
| 969 | 3300025230 | Ga0209563_100013 | Ga0209563_100013592 | 434 |
| 970 | 3300025298 | Ga0209050_1008731 | Ga0209050_10087312 | 434 |
| 971 | 3300025303 | Ga0209051_1002208 | Ga0209051_10022086 | 434 |
| 972 | 3300025304 | Ga0209257_1000033 | Ga0209257_1000033417 | 434 |
| 973 | 3300025913 | Ga0207695_10016415 | Ga0207695_100164152 | 434 |
| 974 | 3300025914 | Ga0207671_10020826 | Ga0207671_100208262 | 434 |
| 975 | 3300025934 | Ga0207686_10040697 | Ga0207686_100406972 | 434 |
| 976 | 3300025949 | Ga0207667_10004623 | Ga0207667_1000462311 | 434 |
| 977 | 3300026089 | Ga0207648_10006652 | Ga0207648_100066524 | 434 |
| 978 | 3300026116 | Ga0207674_10255021 | Ga0207674_102550212 | 434 |
| 979 | 3300028577 | Ga0265318_10004293 | Ga0265318_100042932 | 434 |
| 980 | 3300031344 | Ga0265316_10153418 | Ga0265316_101534182 | 434 |
| 981 | 3300031711 | Ga0265314_10016328 | Ga0265314_100163284 | 434 |
| 982 | 3300032004 | Ga0307414_10002146 | Ga0307414_100021464 | 434 |
| 983 | 3300032005 | Ga0307411_10000107 | Ga0307411_100001078 | 434 |
| 984 | 3300035088 | Ga0373940_0002677 | Ga0373940_0002677_1737_3053 | 434 |
| 985 | 3300035114 | Ga0373939_0000188 | Ga0373939_0000188_9615_10931 | 434 |
| 986 | 3300042126 | Ga0450888_000097 | Ga0450888_000097_475_1791 | 434 |
| 987 | 3300042127 | Ga0450890_000925 | Ga0450890_000925_2893_4209 | 434 |
| 988 | 3300042130 | Ga0450892_000431 | Ga0450892_000431_26_1342 | 434 |
| 989 | 3300042532 | Ga0450893_0002729 | Ga0450893_0002729_863_2179 | 434 |
| 990 | 3300048905 | Ga0496102_0120362 | Ga0496102_0120362_977_2308 | 434 |
| 991 | 3300048907 | Ga0496104_0051606 | Ga0496104_0051606_1291_2622 | 434 |
| 992 | 3300048917 | Ga0496114_0005571 | Ga0496114_0005571_7913_9244 | 434 |
| 993 | 3300049160 | Ga0501304_001476 | Ga0501304_001476_175_1491 | 434 |
| 994 | 3300049581 | Ga0501047_0008929 | Ga0501047_0008929_4874_6178 | 434 |
| 995 | 3300049586 | Ga0501070_0005494 | Ga0501070_0005494_2039_3343 | 434 |
| 996 | 3300049654 | Ga0501207_001043 | Ga0501207_001043_183_1499 | 434 |
| 997 | 3300049663 | Ga0501223_008382 | Ga0501223_008382_77_1393 | 434 |
| 998 | 3300049704 | Ga0501221_000258 | Ga0501221_000258_2529_3845 | 434 |
| 999 | 3300049742 | Ga0501080_0048583 | Ga0501080_0048583_28_1347 | 434 |
| 1000 | 3300049742 | Ga0501080_0121692 | Ga0501080_0121692_262_1566 | 434 |
| 1001 | 3300049757 | Ga0501232_000308 | Ga0501232_000308_52_1368 | 434 |
| 1002 | 3300050496 | nmdc:mga07m45_5037_c1 | nmdc:mga07m45_5037_c1_946_2262 | 434 |
| 1003 | 3300053122 | Ga0500608_002836 | Ga0500608_002836_739_2043 | 434 |
| 1004 | 3300053156 | Ga0500622_0000101 | Ga0500622_0000101_20534_21838 | 434 |
| 1005 | iso_pu_bacteria | 2791354903 | 2791922117 | 434 |
| 1006 | 3300005354 | Ga0070675_100112804 | Ga0070675_1001128042 | 435 |
| 1007 | 3300005548 | Ga0070665_100097821 | Ga0070665_1000978212 | 435 |
| 1008 | 3300005578 | Ga0068854_100061423 | Ga0068854_1000614232 | 435 |
| 1009 | 3300006048 | Ga0075363_100032088 | Ga0075363_1000320882 | 435 |
| 1010 | 3300006051 | Ga0075364_10135081 | Ga0075364_101350812 | 435 |
| 1011 | 3300006177 | Ga0075362_10001059 | Ga0075362_100010593 | 435 |
| 1012 | 3300006177 | Ga0075362_10029465 | Ga0075362_100294652 | 435 |
| 1013 | 3300006178 | Ga0075367_10056832 | Ga0075367_100568322 | 435 |
| 1014 | 3300006237 | Ga0097621_100113413 | Ga0097621_1001134133 | 435 |
| 1015 | 3300013297 | Ga0157378_10140250 | Ga0157378_101402502 | 435 |
| 1016 | 3300025231 | Ga0207427_103198 | Ga0207427_1031981 | 435 |
| 1017 | 3300025261 | Ga0209233_1001762 | Ga0209233_10017627 | 435 |
| 1018 | 3300025913 | Ga0207695_10054111 | Ga0207695_100541114 | 435 |
| 1019 | 3300025913 | Ga0207695_10083047 | Ga0207695_100830475 | 435 |
| 1020 | 3300025914 | Ga0207671_10029566 | Ga0207671_100295661 | 435 |
| 1021 | 3300025925 | Ga0207650_10059566 | Ga0207650_100595661 | 435 |
| 1022 | 3300028379 | Ga0268266_10059352 | Ga0268266_100593522 | 435 |
| 1023 | 3300028794 | Ga0307515_10000145 | Ga0307515_100001459 | 435 |
| 1024 | 3300031241 | Ga0265325_10001162 | Ga0265325_1000116210 | 435 |
| 1025 | 3300031241 | Ga0265325_10003071 | Ga0265325_100030716 | 435 |
| 1026 | 3300031249 | Ga0265339_10000239 | Ga0265339_1000023925 | 435 |
| 1027 | 3300031250 | Ga0265331_10011091 | Ga0265331_100110913 | 435 |
| 1028 | 3300031344 | Ga0265316_10027142 | Ga0265316_100271423 | 435 |
| 1029 | 3300031344 | Ga0265316_10064691 | Ga0265316_100646912 | 435 |
| 1030 | 3300031456 | Ga0307513_10194829 | Ga0307513_101948292 | 435 |
| 1031 | 3300031711 | Ga0265314_10009013 | Ga0265314_100090134 | 435 |
| 1032 | 3300031712 | Ga0265342_10048064 | Ga0265342_100480642 | 435 |
| 1033 | 3300031730 | Ga0307516_10207891 | Ga0307516_102078911 | 435 |
| 1034 | 3300037312 | Ga0395899_0165917 | Ga0395899_0165917_93_1409 | 435 |
| 1035 | 3300038443 | Ga0395901_0058770 | Ga0395901_0058770_2363_3670 | 435 |
| 1036 | 3300039062 | Ga0400483_256661 | Ga0400483_256661_28_1335 | 435 |
| 1037 | 3300046518 | Ga0495631_0013726 | Ga0495631_0013726_806_2119 | 435 |
| 1038 | 3300046660 | Ga0495625_0087624 | Ga0495625_0087624_603_1910 | 435 |
| 1039 | 3300048914 | Ga0496111_0051207 | Ga0496111_0051207_967_2274 | 435 |
| 1040 | 3300048919 | Ga0496116_0066736 | Ga0496116_0066736_618_1925 | 435 |
| 1041 | 3300048922 | Ga0496119_0004065 | Ga0496119_0004065_3352_4662 | 435 |
| 1042 | 3300048925 | Ga0496122_0009737 | Ga0496122_0009737_6914_8224 | 435 |
| 1043 | 3300048925 | Ga0496122_0096358 | Ga0496122_0096358_590_1900 | 435 |
| 1044 | 3300048928 | Ga0496125_0000053 | Ga0496125_0000053_63400_64707 | 435 |
| 1045 | 3300048928 | Ga0496125_0000323 | Ga0496125_0000323_49586_50896 | 435 |
| 1046 | 3300048928 | Ga0496125_0088534 | Ga0496125_0088534_744_2054 | 435 |
| 1047 | 3300049570 | Ga0501033_0000361 | Ga0501033_0000361_32089_33396 | 435 |
| 1048 | 3300049571 | Ga0501034_0007494 | Ga0501034_0007494_4260_5567 | 435 |
| 1049 | 3300049571 | Ga0501034_0019998 | Ga0501034_0019998_1403_2713 | 435 |
| 1050 | 3300049571 | Ga0501034_0056012 | Ga0501034_0056012_960_2267 | 435 |
| 1051 | 3300049571 | Ga0501034_0066655 | Ga0501034_0066655_268_1575 | 435 |
| 1052 | 3300049571 | Ga0501034_0216430 | Ga0501034_0216430_230_1537 | 435 |
| 1053 | 3300049572 | Ga0501036_0102684 | Ga0501036_0102684_417_1724 | 435 |
| 1054 | 3300049572 | Ga0501036_0127063 | Ga0501036_0127063_17_1324 | 435 |
| 1055 | 3300049574 | Ga0501038_0045286 | Ga0501038_0045286_1018_2325 | 435 |
| 1056 | 3300049581 | Ga0501047_0124293 | Ga0501047_0124293_674_1981 | 435 |
| 1057 | 3300049589 | Ga0501073_0063110 | Ga0501073_0063110_369_1688 | 435 |
| 1058 | 3300049742 | Ga0501080_0240990 | Ga0501080_0240990_181_1488 | 435 |
| 1059 | 3300049823 | Ga0501044_0165798 | Ga0501044_0165798_133_1440 | 435 |
| 1060 | 3300050489 | nmdc:mga03683_12179_c1 | nmdc:mga03683_12179_c1_900_2207 | 435 |
| 1061 | 3300050493 | nmdc:mga0k408_50586_c1 | nmdc:mga0k408_50586_c1_460_1767 | 435 |
| 1062 | 3300050496 | nmdc:mga07m45_57439_c1 | nmdc:mga07m45_57439_c1_177_1484 | 435 |
| 1063 | 3300053151 | Ga0500604_0000141 | Ga0500604_0000141_5044_6351 | 435 |
| 1064 | 3300053161 | Ga0500634_0000029 | Ga0500634_0000029_45644_46951 | 435 |
| 1065 | iso_pu_bacteria | 2507262055 | 2507504739 | 435 |
| 1066 | iso_pu_bacteria | 2508501009 | 2508539845 | 435 |
| 1067 | iso_pu_bacteria | 2508501042 | 2508695024 | 435 |
| 1068 | iso_pu_bacteria | 2511231028 | 2511397016 | 435 |
| 1069 | iso_pu_bacteria | 2513237092 | 2513626669 | 435 |
| 1070 | iso_pu_bacteria | 2513237095 | 2513648119 | 435 |
| 1071 | iso_pu_bacteria | 2513237101 | 2513693865 | 435 |
| 1072 | iso_pu_bacteria | 2513237102 | 2513704766 | 435 |
| 1073 | iso_pu_bacteria | 2513237104 | 2513715585 | 435 |
| 1074 | iso_pu_bacteria | 2513237139 | 2513875710 | 435 |
| 1075 | iso_pu_bacteria | 2513237161 | 2514016376 | 435 |
| 1076 | iso_pu_bacteria | 2515154112 | 2515627823 | 435 |
| 1077 | iso_pu_bacteria | 2517093001 | 2517106978 | 435 |
| 1078 | iso_pu_bacteria | 2524023205 | 2524435629 | 435 |
| 1079 | iso_pu_bacteria | 2528768022 | 2528850282 | 435 |
| 1080 | iso_pu_bacteria | 2617270735 | 2617352941 | 435 |
| 1081 | iso_pu_bacteria | 2617270741 | 2617374242 | 435 |
| 1082 | iso_pu_bacteria | 2744054633 | 2745079886 | 435 |
| 1083 | iso_pu_bacteria | 2791355196 | 2793063216 | 435 |
| 1084 | iso_pu_bacteria | 2802429603 | 2805919386 | 435 |
| 1085 | iso_pu_bacteria | 2816332527 | 2818237165 | 435 |
| 1086 | iso_pu_bacteria | 2824617872 | 2824625085 | 435 |
| 1087 | iso_pu_bacteria | 2824626560 | 2824632498 | 435 |
| 1088 | iso_pu_bacteria | 2824635225 | 2824642306 | 435 |
| 1089 | iso_pu_bacteria | 2824644064 | 2824649663 | 435 |
| 1090 | iso_pu_bacteria | 2824661429 | 2824670675 | 435 |
| 1091 | iso_pu_bacteria | 2824671348 | 2824679132 | 435 |
| 1092 | iso_pu_bacteria | 2824679649 | 2824685459 | 435 |
| 1093 | iso_pu_bacteria | 2824687955 | 2824695754 | 435 |
| 1094 | iso_pu_bacteria | 2824696289 | 2824702105 | 435 |
| 1095 | iso_pu_bacteria | 2824704595 | 2824712237 | 435 |
| 1096 | iso_pu_bacteria | 2824714736 | 2824719610 | 435 |
| 1097 | iso_pu_bacteria | 2824723954 | 2824730071 | 435 |
| 1098 | iso_pu_bacteria | 2824732956 | 2824738107 | 435 |
| 1099 | iso_pu_bacteria | 2824746037 | 2824752991 | 435 |
| 1100 | iso_pu_bacteria | 2824753945 | 2824760639 | 435 |
| 1101 | iso_pu_bacteria | 2824763712 | 2824773057 | 435 |
| 1102 | iso_pu_bacteria | 2824773399 | 2824779860 | 435 |
| 1103 | iso_pu_bacteria | 2838122688 | 2838129422 | 435 |
| 1104 | iso_pu_bacteria | 2841941048 | 2841944341 | 435 |
| 1105 | iso_pu_bacteria | 2841949485 | 2841954482 | 435 |
| 1106 | iso_pu_bacteria | 2841957949 | 2841966000 | 435 |
| 1107 | iso_pu_bacteria | 2841966195 | 2841969118 | 435 |
| 1108 | iso_pu_bacteria | 2841974524 | 2841979892 | 435 |
| 1109 | iso_pu_bacteria | 2841983080 | 2841990927 | 435 |
| 1110 | iso_pu_bacteria | 2842038055 | 2842044003 | 435 |
| 1111 | iso_pu_bacteria | 2842045827 | 2842052008 | 435 |
| 1112 | iso_pu_bacteria | 2844315083 | 2844321686 | 435 |
| 1113 | iso_pu_bacteria | 2847930680 | 2847939682 | 435 |
| 1114 | iso_pu_bacteria | 2847939898 | 2847941637 | 435 |
| 1115 | iso_pu_bacteria | 2849076700 | 2849082559 | 435 |
| 1116 | iso_pu_bacteria | 2857509624 | 2857511454 | 435 |
| 1117 | iso_pu_bacteria | 2874590934 | 2874591481 | 435 |
| 1118 | iso_pu_bacteria | 2874604998 | 2874611752 | 435 |
| 1119 | iso_pu_bacteria | 2874620515 | 2874624314 | 435 |
| 1120 | iso_pu_bacteria | 2874628541 | 2874634076 | 435 |
| 1121 | iso_pu_bacteria | 2874645413 | 2874647731 | 435 |
| 1122 | iso_pu_bacteria | 2876771140 | 2876771623 | 435 |
| 1123 | iso_pu_bacteria | 2876808645 | 2876814129 | 435 |
| 1124 | iso_pu_bacteria | 2876818435 | 2876826516 | 435 |
| 1125 | iso_pu_bacteria | 2879074833 | 2879075437 | 435 |
| 1126 | iso_pu_bacteria | 2879083081 | 2879090515 | 435 |
| 1127 | iso_pu_bacteria | 2879099564 | 2879101856 | 435 |
| 1128 | iso_pu_bacteria | 2879110137 | 2879111809 | 435 |
| 1129 | iso_pu_bacteria | 2879127579 | 2879130665 | 435 |
| 1130 | iso_pu_bacteria | 2879142872 | 2879142979 | 435 |
| 1131 | iso_pu_bacteria | 2881364244 | 2881364980 | 435 |
| 1132 | iso_pu_bacteria | 2885366525 | 2885368113 | 435 |
| 1133 | iso_pu_bacteria | 2888378607 | 2888380126 | 435 |
| 1134 | iso_pu_bacteria | 2888388044 | 2888391141 | 435 |
| 1135 | iso_pu_bacteria | 2903727486 | 2903727739 | 435 |
| 1136 | iso_pu_bacteria | 2904666416 | 2904672347 | 435 |
| 1137 | iso_pu_bacteria | 2904711408 | 2904717933 | 435 |
| 1138 | iso_pu_bacteria | 2906602504 | 2906602775 | 435 |
| 1139 | iso_pu_bacteria | 2906626472 | 2906632418 | 435 |
| 1140 | iso_pu_bacteria | 2906643746 | 2906645054 | 435 |
| 1141 | iso_pu_bacteria | 2908775508 | 2908776717 | 435 |
| 1142 | iso_pu_bacteria | 2919450847 | 2919451848 | 435 |
| 1143 | iso_pu_bacteria | 2922361189 | 2922362739 | 435 |
| 1144 | iso_pu_bacteria | 2922368715 | 2922378479 | 435 |
| 1145 | iso_pu_bacteria | 2922386360 | 2922390396 | 435 |
| 1146 | iso_pu_bacteria | 2922393267 | 2922400248 | 435 |
| 1147 | iso_pu_bacteria | 2929615660 | 2929622433 | 435 |
| 1148 | iso_pu_bacteria | 2929624759 | 2929631350 | 435 |
| 1149 | iso_pu_bacteria | 2932784394 | 2932786233 | 435 |
| 1150 | iso_pu_bacteria | 2932809354 | 2932812693 | 435 |
| 1151 | iso_pu_bacteria | 2932818245 | 2932823055 | 435 |
| 1152 | iso_pu_bacteria | 2932828146 | 2932829471 | 435 |
| 1153 | iso_pu_bacteria | 2933577622 | 2933584487 | 435 |
| 1154 | iso_pu_bacteria | 2935608549 | 2935615064 | 435 |
| 1155 | iso_pu_bacteria | 2935616580 | 2935617903 | 435 |
| 1156 | iso_pu_bacteria | 2935638405 | 2935641613 | 435 |
| 1157 | iso_pu_bacteria | 2935648319 | 2935651584 | 435 |
| 1158 | iso_pu_bacteria | 2935656913 | 2935659648 | 435 |
| 1159 | iso_pu_bacteria | 2935665750 | 2935669329 | 435 |
| 1160 | iso_pu_bacteria | 2935675223 | 2935678075 | 435 |
| 1161 | iso_pu_bacteria | 2935684952 | 2935693606 | 435 |
| 1162 | iso_pu_bacteria | 2935694250 | 2935702926 | 435 |
| 1163 | iso_pu_bacteria | 2935703347 | 2935707152 | 435 |
| 1164 | iso_pu_bacteria | 2935713505 | 2935716970 | 435 |
| 1165 | iso_pu_bacteria | 2935722832 | 2935730196 | 435 |
| 1166 | iso_pu_bacteria | 2935732158 | 2935738409 | 435 |
| 1167 | iso_pu_bacteria | 2935741537 | 2935750197 | 435 |
| 1168 | iso_pu_bacteria | 2935750917 | 2935759791 | 435 |
| 1169 | iso_pu_bacteria | 2935760218 | 2935764558 | 435 |
| 1170 | iso_pu_bacteria | 2935785616 | 2935787188 | 435 |
| 1171 | iso_pu_bacteria | 2935793552 | 2935796024 | 435 |
| 1172 | iso_pu_bacteria | 2935801545 | 2935804467 | 435 |
| 1173 | iso_pu_bacteria | 2935810662 | 2935819132 | 435 |
| 1174 | iso_pu_bacteria | 2935819856 | 2935825898 | 435 |
| 1175 | iso_pu_bacteria | 2935827899 | 2935831344 | 435 |
| 1176 | iso_pu_bacteria | 2935837841 | 2935841953 | 435 |
| 1177 | iso_pu_bacteria | 2935847175 | 2935851517 | 435 |
| 1178 | iso_pu_bacteria | 2935855204 | 2935856598 | 435 |
| 1179 | iso_pu_bacteria | 2935864058 | 2935870213 | 435 |
| 1180 | iso_pu_bacteria | 2935873716 | 2935874462 | 435 |
| 1181 | iso_pu_bacteria | 2935908558 | 2935910462 | 435 |
| 1182 | iso_pu_bacteria | 2935916978 | 2935918136 | 435 |
| 1183 | iso_pu_bacteria | 2935926038 | 2935927627 | 435 |
| 1184 | iso_pu_bacteria | 2935934488 | 2935936501 | 435 |
| 1185 | iso_pu_bacteria | 2935942939 | 2935943946 | 435 |
| 1186 | iso_pu_bacteria | 2935951376 | 2935952383 | 435 |
| 1187 | iso_pu_bacteria | 2935959822 | 2935964259 | 435 |
| 1188 | iso_pu_bacteria | 2935967501 | 2935969223 | 435 |
| 1189 | iso_pu_bacteria | 2935975950 | 2935978016 | 435 |
| 1190 | iso_pu_bacteria | 2935984226 | 2935984684 | 435 |
| 1191 | iso_pu_bacteria | 2935992306 | 2935993923 | 435 |
| 1192 | iso_pu_bacteria | 2936002035 | 2936005066 | 435 |
| 1193 | iso_pu_bacteria | 2936011229 | 2936014064 | 435 |
| 1194 | iso_pu_bacteria | 2936019824 | 2936023027 | 435 |
| 1195 | iso_pu_bacteria | 2936028420 | 2936031163 | 435 |
| 1196 | iso_pu_bacteria | 2936037263 | 2936045717 | 435 |
| 1197 | iso_pu_bacteria | 2936046547 | 2936049285 | 435 |
| 1198 | iso_pu_bacteria | 2936055302 | 2936055827 | 435 |
| 1199 | iso_pu_bacteria | 2940556831 | 2940565755 | 435 |
| 1200 | iso_pu_bacteria | 2941538514 | 2941544026 | 435 |
| 1201 | iso_pu_bacteria | 3005483717 | 3005490978 | 435 |
| 1202 | iso_pu_bacteria | 3005506211 | 3005509656 | 435 |
| 1203 | iso_pu_bacteria | 3005587118 | 3005594262 | 435 |
| 1204 | iso_pu_bacteria | 3005710791 | 3005717796 | 435 |
| 1205 | iso_pu_bacteria | 3005718088 | 3005724849 | 435 |
| 1206 | iso_pu_bacteria | 8001845381 | 8001850055 | 435 |
| 1207 | iso_pu_bacteria | 8006926726 | 8006932415 | 435 |
| 1208 | iso_pu_bacteria | 8006964411 | 8006969954 | 435 |
| 1209 | iso_pu_bacteria | 8006984368 | 8006985673 | 435 |
| 1210 | iso_pu_bacteria | 8006994254 | 8006994763 | 435 |
| 1211 | iso_pu_bacteria | 8016511872 | 8016518762 | 435 |
| 1212 | iso_pu_bacteria | 8016522445 | 8016526713 | 435 |
| 1213 | iso_pu_bacteria | 8016566248 | 8016570078 | 435 |
| 1214 | iso_pu_bacteria | 8016595262 | 8016603057 | 435 |
| 1215 | iso_pu_bacteria | 8016603502 | 8016605958 | 435 |
| 1216 | iso_pu_bacteria | 8016613128 | 8016617844 | 435 |
| 1217 | iso_pu_bacteria | 8016622563 | 8016623730 | 435 |
| 1218 | iso_pu_bacteria | 8016630954 | 8016636408 | 435 |
| 1219 | iso_pu_bacteria | 8017057580 | 8017057915 | 435 |
| 1220 | iso_pu_bacteria | 8019547302 | 8019550749 | 435 |
| 1221 | iso_pu_bacteria | 8019576017 | 8019577809 | 435 |
| 1222 | iso_pu_bacteria | 8019586578 | 8019595912 | 435 |
| 1223 | iso_pu_bacteria | 8019597564 | 8019605844 | 435 |
| 1224 | iso_pu_bacteria | 8019608314 | 8019612689 | 435 |
| 1225 | iso_pu_bacteria | 8019619141 | 8019622431 | 435 |
| 1226 | iso_pu_bacteria | 8019629233 | 8019630848 | 435 |
| 1227 | iso_pu_bacteria | 8019648815 | 8019651936 | 435 |
| 1228 | iso_pu_bacteria | 8019659431 | 8019667865 | 435 |
| 1229 | iso_pu_bacteria | 8019678201 | 8019678703 | 435 |
| 1230 | iso_pu_bacteria | 8019687851 | 8019696813 | 435 |
| 1231 | iso_pu_bacteria | 8055742211 | 8055750884 | 435 |
| 1232 | iso_pu_bacteria | 8056967851 | 8056975567 | 435 |
| 1233 | 3300001979 | JGI24740J21852_10001156 | JGI24740J21852_100011568 | 436 |
| 1234 | 3300002704 | JGI25155J39150_1000012 | JGI25155J39150_1000012107 | 436 |
| 1235 | 3300002705 | JGI25156J39149_1000036 | JGI25156J39149_100003674 | 436 |
| 1236 | 3300002737 | JGI25162J39368_1000146 | JGI25162J39368_100014661 | 436 |
| 1237 | 3300002737 | JGI25162J39368_1000616 | JGI25162J39368_10006164 | 436 |
| 1238 | 3300002737 | JGI25162J39368_1000674 | JGI25162J39368_10006741 | 436 |
| 1239 | 3300002738 | JGI25154J39366_1000033 | JGI25154J39366_100003366 | 436 |
| 1240 | 3300002741 | JGI25157J39369_1000457 | JGI25157J39369_100045727 | 436 |
| 1241 | 3300002741 | JGI25157J39369_1000542 | JGI25157J39369_100054217 | 436 |
| 1242 | 3300002773 | JGI25152J39213_1001129 | JGI25152J39213_10011294 | 436 |
| 1243 | 3300002773 | JGI25152J39213_1002051 | JGI25152J39213_10020514 | 436 |
| 1244 | 3300002773 | JGI25152J39213_1002782 | JGI25152J39213_10027823 | 436 |
| 1245 | 3300002773 | JGI25152J39213_1002804 | JGI25152J39213_10028046 | 436 |
| 1246 | 3300002774 | JGI25150J39212_1000063 | JGI25150J39212_100006337 | 436 |
| 1247 | 3300002987 | JGI25159J45721_1000092 | JGI25159J45721_100009240 | 436 |
| 1248 | 3300002987 | JGI25159J45721_1000464 | JGI25159J45721_10004646 | 436 |
| 1249 | 3300003187 | JGI25151J46595_10000140 | JGI25151J46595_1000014070 | 436 |
| 1250 | 3300003187 | JGI25151J46595_10001756 | JGI25151J46595_100017566 | 436 |
| 1251 | 3300003187 | JGI25151J46595_10004817 | JGI25151J46595_100048175 | 436 |
| 1252 | 3300003203 | JGI25406J46586_10009739 | JGI25406J46586_100097392 | 436 |
| 1253 | 3300003214 | JGI25165J46597_1000653 | JGI25165J46597_10006534 | 436 |
| 1254 | 3300003214 | JGI25165J46597_1000719 | JGI25165J46597_100071914 | 436 |
| 1255 | 3300003214 | JGI25165J46597_1001438 | JGI25165J46597_10014386 | 436 |
| 1256 | 3300003215 | JGI25153J46596_10003062 | JGI25153J46596_100030626 | 436 |
| 1257 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_1000006138 | 436 |
| 1258 | 3300003354 | JGI25160J50197_1000877 | JGI25160J50197_10008772 | 436 |
| 1259 | 3300003354 | JGI25160J50197_1001286 | JGI25160J50197_100128612 | 436 |
| 1260 | 3300003354 | JGI25160J50197_1001787 | JGI25160J50197_10017872 | 436 |
| 1261 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_1000004138 | 436 |
| 1262 | 3300003374 | JGI25161J50226_1000103 | JGI25161J50226_100010347 | 436 |
| 1263 | 3300003374 | JGI25161J50226_1000116 | JGI25161J50226_10001162 | 436 |
| 1264 | 3300003374 | JGI25161J50226_1001626 | JGI25161J50226_10016265 | 436 |
| 1265 | 3300003762 | Ga0055542_1001041 | Ga0055542_10010415 | 436 |
| 1266 | 3300003771 | Ga0055526_1001877 | Ga0055526_10018778 | 436 |
| 1267 | 3300003771 | Ga0055526_1002290 | Ga0055526_10022902 | 436 |
| 1268 | 3300003771 | Ga0055526_1016674 | Ga0055526_10166743 | 436 |
| 1269 | 3300003775 | Ga0055524_1000790 | Ga0055524_100079016 | 436 |
| 1270 | 3300003775 | Ga0055524_1001459 | Ga0055524_10014599 | 436 |
| 1271 | 3300003781 | Ga0055536_1014991 | Ga0055536_10149912 | 436 |
| 1272 | 3300003790 | Ga0055528_1000548 | Ga0055528_100054818 | 436 |
| 1273 | 3300003790 | Ga0055528_1000886 | Ga0055528_100088614 | 436 |
| 1274 | 3300003790 | Ga0055528_1003424 | Ga0055528_10034242 | 436 |
| 1275 | 3300003790 | Ga0055528_1011189 | Ga0055528_10111892 | 436 |
| 1276 | 3300003792 | Ga0055540_1000548 | Ga0055540_10005485 | 436 |
| 1277 | 3300003792 | Ga0055540_1010663 | Ga0055540_10106634 | 436 |
| 1278 | 3300003856 | Ga0058692_1008879 | Ga0058692_10088792 | 436 |
| 1279 | 3300004625 | Ga0055543_1000002 | Ga0055543_1000002197 | 436 |
| 1280 | 3300004625 | Ga0055543_1000029 | Ga0055543_100002924 | 436 |
| 1281 | 3300004625 | Ga0055543_1000337 | Ga0055543_10003372 | 436 |
| 1282 | 3300004625 | Ga0055543_1001407 | Ga0055543_10014075 | 436 |
| 1283 | 3300005262 | Ga0065165_1000196 | Ga0065165_100019622 | 436 |
| 1284 | 3300005262 | Ga0065165_1001746 | Ga0065165_100174613 | 436 |
| 1285 | 3300005262 | Ga0065165_1004041 | Ga0065165_10040418 | 436 |
| 1286 | 3300005262 | Ga0065165_1005489 | Ga0065165_10054895 | 436 |
| 1287 | 3300005262 | Ga0065165_1017482 | Ga0065165_10174821 | 436 |
| 1288 | 3300005331 | Ga0070670_100006699 | Ga0070670_1000066998 | 436 |
| 1289 | 3300005340 | Ga0070689_100063568 | Ga0070689_1000635681 | 436 |
| 1290 | 3300005347 | Ga0070668_100044222 | Ga0070668_1000442222 | 436 |
| 1291 | 3300005353 | Ga0070669_100158925 | Ga0070669_1001589252 | 436 |
| 1292 | 3300005355 | Ga0070671_100057072 | Ga0070671_1000570724 | 436 |
| 1293 | 3300005438 | Ga0070701_10021591 | Ga0070701_100215912 | 436 |
| 1294 | 3300005440 | Ga0070705_100145598 | Ga0070705_1001455982 | 436 |
| 1295 | 3300005445 | Ga0070708_100188175 | Ga0070708_1001881751 | 436 |
| 1296 | 3300005468 | Ga0070707_100268054 | Ga0070707_1002680542 | 436 |
| 1297 | 3300005539 | Ga0068853_100024508 | Ga0068853_1000245083 | 436 |
| 1298 | 3300005548 | Ga0070665_100042121 | Ga0070665_1000421212 | 436 |
| 1299 | 3300005548 | Ga0070665_100133580 | Ga0070665_1001335802 | 436 |
| 1300 | 3300005614 | Ga0068856_100180813 | Ga0068856_1001808133 | 436 |
| 1301 | 3300005617 | Ga0068859_100091038 | Ga0068859_1000910382 | 436 |
| 1302 | 3300005844 | Ga0068862_100110024 | Ga0068862_1001100242 | 436 |
| 1303 | 3300005937 | Ga0081455_10051502 | Ga0081455_100515023 | 436 |
| 1304 | 3300005985 | Ga0081539_10001815 | Ga0081539_100018158 | 436 |
| 1305 | 3300006038 | Ga0075365_10010764 | Ga0075365_100107642 | 436 |
| 1306 | 3300006038 | Ga0075365_10015316 | Ga0075365_100153164 | 436 |
| 1307 | 3300006038 | Ga0075365_10061156 | Ga0075365_100611562 | 436 |
| 1308 | 3300006038 | Ga0075365_10067310 | Ga0075365_100673102 | 436 |
| 1309 | 3300006038 | Ga0075365_10070522 | Ga0075365_100705222 | 436 |
| 1310 | 3300006038 | Ga0075365_10124345 | Ga0075365_101243452 | 436 |
| 1311 | 3300006038 | Ga0075365_10202682 | Ga0075365_102026821 | 436 |
| 1312 | 3300006048 | Ga0075363_100005203 | Ga0075363_1000052034 | 436 |
| 1313 | 3300006048 | Ga0075363_100057919 | Ga0075363_1000579192 | 436 |
| 1314 | 3300006051 | Ga0075364_10001625 | Ga0075364_100016254 | 436 |
| 1315 | 3300006051 | Ga0075364_10023758 | Ga0075364_100237583 | 436 |
| 1316 | 3300006177 | Ga0075362_10009934 | Ga0075362_100099343 | 436 |
| 1317 | 3300006177 | Ga0075362_10041803 | Ga0075362_100418031 | 436 |
| 1318 | 3300006178 | Ga0075367_10004539 | Ga0075367_100045392 | 436 |
| 1319 | 3300006178 | Ga0075367_10018322 | Ga0075367_100183222 | 436 |
| 1320 | 3300006178 | Ga0075367_10072640 | Ga0075367_100726403 | 436 |
| 1321 | 3300006178 | Ga0075367_10080318 | Ga0075367_100803182 | 436 |
| 1322 | 3300006195 | Ga0075366_10073059 | Ga0075366_100730592 | 436 |
| 1323 | 3300006353 | Ga0075370_10000839 | Ga0075370_100008395 | 436 |
| 1324 | 3300006844 | Ga0075428_100005976 | Ga0075428_1000059769 | 436 |
| 1325 | 3300006846 | Ga0075430_100000852 | Ga0075430_1000008529 | 436 |
| 1326 | 3300006846 | Ga0075430_100008547 | Ga0075430_1000085473 | 436 |
| 1327 | 3300006847 | Ga0075431_100084545 | Ga0075431_1000845452 | 436 |
| 1328 | 3300006880 | Ga0075429_100000927 | Ga0075429_1000009272 | 436 |
| 1329 | 3300006880 | Ga0075429_100143608 | Ga0075429_1001436082 | 436 |
| 1330 | 3300006931 | Ga0097620_100091038 | Ga0097620_1000910382 | 436 |
| 1331 | 3300006946 | Ga0079104_1000042 | Ga0079104_100004228 | 436 |
| 1332 | 3300006946 | Ga0079104_1009436 | Ga0079104_10094361 | 436 |
| 1333 | 3300006948 | Ga0099826_10003152 | Ga0099826_100031524 | 436 |
| 1334 | 3300009011 | Ga0105251_10026227 | Ga0105251_100262272 | 436 |
| 1335 | 3300009093 | Ga0105240_10000019 | Ga0105240_10000019112 | 436 |
| 1336 | 3300009094 | Ga0111539_10001873 | Ga0111539_100018737 | 436 |
| 1337 | 3300009094 | Ga0111539_10004595 | Ga0111539_1000459510 | 436 |
| 1338 | 3300009147 | Ga0114129_10000293 | Ga0114129_1000029329 | 436 |
| 1339 | 3300009148 | Ga0105243_10054480 | Ga0105243_100544802 | 436 |
| 1340 | 3300009177 | Ga0105248_10071041 | Ga0105248_100710412 | 436 |
| 1341 | 3300009545 | Ga0105237_10033689 | Ga0105237_100336893 | 436 |
| 1342 | 3300009545 | Ga0105237_10101978 | Ga0105237_101019783 | 436 |
| 1343 | 3300009553 | Ga0105249_10017064 | Ga0105249_100170643 | 436 |
| 1344 | 3300009553 | Ga0105249_10181544 | Ga0105249_101815442 | 436 |
| 1345 | 3300009765 | Ga0123341_1000015 | Ga0123341_100001520 | 436 |
| 1346 | 3300013102 | Ga0157371_10000005 | Ga0157371_10000005350 | 436 |
| 1347 | 3300013104 | Ga0157370_10000036 | Ga0157370_1000003630 | 436 |
| 1348 | 3300013104 | Ga0157370_10002915 | Ga0157370_1000291510 | 436 |
| 1349 | 3300013104 | Ga0157370_10293465 | Ga0157370_102934651 | 436 |
| 1350 | 3300013249 | Ga0171463_1014 | Ga0171463_101472 | 436 |
| 1351 | 3300015262 | Ga0182007_10017364 | Ga0182007_100173643 | 436 |
| 1352 | 3300015262 | Ga0182007_10022122 | Ga0182007_100221222 | 436 |
| 1353 | 3300015690 | Ga0183363_1052 | Ga0183363_105227 | 436 |
| 1354 | 3300021320 | Ga0214544_1000063 | Ga0214544_100006369 | 436 |
| 1355 | 3300021321 | Ga0214542_1000095 | Ga0214542_100009559 | 436 |
| 1356 | 3300021327 | Ga0214543_1000008 | Ga0214543_1000008269 | 436 |
| 1357 | 3300021327 | Ga0214543_1000026 | Ga0214543_100002659 | 436 |
| 1358 | 3300021384 | Ga0213876_10038669 | Ga0213876_100386691 | 436 |
| 1359 | 3300022739 | Ga0228711_1000003 | Ga0228711_1000003195 | 436 |
| 1360 | 3300022740 | Ga0228710_1000003 | Ga0228710_1000003201 | 436 |
| 1361 | 3300025206 | Ga0209435_100005 | Ga0209435_100005107 | 436 |
| 1362 | 3300025208 | Ga0209436_100041 | Ga0209436_10004157 | 436 |
| 1363 | 3300025208 | Ga0209436_105270 | Ga0209436_1052703 | 436 |
| 1364 | 3300025233 | Ga0209437_100078 | Ga0209437_100078133 | 436 |
| 1365 | 3300025233 | Ga0209437_100174 | Ga0209437_10017446 | 436 |
| 1366 | 3300025245 | Ga0207425_1000080 | Ga0207425_100008070 | 436 |
| 1367 | 3300025245 | Ga0207425_1003292 | Ga0207425_10032923 | 436 |
| 1368 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011107 | 436 |
| 1369 | 3300025246 | Ga0209646_1006491 | Ga0209646_10064912 | 436 |
| 1370 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008107 | 436 |
| 1371 | 3300025250 | Ga0209026_1000050 | Ga0209026_1000050200 | 436 |
| 1372 | 3300025253 | Ga0209677_101144 | Ga0209677_1011447 | 436 |
| 1373 | 3300025254 | Ga0209148_1000032 | Ga0209148_1000032458 | 436 |
| 1374 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004107 | 436 |
| 1375 | 3300025256 | Ga0209759_1000233 | Ga0209759_100023371 | 436 |
| 1376 | 3300025258 | Ga0209129_1000195 | Ga0209129_100019531 | 436 |
| 1377 | 3300025258 | Ga0209129_1000199 | Ga0209129_100019954 | 436 |
| 1378 | 3300025258 | Ga0209129_1001192 | Ga0209129_10011929 | 436 |
| 1379 | 3300025258 | Ga0209129_1002022 | Ga0209129_10020227 | 436 |
| 1380 | 3300025258 | Ga0209129_1004508 | Ga0209129_10045084 | 436 |
| 1381 | 3300025258 | Ga0209129_1004637 | Ga0209129_10046374 | 436 |
| 1382 | 3300025261 | Ga0209233_1000034 | Ga0209233_100003417 | 436 |
| 1383 | 3300025261 | Ga0209233_1000163 | Ga0209233_1000163133 | 436 |
| 1384 | 3300025261 | Ga0209233_1000299 | Ga0209233_100029931 | 436 |
| 1385 | 3300025261 | Ga0209233_1000305 | Ga0209233_100030530 | 436 |
| 1386 | 3300025272 | Ga0209455_1000085 | Ga0209455_1000085214 | 436 |
| 1387 | 3300025272 | Ga0209455_1008371 | Ga0209455_10083712 | 436 |
| 1388 | 3300025273 | Ga0209673_1000037 | Ga0209673_100003783 | 436 |
| 1389 | 3300025273 | Ga0209673_1000320 | Ga0209673_100032019 | 436 |
| 1390 | 3300025273 | Ga0209673_1000880 | Ga0209673_100088030 | 436 |
| 1391 | 3300025273 | Ga0209673_1000924 | Ga0209673_100092418 | 436 |
| 1392 | 3300025273 | Ga0209673_1003302 | Ga0209673_10033023 | 436 |
| 1393 | 3300025273 | Ga0209673_1007876 | Ga0209673_10078763 | 436 |
| 1394 | 3300025284 | Ga0209130_1000030 | Ga0209130_1000030102 | 436 |
| 1395 | 3300025284 | Ga0209130_1000032 | Ga0209130_1000032132 | 436 |
| 1396 | 3300025284 | Ga0209130_1000198 | Ga0209130_100019871 | 436 |
| 1397 | 3300025284 | Ga0209130_1010028 | Ga0209130_10100281 | 436 |
| 1398 | 3300025292 | Ga0209676_1005216 | Ga0209676_10052162 | 436 |
| 1399 | 3300025292 | Ga0209676_1007354 | Ga0209676_10073543 | 436 |
| 1400 | 3300025294 | Ga0209025_1000052 | Ga0209025_1000052207 | 436 |
| 1401 | 3300025294 | Ga0209025_1000074 | Ga0209025_100007456 | 436 |
| 1402 | 3300025294 | Ga0209025_1000080 | Ga0209025_1000080237 | 436 |
| 1403 | 3300025294 | Ga0209025_1000332 | Ga0209025_100033270 | 436 |
| 1404 | 3300025294 | Ga0209025_1000339 | Ga0209025_100033920 | 436 |
| 1405 | 3300025294 | Ga0209025_1000354 | Ga0209025_100035421 | 436 |
| 1406 | 3300025294 | Ga0209025_1000566 | Ga0209025_100056623 | 436 |
| 1407 | 3300025294 | Ga0209025_1051465 | Ga0209025_10514651 | 436 |
| 1408 | 3300025295 | Ga0209564_1000207 | Ga0209564_100020727 | 436 |
| 1409 | 3300025295 | Ga0209564_1000345 | Ga0209564_100034519 | 436 |
| 1410 | 3300025295 | Ga0209564_1000353 | Ga0209564_10003532 | 436 |
| 1411 | 3300025295 | Ga0209564_1001668 | Ga0209564_100166817 | 436 |
| 1412 | 3300025295 | Ga0209564_1011812 | Ga0209564_10118123 | 436 |
| 1413 | 3300025297 | Ga0209758_1000105 | Ga0209758_100010527 | 436 |
| 1414 | 3300025297 | Ga0209758_1000263 | Ga0209758_100026370 | 436 |
| 1415 | 3300025297 | Ga0209758_1000561 | Ga0209758_100056144 | 436 |
| 1416 | 3300025297 | Ga0209758_1001323 | Ga0209758_100132322 | 436 |
| 1417 | 3300025297 | Ga0209758_1001789 | Ga0209758_100178913 | 436 |
| 1418 | 3300025297 | Ga0209758_1002280 | Ga0209758_10022809 | 436 |
| 1419 | 3300025297 | Ga0209758_1002342 | Ga0209758_10023429 | 436 |
| 1420 | 3300025297 | Ga0209758_1018773 | Ga0209758_10187733 | 436 |
| 1421 | 3300025297 | Ga0209758_1032328 | Ga0209758_10323281 | 436 |
| 1422 | 3300025298 | Ga0209050_1003774 | Ga0209050_10037746 | 436 |
| 1423 | 3300025298 | Ga0209050_1008822 | Ga0209050_10088224 | 436 |
| 1424 | 3300025299 | Ga0209256_1000343 | Ga0209256_100034366 | 436 |
| 1425 | 3300025299 | Ga0209256_1000348 | Ga0209256_100034859 | 436 |
| 1426 | 3300025299 | Ga0209256_1000368 | Ga0209256_100036831 | 436 |
| 1427 | 3300025299 | Ga0209256_1003220 | Ga0209256_100322010 | 436 |
| 1428 | 3300025299 | Ga0209256_1004594 | Ga0209256_10045947 | 436 |
| 1429 | 3300025299 | Ga0209256_1007480 | Ga0209256_10074802 | 436 |
| 1430 | 3300025302 | Ga0207426_1000047 | Ga0207426_1000047298 | 436 |
| 1431 | 3300025302 | Ga0207426_1000048 | Ga0207426_1000048308 | 436 |
| 1432 | 3300025302 | Ga0207426_1000077 | Ga0207426_1000077132 | 436 |
| 1433 | 3300025302 | Ga0207426_1000296 | Ga0207426_100029621 | 436 |
| 1434 | 3300025302 | Ga0207426_1000985 | Ga0207426_10009859 | 436 |
| 1435 | 3300025303 | Ga0209051_1000236 | Ga0209051_100023637 | 436 |
| 1436 | 3300025303 | Ga0209051_1000517 | Ga0209051_100051729 | 436 |
| 1437 | 3300025303 | Ga0209051_1003116 | Ga0209051_10031162 | 436 |
| 1438 | 3300025303 | Ga0209051_1006923 | Ga0209051_10069234 | 436 |
| 1439 | 3300025303 | Ga0209051_1007923 | Ga0209051_10079232 | 436 |
| 1440 | 3300025303 | Ga0209051_1017517 | Ga0209051_10175172 | 436 |
| 1441 | 3300025304 | Ga0209257_1011867 | Ga0209257_10118671 | 436 |
| 1442 | 3300025901 | Ga0207688_10067120 | Ga0207688_100671202 | 436 |
| 1443 | 3300025907 | Ga0207645_10096755 | Ga0207645_100967551 | 436 |
| 1444 | 3300025913 | Ga0207695_10000049 | Ga0207695_10000049114 | 436 |
| 1445 | 3300025914 | Ga0207671_10000107 | Ga0207671_1000010755 | 436 |
| 1446 | 3300025914 | Ga0207671_10019495 | Ga0207671_100194953 | 436 |
| 1447 | 3300025925 | Ga0207650_10005592 | Ga0207650_100055921 | 436 |
| 1448 | 3300025935 | Ga0207709_10043168 | Ga0207709_100431682 | 436 |
| 1449 | 3300025961 | Ga0207712_10023861 | Ga0207712_100238613 | 436 |
| 1450 | 3300025972 | Ga0207668_10120463 | Ga0207668_101204631 | 436 |
| 1451 | 3300025981 | Ga0207640_10089470 | Ga0207640_100894701 | 436 |
| 1452 | 3300026078 | Ga0207702_10103179 | Ga0207702_101031792 | 436 |
| 1453 | 3300026089 | Ga0207648_10053604 | Ga0207648_100536044 | 436 |
| 1454 | 3300026118 | Ga0207675_100050326 | Ga0207675_1000503262 | 436 |
| 1455 | 3300026142 | Ga0207698_10252891 | Ga0207698_102528911 | 436 |
| 1456 | 3300027111 | Ga0209281_1000081 | Ga0209281_1000081195 | 436 |
| 1457 | 3300027111 | Ga0209281_1000141 | Ga0209281_100014183 | 436 |
| 1458 | 3300027111 | Ga0209281_1000194 | Ga0209281_100019428 | 436 |
| 1459 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003304 | 436 |
| 1460 | 3300027312 | Ga0209371_1003578 | Ga0209371_10035783 | 436 |
| 1461 | 3300027312 | Ga0209371_1007496 | Ga0209371_10074962 | 436 |
| 1462 | 3300027312 | Ga0209371_1009533 | Ga0209371_10095333 | 436 |
| 1463 | 3300027666 | Ga0209282_1000036 | Ga0209282_100003643 | 436 |
| 1464 | 3300027666 | Ga0209282_1000245 | Ga0209282_100024524 | 436 |
| 1465 | 3300027866 | Ga0209813_10008959 | Ga0209813_100089591 | 436 |
| 1466 | 3300027907 | Ga0207428_10159438 | Ga0207428_101594382 | 436 |
| 1467 | 3300028380 | Ga0268265_10066200 | Ga0268265_100662002 | 436 |
| 1468 | 3300028380 | Ga0268265_10139494 | Ga0268265_101394942 | 436 |
| 1469 | 3300028381 | Ga0268264_10020771 | Ga0268264_100207713 | 436 |
| 1470 | 3300028563 | Ga0265319_1026169 | Ga0265319_10261692 | 436 |
| 1471 | 3300028577 | Ga0265318_10033461 | Ga0265318_100334612 | 436 |
| 1472 | 3300028794 | Ga0307515_10001520 | Ga0307515_1000152043 | 436 |
| 1473 | 3300028794 | Ga0307515_10006129 | Ga0307515_100061296 | 436 |
| 1474 | 3300028794 | Ga0307515_10100689 | Ga0307515_101006893 | 436 |
| 1475 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004747 | 436 |
| 1476 | 3300030500 | Ga0268256_1010141 | Ga0268256_10101412 | 436 |
| 1477 | 3300030500 | Ga0268256_1015653 | Ga0268256_10156532 | 436 |
| 1478 | 3300030744 | Ga0316181_1110178 | Ga0316181_11101782 | 436 |
| 1479 | 3300031241 | Ga0265325_10084294 | Ga0265325_100842941 | 436 |
| 1480 | 3300031456 | Ga0307513_10003087 | Ga0307513_100030879 | 436 |
| 1481 | 3300031456 | Ga0307513_10003471 | Ga0307513_1000347120 | 436 |
| 1482 | 3300031712 | Ga0265342_10104380 | Ga0265342_101043802 | 436 |
| 1483 | 3300031731 | Ga0307405_10000333 | Ga0307405_1000033316 | 436 |
| 1484 | 3300031852 | Ga0307410_10017254 | Ga0307410_100172543 | 436 |
| 1485 | 3300031901 | Ga0307406_10079726 | Ga0307406_100797262 | 436 |
| 1486 | 3300031911 | Ga0307412_10005005 | Ga0307412_100050055 | 436 |
| 1487 | 3300031967 | Ga0315914_1000002 | Ga0315914_1000002301 | 436 |
| 1488 | 3300033430 | Ga0315913_1000009 | Ga0315913_100000943 | 436 |
| 1489 | 3300033464 | Ga0315915_1000005 | Ga0315915_1000005301 | 436 |
| 1490 | 3300035692 | Ga0373935_0039661 | Ga0373935_0039661_35_1345 | 436 |
| 1491 | 3300035695 | Ga0373927_0000047 | Ga0373927_0000047_39617_40927 | 436 |
| 1492 | 3300036712 | Ga0316584_0130159 | Ga0316584_0130159_204_1517 | 436 |
| 1493 | 3300037068 | Ga0373925_0001420 | Ga0373925_0001420_7575_8885 | 436 |
| 1494 | 3300037312 | Ga0395899_0000030 | Ga0395899_0000030_114099_115409 | 436 |
| 1495 | 3300037418 | Ga0395900_0000023 | Ga0395900_0000023_120505_121815 | 436 |
| 1496 | 3300037418 | Ga0395900_0174865 | Ga0395900_0174865_324_1649 | 436 |
| 1497 | 3300037466 | Ga0395898_0000038 | Ga0395898_0000038_114099_115409 | 436 |
| 1498 | 3300037471 | Ga0395905_0000021 | Ga0395905_0000021_114099_115409 | 436 |
| 1499 | 3300037471 | Ga0395905_0001828 | Ga0395905_0001828_17438_18748 | 436 |
| 1500 | 3300037471 | Ga0395905_0043048 | Ga0395905_0043048_483_1808 | 436 |
| 1501 | 3300037471 | Ga0395905_0090275 | Ga0395905_0090275_777_2102 | 436 |
| 1502 | 3300037471 | Ga0395905_0170337 | Ga0395905_0170337_612_1937 | 436 |
| 1503 | 3300038443 | Ga0395901_0000018 | Ga0395901_0000018_120505_121815 | 436 |
| 1504 | 3300039062 | Ga0400483_056535 | Ga0400483_056535_22717_24039 | 436 |
| 1505 | 3300039062 | Ga0400483_064331 | Ga0400483_064331_588_1910 | 436 |
| 1506 | 3300039062 | Ga0400483_225954 | Ga0400483_225954_1066_2388 | 436 |
| 1507 | 3300039437 | Ga0436365_0966943 | Ga0436365_0966943_1422_2732 | 436 |
| 1508 | 3300039438 | Ga0436360_0078821 | Ga0436360_0078821_772_2085 | 436 |
| 1509 | 3300039447 | Ga0436361_0656175 | Ga0436361_0656175_2462_3772 | 436 |
| 1510 | 3300041404 | Ga0439436_0011526 | Ga0439436_0011526_1099_2409 | 436 |
| 1511 | 3300041413 | Ga0439465_0002349 | Ga0439465_0002349_3046_4356 | 436 |
| 1512 | 3300041451 | Ga0451791_1838827 | Ga0451791_1838827_90_1400 | 436 |
| 1513 | 3300041458 | Ga0451798_0601713 | Ga0451798_0601713_258_1568 | 436 |
| 1514 | 3300041494 | Ga0451837_0668917 | Ga0451837_0668917_1102_2412 | 436 |
| 1515 | 3300041498 | Ga0451841_0495290 | Ga0451841_0495290_1088_2398 | 436 |
| 1516 | 3300042001 | Ga0439441_010430 | Ga0439441_010430_166_1476 | 436 |
| 1517 | 3300042007 | Ga0439449_0004566 | Ga0439449_0004566_3697_5007 | 436 |
| 1518 | 3300042007 | Ga0439449_0030804 | Ga0439449_0030804_473_1783 | 436 |
| 1519 | 3300044684 | Ga0466966_0036092 | Ga0466966_0036092_1796_3106 | 436 |
| 1520 | 3300044712 | Ga0453684_0048819 | Ga0453684_0048819_2354_3667 | 436 |
| 1521 | 3300044765 | Ga0466970_0007062 | Ga0466970_0007062_412_1722 | 436 |
| 1522 | 3300046459 | Ga0495629_0096059 | Ga0495629_0096059_146_1456 | 436 |
| 1523 | 3300046460 | Ga0495638_0076673 | Ga0495638_0076673_169_1479 | 436 |
| 1524 | 3300046474 | Ga0495605_0025255 | Ga0495605_0025255_690_2006 | 436 |
| 1525 | 3300046492 | Ga0495585_0018784 | Ga0495585_0018784_1783_3093 | 436 |
| 1526 | 3300046507 | Ga0495606_0000629 | Ga0495606_0000629_1168_2478 | 436 |
| 1527 | 3300046507 | Ga0495606_0002219 | Ga0495606_0002219_8087_9397 | 436 |
| 1528 | 3300046507 | Ga0495606_0013151 | Ga0495606_0013151_4068_5378 | 436 |
| 1529 | 3300046513 | Ga0495616_0093071 | Ga0495616_0093071_60_1370 | 436 |
| 1530 | 3300046519 | Ga0495632_0025688 | Ga0495632_0025688_1224_2534 | 436 |
| 1531 | 3300046519 | Ga0495632_0061201 | Ga0495632_0061201_488_1798 | 436 |
| 1532 | 3300046522 | Ga0495643_0023336 | Ga0495643_0023336_1169_2479 | 436 |
| 1533 | 3300046522 | Ga0495643_0023803 | Ga0495643_0023803_669_1979 | 436 |
| 1534 | 3300046522 | Ga0495643_0028720 | Ga0495643_0028720_1196_2521 | 436 |
| 1535 | 3300046524 | Ga0495648_0016311 | Ga0495648_0016311_807_2117 | 436 |
| 1536 | 3300046530 | Ga0495654_0001861 | Ga0495654_0001861_9087_10412 | 436 |
| 1537 | 3300046536 | Ga0495587_0072106 | Ga0495587_0072106_454_1764 | 436 |
| 1538 | 3300046558 | Ga0495633_0088023 | Ga0495633_0088023_16_1326 | 436 |
| 1539 | 3300046660 | Ga0495625_0015812 | Ga0495625_0015812_577_1887 | 436 |
| 1540 | 3300046660 | Ga0495625_0031642 | Ga0495625_0031642_2391_3701 | 436 |
| 1541 | 3300046665 | Ga0495661_0060714 | Ga0495661_0060714_241_1551 | 436 |
| 1542 | 3300046674 | Ga0495588_0032887 | Ga0495588_0032887_531_1841 | 436 |
| 1543 | 3300047443 | Ga0495687_048323 | Ga0495687_048323_383_1693 | 436 |
| 1544 | 3300047472 | Ga0495686_0002643 | Ga0495686_0002643_7822_9132 | 436 |
| 1545 | 3300048904 | Ga0496101_0031137 | Ga0496101_0031137_418_1734 | 436 |
| 1546 | 3300048905 | Ga0496102_0059349 | Ga0496102_0059349_666_1982 | 436 |
| 1547 | 3300048907 | Ga0496104_0016934 | Ga0496104_0016934_4892_6208 | 436 |
| 1548 | 3300048908 | Ga0496105_0034708 | Ga0496105_0034708_1018_2334 | 436 |
| 1549 | 3300048910 | Ga0496107_0106317 | Ga0496107_0106317_53_1363 | 436 |
| 1550 | 3300048912 | Ga0496109_0188238 | Ga0496109_0188238_85_1401 | 436 |
| 1551 | 3300048914 | Ga0496111_0000570 | Ga0496111_0000570_2963_4273 | 436 |
| 1552 | 3300048919 | Ga0496116_0000097 | Ga0496116_0000097_168525_169835 | 436 |
| 1553 | 3300048919 | Ga0496116_0035905 | Ga0496116_0035905_1472_2782 | 436 |
| 1554 | 3300048920 | Ga0496117_0000030 | Ga0496117_0000030_124835_126145 | 436 |
| 1555 | 3300048920 | Ga0496117_0002458 | Ga0496117_0002458_6867_8177 | 436 |
| 1556 | 3300048920 | Ga0496117_0005055 | Ga0496117_0005055_2304_3614 | 436 |
| 1557 | 3300048920 | Ga0496117_0030483 | Ga0496117_0030483_2772_4082 | 436 |
| 1558 | 3300048920 | Ga0496117_0062045 | Ga0496117_0062045_929_2239 | 436 |
| 1559 | 3300048920 | Ga0496117_0067662 | Ga0496117_0067662_541_1851 | 436 |
| 1560 | 3300048921 | Ga0496118_0005475 | Ga0496118_0005475_2569_3879 | 436 |
| 1561 | 3300048921 | Ga0496118_0010916 | Ga0496118_0010916_1977_3287 | 436 |
| 1562 | 3300048921 | Ga0496118_0018933 | Ga0496118_0018933_693_2003 | 436 |
| 1563 | 3300048921 | Ga0496118_0023602 | Ga0496118_0023602_3414_4724 | 436 |
| 1564 | 3300048922 | Ga0496119_0019969 | Ga0496119_0019969_2840_4150 | 436 |
| 1565 | 3300048922 | Ga0496119_0029278 | Ga0496119_0029278_509_1825 | 436 |
| 1566 | 3300048922 | Ga0496119_0037868 | Ga0496119_0037868_649_1959 | 436 |
| 1567 | 3300048922 | Ga0496119_0066315 | Ga0496119_0066315_550_1875 | 436 |
| 1568 | 3300048923 | Ga0496120_0000148 | Ga0496120_0000148_82408_83718 | 436 |
| 1569 | 3300048923 | Ga0496120_0006073 | Ga0496120_0006073_5194_6504 | 436 |
| 1570 | 3300048923 | Ga0496120_0044423 | Ga0496120_0044423_715_2040 | 436 |
| 1571 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_1043157_1044467 | 436 |
| 1572 | 3300048924 | Ga0496121_0000180 | Ga0496121_0000180_12027_13337 | 436 |
| 1573 | 3300048924 | Ga0496121_0003259 | Ga0496121_0003259_3655_4965 | 436 |
| 1574 | 3300048924 | Ga0496121_0020232 | Ga0496121_0020232_913_2223 | 436 |
| 1575 | 3300048924 | Ga0496121_0023174 | Ga0496121_0023174_3270_4580 | 436 |
| 1576 | 3300048924 | Ga0496121_0027611 | Ga0496121_0027611_2947_4257 | 436 |
| 1577 | 3300048925 | Ga0496122_0000024 | Ga0496122_0000024_150694_152004 | 436 |
| 1578 | 3300048925 | Ga0496122_0000050 | Ga0496122_0000050_45418_46728 | 436 |
| 1579 | 3300048925 | Ga0496122_0000107 | Ga0496122_0000107_101755_103065 | 436 |
| 1580 | 3300048925 | Ga0496122_0001243 | Ga0496122_0001243_12089_13405 | 436 |
| 1581 | 3300048925 | Ga0496122_0008479 | Ga0496122_0008479_5783_7093 | 436 |
| 1582 | 3300048925 | Ga0496122_0010876 | Ga0496122_0010876_7674_8984 | 436 |
| 1583 | 3300048925 | Ga0496122_0021073 | Ga0496122_0021073_689_1999 | 436 |
| 1584 | 3300048925 | Ga0496122_0029228 | Ga0496122_0029228_404_1714 | 436 |
| 1585 | 3300048925 | Ga0496122_0055523 | Ga0496122_0055523_709_2019 | 436 |
| 1586 | 3300048926 | Ga0496123_0000023 | Ga0496123_0000023_81604_82914 | 436 |
| 1587 | 3300048926 | Ga0496123_0000063 | Ga0496123_0000063_90044_91354 | 436 |
| 1588 | 3300048926 | Ga0496123_0000086 | Ga0496123_0000086_74293_75603 | 436 |
| 1589 | 3300048926 | Ga0496123_0003983 | Ga0496123_0003983_8125_9441 | 436 |
| 1590 | 3300048926 | Ga0496123_0009186 | Ga0496123_0009186_2817_4127 | 436 |
| 1591 | 3300048926 | Ga0496123_0052226 | Ga0496123_0052226_648_1958 | 436 |
| 1592 | 3300048926 | Ga0496123_0084740 | Ga0496123_0084740_515_1825 | 436 |
| 1593 | 3300048927 | Ga0496124_0000239 | Ga0496124_0000239_85916_87226 | 436 |
| 1594 | 3300048927 | Ga0496124_0001850 | Ga0496124_0001850_8961_10271 | 436 |
| 1595 | 3300048927 | Ga0496124_0003986 | Ga0496124_0003986_12314_13624 | 436 |
| 1596 | 3300048927 | Ga0496124_0005879 | Ga0496124_0005879_11522_12838 | 436 |
| 1597 | 3300048927 | Ga0496124_0010962 | Ga0496124_0010962_2634_3944 | 436 |
| 1598 | 3300048927 | Ga0496124_0015054 | Ga0496124_0015054_3640_4950 | 436 |
| 1599 | 3300048927 | Ga0496124_0030974 | Ga0496124_0030974_1584_2894 | 436 |
| 1600 | 3300048928 | Ga0496125_0000833 | Ga0496125_0000833_17312_18622 | 436 |
| 1601 | 3300048928 | Ga0496125_0000963 | Ga0496125_0000963_19461_20771 | 436 |
| 1602 | 3300048928 | Ga0496125_0003888 | Ga0496125_0003888_4014_5324 | 436 |
| 1603 | 3300048928 | Ga0496125_0048642 | Ga0496125_0048642_778_2088 | 436 |
| 1604 | 3300048928 | Ga0496125_0096697 | Ga0496125_0096697_430_1746 | 436 |
| 1605 | 3300048929 | Ga0496126_0000119 | Ga0496126_0000119_12018_13328 | 436 |
| 1606 | 3300048929 | Ga0496126_0000434 | Ga0496126_0000434_18978_20288 | 436 |
| 1607 | 3300048929 | Ga0496126_0048221 | Ga0496126_0048221_228_1538 | 436 |
| 1608 | 3300048929 | Ga0496126_0064335 | Ga0496126_0064335_60_1376 | 436 |
| 1609 | 3300048929 | Ga0496126_0140941 | Ga0496126_0140941_361_1671 | 436 |
| 1610 | 3300049568 | Ga0501031_0000006 | Ga0501031_0000006_120970_122280 | 436 |
| 1611 | 3300049568 | Ga0501031_0018057 | Ga0501031_0018057_2029_3339 | 436 |
| 1612 | 3300049569 | Ga0501032_0000013 | Ga0501032_0000013_98542_99852 | 436 |
| 1613 | 3300049569 | Ga0501032_0000016 | Ga0501032_0000016_120975_122285 | 436 |
| 1614 | 3300049569 | Ga0501032_0017003 | Ga0501032_0017003_148_1458 | 436 |
| 1615 | 3300049570 | Ga0501033_0000101 | Ga0501033_0000101_68954_70264 | 436 |
| 1616 | 3300049570 | Ga0501033_0000660 | Ga0501033_0000660_21499_22824 | 436 |
| 1617 | 3300049570 | Ga0501033_0009148 | Ga0501033_0009148_640_1950 | 436 |
| 1618 | 3300049571 | Ga0501034_0000054 | Ga0501034_0000054_202924_204234 | 436 |
| 1619 | 3300049571 | Ga0501034_0000168 | Ga0501034_0000168_52404_53714 | 436 |
| 1620 | 3300049571 | Ga0501034_0014819 | Ga0501034_0014819_3653_4963 | 436 |
| 1621 | 3300049571 | Ga0501034_0036336 | Ga0501034_0036336_511_1824 | 436 |
| 1622 | 3300049571 | Ga0501034_0043477 | Ga0501034_0043477_1835_3160 | 436 |
| 1623 | 3300049572 | Ga0501036_0000019 | Ga0501036_0000019_64930_66240 | 436 |
| 1624 | 3300049572 | Ga0501036_0000828 | Ga0501036_0000828_14347_15657 | 436 |
| 1625 | 3300049572 | Ga0501036_0006703 | Ga0501036_0006703_4094_5404 | 436 |
| 1626 | 3300049573 | Ga0501037_0000013 | Ga0501037_0000013_52404_53714 | 436 |
| 1627 | 3300049573 | Ga0501037_0000105 | Ga0501037_0000105_24966_26291 | 436 |
| 1628 | 3300049573 | Ga0501037_0005064 | Ga0501037_0005064_2716_4026 | 436 |
| 1629 | 3300049573 | Ga0501037_0006338 | Ga0501037_0006338_5421_6731 | 436 |
| 1630 | 3300049573 | Ga0501037_0031629 | Ga0501037_0031629_2020_3345 | 436 |
| 1631 | 3300049574 | Ga0501038_0000012 | Ga0501038_0000012_52404_53714 | 436 |
| 1632 | 3300049574 | Ga0501038_0001713 | Ga0501038_0001713_19033_20343 | 436 |
| 1633 | 3300049574 | Ga0501038_0016274 | Ga0501038_0016274_1339_2649 | 436 |
| 1634 | 3300049574 | Ga0501038_0133243 | Ga0501038_0133243_455_1765 | 436 |
| 1635 | 3300049574 | Ga0501038_0193044 | Ga0501038_0193044_215_1540 | 436 |
| 1636 | 3300049575 | Ga0501039_0000019 | Ga0501039_0000019_52404_53714 | 436 |
| 1637 | 3300049575 | Ga0501039_0000152 | Ga0501039_0000152_40563_41873 | 436 |
| 1638 | 3300049575 | Ga0501039_0222261 | Ga0501039_0222261_148_1458 | 436 |
| 1639 | 3300049576 | Ga0501040_0000768 | Ga0501040_0000768_17458_18768 | 436 |
| 1640 | 3300049577 | Ga0501041_0030414 | Ga0501041_0030414_1319_2629 | 436 |
| 1641 | 3300049578 | Ga0501042_0003664 | Ga0501042_0003664_4484_5794 | 436 |
| 1642 | 3300049579 | Ga0501043_0000014 | Ga0501043_0000014_6117_7427 | 436 |
| 1643 | 3300049579 | Ga0501043_0000055 | Ga0501043_0000055_41323_42648 | 436 |
| 1644 | 3300049579 | Ga0501043_0000209 | Ga0501043_0000209_2591_3901 | 436 |
| 1645 | 3300049579 | Ga0501043_0030311 | Ga0501043_0030311_2793_4103 | 436 |
| 1646 | 3300049579 | Ga0501043_0059365 | Ga0501043_0059365_1442_2752 | 436 |
| 1647 | 3300049580 | Ga0501046_0020472 | Ga0501046_0020472_2928_4238 | 436 |
| 1648 | 3300049581 | Ga0501047_0003446 | Ga0501047_0003446_7837_9147 | 436 |
| 1649 | 3300049581 | Ga0501047_0005984 | Ga0501047_0005984_5362_6672 | 436 |
| 1650 | 3300049581 | Ga0501047_0011138 | Ga0501047_0011138_5504_6829 | 436 |
| 1651 | 3300049581 | Ga0501047_0020376 | Ga0501047_0020376_1454_2764 | 436 |
| 1652 | 3300049582 | Ga0501048_0005288 | Ga0501048_0005288_3485_4795 | 436 |
| 1653 | 3300049584 | Ga0501068_0010106 | Ga0501068_0010106_3806_5116 | 436 |
| 1654 | 3300049585 | Ga0501069_0000106 | Ga0501069_0000106_25519_26844 | 436 |
| 1655 | 3300049585 | Ga0501069_0037080 | Ga0501069_0037080_1061_2386 | 436 |
| 1656 | 3300049586 | Ga0501070_0001320 | Ga0501070_0001320_748_2073 | 436 |
| 1657 | 3300049586 | Ga0501070_0003394 | Ga0501070_0003394_7981_9291 | 436 |
| 1658 | 3300049586 | Ga0501070_0005565 | Ga0501070_0005565_7992_9317 | 436 |
| 1659 | 3300049586 | Ga0501070_0016146 | Ga0501070_0016146_1492_2802 | 436 |
| 1660 | 3300049587 | Ga0501071_0001762 | Ga0501071_0001762_2467_3792 | 436 |
| 1661 | 3300049587 | Ga0501071_0032434 | Ga0501071_0032434_1079_2389 | 436 |
| 1662 | 3300049589 | Ga0501073_0030633 | Ga0501073_0030633_608_1918 | 436 |
| 1663 | 3300049590 | Ga0501074_0000072 | Ga0501074_0000072_15047_16372 | 436 |
| 1664 | 3300049590 | Ga0501074_0027619 | Ga0501074_0027619_2103_3413 | 436 |
| 1665 | 3300049742 | Ga0501080_0000878 | Ga0501080_0000878_9033_10358 | 436 |
| 1666 | 3300049742 | Ga0501080_0007242 | Ga0501080_0007242_4760_6070 | 436 |
| 1667 | 3300049744 | Ga0501083_0000484 | Ga0501083_0000484_12488_13813 | 436 |
| 1668 | 3300049744 | Ga0501083_0060413 | Ga0501083_0060413_522_1832 | 436 |
| 1669 | 3300049822 | Ga0501035_0000019 | Ga0501035_0000019_38167_39477 | 436 |
| 1670 | 3300049822 | Ga0501035_0000081 | Ga0501035_0000081_63740_65050 | 436 |
| 1671 | 3300049822 | Ga0501035_0000183 | Ga0501035_0000183_62347_63672 | 436 |
| 1672 | 3300049822 | Ga0501035_0004384 | Ga0501035_0004384_9431_10756 | 436 |
| 1673 | 3300049822 | Ga0501035_0012030 | Ga0501035_0012030_1934_3244 | 436 |
| 1674 | 3300049822 | Ga0501035_0065881 | Ga0501035_0065881_1503_2813 | 436 |
| 1675 | 3300049823 | Ga0501044_0000009 | Ga0501044_0000009_205182_206507 | 436 |
| 1676 | 3300049823 | Ga0501044_0000029 | Ga0501044_0000029_120975_122285 | 436 |
| 1677 | 3300049823 | Ga0501044_0004154 | Ga0501044_0004154_2802_4127 | 436 |
| 1678 | 3300049823 | Ga0501044_0008796 | Ga0501044_0008796_4762_6072 | 436 |
| 1679 | 3300049823 | Ga0501044_0020961 | Ga0501044_0020961_5600_6910 | 436 |
| 1680 | 3300049823 | Ga0501044_0021041 | Ga0501044_0021041_2502_3827 | 436 |
| 1681 | 3300049823 | Ga0501044_0046742 | Ga0501044_0046742_2801_4126 | 436 |
| 1682 | 3300049823 | Ga0501044_0051933 | Ga0501044_0051933_697_2034 | 436 |
| 1683 | 3300049823 | Ga0501044_0058456 | Ga0501044_0058456_930_2240 | 436 |
| 1684 | 3300049824 | Ga0501045_0005518 | Ga0501045_0005518_3971_5281 | 436 |
| 1685 | 3300049824 | Ga0501045_0059823 | Ga0501045_0059823_1358_2668 | 436 |
| 1686 | 3300050489 | nmdc:mga03683_55260_c1 | nmdc:mga03683_55260_c1_291_1616 | 436 |
| 1687 | 3300050490 | nmdc:mga03n38_10877_c1 | nmdc:mga03n38_10877_c1_970_2295 | 436 |
| 1688 | 3300050491 | nmdc:mga00v17_2647_c1 | nmdc:mga00v17_2647_c1_5406_6716 | 436 |
| 1689 | 3300050491 | nmdc:mga00v17_2942_c2 | nmdc:mga00v17_2942_c2_1009_2334 | 436 |
| 1690 | 3300050491 | nmdc:mga00v17_337_c1 | nmdc:mga00v17_337_c1_21255_22565 | 436 |
| 1691 | 3300050491 | nmdc:mga00v17_67377_c1 | nmdc:mga00v17_67377_c1_104_1414 | 436 |
| 1692 | 3300050492 | nmdc:mga0yw44_2133_c1 | nmdc:mga0yw44_2133_c1_3231_4556 | 436 |
| 1693 | 3300050492 | nmdc:mga0yw44_44224_c1 | nmdc:mga0yw44_44224_c1_1182_2534 | 436 |
| 1694 | 3300050493 | nmdc:mga0k408_7537_c1 | nmdc:mga0k408_7537_c1_4228_5538 | 436 |
| 1695 | 3300050494 | nmdc:mga06z11_40796_c1 | nmdc:mga06z11_40796_c1_262_1572 | 436 |
| 1696 | 3300050494 | nmdc:mga06z11_51034_c1 | nmdc:mga06z11_51034_c1_87_1397 | 436 |
| 1697 | 3300050494 | nmdc:mga06z11_63975_c1 | nmdc:mga06z11_63975_c1_164_1489 | 436 |
| 1698 | 3300050496 | nmdc:mga07m45_37856_c1 | nmdc:mga07m45_37856_c1_168_1478 | 436 |
| 1699 | 3300050496 | nmdc:mga07m45_39431_c1 | nmdc:mga07m45_39431_c1_549_1874 | 436 |
| 1700 | 3300050496 | nmdc:mga07m45_62749_c1 | nmdc:mga07m45_62749_c1_389_1699 | 436 |
| 1701 | 3300050507 | nmdc:mga05p37_227_c1 | nmdc:mga05p37_227_c1_36652_37989 | 436 |
| 1702 | 3300050508 | nmdc:mga09592_139472_c1 | nmdc:mga09592_139472_c1_106_1416 | 436 |
| 1703 | 3300050508 | nmdc:mga09592_578_c1 | nmdc:mga09592_578_c1_21439_22776 | 436 |
| 1704 | 3300050509 | nmdc:mga0qj67_12914_c1 | nmdc:mga0qj67_12914_c1_1743_3080 | 436 |
| 1705 | 3300050509 | nmdc:mga0qj67_9436_c1 | nmdc:mga0qj67_9436_c1_1601_2911 | 436 |
| 1706 | 3300050510 | nmdc:mga06r32_10595_c1 | nmdc:mga06r32_10595_c1_3012_4349 | 436 |
| 1707 | 3300050511 | nmdc:mga08y16_12387_c1 | nmdc:mga08y16_12387_c1_6269_7579 | 436 |
| 1708 | 3300050511 | nmdc:mga08y16_184793_c1 | nmdc:mga08y16_184793_c1_260_1600 | 436 |
| 1709 | 3300050516 | nmdc:mga0sz30_74_c2 | nmdc:mga0sz30_74_c2_21749_23059 | 436 |
| 1710 | 3300053086 | Ga0500578_0011996 | Ga0500578_0011996_2660_3970 | 436 |
| 1711 | 3300053107 | Ga0500560_000303 | Ga0500560_000303_586_1896 | 436 |
| 1712 | 3300053125 | Ga0500618_000109 | Ga0500618_000109_24598_25908 | 436 |
| 1713 | 3300053125 | Ga0500618_000114 | Ga0500618_000114_22225_23535 | 436 |
| 1714 | 3300053125 | Ga0500618_000249 | Ga0500618_000249_1883_3202 | 436 |
| 1715 | 3300053125 | Ga0500618_001997 | Ga0500618_001997_6275_7585 | 436 |
| 1716 | 3300053134 | Ga0500658_0001045 | Ga0500658_0001045_5474_6784 | 436 |
| 1717 | 3300053137 | Ga0500561_0000118 | Ga0500561_0000118_2631_3941 | 436 |
| 1718 | 3300053139 | Ga0500568_0000035 | Ga0500568_0000035_38959_40269 | 436 |
| 1719 | 3300053140 | Ga0500573_0010491 | Ga0500573_0010491_3397_4707 | 436 |
| 1720 | 3300053148 | Ga0500590_005965 | Ga0500590_005965_4075_5385 | 436 |
| 1721 | 3300053153 | Ga0500616_0002051 | Ga0500616_0002051_5664_6974 | 436 |
| 1722 | 3300053153 | Ga0500616_0014986 | Ga0500616_0014986_21_1337 | 436 |
| 1723 | 3300053153 | Ga0500616_0079814 | Ga0500616_0079814_61_1371 | 436 |
| 1724 | 3300053156 | Ga0500622_0005319 | Ga0500622_0005319_5486_6796 | 436 |
| 1725 | 3300053157 | Ga0500624_000988 | Ga0500624_000988_962_2272 | 436 |
| 1726 | 3300053177 | Ga0500636_0000005 | Ga0500636_0000005_153758_155068 | 436 |
| 1727 | 3300053177 | Ga0500636_0003484 | Ga0500636_0003484_7105_8415 | 436 |
| 1728 | 3300060353 | Ga0501082_0082547 | Ga0501082_0082547_557_1882 | 436 |
| 1729 | 3300003775 | Ga0055524_1022270 | Ga0055524_10222701 | 437 |
| 1730 | 3300005334 | Ga0068869_100115281 | Ga0068869_1001152812 | 437 |
| 1731 | 3300005444 | Ga0070694_100101799 | Ga0070694_1001017992 | 437 |
| 1732 | 3300005445 | Ga0070708_100000686 | Ga0070708_1000006868 | 437 |
| 1733 | 3300005457 | Ga0070662_100003105 | Ga0070662_1000031057 | 437 |
| 1734 | 3300005458 | Ga0070681_10089646 | Ga0070681_100896462 | 437 |
| 1735 | 3300005467 | Ga0070706_100000652 | Ga0070706_1000006522 | 437 |
| 1736 | 3300005468 | Ga0070707_100008026 | Ga0070707_1000080265 | 437 |
| 1737 | 3300005468 | Ga0070707_100050009 | Ga0070707_1000500092 | 437 |
| 1738 | 3300005471 | Ga0070698_100231330 | Ga0070698_1002313302 | 437 |
| 1739 | 3300005471 | Ga0070698_100310404 | Ga0070698_1003104041 | 437 |
| 1740 | 3300005518 | Ga0070699_100187558 | Ga0070699_1001875582 | 437 |
| 1741 | 3300005546 | Ga0070696_100008273 | Ga0070696_1000082734 | 437 |
| 1742 | 3300005719 | Ga0068861_100006986 | Ga0068861_1000069865 | 437 |
| 1743 | 3300005985 | Ga0081539_10004098 | Ga0081539_1000409817 | 437 |
| 1744 | 3300005985 | Ga0081539_10034584 | Ga0081539_100345842 | 437 |
| 1745 | 3300014968 | Ga0157379_10026503 | Ga0157379_100265032 | 437 |
| 1746 | 3300021361 | Ga0213872_10002930 | Ga0213872_100029306 | 437 |
| 1747 | 3300021388 | Ga0213875_10003139 | Ga0213875_100031393 | 437 |
| 1748 | 3300025910 | Ga0207684_10000698 | Ga0207684_100006982 | 437 |
| 1749 | 3300025910 | Ga0207684_10199062 | Ga0207684_101990621 | 437 |
| 1750 | 3300025918 | Ga0207662_10031681 | Ga0207662_100316812 | 437 |
| 1751 | 3300025922 | Ga0207646_10012944 | Ga0207646_100129442 | 437 |
| 1752 | 3300025933 | Ga0207706_10002765 | Ga0207706_1000276515 | 437 |
| 1753 | 3300025942 | Ga0207689_10016113 | Ga0207689_100161133 | 437 |
| 1754 | 3300026089 | Ga0207648_10024247 | Ga0207648_100242471 | 437 |
| 1755 | 3300026118 | Ga0207675_100008827 | Ga0207675_1000088272 | 437 |
| 1756 | 3300026121 | Ga0207683_10074129 | Ga0207683_100741292 | 437 |
| 1757 | 3300028558 | Ga0265326_10016273 | Ga0265326_100162732 | 437 |
| 1758 | 3300028794 | Ga0307515_10011387 | Ga0307515_100113872 | 437 |
| 1759 | 3300031251 | Ga0265327_10030164 | Ga0265327_100301642 | 437 |
| 1760 | 3300037853 | Ga0436364_0457171 | Ga0436364_0457171_9179_10495 | 437 |
| 1761 | 3300039447 | Ga0436361_0015273 | Ga0436361_0015273_6210_7529 | 437 |
| 1762 | 3300042876 | Ga0451577_0005071 | Ga0451577_0005071_4748_6067 | 437 |
| 1763 | 3300042876 | Ga0451577_0147770 | Ga0451577_0147770_91_1407 | 437 |
| 1764 | 3300049572 | Ga0501036_0074452 | Ga0501036_0074452_714_2078 | 437 |
| 1765 | 3300049575 | Ga0501039_0010051 | Ga0501039_0010051_1514_2878 | 437 |
| 1766 | 3300049577 | Ga0501041_0024119 | Ga0501041_0024119_342_1706 | 437 |
| 1767 | 3300049589 | Ga0501073_0003088 | Ga0501073_0003088_5980_7308 | 437 |
| 1768 | 3300049590 | Ga0501074_0005586 | Ga0501074_0005586_3561_4889 | 437 |
| 1769 | 3300049591 | Ga0501075_0068634 | Ga0501075_0068634_866_2230 | 437 |
| 1770 | 3300049592 | Ga0501076_0052220 | Ga0501076_0052220_1092_2456 | 437 |
| 1771 | 3300049742 | Ga0501080_0024475 | Ga0501080_0024475_1018_2346 | 437 |
| 1772 | 3300049742 | Ga0501080_0289743 | Ga0501080_0289743_67_1431 | 437 |
| 1773 | 3300049744 | Ga0501083_0003518 | Ga0501083_0003518_2975_4303 | 437 |
| 1774 | 3300049823 | Ga0501044_0313781 | Ga0501044_0313781_39_1367 | 437 |
| 1775 | 3300053092 | Ga0500583_0056561 | Ga0500583_0056561_69_1385 | 437 |
| 1776 | 3300053120 | Ga0500597_009019 | Ga0500597_009019_775_2091 | 437 |
| 1777 | 3300054114 | Ga0501084_0013761 | Ga0501084_0013761_3940_5268 | 437 |
| 1778 | 3300060353 | Ga0501082_0020797 | Ga0501082_0020797_601_1929 | 437 |
| 1779 | 3300061734 | Ga0530510_0004233 | Ga0530510_0004233_6336_7700 | 437 |
| 1780 | 3300003215 | JGI25153J46596_10003984 | JGI25153J46596_100039848 | 438 |
| 1781 | 3300005340 | Ga0070689_100000019 | Ga0070689_10000001973 | 438 |
| 1782 | 3300005577 | Ga0068857_100065905 | Ga0068857_1000659054 | 438 |
| 1783 | 3300005844 | Ga0068862_100235797 | Ga0068862_1002357971 | 438 |
| 1784 | 3300006914 | Ga0075436_100116776 | Ga0075436_1001167761 | 438 |
| 1785 | 3300009093 | Ga0105240_10001841 | Ga0105240_1000184122 | 438 |
| 1786 | 3300009545 | Ga0105237_10000025 | Ga0105237_1000002511 | 438 |
| 1787 | 3300009551 | Ga0105238_10001161 | Ga0105238_1000116125 | 438 |
| 1788 | 3300014326 | Ga0157380_10162421 | Ga0157380_101624211 | 438 |
| 1789 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015284 | 438 |
| 1790 | 3300025304 | Ga0209257_1001378 | Ga0209257_100137824 | 438 |
| 1791 | 3300025914 | Ga0207671_10000644 | Ga0207671_1000064411 | 438 |
| 1792 | 3300025924 | Ga0207694_10002608 | Ga0207694_100026083 | 438 |
| 1793 | 3300025936 | Ga0207670_10000013 | Ga0207670_10000013111 | 438 |
| 1794 | 3300028556 | Ga0265337_1007267 | Ga0265337_10072673 | 438 |
| 1795 | 3300028558 | Ga0265326_10004795 | Ga0265326_100047953 | 438 |
| 1796 | 3300028563 | Ga0265319_1000654 | Ga0265319_10006542 | 438 |
| 1797 | 3300028577 | Ga0265318_10000177 | Ga0265318_1000017725 | 438 |
| 1798 | 3300028577 | Ga0265318_10000533 | Ga0265318_1000053321 | 438 |
| 1799 | 3300028653 | Ga0265323_10000448 | Ga0265323_1000044818 | 438 |
| 1800 | 3300028653 | Ga0265323_10004144 | Ga0265323_100041443 | 438 |
| 1801 | 3300028654 | Ga0265322_10029308 | Ga0265322_100293081 | 438 |
| 1802 | 3300028800 | Ga0265338_10021117 | Ga0265338_100211171 | 438 |
| 1803 | 3300028800 | Ga0265338_10078963 | Ga0265338_100789631 | 438 |
| 1804 | 3300029957 | Ga0265324_10000063 | Ga0265324_100000635 | 438 |
| 1805 | 3300031235 | Ga0265330_10000585 | Ga0265330_1000058512 | 438 |
| 1806 | 3300031235 | Ga0265330_10000707 | Ga0265330_100007073 | 438 |
| 1807 | 3300031235 | Ga0265330_10004926 | Ga0265330_100049263 | 438 |
| 1808 | 3300031235 | Ga0265330_10012298 | Ga0265330_100122982 | 438 |
| 1809 | 3300031238 | Ga0265332_10000386 | Ga0265332_1000038629 | 438 |
| 1810 | 3300031239 | Ga0265328_10006947 | Ga0265328_100069472 | 438 |
| 1811 | 3300031240 | Ga0265320_10000867 | Ga0265320_1000086723 | 438 |
| 1812 | 3300031241 | Ga0265325_10002706 | Ga0265325_100027068 | 438 |
| 1813 | 3300031242 | Ga0265329_10000042 | Ga0265329_1000004229 | 438 |
| 1814 | 3300031242 | Ga0265329_10000088 | Ga0265329_100000888 | 438 |
| 1815 | 3300031242 | Ga0265329_10010888 | Ga0265329_100108882 | 438 |
| 1816 | 3300031247 | Ga0265340_10002283 | Ga0265340_100022839 | 438 |
| 1817 | 3300031247 | Ga0265340_10003645 | Ga0265340_100036454 | 438 |
| 1818 | 3300031249 | Ga0265339_10000010 | Ga0265339_10000010123 | 438 |
| 1819 | 3300031249 | Ga0265339_10021747 | Ga0265339_100217472 | 438 |
| 1820 | 3300031250 | Ga0265331_10000539 | Ga0265331_1000053923 | 438 |
| 1821 | 3300031344 | Ga0265316_10000160 | Ga0265316_1000016017 | 438 |
| 1822 | 3300031344 | Ga0265316_10000175 | Ga0265316_1000017522 | 438 |
| 1823 | 3300031344 | Ga0265316_10000603 | Ga0265316_1000060327 | 438 |
| 1824 | 3300031344 | Ga0265316_10000739 | Ga0265316_1000073910 | 438 |
| 1825 | 3300031344 | Ga0265316_10005410 | Ga0265316_100054106 | 438 |
| 1826 | 3300031344 | Ga0265316_10089522 | Ga0265316_100895222 | 438 |
| 1827 | 3300031595 | Ga0265313_10000422 | Ga0265313_100004227 | 438 |
| 1828 | 3300031595 | Ga0265313_10001459 | Ga0265313_1000145912 | 438 |
| 1829 | 3300031595 | Ga0265313_10061577 | Ga0265313_100615772 | 438 |
| 1830 | 3300031711 | Ga0265314_10001482 | Ga0265314_1000148225 | 438 |
| 1831 | 3300031712 | Ga0265342_10000199 | Ga0265342_1000019929 | 438 |
| 1832 | 3300031712 | Ga0265342_10001752 | Ga0265342_100017529 | 438 |
| 1833 | 3300031712 | Ga0265342_10012574 | Ga0265342_100125742 | 438 |
| 1834 | 3300031712 | Ga0265342_10099135 | Ga0265342_100991351 | 438 |
| 1835 | 3300031727 | Ga0316576_10025856 | Ga0316576_100258562 | 438 |
| 1836 | 3300031727 | Ga0316576_10027210 | Ga0316576_100272101 | 438 |
| 1837 | 3300031727 | Ga0316576_10124348 | Ga0316576_101243482 | 438 |
| 1838 | 3300031728 | Ga0316578_10011315 | Ga0316578_100113151 | 438 |
| 1839 | 3300031728 | Ga0316578_10082317 | Ga0316578_100823172 | 438 |
| 1840 | 3300031903 | Ga0307407_10081444 | Ga0307407_100814442 | 438 |
| 1841 | 3300033528 | Ga0316588_1016704 | Ga0316588_10167041 | 438 |
| 1842 | 3300036647 | Ga0316582_0121812 | Ga0316582_0121812_354_1673 | 438 |
| 1843 | 3300036712 | Ga0316584_0137017 | Ga0316584_0137017_352_1671 | 438 |
| 1844 | 3300039062 | Ga0400483_199980 | Ga0400483_199980_3258_4574 | 438 |
| 1845 | 3300039437 | Ga0436365_0615937 | Ga0436365_0615937_816_2138 | 438 |
| 1846 | 3300049581 | Ga0501047_0067229 | Ga0501047_0067229_1920_3314 | 438 |
| 1847 | 3300049586 | Ga0501070_0000781 | Ga0501070_0000781_27070_28464 | 438 |
| 1848 | 3300049742 | Ga0501080_0000168 | Ga0501080_0000168_43222_44616 | 438 |
| 1849 | 3300049822 | Ga0501035_0005434 | Ga0501035_0005434_6564_7958 | 438 |
| 1850 | 3300050512 | nmdc:mga0n895_99514_c1 | nmdc:mga0n895_99514_c1_1245_2564 | 438 |
| 1851 | 3300050514 | nmdc:mga08x19_86102_c1 | nmdc:mga08x19_86102_c1_429_1748 | 438 |
| 1852 | 3300053161 | Ga0500634_0011815 | Ga0500634_0011815_1863_3266 | 438 |
| 1853 | iso_pu_bacteria | 2690316117 | 2692314447 | 438 |
| 1854 | 3300003354 | JGI25160J50197_1000486 | JGI25160J50197_100048620 | 439 |
| 1855 | 3300003775 | Ga0055524_1001086 | Ga0055524_10010861 | 439 |
| 1856 | 3300005262 | Ga0065165_1001966 | Ga0065165_10019668 | 439 |
| 1857 | 3300005353 | Ga0070669_100041129 | Ga0070669_1000411293 | 439 |
| 1858 | 3300005367 | Ga0070667_100019582 | Ga0070667_1000195824 | 439 |
| 1859 | 3300005437 | Ga0070710_10000681 | Ga0070710_100006815 | 439 |
| 1860 | 3300005439 | Ga0070711_100001092 | Ga0070711_10000109211 | 439 |
| 1861 | 3300005546 | Ga0070696_100025482 | Ga0070696_1000254822 | 439 |
| 1862 | 3300005616 | Ga0068852_100004165 | Ga0068852_10000416510 | 439 |
| 1863 | 3300005719 | Ga0068861_100109912 | Ga0068861_1001099122 | 439 |
| 1864 | 3300005842 | Ga0068858_100243785 | Ga0068858_1002437852 | 439 |
| 1865 | 3300005937 | Ga0081455_10001445 | Ga0081455_1000144516 | 439 |
| 1866 | 3300005983 | Ga0081540_1003545 | Ga0081540_10035457 | 439 |
| 1867 | 3300005983 | Ga0081540_1028845 | Ga0081540_10288453 | 439 |
| 1868 | 3300005985 | Ga0081539_10001251 | Ga0081539_1000125116 | 439 |
| 1869 | 3300005985 | Ga0081539_10018206 | Ga0081539_100182063 | 439 |
| 1870 | 3300006038 | Ga0075365_10002314 | Ga0075365_100023145 | 439 |
| 1871 | 3300006038 | Ga0075365_10122565 | Ga0075365_101225651 | 439 |
| 1872 | 3300006177 | Ga0075362_10005150 | Ga0075362_100051502 | 439 |
| 1873 | 3300006177 | Ga0075362_10015420 | Ga0075362_100154202 | 439 |
| 1874 | 3300006844 | Ga0075428_100107959 | Ga0075428_1001079593 | 439 |
| 1875 | 3300009093 | Ga0105240_10002869 | Ga0105240_1000286915 | 439 |
| 1876 | 3300009174 | Ga0105241_10099547 | Ga0105241_100995472 | 439 |
| 1877 | 3300009174 | Ga0105241_10135860 | Ga0105241_101358602 | 439 |
| 1878 | 3300009176 | Ga0105242_10244438 | Ga0105242_102444382 | 439 |
| 1879 | 3300009177 | Ga0105248_10034425 | Ga0105248_100344256 | 439 |
| 1880 | 3300009545 | Ga0105237_10006193 | Ga0105237_1000619310 | 439 |
| 1881 | 3300009551 | Ga0105238_10075130 | Ga0105238_100751302 | 439 |
| 1882 | 3300009553 | Ga0105249_10238794 | Ga0105249_102387942 | 439 |
| 1883 | 3300010375 | Ga0105239_10092443 | Ga0105239_100924433 | 439 |
| 1884 | 3300013306 | Ga0163162_10348125 | Ga0163162_103481252 | 439 |
| 1885 | 3300021320 | Ga0214544_1000003 | Ga0214544_1000003242 | 439 |
| 1886 | 3300021321 | Ga0214542_1000003 | Ga0214542_1000003232 | 439 |
| 1887 | 3300021321 | Ga0214542_1028661 | Ga0214542_10286612 | 439 |
| 1888 | 3300021324 | Ga0214545_1000004 | Ga0214545_1000004245 | 439 |
| 1889 | 3300021327 | Ga0214543_1000007 | Ga0214543_1000007172 | 439 |
| 1890 | 3300025253 | Ga0209677_108366 | Ga0209677_1083662 | 439 |
| 1891 | 3300025254 | Ga0209148_1000904 | Ga0209148_10009047 | 439 |
| 1892 | 3300025261 | Ga0209233_1002525 | Ga0209233_10025256 | 439 |
| 1893 | 3300025272 | Ga0209455_1001820 | Ga0209455_100182010 | 439 |
| 1894 | 3300025297 | Ga0209758_1000389 | Ga0209758_100038922 | 439 |
| 1895 | 3300025297 | Ga0209758_1000716 | Ga0209758_100071633 | 439 |
| 1896 | 3300025297 | Ga0209758_1002865 | Ga0209758_100286510 | 439 |
| 1897 | 3300025297 | Ga0209758_1004558 | Ga0209758_10045582 | 439 |
| 1898 | 3300025302 | Ga0207426_1000380 | Ga0207426_100038052 | 439 |
| 1899 | 3300025302 | Ga0207426_1020340 | Ga0207426_10203401 | 439 |
| 1900 | 3300025304 | Ga0209257_1020225 | Ga0209257_10202253 | 439 |
| 1901 | 3300025898 | Ga0207692_10006874 | Ga0207692_100068743 | 439 |
| 1902 | 3300025906 | Ga0207699_10000803 | Ga0207699_100008039 | 439 |
| 1903 | 3300025907 | Ga0207645_10124638 | Ga0207645_101246382 | 439 |
| 1904 | 3300025913 | Ga0207695_10000065 | Ga0207695_1000006574 | 439 |
| 1905 | 3300025914 | Ga0207671_10002455 | Ga0207671_1000245513 | 439 |
| 1906 | 3300025914 | Ga0207671_10022981 | Ga0207671_100229813 | 439 |
| 1907 | 3300025928 | Ga0207700_10002933 | Ga0207700_100029334 | 439 |
| 1908 | 3300025928 | Ga0207700_10087424 | Ga0207700_100874241 | 439 |
| 1909 | 3300025939 | Ga0207665_10003192 | Ga0207665_100031924 | 439 |
| 1910 | 3300025942 | Ga0207689_10001797 | Ga0207689_100017974 | 439 |
| 1911 | 3300025942 | Ga0207689_10160603 | Ga0207689_101606032 | 439 |
| 1912 | 3300025961 | Ga0207712_10043564 | Ga0207712_100435642 | 439 |
| 1913 | 3300025972 | Ga0207668_10003572 | Ga0207668_100035723 | 439 |
| 1914 | 3300025986 | Ga0207658_10129273 | Ga0207658_101292732 | 439 |
| 1915 | 3300026095 | Ga0207676_10056773 | Ga0207676_100567732 | 439 |
| 1916 | 3300026116 | Ga0207674_10067654 | Ga0207674_100676543 | 439 |
| 1917 | 3300026118 | Ga0207675_100002011 | Ga0207675_1000020113 | 439 |
| 1918 | 3300026121 | Ga0207683_10141108 | Ga0207683_101411082 | 439 |
| 1919 | 3300026142 | Ga0207698_10051799 | Ga0207698_100517992 | 439 |
| 1920 | 3300027296 | Ga0209389_1000180 | Ga0209389_100018029 | 439 |
| 1921 | 3300027361 | Ga0209489_101411 | Ga0209489_10141129 | 439 |
| 1922 | 3300027363 | Ga0209700_101443 | Ga0209700_10144330 | 439 |
| 1923 | 3300028556 | Ga0265337_1005026 | Ga0265337_10050264 | 439 |
| 1924 | 3300028558 | Ga0265326_10001905 | Ga0265326_100019051 | 439 |
| 1925 | 3300028573 | Ga0265334_10002493 | Ga0265334_100024936 | 439 |
| 1926 | 3300028653 | Ga0265323_10002030 | Ga0265323_100020308 | 439 |
| 1927 | 3300028666 | Ga0265336_10002907 | Ga0265336_100029073 | 439 |
| 1928 | 3300028800 | Ga0265338_10000280 | Ga0265338_100002802 | 439 |
| 1929 | 3300029957 | Ga0265324_10005408 | Ga0265324_100054082 | 439 |
| 1930 | 3300031456 | Ga0307513_10234007 | Ga0307513_102340072 | 439 |
| 1931 | 3300031507 | Ga0307509_10017985 | Ga0307509_100179852 | 439 |
| 1932 | 3300031616 | Ga0307508_10000003 | Ga0307508_1000000340 | 439 |
| 1933 | 3300031616 | Ga0307508_10053641 | Ga0307508_100536412 | 439 |
| 1934 | 3300031616 | Ga0307508_10095438 | Ga0307508_100954382 | 439 |
| 1935 | 3300031730 | Ga0307516_10006895 | Ga0307516_100068956 | 439 |
| 1936 | 3300033180 | Ga0307510_10003428 | Ga0307510_1000342813 | 439 |
| 1937 | 3300033544 | Ga0316215_1000798 | Ga0316215_10007982 | 439 |
| 1938 | 3300037471 | Ga0395905_0003588 | Ga0395905_0003588_2481_3803 | 439 |
| 1939 | 3300039450 | Ga0436363_1120285 | Ga0436363_1120285_27_1349 | 439 |
| 1940 | 3300039453 | Ga0436362_0872866 | Ga0436362_0872866_501_1823 | 439 |
| 1941 | 3300044694 | Ga0466963_0021877 | Ga0466963_0021877_498_1820 | 439 |
| 1942 | 3300044735 | Ga0466968_0003538 | Ga0466968_0003538_3106_4428 | 439 |
| 1943 | 3300045051 | Ga0451576_0007219 | Ga0451576_0007219_981_2303 | 439 |
| 1944 | 3300045976 | Ga0466967_0004486 | Ga0466967_0004486_4158_5480 | 439 |
| 1945 | 3300046524 | Ga0495648_0055627 | Ga0495648_0055627_700_2022 | 439 |
| 1946 | 3300046542 | Ga0495597_0016255 | Ga0495597_0016255_2052_3374 | 439 |
| 1947 | 3300046674 | Ga0495588_0001753 | Ga0495588_0001753_1841_3163 | 439 |
| 1948 | 3300046809 | Ga0495600_0031448 | Ga0495600_0031448_1700_3025 | 439 |
| 1949 | 3300047469 | Ga0495673_0048594 | Ga0495673_0048594_323_1645 | 439 |
| 1950 | 3300048909 | Ga0496106_0001659 | Ga0496106_0001659_1938_3260 | 439 |
| 1951 | 3300048911 | Ga0496108_0113512 | Ga0496108_0113512_73_1395 | 439 |
| 1952 | 3300048918 | Ga0496115_0157199 | Ga0496115_0157199_298_1620 | 439 |
| 1953 | 3300048920 | Ga0496117_0064820 | Ga0496117_0064820_229_1551 | 439 |
| 1954 | 3300048921 | Ga0496118_0043627 | Ga0496118_0043627_2150_3472 | 439 |
| 1955 | 3300048922 | Ga0496119_0005138 | Ga0496119_0005138_6429_7751 | 439 |
| 1956 | 3300048924 | Ga0496121_0000452 | Ga0496121_0000452_55201_56523 | 439 |
| 1957 | 3300048924 | Ga0496121_0005630 | Ga0496121_0005630_6371_7693 | 439 |
| 1958 | 3300048925 | Ga0496122_0003715 | Ga0496122_0003715_6224_7546 | 439 |
| 1959 | 3300048926 | Ga0496123_0008804 | Ga0496123_0008804_6577_7899 | 439 |
| 1960 | 3300048927 | Ga0496124_0000267 | Ga0496124_0000267_35952_37274 | 439 |
| 1961 | 3300048927 | Ga0496124_0049935 | Ga0496124_0049935_935_2257 | 439 |
| 1962 | 3300048928 | Ga0496125_0043340 | Ga0496125_0043340_691_2013 | 439 |
| 1963 | 3300050489 | nmdc:mga03683_5535_c1 | nmdc:mga03683_5535_c1_1147_2469 | 439 |
| 1964 | 3300050492 | nmdc:mga0yw44_16598_c1 | nmdc:mga0yw44_16598_c1_1317_2639 | 439 |
| 1965 | 3300050507 | nmdc:mga05p37_43104_c1 | nmdc:mga05p37_43104_c1_3596_4918 | 439 |
| 1966 | 3300053087 | Ga0500643_000278 | Ga0500643_000278_38434_39756 | 439 |
| 1967 | 3300053091 | Ga0500647_0012446 | Ga0500647_0012446_2292_3614 | 439 |
| 1968 | 3300053091 | Ga0500647_0031354 | Ga0500647_0031354_327_1649 | 439 |
| 1969 | 3300053094 | Ga0500566_0000565 | Ga0500566_0000565_5077_6399 | 439 |
| 1970 | 3300053103 | Ga0500555_018996 | Ga0500555_018996_360_1682 | 439 |
| 1971 | 3300053104 | Ga0500556_0000148 | Ga0500556_0000148_36586_37908 | 439 |
| 1972 | 3300053105 | Ga0500557_000028 | Ga0500557_000028_35075_36397 | 439 |
| 1973 | 3300053119 | Ga0500595_002261 | Ga0500595_002261_5927_7249 | 439 |
| 1974 | 3300053130 | Ga0500642_0000189 | Ga0500642_0000189_15207_16529 | 439 |
| 1975 | 3300053156 | Ga0500622_0037789 | Ga0500622_0037789_623_1945 | 439 |
| 1976 | 3300053177 | Ga0500636_0007269 | Ga0500636_0007269_3299_4621 | 439 |
| 1977 | 3300053178 | Ga0500637_0063963 | Ga0500637_0063963_731_2053 | 439 |
| 1978 | 3300005547 | Ga0070693_100070986 | Ga0070693_1000709861 | 440 |
| 1979 | 3300031239 | Ga0265328_10040281 | Ga0265328_100402812 | 440 |
| 1980 | 3300031344 | Ga0265316_10094800 | Ga0265316_100948001 | 440 |
| 1981 | 3300031507 | Ga0307509_10093227 | Ga0307509_100932274 | 440 |
| 1982 | 3300044712 | Ga0453684_0202291 | Ga0453684_0202291_129_1466 | 440 |
| 1983 | 3300045051 | Ga0451576_0010072 | Ga0451576_0010072_1807_3144 | 440 |
| 1984 | 3300046501 | Ga0495607_0000319 | Ga0495607_0000319_3872_5200 | 440 |
| 1985 | 3300046513 | Ga0495616_0000241 | Ga0495616_0000241_1663_2991 | 440 |
| 1986 | 3300046665 | Ga0495661_0006830 | Ga0495661_0006830_4604_5932 | 440 |
| 1987 | 3300048091 | Ga0495626_0001302 | Ga0495626_0001302_5420_6748 | 440 |
| 1988 | 3300049579 | Ga0501043_0000020 | Ga0501043_0000020_91618_92991 | 440 |
| 1989 | 3300049580 | Ga0501046_0000039 | Ga0501046_0000039_91656_93029 | 440 |
| 1990 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_91630_93003 | 440 |
| 1991 | 3300049824 | Ga0501045_0008620 | Ga0501045_0008620_861_2321 | 440 |
| 1992 | 3300050515 | nmdc:mga0a205_50322_c1 | nmdc:mga0a205_50322_c1_2162_3604 | 440 |
| 1993 | 3300005456 | Ga0070678_100209605 | Ga0070678_1002096051 | 441 |
| 1994 | 3300006237 | Ga0097621_100137847 | Ga0097621_1001378472 | 441 |
| 1995 | 3300025254 | Ga0209148_1000643 | Ga0209148_100064312 | 441 |
| 1996 | 3300025272 | Ga0209455_1000488 | Ga0209455_10004883 | 441 |
| 1997 | 3300000546 | LJNas_1000993 | LJNas_10009932 | 444 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1a0c-assembly1.cif.gz_A | xylose isomerase from thermoanaerobacterium thermosulfurigenes | 0.9743 | 11 | 443 |
| 1a0d-assembly1.cif.gz_A | xylose isomerase from bacillus stearothermophilus | 0.9743 | 14 | 443 |
| 4xkm-assembly2.cif.gz_E | crystal structure of xylose isomerase from an human intestinal tract microbe bacteroides thetaiotaomicron | 0.973 | 8 | 442 |
| 1a0e-assembly1.cif.gz_A | xylose isomerase from thermotoga neapolitana | 0.9715 | 11 | 443 |
| 6t8f-assembly1.cif.gz_D | crystal structure of mutant xylose isomerase (v270a/a273g) from piromyces e2 grown in yeast, in complex with xylose | 0.9698 | 7 | 442 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6QER4_85_310_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9819 | 48 | 283 | 3.20.20.150 |
| 1a0dA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9743 | 14 | 443 | 3.20.20.150 |
| af_A0A1D6QER4_85_310_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9733 | 48 | 283 | 3.20.20.150 |
| 1a0dA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9525 | 14 | 443 | 3.20.20.150 |
| af_P45541_1_270_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8021 | 48 | 369 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X3DHG8-F1-model_v4 | Xylose isomerase (EC 5.3.1.5) | 1.001 | 213 | 299 |
GO:0005737
GO:0009045 GO:0042732 GO:0046872 |
| AF-A0A0E4B177-F1-model_v4 | Xylose isomerase (EC 5.3.1.5) | 0.9992 | 200 | 276 |
GO:0005737
GO:0009045 GO:0042732 GO:0046872 |
| AF-A0A656GL89-F1-model_v4 | Xylose isomerase (EC 5.3.1.5) | 0.9988 | 240 | 312 |
GO:0005737
GO:0009045 GO:0042732 GO:0046872 |
| AF-A0A376ML40-F1-model_v4 | Xylose isomerase (EC 5.3.1.5) | 0.998 | 203 | 297 |
GO:0005737
GO:0009045 GO:0016020 GO:0042732 GO:0046872 |
| AF-A0A0E4B207-F1-model_v4 | Xylose isomerase (EC 5.3.1.5) | 0.998 | 200 | 276 |
GO:0005737
GO:0009045 GO:0042732 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar