F496144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1957 | 799 | 1725 | 305 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2935630451|2935632812 |
| Length | 363 |
| Sequence | DEPSITHRVCPAVNFYQLLAGSGPFPISDGLFDPPRFAYLRGFISRPDVYPPVAEPLRIMTQTISSVPNGQRAPKTPKISFEFFPPKTEEMERNLWETINRLAPLTPNFVSVTYGAGGSTRERTHSTITRILRETDLLPAAHLTCVSASRGEIDDIVDRYHEVGVRHIVALRGDPPGGIGTPYFTHPDGYQSSAELVAGIKKRHADIEISVSAYPEKHPEAADFDADIDTLKAKVDAGATRAITQVFFDNDLYHRYVDKVRTRGIEIPIVPGIMPMHNFKQARNFVTRAGTSVPDWLAEKFDGLDNDAETRKLVAATVAAGQVQKLFKHGVDTFHFYTMNRADLVFAISHLLGIRPNGAQKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 20 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 21 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 22 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 30 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 31 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 32 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 33 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 34 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 35 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 36 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 37 | 2791355199 | |||
| 38 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 39 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 40 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 41 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 42 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 43 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 44 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 45 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 46 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 47 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 48 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 49 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 50 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 51 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 52 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 53 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 54 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 55 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 56 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 57 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 58 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 59 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 60 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 61 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 62 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 63 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 64 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 65 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 66 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 67 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 68 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 69 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 70 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 71 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 72 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 73 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 74 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 75 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 76 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 77 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 78 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 79 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 80 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 81 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 82 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 83 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 84 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 85 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 86 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 87 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 88 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 89 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 90 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 91 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 92 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 93 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 94 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 95 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 96 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 97 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 98 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 99 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 100 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 101 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 102 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 103 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 104 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 105 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 106 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 107 | 2904699407 | |||
| 108 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 109 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 110 | 2906610324 | |||
| 111 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 112 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 113 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 114 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 115 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 116 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 117 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 118 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 119 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 120 | 2922368715 | |||
| 121 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 122 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 123 | 2922425934 | |||
| 124 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 125 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 126 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 127 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 128 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 129 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 130 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 131 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 132 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 133 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 134 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 135 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 136 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 137 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 138 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 139 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 140 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 141 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 142 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 143 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 144 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 145 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 146 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 147 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 148 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 149 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 150 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 151 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 152 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 153 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 154 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 155 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 156 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 157 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 158 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 159 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 160 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 161 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 162 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 163 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 164 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 165 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 166 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 167 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 168 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 169 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 170 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 171 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 172 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 173 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 174 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 175 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 176 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 177 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 178 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 179 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 180 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 181 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 182 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 183 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 184 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 185 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 186 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 187 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 188 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 189 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 190 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 191 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 192 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 193 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 194 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 195 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 197 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 199 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 201 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 202 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 203 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 204 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 205 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 206 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 207 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 208 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 209 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 210 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 211 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 212 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 213 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 214 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 215 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 216 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 217 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 218 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 219 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 220 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 221 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 222 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 223 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 224 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 225 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 226 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 227 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 228 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 231 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 234 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 236 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 237 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 238 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 240 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 242 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 244 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 253 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 255 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 256 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 259 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 263 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 264 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 265 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 267 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 268 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 269 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 270 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 272 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 273 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 277 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 279 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 280 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 281 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 283 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 284 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 285 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 286 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 287 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 288 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 289 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 290 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 291 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 292 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 293 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 294 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 295 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 296 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 298 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 299 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 300 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 301 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 302 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 303 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 304 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 305 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 306 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 307 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 308 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 309 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 310 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 312 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 313 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 314 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 315 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 316 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 317 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 318 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 319 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 320 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 321 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 323 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 324 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 325 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 326 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 334 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 335 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 343 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 344 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 358 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 359 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 360 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 361 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 362 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 363 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 364 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 365 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 366 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 374 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 376 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 444 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 445 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 446 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 447 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 455 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 457 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 461 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 462 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 463 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 464 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 465 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 466 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 467 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 468 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 469 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 470 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 471 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 472 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 473 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 474 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 475 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 476 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 477 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 478 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 479 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 480 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 481 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 482 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 483 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 484 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 485 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 486 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 487 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 488 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 489 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 490 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 491 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 492 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 493 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 494 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 495 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 496 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 497 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 498 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 499 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 500 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 501 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 502 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 503 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 504 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 505 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 506 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 507 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 508 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 509 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 510 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 511 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 512 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 513 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 514 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 515 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 516 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 517 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 518 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 519 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 520 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 521 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 522 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 523 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 524 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 525 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 526 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 527 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 528 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 529 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 530 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 531 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 532 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 533 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 534 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 535 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 536 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 537 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 538 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 539 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 540 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 541 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 542 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 543 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 544 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 545 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 546 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 547 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 548 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 549 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 550 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 551 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 552 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 553 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 640 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 641 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 642 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 643 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 644 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 645 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 646 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 647 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 648 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 649 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 650 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 651 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 652 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 653 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 654 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 655 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 656 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 657 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 658 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 659 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 660 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 661 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 662 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 663 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 664 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 665 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 666 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 667 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 668 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 669 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 670 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 671 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 673 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 674 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 675 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 676 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 677 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 678 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 679 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 680 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 681 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 682 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 683 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 684 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 687 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 688 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 689 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 691 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 692 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 693 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 694 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 695 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 696 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 697 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 698 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 699 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 700 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 701 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 702 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 703 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 704 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 705 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 706 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 707 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 708 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 709 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 710 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 713 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 714 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 717 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 718 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 719 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 720 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 721 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 722 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 723 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 724 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 725 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 726 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 727 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 728 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 729 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 730 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 731 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 732 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 733 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 734 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 735 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 736 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 737 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 738 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 739 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 740 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 741 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 742 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 743 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 744 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 745 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 746 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 747 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 748 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 749 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 750 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 751 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 752 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 753 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 754 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 755 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 756 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 757 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 758 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 759 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 760 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 761 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 762 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 763 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 764 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 765 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 766 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 767 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 768 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 769 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 770 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 771 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 772 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 773 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 774 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 775 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 776 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 777 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 778 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 779 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 780 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 781 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 782 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 783 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 784 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 785 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 786 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 787 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 788 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 789 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 790 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 791 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 792 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 793 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 794 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 795 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 796 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 797 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 798 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 799 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.27 |
| Metatranscriptomes | 0.1 |
| Isolates | 11.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.77 |
| Nodule | 9.15 |
| Rhizoplane | 5.98 |
| Rhizosphere | 69.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214775796 | 2209111006 | Bacteria | 2534 |
| 2 | ARcpr5oldR_c000014 | 3300000041 | Bacteria | 37047 |
| 3 | ARSoilYngRDRAFT_c00094 | 3300000042 | Bacteria | 15087 |
| 4 | ARcpr5yngRDRAFT_c000058 | 3300000043 | Bacteria | 17826 |
| 5 | ARSoilOldRDRAFT_c000007 | 3300000044 | Bacteria | 55959 |
| 6 | ARCol0oldRDRAFT_c00221 | 3300000045 | Bacteria | 5288 |
| 7 | ARCol0yngRDRAFT_1000009 | 3300000652 | Bacteria | 43473 |
| 8 | JGI24032J14994_100677 | 3300001430 | Bacteria | 1760 |
| 9 | JGI24741J21665_1011668 | 3300001915 | Bacteria | 1529 |
| 10 | JGI24752J21851_1002204 | 3300001976 | Bacteria | 2604 |
| 11 | JGI24747J21853_1001137 | 3300001978 | Bacteria | 1929 |
| 12 | JGI24740J21852_10005937 | 3300001979 | Bacteria | 5113 |
| 13 | JGI24739J22299_10010412 | 3300001989 | Bacteria | 3454 |
| 14 | JGI24737J22298_10021581 | 3300001990 | Bacteria | 2051 |
| 15 | JGI24750J21931_1000699 | 3300002070 | Bacteria | 4845 |
| 16 | JGI24745J21846_1000166 | 3300002073 | Bacteria | 5259 |
| 17 | JGI24738J21930_10001608 | 3300002075 | Bacteria | 6219 |
| 18 | JGI24749J21850_1005910 | 3300002076 | Bacteria | 1706 |
| 19 | JGI24744J21845_10011953 | 3300002077 | Bacteria | 1767 |
| 20 | JGI24035J26624_1002415 | 3300002126 | Bacteria | 1745 |
| 21 | JGI24033J26618_1000651 | 3300002155 | Bacteria | 3316 |
| 22 | JGI24034J26672_10004455 | 3300002239 | Bacteria | 1987 |
| 23 | JGI24742J22300_10006743 | 3300002244 | Bacteria | 1894 |
| 24 | JGI24751J29686_10019326 | 3300002459 | Bacteria | 1410 |
| 25 | JGI25406J46586_10000012 | 3300003203 | Bacteria | 102438 |
| 26 | JGI25153J46596_10003697 | 3300003215 | Bacteria | 8457 |
| 27 | JGI25153J46596_10008046 | 3300003215 | Bacteria | 5094 |
| 28 | JGI25153J46596_10034157 | 3300003215 | Bacteria | 1666 |
| 29 | JGI25160J50197_1007198 | 3300003354 | Bacteria | 4383 |
| 30 | Ga0065165_1000982 | 3300005262 | Bacteria | 35331 |
| 31 | Ga0065165_1007672 | 3300005262 | Bacteria | 5235 |
| 32 | Ga0065165_1008445 | 3300005262 | Bacteria | 4816 |
| 33 | Ga0065717_1003292 | 3300005276 | Bacteria | 1335 |
| 34 | Ga0065714_10115997 | 3300005288 | Bacteria | 1397 |
| 35 | Ga0065704_10019537 | 3300005289 | Bacteria | 1689 |
| 36 | Ga0065712_10001073 | 3300005290 | Bacteria | 6956 |
| 37 | Ga0065712_10136646 | 3300005290 | Bacteria | 1491 |
| 38 | Ga0065715_10005375 | 3300005293 | Bacteria | 4394 |
| 39 | Ga0065715_10108905 | 3300005293 | Bacteria | 2695 |
| 40 | Ga0065707_10162208 | 3300005295 | Bacteria | 1553 |
| 41 | Ga0070658_10029096 | 3300005327 | Bacteria | 4437 |
| 42 | Ga0070658_10076839 | 3300005327 | Bacteria | 2739 |
| 43 | Ga0070658_10117782 | 3300005327 | Bacteria | 2205 |
| 44 | Ga0070658_10259088 | 3300005327 | Bacteria | 1477 |
| 45 | Ga0070676_10010461 | 3300005328 | Bacteria | 5036 |
| 46 | Ga0070690_100011006 | 3300005330 | Bacteria | 5282 |
| 47 | Ga0070670_100012145 | 3300005331 | Bacteria | 7367 |
| 48 | Ga0070670_100135211 | 3300005331 | Bacteria | 2130 |
| 49 | Ga0070677_10000731 | 3300005333 | Bacteria | 10938 |
| 50 | Ga0068869_100015435 | 3300005334 | Bacteria | 5124 |
| 51 | Ga0068869_100023869 | 3300005334 | Bacteria | 4232 |
| 52 | Ga0070666_10024658 | 3300005335 | Bacteria | 3920 |
| 53 | Ga0070666_10128387 | 3300005335 | Bacteria | 1760 |
| 54 | Ga0070666_10365109 | 3300005335 | Bacteria | 1035 |
| 55 | Ga0070680_100016577 | 3300005336 | Bacteria | 5798 |
| 56 | Ga0070680_100019249 | 3300005336 | Bacteria | 5409 |
| 57 | Ga0070680_100064099 | 3300005336 | Bacteria | 3011 |
| 58 | Ga0070680_100090696 | 3300005336 | Bacteria | 2530 |
| 59 | Ga0070680_100165630 | 3300005336 | Bacteria | 1858 |
| 60 | Ga0070682_100013849 | 3300005337 | Bacteria | 4650 |
| 61 | Ga0068868_100056620 | 3300005338 | Bacteria | 3096 |
| 62 | Ga0068868_100081641 | 3300005338 | Bacteria | 2592 |
| 63 | Ga0070660_100001770 | 3300005339 | Bacteria | 14832 |
| 64 | Ga0070689_100031509 | 3300005340 | Bacteria | 4030 |
| 65 | Ga0070689_100122632 | 3300005340 | Bacteria | 2077 |
| 66 | Ga0070689_100270099 | 3300005340 | Bacteria | 1408 |
| 67 | Ga0070691_10004889 | 3300005341 | Bacteria | 6096 |
| 68 | Ga0070687_100005741 | 3300005343 | Bacteria | 5036 |
| 69 | Ga0070661_100025157 | 3300005344 | Bacteria | 4276 |
| 70 | Ga0070692_10006550 | 3300005345 | Bacteria | 5064 |
| 71 | Ga0070668_100001862 | 3300005347 | Bacteria | 15407 |
| 72 | Ga0070668_100005832 | 3300005347 | Bacteria | 9133 |
| 73 | Ga0070668_100098279 | 3300005347 | Bacteria | 2316 |
| 74 | Ga0070668_100452132 | 3300005347 | Bacteria | 1104 |
| 75 | Ga0070669_100002311 | 3300005353 | Bacteria | 13796 |
| 76 | Ga0070669_100082025 | 3300005353 | Bacteria | 2403 |
| 77 | Ga0070675_100026314 | 3300005354 | Bacteria | 4669 |
| 78 | Ga0070671_100027221 | 3300005355 | Bacteria | 4704 |
| 79 | Ga0070671_100029720 | 3300005355 | Bacteria | 4507 |
| 80 | Ga0070671_100044664 | 3300005355 | Bacteria | 3682 |
| 81 | Ga0070674_100062573 | 3300005356 | Bacteria | 2601 |
| 82 | Ga0070674_100165878 | 3300005356 | Bacteria | 1680 |
| 83 | Ga0070674_100242565 | 3300005356 | Bacteria | 1412 |
| 84 | Ga0070673_100012367 | 3300005364 | Bacteria | 5858 |
| 85 | Ga0070659_100002966 | 3300005366 | Bacteria | 12095 |
| 86 | Ga0070667_100095986 | 3300005367 | Bacteria | 2557 |
| 87 | Ga0070667_100339293 | 3300005367 | Bacteria | 1359 |
| 88 | Ga0070709_10002283 | 3300005434 | Bacteria | 10401 |
| 89 | Ga0070709_10002761 | 3300005434 | Bacteria | 9496 |
| 90 | Ga0070709_10008203 | 3300005434 | Bacteria | 5734 |
| 91 | Ga0070709_10011241 | 3300005434 | Bacteria | 4981 |
| 92 | Ga0070709_10014093 | 3300005434 | Bacteria | 4514 |
| 93 | Ga0070714_100008916 | 3300005435 | Bacteria | 7848 |
| 94 | Ga0070714_100039738 | 3300005435 | Bacteria | 3962 |
| 95 | Ga0070714_100043482 | 3300005435 | Bacteria | 3799 |
| 96 | Ga0070714_100048021 | 3300005435 | Bacteria | 3629 |
| 97 | Ga0070714_100049678 | 3300005435 | Bacteria | 3571 |
| 98 | Ga0070714_100093694 | 3300005435 | Bacteria | 2635 |
| 99 | Ga0070714_100102386 | 3300005435 | Bacteria | 2525 |
| 100 | Ga0070714_100195587 | 3300005435 | Bacteria | 1847 |
| 101 | Ga0070713_100000399 | 3300005436 | Bacteria | 27898 |
| 102 | Ga0070713_100002808 | 3300005436 | Bacteria | 11387 |
| 103 | Ga0070713_100022749 | 3300005436 | Bacteria | 4849 |
| 104 | Ga0070713_100028352 | 3300005436 | Bacteria | 4421 |
| 105 | Ga0070713_100060987 | 3300005436 | Bacteria | 3155 |
| 106 | Ga0070713_100064957 | 3300005436 | Bacteria | 3064 |
| 107 | Ga0070713_100073833 | 3300005436 | Bacteria | 2888 |
| 108 | Ga0070713_100193756 | 3300005436 | Bacteria | 1833 |
| 109 | Ga0070710_10013667 | 3300005437 | Bacteria | 4073 |
| 110 | Ga0070710_10036514 | 3300005437 | Bacteria | 2687 |
| 111 | Ga0070710_10039926 | 3300005437 | Bacteria | 2584 |
| 112 | Ga0070710_10095144 | 3300005437 | Bacteria | 1764 |
| 113 | Ga0070710_10119090 | 3300005437 | Bacteria | 1596 |
| 114 | Ga0070711_100006842 | 3300005439 | Bacteria | 6903 |
| 115 | Ga0070711_100009346 | 3300005439 | Bacteria | 6035 |
| 116 | Ga0070711_100010498 | 3300005439 | Bacteria | 5735 |
| 117 | Ga0070711_100031695 | 3300005439 | Bacteria | 3511 |
| 118 | Ga0070711_100056042 | 3300005439 | Bacteria | 2724 |
| 119 | Ga0070711_100079939 | 3300005439 | Bacteria | 2326 |
| 120 | Ga0070711_100082494 | 3300005439 | Bacteria | 2295 |
| 121 | Ga0070711_100145021 | 3300005439 | Bacteria | 1784 |
| 122 | Ga0070711_100213146 | 3300005439 | Bacteria | 1497 |
| 123 | Ga0070711_100307913 | 3300005439 | Bacteria | 1262 |
| 124 | Ga0070705_100007363 | 3300005440 | Bacteria | 5418 |
| 125 | Ga0070705_100034239 | 3300005440 | Bacteria | 2838 |
| 126 | Ga0070700_100012996 | 3300005441 | Bacteria | 4669 |
| 127 | Ga0070663_100028428 | 3300005455 | Bacteria | 3806 |
| 128 | Ga0070663_100029515 | 3300005455 | Bacteria | 3748 |
| 129 | Ga0070663_100036700 | 3300005455 | Bacteria | 3406 |
| 130 | Ga0070663_100043179 | 3300005455 | Bacteria | 3172 |
| 131 | Ga0070663_100075766 | 3300005455 | Bacteria | 2459 |
| 132 | Ga0070663_100115270 | 3300005455 | Bacteria | 2024 |
| 133 | Ga0070663_100123894 | 3300005455 | Bacteria | 1955 |
| 134 | Ga0070663_100168454 | 3300005455 | Bacteria | 1691 |
| 135 | Ga0070678_100014938 | 3300005456 | Bacteria | 4917 |
| 136 | Ga0070678_100017054 | 3300005456 | Bacteria | 4664 |
| 137 | Ga0070678_100106325 | 3300005456 | Bacteria | 2186 |
| 138 | Ga0070678_100259963 | 3300005456 | Bacteria | 1459 |
| 139 | Ga0070662_100195321 | 3300005457 | Bacteria | 1602 |
| 140 | Ga0070681_10006388 | 3300005458 | Bacteria | 11462 |
| 141 | Ga0070681_10045404 | 3300005458 | Bacteria | 4395 |
| 142 | Ga0070681_10058848 | 3300005458 | Bacteria | 3822 |
| 143 | Ga0070681_10080697 | 3300005458 | Bacteria | 3209 |
| 144 | Ga0070681_10249245 | 3300005458 | Bacteria | 1689 |
| 145 | Ga0068867_100016521 | 3300005459 | Bacteria | 5241 |
| 146 | Ga0068867_100493130 | 3300005459 | Bacteria | 1052 |
| 147 | Ga0070707_100054763 | 3300005468 | Bacteria | 3825 |
| 148 | Ga0070699_100237581 | 3300005518 | Bacteria | 1625 |
| 149 | Ga0070679_100033931 | 3300005530 | Bacteria | 5055 |
| 150 | Ga0070679_100091315 | 3300005530 | Bacteria | 3033 |
| 151 | Ga0070679_100128586 | 3300005530 | Bacteria | 2514 |
| 152 | Ga0070684_100029086 | 3300005535 | Bacteria | 4679 |
| 153 | Ga0070684_100065197 | 3300005535 | Bacteria | 3196 |
| 154 | Ga0070684_100417812 | 3300005535 | Bacteria | 1238 |
| 155 | Ga0070697_100103757 | 3300005536 | Bacteria | 2364 |
| 156 | Ga0070697_100177098 | 3300005536 | Bacteria | 1807 |
| 157 | Ga0068853_100030191 | 3300005539 | Bacteria | 4577 |
| 158 | Ga0068853_100032830 | 3300005539 | Bacteria | 4400 |
| 159 | Ga0068853_100040910 | 3300005539 | Bacteria | 3957 |
| 160 | Ga0070672_100002208 | 3300005543 | Bacteria | 12274 |
| 161 | Ga0070686_100129660 | 3300005544 | Bacteria | 1742 |
| 162 | Ga0070695_100000800 | 3300005545 | Bacteria | 16940 |
| 163 | Ga0070696_100026211 | 3300005546 | Bacteria | 3965 |
| 164 | Ga0070696_100063701 | 3300005546 | Bacteria | 2583 |
| 165 | Ga0070693_100010396 | 3300005547 | Bacteria | 4664 |
| 166 | Ga0070665_100012864 | 3300005548 | Bacteria | 8426 |
| 167 | Ga0070665_100057373 | 3300005548 | Bacteria | 3903 |
| 168 | Ga0070665_100059233 | 3300005548 | Bacteria | 3838 |
| 169 | Ga0070665_100102558 | 3300005548 | Bacteria | 2864 |
| 170 | Ga0070665_100176149 | 3300005548 | Bacteria | 2140 |
| 171 | Ga0070665_100306449 | 3300005548 | Bacteria | 1591 |
| 172 | Ga0068855_100054636 | 3300005563 | Bacteria | 4693 |
| 173 | Ga0068855_100103075 | 3300005563 | Bacteria | 3283 |
| 174 | Ga0068855_100117639 | 3300005563 | Bacteria | 3044 |
| 175 | Ga0068855_100189821 | 3300005563 | Bacteria | 2318 |
| 176 | Ga0068855_100203952 | 3300005563 | Bacteria | 2225 |
| 177 | Ga0068855_100325986 | 3300005563 | Bacteria | 1696 |
| 178 | Ga0068855_100599507 | 3300005563 | Bacteria | 1188 |
| 179 | Ga0068855_100689100 | 3300005563 | Bacteria | 1094 |
| 180 | Ga0068855_100692157 | 3300005563 | Bacteria | 1092 |
| 181 | Ga0070664_100018373 | 3300005564 | Bacteria | 5742 |
| 182 | Ga0070664_100066777 | 3300005564 | Bacteria | 3072 |
| 183 | Ga0070664_100102414 | 3300005564 | Bacteria | 2491 |
| 184 | Ga0070664_100311354 | 3300005564 | Bacteria | 1425 |
| 185 | Ga0068857_100000616 | 3300005577 | Bacteria | 26168 |
| 186 | Ga0068857_100023618 | 3300005577 | Bacteria | 5413 |
| 187 | Ga0068857_100039537 | 3300005577 | Bacteria | 4178 |
| 188 | Ga0068854_100043694 | 3300005578 | Bacteria | 3178 |
| 189 | Ga0068854_100185442 | 3300005578 | Bacteria | 1627 |
| 190 | Ga0068854_100327352 | 3300005578 | Bacteria | 1247 |
| 191 | Ga0068854_100352193 | 3300005578 | Bacteria | 1205 |
| 192 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 193 | Ga0068856_100002724 | 3300005614 | Bacteria | 18087 |
| 194 | Ga0068856_100222278 | 3300005614 | Bacteria | 1904 |
| 195 | Ga0068856_100402031 | 3300005614 | Bacteria | 1389 |
| 196 | Ga0068856_100511607 | 3300005614 | Bacteria | 1222 |
| 197 | Ga0070702_100010977 | 3300005615 | Bacteria | 4489 |
| 198 | Ga0068852_100010212 | 3300005616 | Bacteria | 6998 |
| 199 | Ga0068852_100011772 | 3300005616 | Bacteria | 6605 |
| 200 | Ga0068852_100184337 | 3300005616 | Bacteria | 1965 |
| 201 | Ga0068852_100257164 | 3300005616 | Bacteria | 1675 |
| 202 | Ga0068852_100790806 | 3300005616 | Bacteria | 962 |
| 203 | Ga0068859_100065834 | 3300005617 | Bacteria | 3657 |
| 204 | Ga0068859_100179390 | 3300005617 | Bacteria | 2200 |
| 205 | Ga0068859_100243352 | 3300005617 | Bacteria | 1888 |
| 206 | Ga0068859_100383185 | 3300005617 | Bacteria | 1501 |
| 207 | Ga0068859_100678183 | 3300005617 | Bacteria | 1122 |
| 208 | Ga0068864_100022002 | 3300005618 | Bacteria | 5344 |
| 209 | Ga0068864_100024791 | 3300005618 | Bacteria | 5046 |
| 210 | Ga0068864_100509629 | 3300005618 | Bacteria | 1159 |
| 211 | Ga0068861_100147039 | 3300005719 | Bacteria | 1929 |
| 212 | Ga0068851_10062866 | 3300005834 | Bacteria | 1905 |
| 213 | Ga0068870_10008285 | 3300005840 | Bacteria | 4669 |
| 214 | Ga0068863_100001280 | 3300005841 | Bacteria | 25093 |
| 215 | Ga0068863_100142726 | 3300005841 | Bacteria | 2289 |
| 216 | Ga0068863_100206995 | 3300005841 | Bacteria | 1888 |
| 217 | Ga0068863_100350823 | 3300005841 | Bacteria | 1437 |
| 218 | Ga0068858_100025278 | 3300005842 | Bacteria | 5526 |
| 219 | Ga0068858_100052822 | 3300005842 | Bacteria | 3760 |
| 220 | Ga0068858_100086107 | 3300005842 | Bacteria | 2923 |
| 221 | Ga0068858_100320806 | 3300005842 | Bacteria | 1481 |
| 222 | Ga0068860_100000837 | 3300005843 | Bacteria | 34452 |
| 223 | Ga0068860_100026148 | 3300005843 | Bacteria | 5629 |
| 224 | Ga0068862_100003249 | 3300005844 | Bacteria | 14059 |
| 225 | Ga0068862_100035921 | 3300005844 | Bacteria | 4199 |
| 226 | Ga0068862_100080069 | 3300005844 | Bacteria | 2832 |
| 227 | Ga0081455_10008343 | 3300005937 | Bacteria | 10788 |
| 228 | Ga0081455_10011276 | 3300005937 | Bacteria | 8994 |
| 229 | Ga0081455_10013423 | 3300005937 | Bacteria | 8097 |
| 230 | Ga0081455_10032605 | 3300005937 | Bacteria | 4692 |
| 231 | Ga0081455_10040385 | 3300005937 | Bacteria | 4114 |
| 232 | Ga0081455_10051423 | 3300005937 | Bacteria | 3535 |
| 233 | Ga0081455_10072405 | 3300005937 | Bacteria | 2853 |
| 234 | Ga0081455_10192346 | 3300005937 | Bacteria | 1535 |
| 235 | Ga0081538_10016354 | 3300005981 | Bacteria | 5693 |
| 236 | Ga0081540_1002034 | 3300005983 | Bacteria | 16870 |
| 237 | Ga0081540_1007800 | 3300005983 | Bacteria | 7574 |
| 238 | Ga0081540_1008423 | 3300005983 | Bacteria | 7210 |
| 239 | Ga0081540_1012078 | 3300005983 | Bacteria | 5714 |
| 240 | Ga0081540_1020975 | 3300005983 | Bacteria | 3910 |
| 241 | Ga0081540_1023647 | 3300005983 | Bacteria | 3588 |
| 242 | Ga0081540_1074654 | 3300005983 | Bacteria | 1553 |
| 243 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 244 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 245 | Ga0081539_10006006 | 3300005985 | Bacteria | 11928 |
| 246 | Ga0070717_10000998 | 3300006028 | Bacteria | 18942 |
| 247 | Ga0070717_10017655 | 3300006028 | Bacteria | 5555 |
| 248 | Ga0070717_10032241 | 3300006028 | Bacteria | 4221 |
| 249 | Ga0070717_10086716 | 3300006028 | Bacteria | 2635 |
| 250 | Ga0070717_10148538 | 3300006028 | Bacteria | 2026 |
| 251 | Ga0075365_10040902 | 3300006038 | Bacteria | 3025 |
| 252 | Ga0075365_10043977 | 3300006038 | Bacteria | 2925 |
| 253 | Ga0075365_10211007 | 3300006038 | Bacteria | 1361 |
| 254 | Ga0075365_10274096 | 3300006038 | Bacteria | 1187 |
| 255 | Ga0075368_10026242 | 3300006042 | Bacteria | 2241 |
| 256 | Ga0075368_10028787 | 3300006042 | Bacteria | 2147 |
| 257 | Ga0075363_100012694 | 3300006048 | Bacteria | 4065 |
| 258 | Ga0075363_100082248 | 3300006048 | Bacteria | 1762 |
| 259 | Ga0075364_10092981 | 3300006051 | Bacteria | 2002 |
| 260 | Ga0075364_10272662 | 3300006051 | Bacteria | 1151 |
| 261 | Ga0075432_10000490 | 3300006058 | Bacteria | 11811 |
| 262 | Ga0070715_10001341 | 3300006163 | Bacteria | 7098 |
| 263 | Ga0070715_10001709 | 3300006163 | Bacteria | 6529 |
| 264 | Ga0070715_10015189 | 3300006163 | Bacteria | 2866 |
| 265 | Ga0070716_100010682 | 3300006173 | Bacteria | 4612 |
| 266 | Ga0070716_100021483 | 3300006173 | Bacteria | 3402 |
| 267 | Ga0070716_100043557 | 3300006173 | Bacteria | 2510 |
| 268 | Ga0070712_100011969 | 3300006175 | Bacteria | 5515 |
| 269 | Ga0070712_100014542 | 3300006175 | Bacteria | 5051 |
| 270 | Ga0070712_100038281 | 3300006175 | Bacteria | 3277 |
| 271 | Ga0070712_100051470 | 3300006175 | Bacteria | 2869 |
| 272 | Ga0070712_100112939 | 3300006175 | Bacteria | 2031 |
| 273 | Ga0075362_10034532 | 3300006177 | Bacteria | 2205 |
| 274 | Ga0075367_10001616 | 3300006178 | Bacteria | 9781 |
| 275 | Ga0075367_10017648 | 3300006178 | Bacteria | 3922 |
| 276 | Ga0075367_10089947 | 3300006178 | Bacteria | 1867 |
| 277 | Ga0075367_10112997 | 3300006178 | Bacteria | 1668 |
| 278 | Ga0075369_10010149 | 3300006186 | Bacteria | 3680 |
| 279 | Ga0075427_10000547 | 3300006194 | Bacteria | 4345 |
| 280 | Ga0075366_10093184 | 3300006195 | Bacteria | 1805 |
| 281 | Ga0075366_10139845 | 3300006195 | Bacteria | 1463 |
| 282 | Ga0075366_10233697 | 3300006195 | Bacteria | 1120 |
| 283 | Ga0097621_100013700 | 3300006237 | Bacteria | 6054 |
| 284 | Ga0097621_100050975 | 3300006237 | Bacteria | 3367 |
| 285 | Ga0097621_100117702 | 3300006237 | Bacteria | 2251 |
| 286 | Ga0075370_10069232 | 3300006353 | Bacteria | 2016 |
| 287 | Ga0075370_10159241 | 3300006353 | Bacteria | 1324 |
| 288 | Ga0068871_100002047 | 3300006358 | Bacteria | 13660 |
| 289 | Ga0068871_100009147 | 3300006358 | Bacteria | 7159 |
| 290 | Ga0075428_100003603 | 3300006844 | Bacteria | 16973 |
| 291 | Ga0075430_100001211 | 3300006846 | Bacteria | 20749 |
| 292 | Ga0075430_100003714 | 3300006846 | Bacteria | 12823 |
| 293 | Ga0075431_100003725 | 3300006847 | Bacteria | 14811 |
| 294 | Ga0075433_10000029 | 3300006852 | Bacteria | 55893 |
| 295 | Ga0075433_10068698 | 3300006852 | Bacteria | 3111 |
| 296 | Ga0075434_100002137 | 3300006871 | Bacteria | 17203 |
| 297 | Ga0075434_100002244 | 3300006871 | Bacteria | 16889 |
| 298 | Ga0075434_100038251 | 3300006871 | Bacteria | 4752 |
| 299 | Ga0075434_100056362 | 3300006871 | Bacteria | 3905 |
| 300 | Ga0075434_100118645 | 3300006871 | Bacteria | 2660 |
| 301 | Ga0075434_100568777 | 3300006871 | Bacteria | 1153 |
| 302 | Ga0075429_100002021 | 3300006880 | Bacteria | 16869 |
| 303 | Ga0068865_100017000 | 3300006881 | Bacteria | 4669 |
| 304 | Ga0075436_100221423 | 3300006914 | Bacteria | 1343 |
| 305 | Ga0097620_100065832 | 3300006931 | Bacteria | 3657 |
| 306 | Ga0097620_100179389 | 3300006931 | Bacteria | 2200 |
| 307 | Ga0097620_100243334 | 3300006931 | Bacteria | 1888 |
| 308 | Ga0097620_100383180 | 3300006931 | Bacteria | 1501 |
| 309 | Ga0097620_100678273 | 3300006931 | Bacteria | 1122 |
| 310 | Ga0099824_1008492 | 3300006942 | Bacteria | 13119 |
| 311 | Ga0099822_1002961 | 3300006943 | Bacteria | 21559 |
| 312 | Ga0075435_100001612 | 3300007076 | Bacteria | 14589 |
| 313 | Ga0075435_100052635 | 3300007076 | Bacteria | 3281 |
| 314 | Ga0075435_100086197 | 3300007076 | Bacteria | 2586 |
| 315 | Ga0075435_100107854 | 3300007076 | Bacteria | 2313 |
| 316 | Ga0099795_10064606 | 3300007788 | Bacteria | 1367 |
| 317 | Ga0105251_10064341 | 3300009011 | Bacteria | 1719 |
| 318 | Ga0105251_10170334 | 3300009011 | Bacteria | 981 |
| 319 | Ga0105244_10069538 | 3300009036 | Bacteria | 1758 |
| 320 | Ga0105240_10012243 | 3300009093 | Bacteria | 11853 |
| 321 | Ga0105240_10027631 | 3300009093 | Bacteria | 7427 |
| 322 | Ga0105240_10069358 | 3300009093 | Bacteria | 4364 |
| 323 | Ga0105240_10228286 | 3300009093 | Bacteria | 2165 |
| 324 | Ga0105240_10274693 | 3300009093 | Bacteria | 1939 |
| 325 | Ga0105240_10284374 | 3300009093 | Bacteria | 1898 |
| 326 | Ga0105240_10478354 | 3300009093 | Bacteria | 1389 |
| 327 | Ga0105240_10818469 | 3300009093 | Bacteria | 1008 |
| 328 | Ga0111539_10000345 | 3300009094 | Bacteria | 57093 |
| 329 | Ga0111539_10001931 | 3300009094 | Bacteria | 27629 |
| 330 | Ga0111539_10002122 | 3300009094 | Bacteria | 26499 |
| 331 | Ga0111539_10060686 | 3300009094 | Bacteria | 4481 |
| 332 | Ga0111539_10653200 | 3300009094 | Bacteria | 1225 |
| 333 | Ga0105245_10189222 | 3300009098 | Bacteria | 1971 |
| 334 | Ga0105245_10251474 | 3300009098 | Bacteria | 1717 |
| 335 | Ga0105245_10270738 | 3300009098 | Bacteria | 1657 |
| 336 | Ga0105247_10002880 | 3300009101 | Bacteria | 11453 |
| 337 | Ga0105247_10169366 | 3300009101 | Bacteria | 1451 |
| 338 | Ga0105247_10434623 | 3300009101 | Bacteria | 943 |
| 339 | Ga0114129_10037724 | 3300009147 | Bacteria | 6822 |
| 340 | Ga0114129_10054577 | 3300009147 | Bacteria | 5602 |
| 341 | Ga0114129_10096796 | 3300009147 | Bacteria | 4086 |
| 342 | Ga0114129_10344682 | 3300009147 | Bacteria | 1975 |
| 343 | Ga0105243_10154406 | 3300009148 | Bacteria | 1972 |
| 344 | Ga0105241_10001280 | 3300009174 | Bacteria | 19200 |
| 345 | Ga0105241_10017075 | 3300009174 | Bacteria | 5329 |
| 346 | Ga0105241_10030510 | 3300009174 | Bacteria | 4030 |
| 347 | Ga0105241_10060338 | 3300009174 | Bacteria | 2918 |
| 348 | Ga0105242_10007716 | 3300009176 | Bacteria | 8277 |
| 349 | Ga0105248_10036476 | 3300009177 | Bacteria | 5498 |
| 350 | Ga0105248_10044578 | 3300009177 | Bacteria | 4974 |
| 351 | Ga0105248_10051698 | 3300009177 | Bacteria | 4610 |
| 352 | Ga0105248_10084972 | 3300009177 | Bacteria | 3561 |
| 353 | Ga0105248_10098149 | 3300009177 | Bacteria | 3300 |
| 354 | Ga0105248_10275012 | 3300009177 | Bacteria | 1896 |
| 355 | Ga0105248_10570825 | 3300009177 | Bacteria | 1276 |
| 356 | Ga0105237_10044776 | 3300009545 | Bacteria | 4455 |
| 357 | Ga0105237_10081375 | 3300009545 | Bacteria | 3229 |
| 358 | Ga0105237_10095015 | 3300009545 | Bacteria | 2970 |
| 359 | Ga0105237_10122555 | 3300009545 | Bacteria | 2594 |
| 360 | Ga0105238_10031282 | 3300009551 | Bacteria | 5418 |
| 361 | Ga0105238_10044002 | 3300009551 | Bacteria | 4517 |
| 362 | Ga0105238_10079710 | 3300009551 | Bacteria | 3264 |
| 363 | Ga0105238_10154023 | 3300009551 | Bacteria | 2273 |
| 364 | Ga0105238_10159077 | 3300009551 | Bacteria | 2234 |
| 365 | Ga0105238_10318790 | 3300009551 | Bacteria | 1540 |
| 366 | Ga0105249_10016757 | 3300009553 | Bacteria | 6502 |
| 367 | Ga0105249_10017803 | 3300009553 | Bacteria | 6313 |
| 368 | Ga0105249_10089982 | 3300009553 | Bacteria | 2869 |
| 369 | Ga0105239_10041141 | 3300010375 | Bacteria | 5064 |
| 370 | Ga0105239_10054114 | 3300010375 | Bacteria | 4401 |
| 371 | Ga0105239_10057236 | 3300010375 | Bacteria | 4276 |
| 372 | Ga0105239_10189719 | 3300010375 | Bacteria | 2301 |
| 373 | Ga0105239_10203284 | 3300010375 | Bacteria | 2219 |
| 374 | Ga0105239_10241536 | 3300010375 | Bacteria | 2027 |
| 375 | Ga0105239_10298975 | 3300010375 | Bacteria | 1813 |
| 376 | Ga0105239_10318087 | 3300010375 | Bacteria | 1755 |
| 377 | Ga0105239_10336405 | 3300010375 | Bacteria | 1703 |
| 378 | Ga0105239_10369100 | 3300010375 | Bacteria | 1622 |
| 379 | Ga0105239_10415914 | 3300010375 | Bacteria | 1522 |
| 380 | Ga0105239_10870780 | 3300010375 | Bacteria | 1033 |
| 381 | Ga0105246_10009048 | 3300011119 | Bacteria | 6133 |
| 382 | Ga0105246_10242021 | 3300011119 | Bacteria | 1427 |
| 383 | Ga0105246_10254899 | 3300011119 | Bacteria | 1395 |
| 384 | Ga0105246_10538887 | 3300011119 | Bacteria | 998 |
| 385 | Ga0157313_1000825 | 3300012503 | Bacteria | 1527 |
| 386 | Ga0157315_1001210 | 3300012508 | Bacteria | 1387 |
| 387 | Ga0157373_10188271 | 3300013100 | Bacteria | 1454 |
| 388 | Ga0157371_10026432 | 3300013102 | Bacteria | 4219 |
| 389 | Ga0157371_10103174 | 3300013102 | Bacteria | 2024 |
| 390 | Ga0157370_10040880 | 3300013104 | Bacteria | 4475 |
| 391 | Ga0157370_10083427 | 3300013104 | Bacteria | 3004 |
| 392 | Ga0157369_10025909 | 3300013105 | Bacteria | 6506 |
| 393 | Ga0157369_10092109 | 3300013105 | Bacteria | 3235 |
| 394 | Ga0157369_10125716 | 3300013105 | Bacteria | 2719 |
| 395 | Ga0157369_10127447 | 3300013105 | Bacteria | 2698 |
| 396 | Ga0157378_10015501 | 3300013297 | Bacteria | 6677 |
| 397 | Ga0157378_10078348 | 3300013297 | Bacteria | 2981 |
| 398 | Ga0157378_10111506 | 3300013297 | Bacteria | 2508 |
| 399 | Ga0157378_10332038 | 3300013297 | Bacteria | 1480 |
| 400 | Ga0163162_10004233 | 3300013306 | Bacteria | 13796 |
| 401 | Ga0163162_10248130 | 3300013306 | Bacteria | 1912 |
| 402 | Ga0163162_10346785 | 3300013306 | Bacteria | 1617 |
| 403 | Ga0157372_10023476 | 3300013307 | Bacteria | 6686 |
| 404 | Ga0157372_10100045 | 3300013307 | Bacteria | 3308 |
| 405 | Ga0157372_10326812 | 3300013307 | Bacteria | 1786 |
| 406 | Ga0157372_10396871 | 3300013307 | Bacteria | 1607 |
| 407 | Ga0157375_10004079 | 3300013308 | Bacteria | 12661 |
| 408 | Ga0157375_10055890 | 3300013308 | Bacteria | 3893 |
| 409 | Ga0157375_10201235 | 3300013308 | Bacteria | 2148 |
| 410 | Ga0157375_10266806 | 3300013308 | Bacteria | 1873 |
| 411 | Ga0163163_10031448 | 3300014325 | Bacteria | 5123 |
| 412 | Ga0163163_10038355 | 3300014325 | Bacteria | 4669 |
| 413 | Ga0163163_10063499 | 3300014325 | Bacteria | 3662 |
| 414 | Ga0163163_10142581 | 3300014325 | Bacteria | 2438 |
| 415 | Ga0163163_10214532 | 3300014325 | Bacteria | 1974 |
| 416 | Ga0163163_10302245 | 3300014325 | Bacteria | 1653 |
| 417 | Ga0157377_10005595 | 3300014745 | Bacteria | 5921 |
| 418 | Ga0157379_10019419 | 3300014968 | Bacteria | 6002 |
| 419 | Ga0157379_10047425 | 3300014968 | Bacteria | 3833 |
| 420 | Ga0157379_10344951 | 3300014968 | Bacteria | 1362 |
| 421 | Ga0157376_10022471 | 3300014969 | Bacteria | 4919 |
| 422 | Ga0157376_10045995 | 3300014969 | Bacteria | 3596 |
| 423 | Ga0163161_10003992 | 3300017792 | Bacteria | 10336 |
| 424 | Ga0163161_10129022 | 3300017792 | Bacteria | 1906 |
| 425 | Ga0163161_10174870 | 3300017792 | Bacteria | 1643 |
| 426 | Ga0206356_11266266 | 3300020070 | Bacteria | 5495 |
| 427 | Ga0206354_10107649 | 3300020081 | Bacteria | 997 |
| 428 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 429 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 430 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 431 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 432 | Ga0213873_10005563 | 3300021358 | Bacteria | 2427 |
| 433 | Ga0213874_10054518 | 3300021377 | Bacteria | 1236 |
| 434 | Ga0213876_10008294 | 3300021384 | Bacteria | 5620 |
| 435 | Ga0213876_10027481 | 3300021384 | Bacteria | 3001 |
| 436 | Ga0213876_10058440 | 3300021384 | Bacteria | 2036 |
| 437 | Ga0213876_10078985 | 3300021384 | Bacteria | 1739 |
| 438 | Ga0209563_103792 | 3300025230 | Bacteria | 3037 |
| 439 | Ga0209677_102183 | 3300025253 | Bacteria | 7623 |
| 440 | Ga0209148_1000321 | 3300025254 | Bacteria | 66604 |
| 441 | Ga0209233_1000907 | 3300025261 | Bacteria | 12948 |
| 442 | Ga0209233_1008907 | 3300025261 | Bacteria | 3075 |
| 443 | Ga0209455_1000807 | 3300025272 | Bacteria | 17148 |
| 444 | Ga0207673_1000001 | 3300025290 | Bacteria | 29268 |
| 445 | Ga0209025_1060712 | 3300025294 | Bacteria | 1417 |
| 446 | Ga0209564_1000477 | 3300025295 | Bacteria | 66843 |
| 447 | Ga0209564_1021999 | 3300025295 | Bacteria | 2268 |
| 448 | Ga0209564_1031051 | 3300025295 | Bacteria | 1641 |
| 449 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 450 | Ga0209758_1000536 | 3300025297 | Bacteria | 60374 |
| 451 | Ga0209758_1001539 | 3300025297 | Bacteria | 26507 |
| 452 | Ga0209758_1001550 | 3300025297 | Bacteria | 26398 |
| 453 | Ga0209758_1002309 | 3300025297 | Bacteria | 19718 |
| 454 | Ga0209758_1004564 | 3300025297 | Bacteria | 11423 |
| 455 | Ga0209758_1018003 | 3300025297 | Bacteria | 3487 |
| 456 | Ga0209758_1021635 | 3300025297 | Bacteria | 2990 |
| 457 | Ga0209256_1011364 | 3300025299 | Bacteria | 3571 |
| 458 | Ga0207426_1000773 | 3300025302 | Bacteria | 35199 |
| 459 | Ga0207426_1000990 | 3300025302 | Bacteria | 27830 |
| 460 | Ga0207426_1003444 | 3300025302 | Bacteria | 8596 |
| 461 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 462 | Ga0209257_1011695 | 3300025304 | Bacteria | 4183 |
| 463 | Ga0207697_10158552 | 3300025315 | Bacteria | 986 |
| 464 | Ga0207656_10005846 | 3300025321 | Bacteria | 4382 |
| 465 | Ga0207682_10000254 | 3300025893 | Bacteria | 24104 |
| 466 | Ga0207692_10000138 | 3300025898 | Bacteria | 22336 |
| 467 | Ga0207692_10008172 | 3300025898 | Bacteria | 4323 |
| 468 | Ga0207692_10010497 | 3300025898 | Bacteria | 3906 |
| 469 | Ga0207692_10025398 | 3300025898 | Bacteria | 2766 |
| 470 | Ga0207692_10070524 | 3300025898 | Bacteria | 1840 |
| 471 | Ga0207692_10110409 | 3300025898 | Bacteria | 1524 |
| 472 | Ga0207710_10010813 | 3300025900 | Bacteria | 3843 |
| 473 | Ga0207710_10014720 | 3300025900 | Bacteria | 3302 |
| 474 | Ga0207710_10044682 | 3300025900 | Bacteria | 1973 |
| 475 | Ga0207710_10057463 | 3300025900 | Bacteria | 1757 |
| 476 | Ga0207710_10060946 | 3300025900 | Bacteria | 1711 |
| 477 | Ga0207710_10148545 | 3300025900 | Bacteria | 1136 |
| 478 | Ga0207688_10000518 | 3300025901 | Bacteria | 18635 |
| 479 | Ga0207688_10101138 | 3300025901 | Bacteria | 1665 |
| 480 | Ga0207680_10088009 | 3300025903 | Bacteria | 1968 |
| 481 | Ga0207680_10199770 | 3300025903 | Bacteria | 1362 |
| 482 | Ga0207647_10005671 | 3300025904 | Bacteria | 9117 |
| 483 | Ga0207647_10012374 | 3300025904 | Bacteria | 5941 |
| 484 | Ga0207685_10021771 | 3300025905 | Bacteria | 2155 |
| 485 | Ga0207699_10000122 | 3300025906 | Bacteria | 55116 |
| 486 | Ga0207699_10003146 | 3300025906 | Bacteria | 7851 |
| 487 | Ga0207699_10008397 | 3300025906 | Bacteria | 5096 |
| 488 | Ga0207699_10135323 | 3300025906 | Bacteria | 1613 |
| 489 | Ga0207699_10184435 | 3300025906 | Bacteria | 1404 |
| 490 | Ga0207645_10000249 | 3300025907 | Bacteria | 44921 |
| 491 | Ga0207645_10103240 | 3300025907 | Bacteria | 1840 |
| 492 | Ga0207643_10000978 | 3300025908 | Bacteria | 17143 |
| 493 | Ga0207643_10008642 | 3300025908 | Bacteria | 5462 |
| 494 | Ga0207643_10128696 | 3300025908 | Bacteria | 1505 |
| 495 | Ga0207705_10086337 | 3300025909 | Bacteria | 2293 |
| 496 | Ga0207705_10150930 | 3300025909 | Bacteria | 1741 |
| 497 | Ga0207684_10037662 | 3300025910 | Bacteria | 4104 |
| 498 | Ga0207654_10000153 | 3300025911 | Bacteria | 43627 |
| 499 | Ga0207654_10017523 | 3300025911 | Bacteria | 3746 |
| 500 | Ga0207654_10058650 | 3300025911 | Bacteria | 2242 |
| 501 | Ga0207707_10000515 | 3300025912 | Bacteria | 39696 |
| 502 | Ga0207707_10002207 | 3300025912 | Bacteria | 17632 |
| 503 | Ga0207707_10016918 | 3300025912 | Bacteria | 6351 |
| 504 | Ga0207707_10036558 | 3300025912 | Bacteria | 4293 |
| 505 | Ga0207707_10102350 | 3300025912 | Bacteria | 2503 |
| 506 | Ga0207707_10110818 | 3300025912 | Bacteria | 2399 |
| 507 | Ga0207707_10286287 | 3300025912 | Bacteria | 1426 |
| 508 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 509 | Ga0207695_10000506 | 3300025913 | Bacteria | 82904 |
| 510 | Ga0207695_10030436 | 3300025913 | Bacteria | 5941 |
| 511 | Ga0207695_10051564 | 3300025913 | Bacteria | 4318 |
| 512 | Ga0207695_10200231 | 3300025913 | Bacteria | 1911 |
| 513 | Ga0207695_10223007 | 3300025913 | Bacteria | 1792 |
| 514 | Ga0207695_10330686 | 3300025913 | Bacteria | 1412 |
| 515 | Ga0207671_10021063 | 3300025914 | Bacteria | 4952 |
| 516 | Ga0207671_10205156 | 3300025914 | Bacteria | 1540 |
| 517 | Ga0207671_10331817 | 3300025914 | Bacteria | 1205 |
| 518 | Ga0207693_10001489 | 3300025915 | Bacteria | 20660 |
| 519 | Ga0207693_10004906 | 3300025915 | Bacteria | 11244 |
| 520 | Ga0207693_10009351 | 3300025915 | Bacteria | 7991 |
| 521 | Ga0207693_10010845 | 3300025915 | Bacteria | 7394 |
| 522 | Ga0207693_10042947 | 3300025915 | Bacteria | 3559 |
| 523 | Ga0207693_10052221 | 3300025915 | Bacteria | 3206 |
| 524 | Ga0207693_10080113 | 3300025915 | Bacteria | 2556 |
| 525 | Ga0207663_10000161 | 3300025916 | Bacteria | 30665 |
| 526 | Ga0207663_10000486 | 3300025916 | Bacteria | 17287 |
| 527 | Ga0207663_10000623 | 3300025916 | Bacteria | 15689 |
| 528 | Ga0207663_10012940 | 3300025916 | Bacteria | 4524 |
| 529 | Ga0207663_10014563 | 3300025916 | Bacteria | 4310 |
| 530 | Ga0207663_10121501 | 3300025916 | Bacteria | 1789 |
| 531 | Ga0207663_10152537 | 3300025916 | Bacteria | 1622 |
| 532 | Ga0207663_10293394 | 3300025916 | Bacteria | 1212 |
| 533 | Ga0207660_10001490 | 3300025917 | Bacteria | 15757 |
| 534 | Ga0207660_10016126 | 3300025917 | Bacteria | 4941 |
| 535 | Ga0207660_10145361 | 3300025917 | Bacteria | 1817 |
| 536 | Ga0207660_10149483 | 3300025917 | Bacteria | 1793 |
| 537 | Ga0207660_10155763 | 3300025917 | Bacteria | 1758 |
| 538 | Ga0207662_10076038 | 3300025918 | Bacteria | 2040 |
| 539 | Ga0207657_10033356 | 3300025919 | Bacteria | 4642 |
| 540 | Ga0207657_10046782 | 3300025919 | Bacteria | 3788 |
| 541 | Ga0207657_10141428 | 3300025919 | Bacteria | 1966 |
| 542 | Ga0207657_10217252 | 3300025919 | Bacteria | 1533 |
| 543 | Ga0207649_10006897 | 3300025920 | Bacteria | 6172 |
| 544 | Ga0207649_10312393 | 3300025920 | Bacteria | 1152 |
| 545 | Ga0207652_10024532 | 3300025921 | Bacteria | 5004 |
| 546 | Ga0207652_10045557 | 3300025921 | Bacteria | 3740 |
| 547 | Ga0207652_10084447 | 3300025921 | Bacteria | 2781 |
| 548 | Ga0207652_10154142 | 3300025921 | Bacteria | 2058 |
| 549 | Ga0207652_10161285 | 3300025921 | Bacteria | 2010 |
| 550 | Ga0207652_10196019 | 3300025921 | Bacteria | 1817 |
| 551 | Ga0207652_10226959 | 3300025921 | Bacteria | 1683 |
| 552 | Ga0207652_10246409 | 3300025921 | Bacteria | 1611 |
| 553 | Ga0207646_10094693 | 3300025922 | Bacteria | 2675 |
| 554 | Ga0207681_10000956 | 3300025923 | Bacteria | 18860 |
| 555 | Ga0207694_10003910 | 3300025924 | Bacteria | 11770 |
| 556 | Ga0207694_10105389 | 3300025924 | Bacteria | 2238 |
| 557 | Ga0207694_10220145 | 3300025924 | Bacteria | 1548 |
| 558 | Ga0207694_10225354 | 3300025924 | Bacteria | 1530 |
| 559 | Ga0207694_10350294 | 3300025924 | Bacteria | 1222 |
| 560 | Ga0207650_10030055 | 3300025925 | Bacteria | 3911 |
| 561 | Ga0207650_10074218 | 3300025925 | Bacteria | 2563 |
| 562 | Ga0207659_10006156 | 3300025926 | Bacteria | 7335 |
| 563 | Ga0207687_10009895 | 3300025927 | Bacteria | 6243 |
| 564 | Ga0207687_10017120 | 3300025927 | Bacteria | 4765 |
| 565 | Ga0207687_10029818 | 3300025927 | Bacteria | 3672 |
| 566 | Ga0207687_10230891 | 3300025927 | Bacteria | 1461 |
| 567 | Ga0207687_10301560 | 3300025927 | Bacteria | 1291 |
| 568 | Ga0207687_10403339 | 3300025927 | Bacteria | 1125 |
| 569 | Ga0207700_10002081 | 3300025928 | Bacteria | 11427 |
| 570 | Ga0207700_10015603 | 3300025928 | Bacteria | 5017 |
| 571 | Ga0207700_10068098 | 3300025928 | Bacteria | 2727 |
| 572 | Ga0207700_10078852 | 3300025928 | Bacteria | 2563 |
| 573 | Ga0207700_10099864 | 3300025928 | Bacteria | 2312 |
| 574 | Ga0207700_10157829 | 3300025928 | Bacteria | 1881 |
| 575 | Ga0207664_10012679 | 3300025929 | Bacteria | 6031 |
| 576 | Ga0207664_10021734 | 3300025929 | Bacteria | 4779 |
| 577 | Ga0207664_10037810 | 3300025929 | Bacteria | 3738 |
| 578 | Ga0207664_10048501 | 3300025929 | Bacteria | 3340 |
| 579 | Ga0207664_10081093 | 3300025929 | Bacteria | 2639 |
| 580 | Ga0207664_10122909 | 3300025929 | Bacteria | 2175 |
| 581 | Ga0207664_10123809 | 3300025929 | Bacteria | 2168 |
| 582 | Ga0207664_10496495 | 3300025929 | Bacteria | 1093 |
| 583 | Ga0207644_10015163 | 3300025931 | Bacteria | 5170 |
| 584 | Ga0207644_10018487 | 3300025931 | Bacteria | 4716 |
| 585 | Ga0207644_10022900 | 3300025931 | Bacteria | 4272 |
| 586 | Ga0207644_10033779 | 3300025931 | Bacteria | 3577 |
| 587 | Ga0207644_10293512 | 3300025931 | Bacteria | 1308 |
| 588 | Ga0207690_10000546 | 3300025932 | Bacteria | 24592 |
| 589 | Ga0207690_10165952 | 3300025932 | Bacteria | 1650 |
| 590 | Ga0207690_10493916 | 3300025932 | Bacteria | 989 |
| 591 | Ga0207706_10020138 | 3300025933 | Bacteria | 5995 |
| 592 | Ga0207706_10062550 | 3300025933 | Bacteria | 3278 |
| 593 | Ga0207706_10126312 | 3300025933 | Bacteria | 2249 |
| 594 | Ga0207706_10162509 | 3300025933 | Bacteria | 1963 |
| 595 | Ga0207706_10198139 | 3300025933 | Bacteria | 1761 |
| 596 | Ga0207686_10007493 | 3300025934 | Bacteria | 5874 |
| 597 | Ga0207709_10005105 | 3300025935 | Bacteria | 7493 |
| 598 | Ga0207709_10041733 | 3300025935 | Bacteria | 2755 |
| 599 | Ga0207670_10002637 | 3300025936 | Bacteria | 9436 |
| 600 | Ga0207670_10056573 | 3300025936 | Bacteria | 2656 |
| 601 | Ga0207670_10084579 | 3300025936 | Bacteria | 2227 |
| 602 | Ga0207670_10183717 | 3300025936 | Bacteria | 1577 |
| 603 | Ga0207669_10002362 | 3300025937 | Bacteria | 8026 |
| 604 | Ga0207669_10311820 | 3300025937 | Bacteria | 1200 |
| 605 | Ga0207704_10000964 | 3300025938 | Bacteria | 12727 |
| 606 | Ga0207704_10054979 | 3300025938 | Bacteria | 2430 |
| 607 | Ga0207704_10098483 | 3300025938 | Bacteria | 1942 |
| 608 | Ga0207665_10000183 | 3300025939 | Bacteria | 41938 |
| 609 | Ga0207665_10002530 | 3300025939 | Bacteria | 12310 |
| 610 | Ga0207665_10016785 | 3300025939 | Bacteria | 4808 |
| 611 | Ga0207665_10090592 | 3300025939 | Bacteria | 2119 |
| 612 | Ga0207691_10001481 | 3300025940 | Bacteria | 23425 |
| 613 | Ga0207711_10023845 | 3300025941 | Bacteria | 5122 |
| 614 | Ga0207711_10094808 | 3300025941 | Bacteria | 2631 |
| 615 | Ga0207711_10117134 | 3300025941 | Bacteria | 2375 |
| 616 | Ga0207689_10000424 | 3300025942 | Bacteria | 39635 |
| 617 | Ga0207689_10087700 | 3300025942 | Bacteria | 2556 |
| 618 | Ga0207689_10244191 | 3300025942 | Bacteria | 1484 |
| 619 | Ga0207661_10000828 | 3300025944 | Bacteria | 20288 |
| 620 | Ga0207661_10001905 | 3300025944 | Bacteria | 14307 |
| 621 | Ga0207661_10028196 | 3300025944 | Bacteria | 4298 |
| 622 | Ga0207661_10128685 | 3300025944 | Bacteria | 2165 |
| 623 | Ga0207679_10000595 | 3300025945 | Bacteria | 24139 |
| 624 | Ga0207667_10030376 | 3300025949 | Bacteria | 5846 |
| 625 | Ga0207667_10058089 | 3300025949 | Bacteria | 4059 |
| 626 | Ga0207667_10064756 | 3300025949 | Bacteria | 3815 |
| 627 | Ga0207667_10104674 | 3300025949 | Bacteria | 2919 |
| 628 | Ga0207667_10332027 | 3300025949 | Bacteria | 1552 |
| 629 | Ga0207651_10020112 | 3300025960 | Bacteria | 4020 |
| 630 | Ga0207651_10199418 | 3300025960 | Bacteria | 1603 |
| 631 | Ga0207712_10018492 | 3300025961 | Bacteria | 4540 |
| 632 | Ga0207712_10023939 | 3300025961 | Bacteria | 4036 |
| 633 | Ga0207712_10121382 | 3300025961 | Bacteria | 1978 |
| 634 | Ga0207668_10000956 | 3300025972 | Bacteria | 17416 |
| 635 | Ga0207668_10006840 | 3300025972 | Bacteria | 6761 |
| 636 | Ga0207668_10043661 | 3300025972 | Bacteria | 3044 |
| 637 | Ga0207640_10007609 | 3300025981 | Bacteria | 5979 |
| 638 | Ga0207640_10023862 | 3300025981 | Bacteria | 3682 |
| 639 | Ga0207640_10134907 | 3300025981 | Bacteria | 1790 |
| 640 | Ga0207658_10020702 | 3300025986 | Bacteria | 4556 |
| 641 | Ga0207658_10067626 | 3300025986 | Bacteria | 2692 |
| 642 | Ga0207658_10316488 | 3300025986 | Bacteria | 1350 |
| 643 | Ga0207677_10032859 | 3300026023 | Bacteria | 3340 |
| 644 | Ga0207677_10408896 | 3300026023 | Bacteria | 1153 |
| 645 | Ga0207703_10035107 | 3300026035 | Bacteria | 3984 |
| 646 | Ga0207703_10141894 | 3300026035 | Bacteria | 2086 |
| 647 | Ga0207703_10416537 | 3300026035 | Bacteria | 1249 |
| 648 | Ga0207639_10006156 | 3300026041 | Bacteria | 8146 |
| 649 | Ga0207639_10024622 | 3300026041 | Bacteria | 4358 |
| 650 | Ga0207639_10042056 | 3300026041 | Bacteria | 3423 |
| 651 | Ga0207678_10022600 | 3300026067 | Bacteria | 5508 |
| 652 | Ga0207678_10026771 | 3300026067 | Bacteria | 5030 |
| 653 | Ga0207678_10038686 | 3300026067 | Bacteria | 4143 |
| 654 | Ga0207678_10059424 | 3300026067 | Bacteria | 3289 |
| 655 | Ga0207678_10096846 | 3300026067 | Bacteria | 2522 |
| 656 | Ga0207678_10105437 | 3300026067 | Bacteria | 2405 |
| 657 | Ga0207678_10155774 | 3300026067 | Bacteria | 1951 |
| 658 | Ga0207678_10298681 | 3300026067 | Bacteria | 1384 |
| 659 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 660 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 661 | Ga0207702_10043737 | 3300026078 | Bacteria | 3762 |
| 662 | Ga0207702_10174014 | 3300026078 | Bacteria | 1977 |
| 663 | Ga0207702_10222152 | 3300026078 | Bacteria | 1761 |
| 664 | Ga0207702_10421699 | 3300026078 | Bacteria | 1290 |
| 665 | Ga0207702_10481793 | 3300026078 | Bacteria | 1207 |
| 666 | Ga0207641_10024879 | 3300026088 | Bacteria | 4935 |
| 667 | Ga0207641_10193115 | 3300026088 | Bacteria | 1872 |
| 668 | Ga0207648_10001553 | 3300026089 | Bacteria | 25292 |
| 669 | Ga0207676_10013306 | 3300026095 | Bacteria | 5910 |
| 670 | Ga0207676_10121038 | 3300026095 | Bacteria | 2207 |
| 671 | Ga0207674_10048571 | 3300026116 | Bacteria | 4343 |
| 672 | Ga0207674_10048718 | 3300026116 | Bacteria | 4336 |
| 673 | Ga0207674_10133209 | 3300026116 | Bacteria | 2448 |
| 674 | Ga0207674_10171418 | 3300026116 | Bacteria | 2123 |
| 675 | Ga0207674_10227285 | 3300026116 | Bacteria | 1814 |
| 676 | Ga0207675_100141890 | 3300026118 | Bacteria | 2282 |
| 677 | Ga0207675_100241858 | 3300026118 | Bacteria | 1744 |
| 678 | Ga0207675_100539240 | 3300026118 | Bacteria | 1165 |
| 679 | Ga0207683_10011960 | 3300026121 | Bacteria | 7408 |
| 680 | Ga0207683_10016218 | 3300026121 | Bacteria | 6341 |
| 681 | Ga0207683_10017647 | 3300026121 | Bacteria | 6084 |
| 682 | Ga0207683_10030540 | 3300026121 | Bacteria | 4669 |
| 683 | Ga0207683_10177815 | 3300026121 | Bacteria | 1929 |
| 684 | Ga0207698_10001038 | 3300026142 | Bacteria | 16161 |
| 685 | Ga0207698_10045959 | 3300026142 | Bacteria | 3293 |
| 686 | Ga0207698_10297454 | 3300026142 | Bacteria | 1501 |
| 687 | Ga0207698_10395256 | 3300026142 | Bacteria | 1319 |
| 688 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 689 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 690 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 691 | Ga0209589_1000055 | 3300027357 | Bacteria | 111890 |
| 692 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 693 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 694 | Ga0209489_100128 | 3300027361 | Bacteria | 111890 |
| 695 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 696 | Ga0209700_100137 | 3300027363 | Bacteria | 111890 |
| 697 | Ga0209967_1007987 | 3300027364 | Bacteria | 1451 |
| 698 | Ga0209968_1006106 | 3300027526 | Bacteria | 1813 |
| 699 | Ga0209982_1004320 | 3300027552 | Bacteria | 2036 |
| 700 | Ga0209970_1005990 | 3300027614 | Bacteria | 1995 |
| 701 | Ga0209588_1005208 | 3300027671 | Bacteria | 3711 |
| 702 | Ga0209966_1003959 | 3300027695 | Bacteria | 2500 |
| 703 | Ga0209998_10002627 | 3300027717 | Bacteria | 4070 |
| 704 | Ga0209813_10020446 | 3300027866 | Bacteria | 1852 |
| 705 | Ga0209974_10006301 | 3300027876 | Bacteria | 4147 |
| 706 | Ga0209974_10014756 | 3300027876 | Bacteria | 2596 |
| 707 | Ga0207428_10000150 | 3300027907 | Bacteria | 94699 |
| 708 | Ga0207428_10000360 | 3300027907 | Bacteria | 58478 |
| 709 | Ga0207428_10001312 | 3300027907 | Bacteria | 26468 |
| 710 | Ga0207428_10036448 | 3300027907 | Bacteria | 4011 |
| 711 | Ga0268266_10011617 | 3300028379 | Bacteria | 7644 |
| 712 | Ga0268266_10034702 | 3300028379 | Bacteria | 4290 |
| 713 | Ga0268266_10053634 | 3300028379 | Bacteria | 3464 |
| 714 | Ga0268266_10115088 | 3300028379 | Bacteria | 2387 |
| 715 | Ga0268266_10188768 | 3300028379 | Bacteria | 1881 |
| 716 | Ga0268266_10219944 | 3300028379 | Bacteria | 1745 |
| 717 | Ga0268266_10600699 | 3300028379 | Bacteria | 1057 |
| 718 | Ga0268265_10011427 | 3300028380 | Bacteria | 6001 |
| 719 | Ga0268265_10021796 | 3300028380 | Bacteria | 4493 |
| 720 | Ga0268265_10029400 | 3300028380 | Bacteria | 3943 |
| 721 | Ga0268265_10130892 | 3300028380 | Bacteria | 2085 |
| 722 | Ga0268264_10000537 | 3300028381 | Bacteria | 48029 |
| 723 | Ga0268264_10004770 | 3300028381 | Bacteria | 11508 |
| 724 | Ga0265337_1061197 | 3300028556 | Bacteria | 1043 |
| 725 | Ga0265334_10039065 | 3300028573 | Bacteria | 1864 |
| 726 | Ga0265318_10007950 | 3300028577 | Bacteria | 4756 |
| 727 | Ga0265323_10012335 | 3300028653 | Bacteria | 3428 |
| 728 | Ga0265336_10001738 | 3300028666 | Bacteria | 9568 |
| 729 | Ga0307517_10001423 | 3300028786 | Bacteria | 40213 |
| 730 | Ga0307515_10046793 | 3300028794 | Bacteria | 6600 |
| 731 | Ga0307515_10122964 | 3300028794 | Bacteria | 2923 |
| 732 | Ga0265338_10000417 | 3300028800 | Bacteria | 76249 |
| 733 | Ga0265338_10085973 | 3300028800 | Bacteria | 2619 |
| 734 | Ga0307511_10080843 | 3300030521 | Bacteria | 2286 |
| 735 | Ga0265330_10025682 | 3300031235 | Bacteria | 2669 |
| 736 | Ga0265330_10034644 | 3300031235 | Bacteria | 2254 |
| 737 | Ga0265330_10102948 | 3300031235 | Bacteria | 1221 |
| 738 | Ga0265332_10040115 | 3300031238 | Bacteria | 2027 |
| 739 | Ga0265325_10000030 | 3300031241 | Bacteria | 103532 |
| 740 | Ga0265340_10001799 | 3300031247 | Bacteria | 12236 |
| 741 | Ga0265340_10013333 | 3300031247 | Bacteria | 4319 |
| 742 | Ga0265340_10046257 | 3300031247 | Bacteria | 2123 |
| 743 | Ga0265340_10068207 | 3300031247 | Bacteria | 1689 |
| 744 | Ga0265340_10068245 | 3300031247 | Bacteria | 1689 |
| 745 | Ga0265340_10069793 | 3300031247 | Bacteria | 1667 |
| 746 | Ga0265340_10070799 | 3300031247 | Bacteria | 1654 |
| 747 | Ga0265340_10105394 | 3300031247 | Bacteria | 1307 |
| 748 | Ga0265340_10144623 | 3300031247 | Bacteria | 1086 |
| 749 | Ga0265339_10000281 | 3300031249 | Bacteria | 41044 |
| 750 | Ga0265339_10009279 | 3300031249 | Bacteria | 6197 |
| 751 | Ga0265339_10116126 | 3300031249 | Bacteria | 1380 |
| 752 | Ga0265331_10089716 | 3300031250 | Bacteria | 1422 |
| 753 | Ga0265331_10130344 | 3300031250 | Bacteria | 1147 |
| 754 | Ga0265316_10012755 | 3300031344 | Bacteria | 7510 |
| 755 | Ga0265316_10159503 | 3300031344 | Bacteria | 1687 |
| 756 | Ga0307513_10171602 | 3300031456 | Bacteria | 2046 |
| 757 | Ga0307509_10053131 | 3300031507 | Bacteria | 4322 |
| 758 | Ga0265313_10001560 | 3300031595 | Bacteria | 21251 |
| 759 | Ga0265313_10005929 | 3300031595 | Bacteria | 8842 |
| 760 | Ga0265313_10023598 | 3300031595 | Bacteria | 3310 |
| 761 | Ga0265313_10107458 | 3300031595 | Bacteria | 1230 |
| 762 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 763 | Ga0307508_10033210 | 3300031616 | Bacteria | 4657 |
| 764 | Ga0307508_10323996 | 3300031616 | Bacteria | 1133 |
| 765 | Ga0265314_10011033 | 3300031711 | Bacteria | 7493 |
| 766 | Ga0265314_10023091 | 3300031711 | Bacteria | 4752 |
| 767 | Ga0265342_10002764 | 3300031712 | Bacteria | 14883 |
| 768 | Ga0265342_10046678 | 3300031712 | Bacteria | 2602 |
| 769 | Ga0265342_10077453 | 3300031712 | Bacteria | 1925 |
| 770 | Ga0265342_10079030 | 3300031712 | Bacteria | 1903 |
| 771 | Ga0307516_10014001 | 3300031730 | Bacteria | 8506 |
| 772 | Ga0307516_10293693 | 3300031730 | Bacteria | 1303 |
| 773 | Ga0307407_10242335 | 3300031903 | Bacteria | 1231 |
| 774 | Ga0307412_10049330 | 3300031911 | Bacteria | 2773 |
| 775 | Ga0307416_100100577 | 3300032002 | Bacteria | 2515 |
| 776 | Ga0307416_100154960 | 3300032002 | Bacteria | 2108 |
| 777 | Ga0307411_10194970 | 3300032005 | Bacteria | 1550 |
| 778 | Ga0316583_10001485 | 3300032133 | Bacteria | 7857 |
| 779 | Ga0307510_10022874 | 3300033180 | Bacteria | 7250 |
| 780 | Ga0307510_10031589 | 3300033180 | Bacteria | 5980 |
| 781 | Ga0307510_10037361 | 3300033180 | Bacteria | 5388 |
| 782 | Ga0307510_10071425 | 3300033180 | Bacteria | 3456 |
| 783 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 784 | Ga0373930_0001257 | 3300034816 | Bacteria | 3742 |
| 785 | Ga0373948_0000908 | 3300034817 | Bacteria | 3960 |
| 786 | Ga0373950_0002852 | 3300034818 | Bacteria | 2422 |
| 787 | Ga0373958_0000355 | 3300034819 | Bacteria | 5513 |
| 788 | Ga0373959_0000802 | 3300034820 | Bacteria | 5367 |
| 789 | Ga0373938_0000819 | 3300034957 | Bacteria | 5030 |
| 790 | Ga0373938_0004439 | 3300034957 | Bacteria | 2345 |
| 791 | Ga0373926_0014919 | 3300035083 | Bacteria | 2646 |
| 792 | Ga0373928_0004165 | 3300035084 | Bacteria | 2757 |
| 793 | Ga0373929_0000724 | 3300035085 | Bacteria | 6375 |
| 794 | Ga0373929_0001327 | 3300035085 | Bacteria | 4770 |
| 795 | Ga0373929_0004365 | 3300035085 | Bacteria | 2537 |
| 796 | Ga0373929_0008227 | 3300035085 | Bacteria | 1921 |
| 797 | Ga0373934_0006879 | 3300035086 | Bacteria | 4222 |
| 798 | Ga0373934_0024456 | 3300035086 | Bacteria | 2335 |
| 799 | Ga0373934_0029496 | 3300035086 | Bacteria | 2143 |
| 800 | Ga0373940_0000119 | 3300035088 | Bacteria | 9863 |
| 801 | Ga0373944_0030301 | 3300035089 | Bacteria | 1622 |
| 802 | Ga0373949_0001280 | 3300035090 | Bacteria | 7323 |
| 803 | Ga0373949_0013053 | 3300035090 | Bacteria | 1841 |
| 804 | Ga0373951_0002117 | 3300035091 | Bacteria | 5077 |
| 805 | Ga0373951_0007708 | 3300035091 | Bacteria | 2442 |
| 806 | Ga0373951_0034361 | 3300035091 | Bacteria | 1204 |
| 807 | Ga0373952_0000988 | 3300035092 | Bacteria | 5183 |
| 808 | Ga0373952_0003629 | 3300035092 | Bacteria | 2783 |
| 809 | Ga0373923_0002058 | 3300035111 | Bacteria | 6070 |
| 810 | Ga0373923_0073674 | 3300035111 | Bacteria | 1471 |
| 811 | Ga0373932_0002403 | 3300035112 | Bacteria | 4749 |
| 812 | Ga0373932_0008557 | 3300035112 | Bacteria | 2447 |
| 813 | Ga0373936_0003648 | 3300035113 | Bacteria | 5778 |
| 814 | Ga0373936_0007352 | 3300035113 | Bacteria | 4145 |
| 815 | Ga0373936_0083421 | 3300035113 | Bacteria | 1332 |
| 816 | Ga0373939_0001166 | 3300035114 | Bacteria | 6435 |
| 817 | Ga0373939_0034470 | 3300035114 | Bacteria | 1485 |
| 818 | Ga0373941_0009208 | 3300035115 | Bacteria | 2479 |
| 819 | Ga0373941_0011011 | 3300035115 | Bacteria | 2327 |
| 820 | Ga0373953_0001704 | 3300035117 | Bacteria | 6467 |
| 821 | Ga0373953_0002691 | 3300035117 | Bacteria | 5390 |
| 822 | Ga0373953_0005593 | 3300035117 | Bacteria | 4090 |
| 823 | Ga0373953_0007780 | 3300035117 | Bacteria | 3609 |
| 824 | Ga0373953_0081173 | 3300035117 | Bacteria | 1348 |
| 825 | Ga0373954_0003012 | 3300035118 | Bacteria | 7106 |
| 826 | Ga0373954_0005688 | 3300035118 | Bacteria | 5407 |
| 827 | Ga0373954_0007407 | 3300035118 | Bacteria | 4802 |
| 828 | Ga0373954_0037525 | 3300035118 | Bacteria | 2252 |
| 829 | Ga0373956_0019212 | 3300035119 | Bacteria | 2898 |
| 830 | Ga0373956_0050946 | 3300035119 | Bacteria | 1860 |
| 831 | Ga0373956_0056817 | 3300035119 | Bacteria | 1767 |
| 832 | Ga0373957_0004673 | 3300035120 | Bacteria | 4187 |
| 833 | Ga0373957_0050268 | 3300035120 | Bacteria | 1593 |
| 834 | Ga0373957_0113656 | 3300035120 | Bacteria | 1092 |
| 835 | Ga0373960_0022622 | 3300035121 | Bacteria | 1685 |
| 836 | Ga0373960_0025006 | 3300035121 | Bacteria | 1620 |
| 837 | Ga0373943_0001786 | 3300035170 | Bacteria | 9742 |
| 838 | Ga0373943_0010318 | 3300035170 | Bacteria | 4190 |
| 839 | Ga0373943_0025951 | 3300035170 | Bacteria | 2741 |
| 840 | Ga0373943_0113383 | 3300035170 | Bacteria | 1432 |
| 841 | Ga0373943_0212634 | 3300035170 | Bacteria | 1074 |
| 842 | Ga0373946_0008815 | 3300035171 | Bacteria | 3702 |
| 843 | Ga0373946_0013746 | 3300035171 | Bacteria | 3046 |
| 844 | Ga0373946_0023480 | 3300035171 | Bacteria | 2409 |
| 845 | Ga0373946_0064188 | 3300035171 | Bacteria | 1570 |
| 846 | Ga0373946_0111979 | 3300035171 | Bacteria | 1236 |
| 847 | Ga0373955_0002129 | 3300035172 | Bacteria | 8555 |
| 848 | Ga0373955_0002139 | 3300035172 | Bacteria | 8536 |
| 849 | Ga0373955_0009253 | 3300035172 | Bacteria | 4612 |
| 850 | Ga0373955_0038590 | 3300035172 | Bacteria | 2545 |
| 851 | Ga0373955_0048106 | 3300035172 | Bacteria | 2311 |
| 852 | Ga0373955_0070775 | 3300035172 | Bacteria | 1949 |
| 853 | Ga0373955_0091565 | 3300035172 | Bacteria | 1733 |
| 854 | Ga0373942_0003873 | 3300035207 | Bacteria | 3499 |
| 855 | Ga0373942_0020819 | 3300035207 | Bacteria | 1650 |
| 856 | Ga0373961_0001933 | 3300035241 | Bacteria | 5614 |
| 857 | Ga0373961_0002392 | 3300035241 | Bacteria | 4881 |
| 858 | Ga0373962_0001833 | 3300035242 | Bacteria | 5059 |
| 859 | Ga0373962_0024304 | 3300035242 | Bacteria | 1619 |
| 860 | Ga0373962_0071171 | 3300035242 | Bacteria | 1039 |
| 861 | Ga0373924_0012594 | 3300035410 | Bacteria | 3163 |
| 862 | Ga0373924_0014039 | 3300035410 | Bacteria | 3021 |
| 863 | Ga0373924_0052820 | 3300035410 | Bacteria | 1687 |
| 864 | Ga0373931_0003840 | 3300035691 | Bacteria | 6792 |
| 865 | Ga0373931_0011514 | 3300035691 | Bacteria | 4275 |
| 866 | Ga0373931_0060213 | 3300035691 | Bacteria | 2043 |
| 867 | Ga0373931_0079578 | 3300035691 | Bacteria | 1805 |
| 868 | Ga0373931_0245685 | 3300035691 | Bacteria | 1086 |
| 869 | Ga0373935_0002000 | 3300035692 | Bacteria | 11490 |
| 870 | Ga0373935_0003730 | 3300035692 | Bacteria | 8891 |
| 871 | Ga0373935_0017629 | 3300035692 | Bacteria | 4335 |
| 872 | Ga0373935_0034724 | 3300035692 | Bacteria | 3145 |
| 873 | Ga0373935_0069494 | 3300035692 | Bacteria | 2268 |
| 874 | Ga0373927_0001492 | 3300035695 | Bacteria | 17635 |
| 875 | Ga0373927_0001793 | 3300035695 | Bacteria | 16018 |
| 876 | Ga0373927_0015381 | 3300035695 | Bacteria | 5057 |
| 877 | Ga0373927_0035090 | 3300035695 | Bacteria | 3261 |
| 878 | Ga0373927_0038128 | 3300035695 | Bacteria | 3121 |
| 879 | Ga0373927_0049781 | 3300035695 | Bacteria | 2709 |
| 880 | Ga0373927_0272536 | 3300035695 | Bacteria | 1113 |
| 881 | Ga0373933_0000267 | 3300035724 | Bacteria | 34008 |
| 882 | Ga0373933_0013540 | 3300035724 | Bacteria | 4523 |
| 883 | Ga0373933_0016394 | 3300035724 | Bacteria | 4142 |
| 884 | Ga0373933_0035758 | 3300035724 | Bacteria | 2903 |
| 885 | Ga0373933_0036074 | 3300035724 | Bacteria | 2892 |
| 886 | Ga0373947_0001861 | 3300035725 | Bacteria | 12857 |
| 887 | Ga0373947_0011238 | 3300035725 | Bacteria | 5137 |
| 888 | Ga0373947_0019083 | 3300035725 | Bacteria | 3952 |
| 889 | Ga0373947_0083092 | 3300035725 | Bacteria | 1985 |
| 890 | Ga0373947_0265768 | 3300035725 | Bacteria | 1137 |
| 891 | Ga0373937_0020562 | 3300036401 | Bacteria | 5917 |
| 892 | Ga0373937_0022299 | 3300036401 | Bacteria | 5693 |
| 893 | Ga0373937_0032052 | 3300036401 | Bacteria | 4765 |
| 894 | Ga0373937_0040210 | 3300036401 | Bacteria | 4262 |
| 895 | Ga0373937_0046803 | 3300036401 | Bacteria | 3956 |
| 896 | Ga0373937_0053422 | 3300036401 | Bacteria | 3706 |
| 897 | Ga0373937_0055275 | 3300036401 | Bacteria | 3644 |
| 898 | Ga0373937_0259198 | 3300036401 | Bacteria | 1639 |
| 899 | Ga0373937_0362752 | 3300036401 | Bacteria | 1373 |
| 900 | Ga0373937_0376854 | 3300036401 | Bacteria | 1345 |
| 901 | Ga0373925_0006016 | 3300037068 | Bacteria | 8981 |
| 902 | Ga0373925_0013546 | 3300037068 | Bacteria | 5904 |
| 903 | Ga0373925_0023355 | 3300037068 | Bacteria | 4512 |
| 904 | Ga0373925_0058364 | 3300037068 | Bacteria | 2894 |
| 905 | Ga0373925_0071715 | 3300037068 | Bacteria | 2620 |
| 906 | Ga0373925_0117043 | 3300037068 | Bacteria | 2065 |
| 907 | Ga0373925_0205500 | 3300037068 | Bacteria | 1567 |
| 908 | Ga0373925_0352427 | 3300037068 | Bacteria | 1195 |
| 909 | Ga0395899_0009278 | 3300037312 | Bacteria | 7554 |
| 910 | Ga0395900_0008470 | 3300037418 | Bacteria | 10576 |
| 911 | Ga0395900_0048769 | 3300037418 | Bacteria | 4362 |
| 912 | Ga0395898_0004229 | 3300037466 | Bacteria | 15742 |
| 913 | Ga0395898_0019947 | 3300037466 | Bacteria | 6816 |
| 914 | Ga0395898_0091016 | 3300037466 | Bacteria | 2935 |
| 915 | Ga0395905_0004165 | 3300037471 | Bacteria | 15125 |
| 916 | Ga0395905_0032236 | 3300037471 | Bacteria | 4928 |
| 917 | Ga0395905_0083368 | 3300037471 | Bacteria | 2995 |
| 918 | Ga0395905_0119852 | 3300037471 | Bacteria | 2473 |
| 919 | Ga0436364_0483388 | 3300037853 | Bacteria | 1691 |
| 920 | Ga0436364_1097754 | 3300037853 | Bacteria | 1005 |
| 921 | Ga0395901_0004987 | 3300038443 | Bacteria | 13397 |
| 922 | Ga0395901_0064055 | 3300038443 | Bacteria | 3826 |
| 923 | Ga0395901_0111647 | 3300038443 | Bacteria | 2871 |
| 924 | Ga0395901_0384405 | 3300038443 | Bacteria | 1444 |
| 925 | Ga0395901_0422299 | 3300038443 | Bacteria | 1367 |
| 926 | Ga0242420_005885 | 3300038996 | Bacteria | 1920 |
| 927 | Ga0436365_0291314 | 3300039437 | Bacteria | 8395 |
| 928 | Ga0436365_0295600 | 3300039437 | Bacteria | 1990 |
| 929 | Ga0436365_0299351 | 3300039437 | Bacteria | 2929 |
| 930 | Ga0436365_0526132 | 3300039437 | Bacteria | 2401 |
| 931 | Ga0436365_0759284 | 3300039437 | Bacteria | 2431 |
| 932 | Ga0436365_1105753 | 3300039437 | Bacteria | 2073 |
| 933 | Ga0436365_1557661 | 3300039437 | Bacteria | 1979 |
| 934 | Ga0436365_1683113 | 3300039437 | Bacteria | 1215 |
| 935 | Ga0436365_1866057 | 3300039437 | Bacteria | 1751 |
| 936 | Ga0436360_1250391 | 3300039438 | Bacteria | 1411 |
| 937 | Ga0436361_0870440 | 3300039447 | Bacteria | 2125 |
| 938 | Ga0436363_0613006 | 3300039450 | Bacteria | 1604 |
| 939 | Ga0436363_0959897 | 3300039450 | Bacteria | 2854 |
| 940 | Ga0436362_0256641 | 3300039453 | Bacteria | 1524 |
| 941 | Ga0436362_0376169 | 3300039453 | Bacteria | 3797 |
| 942 | Ga0451793_0917594 | 3300041452 | Bacteria | 1792 |
| 943 | Ga0451843_1211220 | 3300041509 | Bacteria | 1408 |
| 944 | Ga0439463_020241 | 3300042016 | Bacteria | 1659 |
| 945 | Ga0466969_0035286 | 3300044656 | Bacteria | 2529 |
| 946 | Ga0466972_0000053 | 3300044658 | Bacteria | 112876 |
| 947 | Ga0466966_0003788 | 3300044684 | Bacteria | 9975 |
| 948 | Ga0466966_0033603 | 3300044684 | Bacteria | 3321 |
| 949 | Ga0466966_0143406 | 3300044684 | Bacteria | 1459 |
| 950 | Ga0466961_0000227 | 3300044693 | Bacteria | 38175 |
| 951 | Ga0466963_0079443 | 3300044694 | Bacteria | 2219 |
| 952 | Ga0466963_0111242 | 3300044694 | Bacteria | 1880 |
| 953 | Ga0466963_0226495 | 3300044694 | Bacteria | 1310 |
| 954 | Ga0466963_0284198 | 3300044694 | Bacteria | 1163 |
| 955 | Ga0466957_0024689 | 3300044842 | Bacteria | 3559 |
| 956 | Ga0466957_0173954 | 3300044842 | Bacteria | 1403 |
| 957 | Ga0466960_0198246 | 3300044901 | Bacteria | 1095 |
| 958 | Ga0466959_0024944 | 3300045049 | Bacteria | 4429 |
| 959 | Ga0466959_0061469 | 3300045049 | Bacteria | 2731 |
| 960 | Ga0466967_0164748 | 3300045976 | Bacteria | 2083 |
| 961 | Ga0495617_020125 | 3300046452 | Bacteria | 2255 |
| 962 | Ga0495592_0002227 | 3300046454 | Bacteria | 13684 |
| 963 | Ga0495592_0008094 | 3300046454 | Bacteria | 7894 |
| 964 | Ga0495592_0033791 | 3300046454 | Bacteria | 3857 |
| 965 | Ga0495592_0047131 | 3300046454 | Bacteria | 3210 |
| 966 | Ga0495592_0053346 | 3300046454 | Bacteria | 2999 |
| 967 | Ga0495592_0107893 | 3300046454 | Bacteria | 1974 |
| 968 | Ga0495603_0000036 | 3300046455 | Bacteria | 57443 |
| 969 | Ga0495603_0008447 | 3300046455 | Bacteria | 6220 |
| 970 | Ga0495603_0015690 | 3300046455 | Bacteria | 4583 |
| 971 | Ga0495603_0015820 | 3300046455 | Bacteria | 4560 |
| 972 | Ga0495603_0017567 | 3300046455 | Bacteria | 4331 |
| 973 | Ga0495603_0061304 | 3300046455 | Bacteria | 2221 |
| 974 | Ga0495603_0090677 | 3300046455 | Bacteria | 1787 |
| 975 | Ga0495591_036395 | 3300046458 | Bacteria | 1433 |
| 976 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 977 | Ga0495629_0000148 | 3300046459 | Bacteria | 61440 |
| 978 | Ga0495629_0000331 | 3300046459 | Bacteria | 40528 |
| 979 | Ga0495629_0026160 | 3300046459 | Bacteria | 4146 |
| 980 | Ga0495629_0108804 | 3300046459 | Bacteria | 1933 |
| 981 | Ga0495629_0214212 | 3300046459 | Bacteria | 1330 |
| 982 | Ga0495629_0252001 | 3300046459 | Bacteria | 1215 |
| 983 | Ga0495629_0326679 | 3300046459 | Bacteria | 1048 |
| 984 | Ga0495638_0033836 | 3300046460 | Bacteria | 3265 |
| 985 | Ga0495638_0046208 | 3300046460 | Bacteria | 2736 |
| 986 | Ga0495638_0254238 | 3300046460 | Bacteria | 967 |
| 987 | Ga0495641_0004773 | 3300046461 | Bacteria | 9436 |
| 988 | Ga0495641_0023447 | 3300046461 | Bacteria | 3065 |
| 989 | Ga0495651_0000808 | 3300046462 | Bacteria | 24239 |
| 990 | Ga0495651_0009401 | 3300046462 | Bacteria | 7508 |
| 991 | Ga0495651_0016761 | 3300046462 | Bacteria | 5675 |
| 992 | Ga0495651_0026176 | 3300046462 | Bacteria | 4543 |
| 993 | Ga0495651_0079310 | 3300046462 | Bacteria | 2482 |
| 994 | Ga0495651_0090115 | 3300046462 | Bacteria | 2301 |
| 995 | Ga0495651_0127727 | 3300046462 | Bacteria | 1860 |
| 996 | Ga0495651_0217048 | 3300046462 | Bacteria | 1326 |
| 997 | Ga0495653_0000697 | 3300046463 | Bacteria | 25621 |
| 998 | Ga0495653_0010076 | 3300046463 | Bacteria | 7731 |
| 999 | Ga0495653_0033411 | 3300046463 | Bacteria | 4076 |
| 1000 | Ga0495653_0200113 | 3300046463 | Bacteria | 1356 |
| 1001 | Ga0495580_0000705 | 3300046472 | Bacteria | 28569 |
| 1002 | Ga0495580_0005369 | 3300046472 | Bacteria | 10609 |
| 1003 | Ga0495580_0097515 | 3300046472 | Bacteria | 2044 |
| 1004 | Ga0495582_0002450 | 3300046473 | Bacteria | 10340 |
| 1005 | Ga0495582_0003391 | 3300046473 | Bacteria | 8970 |
| 1006 | Ga0495582_0005700 | 3300046473 | Bacteria | 6937 |
| 1007 | Ga0495582_0172305 | 3300046473 | Bacteria | 1232 |
| 1008 | Ga0495605_0096947 | 3300046474 | Bacteria | 1360 |
| 1009 | Ga0495639_0000135 | 3300046475 | Bacteria | 38122 |
| 1010 | Ga0495639_0004541 | 3300046475 | Bacteria | 5951 |
| 1011 | Ga0495639_0009129 | 3300046475 | Bacteria | 4249 |
| 1012 | Ga0495662_0000811 | 3300046476 | Bacteria | 15187 |
| 1013 | Ga0495662_0010232 | 3300046476 | Bacteria | 4596 |
| 1014 | Ga0495664_0002195 | 3300046477 | Bacteria | 10450 |
| 1015 | Ga0495664_0015540 | 3300046477 | Bacteria | 4328 |
| 1016 | Ga0495664_0020709 | 3300046477 | Bacteria | 3795 |
| 1017 | Ga0495664_0024550 | 3300046477 | Bacteria | 3505 |
| 1018 | Ga0495664_0242264 | 3300046477 | Bacteria | 1091 |
| 1019 | Ga0495584_0024184 | 3300046491 | Bacteria | 3080 |
| 1020 | Ga0495584_0127502 | 3300046491 | Bacteria | 1290 |
| 1021 | Ga0495585_0005952 | 3300046492 | Bacteria | 7630 |
| 1022 | Ga0495585_0095908 | 3300046492 | Bacteria | 1592 |
| 1023 | Ga0495594_0001252 | 3300046499 | Bacteria | 13306 |
| 1024 | Ga0495594_0161976 | 3300046499 | Bacteria | 1272 |
| 1025 | Ga0495594_0217482 | 3300046499 | Bacteria | 1089 |
| 1026 | Ga0495594_0232899 | 3300046499 | Bacteria | 1050 |
| 1027 | Ga0495594_0234788 | 3300046499 | Bacteria | 1045 |
| 1028 | Ga0495594_0242154 | 3300046499 | Bacteria | 1028 |
| 1029 | Ga0495594_0247000 | 3300046499 | Bacteria | 1017 |
| 1030 | Ga0495596_0098348 | 3300046500 | Bacteria | 1136 |
| 1031 | Ga0495607_0022960 | 3300046501 | Bacteria | 3910 |
| 1032 | Ga0495607_0151071 | 3300046501 | Bacteria | 1189 |
| 1033 | Ga0495583_0094855 | 3300046506 | Bacteria | 1280 |
| 1034 | Ga0495583_0108198 | 3300046506 | Bacteria | 1180 |
| 1035 | Ga0495606_0001350 | 3300046507 | Bacteria | 33317 |
| 1036 | Ga0495606_0109676 | 3300046507 | Bacteria | 1666 |
| 1037 | Ga0495608_0004227 | 3300046511 | Bacteria | 10294 |
| 1038 | Ga0495608_0045151 | 3300046511 | Bacteria | 2938 |
| 1039 | Ga0495608_0062538 | 3300046511 | Bacteria | 2445 |
| 1040 | Ga0495608_0083219 | 3300046511 | Bacteria | 2077 |
| 1041 | Ga0495616_0037770 | 3300046513 | Bacteria | 2482 |
| 1042 | Ga0495616_0084300 | 3300046513 | Bacteria | 1515 |
| 1043 | Ga0495616_0124891 | 3300046513 | Bacteria | 1184 |
| 1044 | Ga0495618_0012417 | 3300046514 | Bacteria | 5174 |
| 1045 | Ga0495618_0016165 | 3300046514 | Bacteria | 4561 |
| 1046 | Ga0495618_0022928 | 3300046514 | Bacteria | 3856 |
| 1047 | Ga0495618_0048606 | 3300046514 | Bacteria | 2678 |
| 1048 | Ga0495618_0185643 | 3300046514 | Bacteria | 1320 |
| 1049 | Ga0495618_0208057 | 3300046514 | Bacteria | 1237 |
| 1050 | Ga0495618_0242587 | 3300046514 | Bacteria | 1132 |
| 1051 | Ga0495620_0013412 | 3300046515 | Bacteria | 4195 |
| 1052 | Ga0495628_0011769 | 3300046516 | Bacteria | 7386 |
| 1053 | Ga0495628_0024473 | 3300046516 | Bacteria | 4942 |
| 1054 | Ga0495628_0045823 | 3300046516 | Bacteria | 3475 |
| 1055 | Ga0495628_0095790 | 3300046516 | Bacteria | 2293 |
| 1056 | Ga0495630_0067195 | 3300046517 | Bacteria | 2694 |
| 1057 | Ga0495630_0086215 | 3300046517 | Bacteria | 2371 |
| 1058 | Ga0495630_0146108 | 3300046517 | Bacteria | 1798 |
| 1059 | Ga0495632_0050213 | 3300046519 | Bacteria | 2058 |
| 1060 | Ga0495637_0017430 | 3300046520 | Bacteria | 3347 |
| 1061 | Ga0495637_0029569 | 3300046520 | Bacteria | 2438 |
| 1062 | Ga0495643_0051759 | 3300046522 | Bacteria | 2207 |
| 1063 | Ga0495644_0000215 | 3300046523 | Bacteria | 27294 |
| 1064 | Ga0495644_0073897 | 3300046523 | Bacteria | 1282 |
| 1065 | Ga0495648_0004337 | 3300046524 | Bacteria | 12150 |
| 1066 | Ga0495648_0040614 | 3300046524 | Bacteria | 2948 |
| 1067 | Ga0495648_0051499 | 3300046524 | Bacteria | 2508 |
| 1068 | Ga0495666_0081772 | 3300046526 | Bacteria | 1528 |
| 1069 | Ga0495666_0107322 | 3300046526 | Bacteria | 1313 |
| 1070 | Ga0495652_0010453 | 3300046529 | Bacteria | 8412 |
| 1071 | Ga0495652_0025648 | 3300046529 | Bacteria | 5210 |
| 1072 | Ga0495652_0335278 | 3300046529 | Bacteria | 1088 |
| 1073 | Ga0495654_0091978 | 3300046530 | Bacteria | 1406 |
| 1074 | Ga0495665_0000118 | 3300046531 | Bacteria | 37731 |
| 1075 | Ga0495665_0005110 | 3300046531 | Bacteria | 7077 |
| 1076 | Ga0495665_0037705 | 3300046531 | Bacteria | 2579 |
| 1077 | Ga0495640_0029993 | 3300046533 | Bacteria | 3898 |
| 1078 | Ga0495640_0057459 | 3300046533 | Bacteria | 2655 |
| 1079 | Ga0495640_0083891 | 3300046533 | Bacteria | 2114 |
| 1080 | Ga0495640_0120148 | 3300046533 | Bacteria | 1709 |
| 1081 | Ga0495586_0019590 | 3300046535 | Bacteria | 3603 |
| 1082 | Ga0495586_0030611 | 3300046535 | Bacteria | 2880 |
| 1083 | Ga0495587_0003557 | 3300046536 | Bacteria | 10385 |
| 1084 | Ga0495587_0009426 | 3300046536 | Bacteria | 6257 |
| 1085 | Ga0495587_0020301 | 3300046536 | Bacteria | 4102 |
| 1086 | Ga0495587_0021420 | 3300046536 | Bacteria | 3986 |
| 1087 | Ga0495587_0037845 | 3300046536 | Bacteria | 2894 |
| 1088 | Ga0495587_0087729 | 3300046536 | Bacteria | 1800 |
| 1089 | Ga0495587_0100858 | 3300046536 | Bacteria | 1664 |
| 1090 | Ga0495587_0241562 | 3300046536 | Bacteria | 1016 |
| 1091 | Ga0495598_0059909 | 3300046537 | Bacteria | 1171 |
| 1092 | Ga0495621_0111029 | 3300046539 | Bacteria | 1051 |
| 1093 | Ga0495597_0055463 | 3300046542 | Bacteria | 1738 |
| 1094 | Ga0495597_0059960 | 3300046542 | Bacteria | 1661 |
| 1095 | Ga0495597_0071706 | 3300046542 | Bacteria | 1491 |
| 1096 | Ga0495645_0003334 | 3300046543 | Bacteria | 10884 |
| 1097 | Ga0495645_0018632 | 3300046543 | Bacteria | 4988 |
| 1098 | Ga0495645_0057120 | 3300046543 | Bacteria | 2834 |
| 1099 | Ga0495645_0124722 | 3300046543 | Bacteria | 1810 |
| 1100 | Ga0495622_0015036 | 3300046557 | Bacteria | 3598 |
| 1101 | Ga0495622_0027568 | 3300046557 | Bacteria | 2651 |
| 1102 | Ga0495622_0053671 | 3300046557 | Bacteria | 1870 |
| 1103 | Ga0495622_0066030 | 3300046557 | Bacteria | 1672 |
| 1104 | Ga0495622_0074657 | 3300046557 | Bacteria | 1563 |
| 1105 | Ga0495633_0001472 | 3300046558 | Bacteria | 18264 |
| 1106 | Ga0495633_0072774 | 3300046558 | Bacteria | 1602 |
| 1107 | Ga0495667_0000379 | 3300046559 | Bacteria | 28161 |
| 1108 | Ga0495667_0001178 | 3300046559 | Bacteria | 17087 |
| 1109 | Ga0495667_0001880 | 3300046559 | Bacteria | 13932 |
| 1110 | Ga0495667_0003467 | 3300046559 | Bacteria | 10570 |
| 1111 | Ga0495667_0013308 | 3300046559 | Bacteria | 5570 |
| 1112 | Ga0495667_0035656 | 3300046559 | Bacteria | 3323 |
| 1113 | Ga0495667_0040798 | 3300046559 | Bacteria | 3080 |
| 1114 | Ga0495667_0047491 | 3300046559 | Bacteria | 2837 |
| 1115 | Ga0495656_0000808 | 3300046615 | Bacteria | 10125 |
| 1116 | Ga0495668_0053348 | 3300046616 | Bacteria | 2235 |
| 1117 | Ga0495668_0063204 | 3300046616 | Bacteria | 2039 |
| 1118 | Ga0495668_0106545 | 3300046616 | Bacteria | 1533 |
| 1119 | Ga0495668_0173550 | 3300046616 | Bacteria | 1181 |
| 1120 | Ga0495634_0000969 | 3300046642 | Bacteria | 27075 |
| 1121 | Ga0495634_0018562 | 3300046642 | Bacteria | 4949 |
| 1122 | Ga0495634_0115284 | 3300046642 | Bacteria | 1724 |
| 1123 | Ga0495634_0116320 | 3300046642 | Bacteria | 1715 |
| 1124 | Ga0495634_0129721 | 3300046642 | Bacteria | 1608 |
| 1125 | Ga0495634_0221464 | 3300046642 | Bacteria | 1168 |
| 1126 | Ga0495634_0261542 | 3300046642 | Bacteria | 1055 |
| 1127 | Ga0495611_0056620 | 3300046648 | Bacteria | 1775 |
| 1128 | Ga0495625_0161696 | 3300046660 | Bacteria | 1500 |
| 1129 | Ga0495635_0006242 | 3300046663 | Bacteria | 8302 |
| 1130 | Ga0495635_0062342 | 3300046663 | Bacteria | 2561 |
| 1131 | Ga0495635_0114367 | 3300046663 | Bacteria | 1842 |
| 1132 | Ga0495659_0009514 | 3300046664 | Bacteria | 3104 |
| 1133 | Ga0495661_0021971 | 3300046665 | Bacteria | 4153 |
| 1134 | Ga0495661_0144082 | 3300046665 | Bacteria | 1293 |
| 1135 | Ga0495588_0036181 | 3300046674 | Bacteria | 2504 |
| 1136 | Ga0495588_0046900 | 3300046674 | Bacteria | 2217 |
| 1137 | Ga0495588_0092873 | 3300046674 | Bacteria | 1581 |
| 1138 | Ga0495588_0131483 | 3300046674 | Bacteria | 1320 |
| 1139 | Ga0495657_0005912 | 3300046675 | Bacteria | 9612 |
| 1140 | Ga0495657_0007977 | 3300046675 | Bacteria | 8117 |
| 1141 | Ga0495657_0008887 | 3300046675 | Bacteria | 7648 |
| 1142 | Ga0495657_0017121 | 3300046675 | Bacteria | 5268 |
| 1143 | Ga0495657_0174238 | 3300046675 | Bacteria | 1323 |
| 1144 | Ga0495599_0006442 | 3300046678 | Bacteria | 7081 |
| 1145 | Ga0495599_0035010 | 3300046678 | Bacteria | 3152 |
| 1146 | Ga0495599_0069200 | 3300046678 | Bacteria | 2203 |
| 1147 | Ga0495599_0130701 | 3300046678 | Bacteria | 1559 |
| 1148 | Ga0495599_0228107 | 3300046678 | Bacteria | 1138 |
| 1149 | Ga0495599_0231185 | 3300046678 | Bacteria | 1129 |
| 1150 | Ga0495623_0005999 | 3300046679 | Bacteria | 7904 |
| 1151 | Ga0495623_0028685 | 3300046679 | Bacteria | 3580 |
| 1152 | Ga0495623_0042152 | 3300046679 | Bacteria | 2908 |
| 1153 | Ga0495646_0000395 | 3300046680 | Bacteria | 22931 |
| 1154 | Ga0495646_0008527 | 3300046680 | Bacteria | 6511 |
| 1155 | Ga0495646_0021600 | 3300046680 | Bacteria | 4066 |
| 1156 | Ga0495646_0142601 | 3300046680 | Bacteria | 1338 |
| 1157 | Ga0495647_0000360 | 3300046681 | Bacteria | 12869 |
| 1158 | Ga0495647_0050904 | 3300046681 | Bacteria | 1608 |
| 1159 | Ga0495658_0001322 | 3300046683 | Bacteria | 12988 |
| 1160 | Ga0495658_0009177 | 3300046683 | Bacteria | 4918 |
| 1161 | Ga0495658_0047609 | 3300046683 | Bacteria | 2415 |
| 1162 | Ga0495658_0107060 | 3300046683 | Bacteria | 1676 |
| 1163 | Ga0495669_0083495 | 3300046684 | Bacteria | 1468 |
| 1164 | Ga0495669_0137467 | 3300046684 | Bacteria | 1152 |
| 1165 | Ga0495613_0012017 | 3300046689 | Bacteria | 6434 |
| 1166 | Ga0495613_0031204 | 3300046689 | Bacteria | 3957 |
| 1167 | Ga0495613_0053959 | 3300046689 | Bacteria | 2955 |
| 1168 | Ga0495613_0123568 | 3300046689 | Bacteria | 1857 |
| 1169 | Ga0495613_0162765 | 3300046689 | Bacteria | 1586 |
| 1170 | Ga0495613_0187711 | 3300046689 | Bacteria | 1462 |
| 1171 | Ga0495624_0000445 | 3300046690 | Bacteria | 32525 |
| 1172 | Ga0495624_0019074 | 3300046690 | Bacteria | 4582 |
| 1173 | Ga0495624_0065072 | 3300046690 | Bacteria | 2278 |
| 1174 | Ga0495624_0078421 | 3300046690 | Bacteria | 2048 |
| 1175 | Ga0495624_0210104 | 3300046690 | Bacteria | 1181 |
| 1176 | Ga0495670_0005172 | 3300046691 | Bacteria | 6420 |
| 1177 | Ga0495670_0123993 | 3300046691 | Bacteria | 1343 |
| 1178 | Ga0495671_0122925 | 3300046692 | Bacteria | 1266 |
| 1179 | Ga0495649_0042903 | 3300046694 | Bacteria | 2470 |
| 1180 | Ga0495589_0082422 | 3300046794 | Bacteria | 1564 |
| 1181 | Ga0495600_0002559 | 3300046809 | Bacteria | 10484 |
| 1182 | Ga0495600_0003883 | 3300046809 | Bacteria | 8870 |
| 1183 | Ga0495600_0007122 | 3300046809 | Bacteria | 6833 |
| 1184 | Ga0495600_0012284 | 3300046809 | Bacteria | 5350 |
| 1185 | Ga0495600_0026362 | 3300046809 | Bacteria | 3751 |
| 1186 | Ga0495600_0086189 | 3300046809 | Bacteria | 2049 |
| 1187 | Ga0495581_0001178 | 3300047315 | Bacteria | 14344 |
| 1188 | Ga0495581_0067552 | 3300047315 | Bacteria | 2067 |
| 1189 | Ga0495581_0169040 | 3300047315 | Bacteria | 1278 |
| 1190 | Ga0495581_0217217 | 3300047315 | Bacteria | 1118 |
| 1191 | Ga0495604_0003605 | 3300047317 | Bacteria | 12338 |
| 1192 | Ga0495604_0012567 | 3300047317 | Bacteria | 6733 |
| 1193 | Ga0495604_0057670 | 3300047317 | Bacteria | 2985 |
| 1194 | Ga0495604_0075876 | 3300047317 | Bacteria | 2530 |
| 1195 | Ga0495604_0093258 | 3300047317 | Bacteria | 2228 |
| 1196 | Ga0495604_0101323 | 3300047317 | Bacteria | 2115 |
| 1197 | Ga0495604_0105349 | 3300047317 | Bacteria | 2064 |
| 1198 | Ga0495604_0121326 | 3300047317 | Bacteria | 1892 |
| 1199 | Ga0495636_0046143 | 3300047318 | Bacteria | 1817 |
| 1200 | Ga0495674_0000443 | 3300047319 | Bacteria | 37259 |
| 1201 | Ga0495674_0008197 | 3300047319 | Bacteria | 9970 |
| 1202 | Ga0495674_0010317 | 3300047319 | Bacteria | 8845 |
| 1203 | Ga0495674_0014605 | 3300047319 | Bacteria | 7349 |
| 1204 | Ga0495674_0030976 | 3300047319 | Bacteria | 4861 |
| 1205 | Ga0495674_0036232 | 3300047319 | Bacteria | 4443 |
| 1206 | Ga0495674_0038574 | 3300047319 | Bacteria | 4287 |
| 1207 | Ga0495674_0201991 | 3300047319 | Bacteria | 1648 |
| 1208 | Ga0495672_0005199 | 3300047320 | Bacteria | 10374 |
| 1209 | Ga0495672_0081822 | 3300047320 | Bacteria | 1797 |
| 1210 | Ga0495672_0123114 | 3300047320 | Bacteria | 1375 |
| 1211 | Ga0495672_0138500 | 3300047320 | Bacteria | 1273 |
| 1212 | Ga0495676_0040035 | 3300047321 | Bacteria | 3872 |
| 1213 | Ga0495676_0104051 | 3300047321 | Bacteria | 2095 |
| 1214 | Ga0495676_0268884 | 3300047321 | Bacteria | 1157 |
| 1215 | Ga0495680_0000825 | 3300047322 | Bacteria | 34510 |
| 1216 | Ga0495680_0001308 | 3300047322 | Bacteria | 27152 |
| 1217 | Ga0495680_0002772 | 3300047322 | Bacteria | 17676 |
| 1218 | Ga0495680_0019969 | 3300047322 | Bacteria | 5647 |
| 1219 | Ga0495680_0024601 | 3300047322 | Bacteria | 4994 |
| 1220 | Ga0495680_0024704 | 3300047322 | Bacteria | 4981 |
| 1221 | Ga0495680_0154704 | 3300047322 | Bacteria | 1669 |
| 1222 | Ga0495680_0247200 | 3300047322 | Bacteria | 1265 |
| 1223 | Ga0495687_058255 | 3300047443 | Bacteria | 1603 |
| 1224 | Ga0495675_0032620 | 3300047444 | Bacteria | 3323 |
| 1225 | Ga0495675_0075757 | 3300047444 | Bacteria | 2120 |
| 1226 | Ga0495675_0087197 | 3300047444 | Bacteria | 1961 |
| 1227 | Ga0495679_019573 | 3300047446 | Bacteria | 2375 |
| 1228 | Ga0495684_0002730 | 3300047471 | Bacteria | 13961 |
| 1229 | Ga0495684_0054251 | 3300047471 | Bacteria | 3057 |
| 1230 | Ga0495684_0076841 | 3300047471 | Bacteria | 2536 |
| 1231 | Ga0495684_0077562 | 3300047471 | Bacteria | 2522 |
| 1232 | Ga0495593_0000495 | 3300047673 | Bacteria | 22212 |
| 1233 | Ga0495593_0001203 | 3300047673 | Bacteria | 15131 |
| 1234 | Ga0495593_0009453 | 3300047673 | Bacteria | 5657 |
| 1235 | Ga0495593_0009518 | 3300047673 | Bacteria | 5637 |
| 1236 | Ga0495593_0022477 | 3300047673 | Bacteria | 3513 |
| 1237 | Ga0495593_0041048 | 3300047673 | Bacteria | 2489 |
| 1238 | Ga0495593_0057475 | 3300047673 | Bacteria | 2042 |
| 1239 | Ga0495593_0105124 | 3300047673 | Bacteria | 1445 |
| 1240 | Ga0495602_0028623 | 3300048088 | Bacteria | 5327 |
| 1241 | Ga0495602_0031862 | 3300048088 | Bacteria | 4975 |
| 1242 | Ga0495602_0048324 | 3300048088 | Bacteria | 3825 |
| 1243 | Ga0495602_0115902 | 3300048088 | Bacteria | 2166 |
| 1244 | Ga0495614_0025736 | 3300048089 | Bacteria | 2537 |
| 1245 | Ga0495614_0111458 | 3300048089 | Bacteria | 1201 |
| 1246 | Ga0495615_0052817 | 3300048090 | Bacteria | 1051 |
| 1247 | Ga0495626_0057165 | 3300048091 | Bacteria | 1785 |
| 1248 | Ga0496100_0011667 | 3300048903 | Bacteria | 5008 |
| 1249 | Ga0496100_0016652 | 3300048903 | Bacteria | 4322 |
| 1250 | Ga0496100_0025723 | 3300048903 | Bacteria | 3600 |
| 1251 | Ga0496100_0341982 | 3300048903 | Bacteria | 1128 |
| 1252 | Ga0496101_0003579 | 3300048904 | Bacteria | 9698 |
| 1253 | Ga0496101_0003853 | 3300048904 | Bacteria | 9381 |
| 1254 | Ga0496101_0023337 | 3300048904 | Bacteria | 4272 |
| 1255 | Ga0496101_0052485 | 3300048904 | Bacteria | 2940 |
| 1256 | Ga0496101_0064455 | 3300048904 | Bacteria | 2669 |
| 1257 | Ga0496101_0185183 | 3300048904 | Bacteria | 1605 |
| 1258 | Ga0496101_0538500 | 3300048904 | Bacteria | 923 |
| 1259 | Ga0496102_0007923 | 3300048905 | Bacteria | 9080 |
| 1260 | Ga0496102_0010957 | 3300048905 | Bacteria | 7811 |
| 1261 | Ga0496102_0045197 | 3300048905 | Bacteria | 3997 |
| 1262 | Ga0496102_0208063 | 3300048905 | Bacteria | 1844 |
| 1263 | Ga0496102_0418721 | 3300048905 | Bacteria | 1258 |
| 1264 | Ga0496103_0008374 | 3300048906 | Bacteria | 6143 |
| 1265 | Ga0496103_0023579 | 3300048906 | Bacteria | 3712 |
| 1266 | Ga0496103_0027759 | 3300048906 | Bacteria | 3432 |
| 1267 | Ga0496103_0053736 | 3300048906 | Bacteria | 2496 |
| 1268 | Ga0496104_0000065 | 3300048907 | Bacteria | 108770 |
| 1269 | Ga0496104_0014455 | 3300048907 | Bacteria | 7131 |
| 1270 | Ga0496104_0014992 | 3300048907 | Bacteria | 7010 |
| 1271 | Ga0496104_0048023 | 3300048907 | Bacteria | 4025 |
| 1272 | Ga0496104_0069177 | 3300048907 | Bacteria | 3355 |
| 1273 | Ga0496104_0079488 | 3300048907 | Bacteria | 3125 |
| 1274 | Ga0496104_0144029 | 3300048907 | Bacteria | 2289 |
| 1275 | Ga0496104_0168221 | 3300048907 | Bacteria | 2102 |
| 1276 | Ga0496104_0184407 | 3300048907 | Bacteria | 1997 |
| 1277 | Ga0496104_0543636 | 3300048907 | Bacteria | 1072 |
| 1278 | Ga0496105_0000338 | 3300048908 | Bacteria | 30721 |
| 1279 | Ga0496105_0007095 | 3300048908 | Bacteria | 8640 |
| 1280 | Ga0496105_0026827 | 3300048908 | Bacteria | 4701 |
| 1281 | Ga0496105_0030697 | 3300048908 | Bacteria | 4404 |
| 1282 | Ga0496105_0102035 | 3300048908 | Bacteria | 2369 |
| 1283 | Ga0496105_0102772 | 3300048908 | Bacteria | 2360 |
| 1284 | Ga0496105_0102995 | 3300048908 | Bacteria | 2357 |
| 1285 | Ga0496105_0141191 | 3300048908 | Bacteria | 1982 |
| 1286 | Ga0496106_0003403 | 3300048909 | Bacteria | 11849 |
| 1287 | Ga0496106_0011816 | 3300048909 | Bacteria | 6446 |
| 1288 | Ga0496106_0012418 | 3300048909 | Bacteria | 6289 |
| 1289 | Ga0496106_0015817 | 3300048909 | Bacteria | 5580 |
| 1290 | Ga0496106_0017137 | 3300048909 | Bacteria | 5363 |
| 1291 | Ga0496106_0168052 | 3300048909 | Bacteria | 1737 |
| 1292 | Ga0496107_0020448 | 3300048910 | Bacteria | 4675 |
| 1293 | Ga0496107_0035807 | 3300048910 | Bacteria | 3559 |
| 1294 | Ga0496107_0052763 | 3300048910 | Bacteria | 2932 |
| 1295 | Ga0496107_0099528 | 3300048910 | Bacteria | 2131 |
| 1296 | Ga0496107_0276695 | 3300048910 | Bacteria | 1249 |
| 1297 | Ga0496108_0002964 | 3300048911 | Bacteria | 13649 |
| 1298 | Ga0496108_0004356 | 3300048911 | Bacteria | 11383 |
| 1299 | Ga0496108_0074602 | 3300048911 | Bacteria | 2865 |
| 1300 | Ga0496108_0074802 | 3300048911 | Bacteria | 2861 |
| 1301 | Ga0496108_0149303 | 3300048911 | Bacteria | 2016 |
| 1302 | Ga0496108_0287503 | 3300048911 | Bacteria | 1431 |
| 1303 | Ga0496108_0506769 | 3300048911 | Bacteria | 1054 |
| 1304 | Ga0496109_0002046 | 3300048912 | Bacteria | 16718 |
| 1305 | Ga0496109_0003207 | 3300048912 | Bacteria | 13613 |
| 1306 | Ga0496109_0014486 | 3300048912 | Bacteria | 6860 |
| 1307 | Ga0496109_0053999 | 3300048912 | Bacteria | 3666 |
| 1308 | Ga0496109_0068598 | 3300048912 | Bacteria | 3250 |
| 1309 | Ga0496109_0208775 | 3300048912 | Bacteria | 1836 |
| 1310 | Ga0496109_0213887 | 3300048912 | Bacteria | 1813 |
| 1311 | Ga0496109_0222188 | 3300048912 | Bacteria | 1776 |
| 1312 | Ga0496109_0302962 | 3300048912 | Bacteria | 1507 |
| 1313 | Ga0496109_0386395 | 3300048912 | Bacteria | 1322 |
| 1314 | Ga0496110_0026611 | 3300048913 | Bacteria | 4952 |
| 1315 | Ga0496110_0029454 | 3300048913 | Bacteria | 4725 |
| 1316 | Ga0496110_0058569 | 3300048913 | Bacteria | 3393 |
| 1317 | Ga0496110_0067181 | 3300048913 | Bacteria | 3172 |
| 1318 | Ga0496110_0107500 | 3300048913 | Bacteria | 2504 |
| 1319 | Ga0496110_0163678 | 3300048913 | Bacteria | 2017 |
| 1320 | Ga0496110_0257349 | 3300048913 | Bacteria | 1589 |
| 1321 | Ga0496110_0328459 | 3300048913 | Bacteria | 1393 |
| 1322 | Ga0496110_0334970 | 3300048913 | Bacteria | 1378 |
| 1323 | Ga0496111_0016724 | 3300048914 | Bacteria | 5060 |
| 1324 | Ga0496111_0027702 | 3300048914 | Bacteria | 4012 |
| 1325 | Ga0496111_0158235 | 3300048914 | Bacteria | 1681 |
| 1326 | Ga0496111_0249161 | 3300048914 | Bacteria | 1318 |
| 1327 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 1328 | Ga0496112_0005532 | 3300048915 | Bacteria | 10946 |
| 1329 | Ga0496112_0015369 | 3300048915 | Bacteria | 7140 |
| 1330 | Ga0496112_0018491 | 3300048915 | Bacteria | 6562 |
| 1331 | Ga0496112_0039371 | 3300048915 | Bacteria | 4619 |
| 1332 | Ga0496112_0053414 | 3300048915 | Bacteria | 3968 |
| 1333 | Ga0496112_0074363 | 3300048915 | Bacteria | 3359 |
| 1334 | Ga0496112_0175826 | 3300048915 | Bacteria | 2106 |
| 1335 | Ga0496112_0190119 | 3300048915 | Bacteria | 2015 |
| 1336 | Ga0496112_0336353 | 3300048915 | Bacteria | 1453 |
| 1337 | Ga0496112_0381138 | 3300048915 | Bacteria | 1351 |
| 1338 | Ga0496112_0458908 | 3300048915 | Bacteria | 1212 |
| 1339 | Ga0496112_0596501 | 3300048915 | Bacteria | 1037 |
| 1340 | Ga0496113_0003527 | 3300048916 | Bacteria | 9389 |
| 1341 | Ga0496113_0020258 | 3300048916 | Bacteria | 4673 |
| 1342 | Ga0496113_0047943 | 3300048916 | Bacteria | 3177 |
| 1343 | Ga0496113_0055955 | 3300048916 | Bacteria | 2959 |
| 1344 | Ga0496113_0083060 | 3300048916 | Bacteria | 2457 |
| 1345 | Ga0496113_0134356 | 3300048916 | Bacteria | 1943 |
| 1346 | Ga0496113_0255493 | 3300048916 | Bacteria | 1399 |
| 1347 | Ga0496114_0011325 | 3300048917 | Bacteria | 7124 |
| 1348 | Ga0496114_0012027 | 3300048917 | Bacteria | 6922 |
| 1349 | Ga0496114_0021000 | 3300048917 | Bacteria | 5305 |
| 1350 | Ga0496114_0206620 | 3300048917 | Bacteria | 1721 |
| 1351 | Ga0496114_0269506 | 3300048917 | Bacteria | 1500 |
| 1352 | Ga0496114_0523529 | 3300048917 | Bacteria | 1048 |
| 1353 | Ga0496115_0000295 | 3300048918 | Bacteria | 42998 |
| 1354 | Ga0496115_0003483 | 3300048918 | Bacteria | 11315 |
| 1355 | Ga0496115_0018198 | 3300048918 | Bacteria | 5389 |
| 1356 | Ga0496115_0022325 | 3300048918 | Bacteria | 4901 |
| 1357 | Ga0496115_0076474 | 3300048918 | Bacteria | 2721 |
| 1358 | Ga0496115_0215397 | 3300048918 | Bacteria | 1586 |
| 1359 | Ga0496115_0230402 | 3300048918 | Bacteria | 1528 |
| 1360 | Ga0496115_0253433 | 3300048918 | Bacteria | 1448 |
| 1361 | Ga0496115_0329554 | 3300048918 | Bacteria | 1247 |
| 1362 | Ga0496116_0018470 | 3300048919 | Bacteria | 5376 |
| 1363 | Ga0496116_0105397 | 3300048919 | Bacteria | 1673 |
| 1364 | Ga0496117_0011427 | 3300048920 | Bacteria | 7954 |
| 1365 | Ga0496117_0091379 | 3300048920 | Bacteria | 1958 |
| 1366 | Ga0496117_0196340 | 3300048920 | Bacteria | 1144 |
| 1367 | Ga0496118_0001805 | 3300048921 | Bacteria | 30834 |
| 1368 | Ga0496118_0022933 | 3300048921 | Bacteria | 5439 |
| 1369 | Ga0496118_0037848 | 3300048921 | Bacteria | 3875 |
| 1370 | Ga0496119_0007315 | 3300048922 | Bacteria | 9989 |
| 1371 | Ga0496119_0062780 | 3300048922 | Bacteria | 2212 |
| 1372 | Ga0496119_0127448 | 3300048922 | Bacteria | 1391 |
| 1373 | Ga0496119_0135649 | 3300048922 | Bacteria | 1335 |
| 1374 | Ga0496120_0002476 | 3300048923 | Bacteria | 18594 |
| 1375 | Ga0496120_0018821 | 3300048923 | Bacteria | 4437 |
| 1376 | Ga0496120_0145843 | 3300048923 | Bacteria | 1196 |
| 1377 | Ga0496121_0001687 | 3300048924 | Bacteria | 36333 |
| 1378 | Ga0496121_0003034 | 3300048924 | Bacteria | 24376 |
| 1379 | Ga0496121_0003702 | 3300048924 | Bacteria | 21459 |
| 1380 | Ga0496121_0004663 | 3300048924 | Bacteria | 18208 |
| 1381 | Ga0496121_0022584 | 3300048924 | Bacteria | 6095 |
| 1382 | Ga0496121_0024664 | 3300048924 | Bacteria | 5741 |
| 1383 | Ga0496121_0031082 | 3300048924 | Bacteria | 4889 |
| 1384 | Ga0496121_0036588 | 3300048924 | Bacteria | 4372 |
| 1385 | Ga0496121_0041193 | 3300048924 | Bacteria | 4041 |
| 1386 | Ga0496121_0099032 | 3300048924 | Bacteria | 2254 |
| 1387 | Ga0496121_0103994 | 3300048924 | Bacteria | 2183 |
| 1388 | Ga0496121_0139347 | 3300048924 | Bacteria | 1802 |
| 1389 | Ga0496121_0157493 | 3300048924 | Bacteria | 1665 |
| 1390 | Ga0496122_0042354 | 3300048925 | Bacteria | 3584 |
| 1391 | Ga0496122_0045370 | 3300048925 | Bacteria | 3417 |
| 1392 | Ga0496122_0067457 | 3300048925 | Bacteria | 2577 |
| 1393 | Ga0496124_0005242 | 3300048927 | Bacteria | 14692 |
| 1394 | Ga0496124_0165082 | 3300048927 | Bacteria | 1722 |
| 1395 | Ga0496124_0205568 | 3300048927 | Bacteria | 1494 |
| 1396 | Ga0496124_0226395 | 3300048927 | Bacteria | 1402 |
| 1397 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 1398 | Ga0496125_0000823 | 3300048928 | Bacteria | 50271 |
| 1399 | Ga0496125_0004393 | 3300048928 | Bacteria | 16325 |
| 1400 | Ga0496125_0052663 | 3300048928 | Bacteria | 3345 |
| 1401 | Ga0496125_0056873 | 3300048928 | Bacteria | 3173 |
| 1402 | Ga0496125_0067186 | 3300048928 | Bacteria | 2827 |
| 1403 | Ga0496125_0074537 | 3300048928 | Bacteria | 2631 |
| 1404 | Ga0496125_0086498 | 3300048928 | Bacteria | 2370 |
| 1405 | Ga0496125_0095367 | 3300048928 | Bacteria | 2213 |
| 1406 | Ga0496126_0005939 | 3300048929 | Bacteria | 13755 |
| 1407 | Ga0496126_0007926 | 3300048929 | Bacteria | 11546 |
| 1408 | Ga0496126_0011331 | 3300048929 | Bacteria | 9244 |
| 1409 | Ga0496126_0034249 | 3300048929 | Bacteria | 4771 |
| 1410 | Ga0496126_0035603 | 3300048929 | Bacteria | 4664 |
| 1411 | Ga0496126_0038680 | 3300048929 | Bacteria | 4435 |
| 1412 | Ga0496126_0090551 | 3300048929 | Bacteria | 2691 |
| 1413 | Ga0496126_0093307 | 3300048929 | Bacteria | 2643 |
| 1414 | Ga0496126_0327476 | 3300048929 | Bacteria | 1258 |
| 1415 | Ga0501031_0002996 | 3300049568 | Bacteria | 10804 |
| 1416 | Ga0501031_0003990 | 3300049568 | Bacteria | 9517 |
| 1417 | Ga0501031_0337165 | 3300049568 | Bacteria | 976 |
| 1418 | Ga0501032_0000073 | 3300049569 | Bacteria | 85584 |
| 1419 | Ga0501032_0004842 | 3300049569 | Bacteria | 10092 |
| 1420 | Ga0501032_0047385 | 3300049569 | Bacteria | 2902 |
| 1421 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 1422 | Ga0501033_0002224 | 3300049570 | Bacteria | 16678 |
| 1423 | Ga0501033_0037424 | 3300049570 | Bacteria | 3632 |
| 1424 | Ga0501033_0057288 | 3300049570 | Bacteria | 2880 |
| 1425 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 1426 | Ga0501034_0000295 | 3300049571 | Bacteria | 88435 |
| 1427 | Ga0501034_0000772 | 3300049571 | Bacteria | 47902 |
| 1428 | Ga0501034_0030135 | 3300049571 | Bacteria | 5514 |
| 1429 | Ga0501034_0040486 | 3300049571 | Bacteria | 4717 |
| 1430 | Ga0501034_0049417 | 3300049571 | Bacteria | 4243 |
| 1431 | Ga0501034_0090938 | 3300049571 | Bacteria | 3050 |
| 1432 | Ga0501034_0116531 | 3300049571 | Bacteria | 2659 |
| 1433 | Ga0501034_0254770 | 3300049571 | Bacteria | 1699 |
| 1434 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 1435 | Ga0501036_0000331 | 3300049572 | Bacteria | 33074 |
| 1436 | Ga0501036_0015708 | 3300049572 | Bacteria | 6322 |
| 1437 | Ga0501036_0030837 | 3300049572 | Bacteria | 4530 |
| 1438 | Ga0501036_0057168 | 3300049572 | Bacteria | 3304 |
| 1439 | Ga0501036_0067709 | 3300049572 | Bacteria | 3021 |
| 1440 | Ga0501036_0249882 | 3300049572 | Bacteria | 1486 |
| 1441 | Ga0501037_0000040 | 3300049573 | Bacteria | 119364 |
| 1442 | Ga0501037_0001428 | 3300049573 | Bacteria | 17519 |
| 1443 | Ga0501037_0023340 | 3300049573 | Bacteria | 4574 |
| 1444 | Ga0501037_0042850 | 3300049573 | Bacteria | 3326 |
| 1445 | Ga0501037_0043750 | 3300049573 | Bacteria | 3290 |
| 1446 | Ga0501037_0064326 | 3300049573 | Bacteria | 2673 |
| 1447 | Ga0501037_0067329 | 3300049573 | Bacteria | 2608 |
| 1448 | Ga0501037_0081263 | 3300049573 | Bacteria | 2350 |
| 1449 | Ga0501038_0000150 | 3300049574 | Bacteria | 59508 |
| 1450 | Ga0501038_0283264 | 3300049574 | Bacteria | 1304 |
| 1451 | Ga0501038_0461706 | 3300049574 | Bacteria | 975 |
| 1452 | Ga0501039_0003418 | 3300049575 | Bacteria | 11852 |
| 1453 | Ga0501039_0096245 | 3300049575 | Bacteria | 2308 |
| 1454 | Ga0501039_0123188 | 3300049575 | Bacteria | 2032 |
| 1455 | Ga0501039_0148562 | 3300049575 | Bacteria | 1842 |
| 1456 | Ga0501042_0008136 | 3300049578 | Bacteria | 6907 |
| 1457 | Ga0501042_0008268 | 3300049578 | Bacteria | 6859 |
| 1458 | Ga0501042_0372384 | 3300049578 | Bacteria | 1034 |
| 1459 | Ga0501043_0000464 | 3300049579 | Bacteria | 36232 |
| 1460 | Ga0501043_0001844 | 3300049579 | Bacteria | 18171 |
| 1461 | Ga0501043_0003336 | 3300049579 | Bacteria | 13229 |
| 1462 | Ga0501043_0008689 | 3300049579 | Bacteria | 7991 |
| 1463 | Ga0501043_0026869 | 3300049579 | Bacteria | 4516 |
| 1464 | Ga0501043_0127609 | 3300049579 | Bacteria | 1994 |
| 1465 | Ga0501043_0137677 | 3300049579 | Bacteria | 1913 |
| 1466 | Ga0501043_0173428 | 3300049579 | Bacteria | 1682 |
| 1467 | Ga0501046_0000398 | 3300049580 | Bacteria | 43497 |
| 1468 | Ga0501046_0124288 | 3300049580 | Bacteria | 1961 |
| 1469 | Ga0501046_0156747 | 3300049580 | Bacteria | 1714 |
| 1470 | Ga0501046_0230322 | 3300049580 | Bacteria | 1369 |
| 1471 | Ga0501047_0000656 | 3300049581 | Bacteria | 36126 |
| 1472 | Ga0501047_0024878 | 3300049581 | Bacteria | 5749 |
| 1473 | Ga0501047_0038030 | 3300049581 | Bacteria | 4655 |
| 1474 | Ga0501047_0060399 | 3300049581 | Bacteria | 3658 |
| 1475 | Ga0501047_0077943 | 3300049581 | Bacteria | 3187 |
| 1476 | Ga0501047_0086369 | 3300049581 | Bacteria | 3014 |
| 1477 | Ga0501047_0212578 | 3300049581 | Bacteria | 1792 |
| 1478 | Ga0501047_0257601 | 3300049581 | Bacteria | 1592 |
| 1479 | Ga0501047_0390827 | 3300049581 | Bacteria | 1224 |
| 1480 | Ga0501047_0420749 | 3300049581 | Bacteria | 1167 |
| 1481 | Ga0501048_0000906 | 3300049582 | Bacteria | 21866 |
| 1482 | Ga0501048_0002157 | 3300049582 | Bacteria | 14989 |
| 1483 | Ga0501048_0168602 | 3300049582 | Bacteria | 1550 |
| 1484 | Ga0501067_0000192 | 3300049583 | Bacteria | 34520 |
| 1485 | Ga0501067_0035211 | 3300049583 | Bacteria | 2780 |
| 1486 | Ga0501068_0002765 | 3300049584 | Bacteria | 9319 |
| 1487 | Ga0501068_0056457 | 3300049584 | Bacteria | 2380 |
| 1488 | Ga0501069_0014897 | 3300049585 | Bacteria | 4163 |
| 1489 | Ga0501069_0028379 | 3300049585 | Bacteria | 3068 |
| 1490 | Ga0501069_0180108 | 3300049585 | Bacteria | 1221 |
| 1491 | Ga0501070_0014900 | 3300049586 | Bacteria | 6539 |
| 1492 | Ga0501070_0026912 | 3300049586 | Bacteria | 4823 |
| 1493 | Ga0501070_0037271 | 3300049586 | Bacteria | 4060 |
| 1494 | Ga0501070_0076207 | 3300049586 | Bacteria | 2776 |
| 1495 | Ga0501070_0111307 | 3300049586 | Bacteria | 2263 |
| 1496 | Ga0501070_0216100 | 3300049586 | Bacteria | 1573 |
| 1497 | Ga0501070_0336501 | 3300049586 | Bacteria | 1226 |
| 1498 | Ga0501071_0053825 | 3300049587 | Bacteria | 2903 |
| 1499 | Ga0501072_0002128 | 3300049588 | Bacteria | 14764 |
| 1500 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 1501 | Ga0501073_0018625 | 3300049589 | Bacteria | 5018 |
| 1502 | Ga0501073_0022099 | 3300049589 | Bacteria | 4584 |
| 1503 | Ga0501073_0158480 | 3300049589 | Bacteria | 1568 |
| 1504 | Ga0501073_0213612 | 3300049589 | Bacteria | 1333 |
| 1505 | Ga0501074_0000133 | 3300049590 | Bacteria | 38342 |
| 1506 | Ga0501074_0047785 | 3300049590 | Bacteria | 3092 |
| 1507 | Ga0501074_0048678 | 3300049590 | Bacteria | 3062 |
| 1508 | Ga0501074_0067059 | 3300049590 | Bacteria | 2581 |
| 1509 | Ga0501074_0148134 | 3300049590 | Bacteria | 1679 |
| 1510 | Ga0501074_0215398 | 3300049590 | Bacteria | 1368 |
| 1511 | Ga0501076_0043461 | 3300049592 | Bacteria | 3541 |
| 1512 | Ga0501076_0128311 | 3300049592 | Bacteria | 2056 |
| 1513 | Ga0501077_0087268 | 3300049593 | Bacteria | 1977 |
| 1514 | Ga0501077_0156248 | 3300049593 | Bacteria | 1448 |
| 1515 | Ga0501079_0057957 | 3300049741 | Bacteria | 2988 |
| 1516 | Ga0501080_0000054 | 3300049742 | Bacteria | 74316 |
| 1517 | Ga0501080_0005201 | 3300049742 | Bacteria | 11597 |
| 1518 | Ga0501080_0030702 | 3300049742 | Bacteria | 5006 |
| 1519 | Ga0501080_0053747 | 3300049742 | Bacteria | 3751 |
| 1520 | Ga0501080_0070063 | 3300049742 | Bacteria | 3261 |
| 1521 | Ga0501080_0133442 | 3300049742 | Bacteria | 2298 |
| 1522 | Ga0501080_0186440 | 3300049742 | Bacteria | 1907 |
| 1523 | Ga0501080_0391339 | 3300049742 | Bacteria | 1251 |
| 1524 | Ga0501083_0026434 | 3300049744 | Bacteria | 4011 |
| 1525 | Ga0501083_0031513 | 3300049744 | Bacteria | 3639 |
| 1526 | Ga0501083_0072454 | 3300049744 | Bacteria | 2290 |
| 1527 | Ga0501083_0143614 | 3300049744 | Bacteria | 1562 |
| 1528 | Ga0501083_0190012 | 3300049744 | Bacteria | 1340 |
| 1529 | Ga0501083_0197123 | 3300049744 | Bacteria | 1314 |
| 1530 | Ga0501083_0277349 | 3300049744 | Bacteria | 1090 |
| 1531 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 1532 | Ga0501035_0007299 | 3300049822 | Bacteria | 10336 |
| 1533 | Ga0501035_0083899 | 3300049822 | Bacteria | 2810 |
| 1534 | Ga0501035_0088492 | 3300049822 | Bacteria | 2729 |
| 1535 | Ga0501035_0158389 | 3300049822 | Bacteria | 1961 |
| 1536 | Ga0501035_0259529 | 3300049822 | Bacteria | 1473 |
| 1537 | Ga0501035_0315098 | 3300049822 | Bacteria | 1315 |
| 1538 | Ga0501035_0364180 | 3300049822 | Bacteria | 1208 |
| 1539 | Ga0501044_0000985 | 3300049823 | Bacteria | 34233 |
| 1540 | Ga0501044_0007854 | 3300049823 | Bacteria | 11731 |
| 1541 | Ga0501044_0017342 | 3300049823 | Bacteria | 7722 |
| 1542 | Ga0501044_0091107 | 3300049823 | Bacteria | 3075 |
| 1543 | Ga0501044_0102936 | 3300049823 | Bacteria | 2870 |
| 1544 | Ga0501044_0237579 | 3300049823 | Bacteria | 1767 |
| 1545 | Ga0501044_0271456 | 3300049823 | Bacteria | 1631 |
| 1546 | Ga0501044_0340708 | 3300049823 | Bacteria | 1420 |
| 1547 | Ga0501044_0481657 | 3300049823 | Bacteria | 1144 |
| 1548 | Ga0501044_0534103 | 3300049823 | Bacteria | 1071 |
| 1549 | Ga0501044_0639664 | 3300049823 | Bacteria | 953 |
| 1550 | nmdc:mga03n38_33351_c1 | 3300050490 | Bacteria | 2190 |
| 1551 | nmdc:mga00v17_100632_c1 | 3300050491 | Bacteria | 1824 |
| 1552 | nmdc:mga00v17_117413_c1 | 3300050491 | Bacteria | 1692 |
| 1553 | nmdc:mga00v17_271514_c1 | 3300050491 | Bacteria | 1100 |
| 1554 | nmdc:mga00v17_9796_c1 | 3300050491 | Bacteria | 3923 |
| 1555 | nmdc:mga0yw44_165167_c1 | 3300050492 | Bacteria | 1451 |
| 1556 | nmdc:mga0yw44_20773_c1 | 3300050492 | Bacteria | 3650 |
| 1557 | nmdc:mga0yw44_247952_c1 | 3300050492 | Bacteria | 1185 |
| 1558 | nmdc:mga0yw44_266741_c1 | 3300050492 | Bacteria | 1142 |
| 1559 | nmdc:mga0yw44_32589_c1 | 3300050492 | Bacteria | 1414 |
| 1560 | nmdc:mga0yw44_39874_c1 | 3300050492 | Bacteria | 2787 |
| 1561 | nmdc:mga0yw44_79569_c1 | 3300050492 | Bacteria | 2051 |
| 1562 | nmdc:mga0k408_125211_c1 | 3300050493 | Bacteria | 1167 |
| 1563 | nmdc:mga0k408_165274_c1 | 3300050493 | Bacteria | 1319 |
| 1564 | nmdc:mga0k408_238923_c1 | 3300050493 | Bacteria | 1085 |
| 1565 | nmdc:mga06z11_132369_c1 | 3300050494 | Bacteria | 1402 |
| 1566 | nmdc:mga06z11_18945_c1 | 3300050494 | Bacteria | 3154 |
| 1567 | nmdc:mga06z11_19780_c1 | 3300050494 | Bacteria | 3103 |
| 1568 | nmdc:mga06z11_3865_c1 | 3300050494 | Bacteria | 5838 |
| 1569 | nmdc:mga06z11_72694_c1 | 3300050494 | Bacteria | 1824 |
| 1570 | nmdc:mga04h51_24381_c1 | 3300050495 | Bacteria | 1852 |
| 1571 | nmdc:mga04h51_32126_c1 | 3300050495 | Bacteria | 1663 |
| 1572 | nmdc:mga04h51_48195_c1 | 3300050495 | Bacteria | 1419 |
| 1573 | nmdc:mga07m45_36090_c2 | 3300050496 | Bacteria | 1843 |
| 1574 | nmdc:mga07m45_6998_c1 | 3300050496 | Bacteria | 5738 |
| 1575 | nmdc:mga05p37_247786_c1 | 3300050507 | Bacteria | 2138 |
| 1576 | nmdc:mga05p37_25974_c1 | 3300050507 | Bacteria | 7121 |
| 1577 | nmdc:mga05p37_2764_c1 | 3300050507 | Bacteria | 20392 |
| 1578 | nmdc:mga05p37_82451_c1 | 3300050507 | Bacteria | 3962 |
| 1579 | nmdc:mga09592_193281_c1 | 3300050508 | Bacteria | 1761 |
| 1580 | nmdc:mga09592_524_c1 | 3300050508 | Bacteria | 28956 |
| 1581 | nmdc:mga0qj67_34036_c1 | 3300050509 | Bacteria | 3979 |
| 1582 | nmdc:mga0qj67_4921_c1 | 3300050509 | Bacteria | 9716 |
| 1583 | nmdc:mga06r32_121_c1 | 3300050510 | Bacteria | 55968 |
| 1584 | nmdc:mga08y16_1115_c1 | 3300050511 | Bacteria | 26487 |
| 1585 | nmdc:mga08y16_5266_c1 | 3300050511 | Bacteria | 13515 |
| 1586 | nmdc:mga08y16_556263_c1 | 3300050511 | Bacteria | 1160 |
| 1587 | nmdc:mga08y16_56605_c1 | 3300050511 | Bacteria | 4097 |
| 1588 | nmdc:mga08y16_940_c1 | 3300050511 | Bacteria | 28306 |
| 1589 | nmdc:mga0n895_12320_c1 | 3300050512 | Bacteria | 7667 |
| 1590 | nmdc:mga0n895_130855_c1 | 3300050512 | Bacteria | 2534 |
| 1591 | nmdc:mga0n895_2636_c1 | 3300050512 | Bacteria | 14138 |
| 1592 | nmdc:mga0n895_34687_c1 | 3300050512 | Bacteria | 4859 |
| 1593 | nmdc:mga0n895_357174_c1 | 3300050512 | Bacteria | 1480 |
| 1594 | nmdc:mga0n895_471786_c1 | 3300050512 | Bacteria | 1266 |
| 1595 | nmdc:mga0n895_534_c1 | 3300050512 | Bacteria | 25950 |
| 1596 | nmdc:mga0rr50_20867_c1 | 3300050513 | Bacteria | 4460 |
| 1597 | nmdc:mga0rr50_31337_c1 | 3300050513 | Bacteria | 3775 |
| 1598 | nmdc:mga0rr50_3849_c1 | 3300050513 | Bacteria | 8721 |
| 1599 | nmdc:mga0rr50_38987_c1 | 3300050513 | Bacteria | 3443 |
| 1600 | nmdc:mga0rr50_6636_c1 | 3300050513 | Bacteria | 7072 |
| 1601 | nmdc:mga08x19_106448_c1 | 3300050514 | Bacteria | 1866 |
| 1602 | nmdc:mga08x19_113613_c1 | 3300050514 | Bacteria | 1808 |
| 1603 | nmdc:mga08x19_143622_c1 | 3300050514 | Bacteria | 1613 |
| 1604 | nmdc:mga08x19_345771_c1 | 3300050514 | Bacteria | 1038 |
| 1605 | nmdc:mga0a205_145005_c1 | 3300050515 | Bacteria | 2274 |
| 1606 | nmdc:mga0a205_213_c1 | 3300050515 | Bacteria | 40801 |
| 1607 | nmdc:mga0a205_398835_c1 | 3300050515 | Bacteria | 1239 |
| 1608 | nmdc:mga0a205_549_c1 | 3300050515 | Bacteria | 29737 |
| 1609 | nmdc:mga0a205_61189_c1 | 3300050515 | Bacteria | 3636 |
| 1610 | nmdc:mga0sz30_49734_c1 | 3300050516 | Bacteria | 1777 |
| 1611 | nmdc:mga0sz30_60233_c1 | 3300050516 | Bacteria | 1621 |
| 1612 | Ga0495601_0000111 | 3300053077 | Bacteria | 44773 |
| 1613 | Ga0495601_0000347 | 3300053077 | Bacteria | 24383 |
| 1614 | Ga0495601_0000946 | 3300053077 | Bacteria | 15808 |
| 1615 | Ga0495601_0004646 | 3300053077 | Bacteria | 7952 |
| 1616 | Ga0495601_0013434 | 3300053077 | Bacteria | 4926 |
| 1617 | Ga0495601_0060208 | 3300053077 | Bacteria | 2409 |
| 1618 | Ga0495601_0069781 | 3300053077 | Bacteria | 2241 |
| 1619 | Ga0495601_0123720 | 3300053077 | Bacteria | 1681 |
| 1620 | Ga0495601_0157802 | 3300053077 | Bacteria | 1482 |
| 1621 | Ga0495612_0001438 | 3300053078 | Bacteria | 9789 |
| 1622 | Ga0495612_0004407 | 3300053078 | Bacteria | 5838 |
| 1623 | Ga0495612_0065498 | 3300053078 | Bacteria | 1509 |
| 1624 | Ga0500610_0130389 | 3300053079 | Bacteria | 1279 |
| 1625 | Ga0500635_0005946 | 3300053080 | Bacteria | 3236 |
| 1626 | Ga0495595_0000587 | 3300053084 | Bacteria | 13888 |
| 1627 | Ga0495595_0000735 | 3300053084 | Bacteria | 12432 |
| 1628 | Ga0495595_0000758 | 3300053084 | Bacteria | 12258 |
| 1629 | Ga0495595_0001611 | 3300053084 | Bacteria | 8813 |
| 1630 | Ga0495595_0015410 | 3300053084 | Bacteria | 3261 |
| 1631 | Ga0495595_0028949 | 3300053084 | Bacteria | 2475 |
| 1632 | Ga0495595_0043394 | 3300053084 | Bacteria | 2062 |
| 1633 | Ga0495619_0000083 | 3300053085 | Bacteria | 70312 |
| 1634 | Ga0495619_0000296 | 3300053085 | Bacteria | 35155 |
| 1635 | Ga0495619_0000617 | 3300053085 | Bacteria | 23526 |
| 1636 | Ga0495619_0000672 | 3300053085 | Bacteria | 22398 |
| 1637 | Ga0495619_0007396 | 3300053085 | Bacteria | 6958 |
| 1638 | Ga0495619_0008615 | 3300053085 | Bacteria | 6451 |
| 1639 | Ga0495619_0012446 | 3300053085 | Bacteria | 5358 |
| 1640 | Ga0500578_0170696 | 3300053086 | Bacteria | 1345 |
| 1641 | Ga0500643_000168 | 3300053087 | Bacteria | 64858 |
| 1642 | Ga0500643_019615 | 3300053087 | Bacteria | 2222 |
| 1643 | Ga0500644_0020873 | 3300053088 | Bacteria | 1954 |
| 1644 | Ga0500647_0056019 | 3300053091 | Bacteria | 1896 |
| 1645 | Ga0500651_0007251 | 3300053093 | Bacteria | 6463 |
| 1646 | Ga0500651_0026339 | 3300053093 | Bacteria | 3654 |
| 1647 | Ga0500566_0000822 | 3300053094 | Bacteria | 17706 |
| 1648 | Ga0500566_0003454 | 3300053094 | Bacteria | 9426 |
| 1649 | Ga0500566_0015378 | 3300053094 | Bacteria | 4489 |
| 1650 | Ga0500566_0103886 | 3300053094 | Bacteria | 1554 |
| 1651 | Ga0500640_000302 | 3300053095 | Bacteria | 11174 |
| 1652 | Ga0500641_0014207 | 3300053096 | Bacteria | 2936 |
| 1653 | Ga0500641_0108360 | 3300053096 | Bacteria | 1195 |
| 1654 | Ga0500554_002374 | 3300053102 | Bacteria | 3691 |
| 1655 | Ga0500554_008660 | 3300053102 | Bacteria | 2402 |
| 1656 | Ga0500555_003167 | 3300053103 | Bacteria | 4691 |
| 1657 | Ga0500555_023816 | 3300053103 | Bacteria | 1756 |
| 1658 | Ga0500556_0000047 | 3300053104 | Bacteria | 126199 |
| 1659 | Ga0500557_000032 | 3300053105 | Bacteria | 74032 |
| 1660 | Ga0500562_020004 | 3300053108 | Bacteria | 1736 |
| 1661 | Ga0500562_054516 | 3300053108 | Bacteria | 1071 |
| 1662 | Ga0500569_006898 | 3300053109 | Bacteria | 2519 |
| 1663 | Ga0500572_001002 | 3300053111 | Bacteria | 8555 |
| 1664 | Ga0500572_009776 | 3300053111 | Bacteria | 2275 |
| 1665 | Ga0500592_000485 | 3300053116 | Bacteria | 6580 |
| 1666 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1667 | Ga0500595_006565 | 3300053119 | Bacteria | 4919 |
| 1668 | Ga0500595_011798 | 3300053119 | Bacteria | 3403 |
| 1669 | Ga0500595_028598 | 3300053119 | Bacteria | 1900 |
| 1670 | Ga0500608_024516 | 3300053122 | Bacteria | 2817 |
| 1671 | Ga0500614_004103 | 3300053123 | Bacteria | 3097 |
| 1672 | Ga0500621_107476 | 3300053126 | Bacteria | 1094 |
| 1673 | Ga0500642_0000142 | 3300053130 | Bacteria | 32016 |
| 1674 | Ga0500642_0000183 | 3300053130 | Bacteria | 25867 |
| 1675 | Ga0500652_001628 | 3300053131 | Bacteria | 6828 |
| 1676 | Ga0500652_035488 | 3300053131 | Bacteria | 1981 |
| 1677 | Ga0500655_009751 | 3300053133 | Bacteria | 1733 |
| 1678 | Ga0500559_0000105 | 3300053136 | Bacteria | 65809 |
| 1679 | Ga0500559_0001644 | 3300053136 | Bacteria | 12374 |
| 1680 | Ga0500559_0004871 | 3300053136 | Bacteria | 6261 |
| 1681 | Ga0500559_0086393 | 3300053136 | Bacteria | 1431 |
| 1682 | Ga0500603_000366 | 3300053150 | Bacteria | 11817 |
| 1683 | Ga0500603_000576 | 3300053150 | Bacteria | 9221 |
| 1684 | Ga0500604_0002170 | 3300053151 | Bacteria | 5398 |
| 1685 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1686 | Ga0500616_0000784 | 3300053153 | Bacteria | 36530 |
| 1687 | Ga0500616_0013923 | 3300053153 | Bacteria | 4642 |
| 1688 | Ga0500620_038702 | 3300053155 | Bacteria | 1554 |
| 1689 | Ga0500622_0008137 | 3300053156 | Bacteria | 5893 |
| 1690 | Ga0500627_0045732 | 3300053158 | Bacteria | 1895 |
| 1691 | Ga0500630_000365 | 3300053159 | Bacteria | 19125 |
| 1692 | Ga0500634_0114185 | 3300053161 | Bacteria | 1326 |
| 1693 | Ga0500638_152477 | 3300053162 | Bacteria | 1026 |
| 1694 | Ga0500639_000031 | 3300053163 | Bacteria | 69938 |
| 1695 | Ga0500636_0000592 | 3300053177 | Bacteria | 19795 |
| 1696 | Ga0500636_0003094 | 3300053177 | Bacteria | 9326 |
| 1697 | Ga0500636_0009727 | 3300053177 | Bacteria | 5600 |
| 1698 | Ga0500636_0130196 | 3300053177 | Bacteria | 1402 |
| 1699 | Ga0500625_000232 | 3300053729 | Bacteria | 12898 |
| 1700 | Ga0500645_000675 | 3300053730 | Bacteria | 21406 |
| 1701 | Ga0500645_007739 | 3300053730 | Bacteria | 3717 |
| 1702 | Ga0500645_010764 | 3300053730 | Bacteria | 3009 |
| 1703 | Ga0500645_016840 | 3300053730 | Bacteria | 2298 |
| 1704 | Ga0500645_067292 | 3300053730 | Bacteria | 1031 |
| 1705 | Ga0500609_009207 | 3300053731 | Bacteria | 1332 |
| 1706 | Ga0500596_001156 | 3300053735 | Bacteria | 5308 |
| 1707 | Ga0500596_003966 | 3300053735 | Bacteria | 2756 |
| 1708 | Ga0500601_000888 | 3300053737 | Bacteria | 3585 |
| 1709 | Ga0500601_001193 | 3300053737 | Bacteria | 2892 |
| 1710 | Ga0501084_0008150 | 3300054114 | Bacteria | 8638 |
| 1711 | Ga0501084_0073495 | 3300054114 | Bacteria | 2863 |
| 1712 | Ga0501084_0169083 | 3300054114 | Bacteria | 1845 |
| 1713 | Ga0590075_031381 | 3300059424 | Bacteria | 1347 |
| 1714 | Ga0501082_0005663 | 3300060353 | Bacteria | 10842 |
| 1715 | Ga0501082_0060179 | 3300060353 | Bacteria | 3271 |
| 1716 | Ga0501082_0082424 | 3300060353 | Bacteria | 2775 |
| 1717 | Ga0501082_0100493 | 3300060353 | Bacteria | 2502 |
| 1718 | Ga0501082_0107708 | 3300060353 | Bacteria | 2411 |
| 1719 | Ga0501082_0235527 | 3300060353 | Bacteria | 1593 |
| 1720 | Ga0501082_0315271 | 3300060353 | Bacteria | 1362 |
| 1721 | Ga0501082_0417925 | 3300060353 | Bacteria | 1171 |
| 1722 | Ga0466962_0053690 | 3300061719 | Bacteria | 1926 |
| 1723 | Ga0530510_0024112 | 3300061734 | Bacteria | 4340 |
| 1724 | Ga0530510_0213573 | 3300061734 | Bacteria | 1433 |
| 1725 | Ga0530510_0315050 | 3300061734 | Bacteria | 1172 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0212634 | Ga0373943_0212634_214_1032 | 271 |
| 2 | 3300039453 | Ga0436362_0256641 | Ga0436362_0256641_42_860 | 271 |
| 3 | 3300005340 | Ga0070689_100270099 | Ga0070689_1002700991 | 281 |
| 4 | 3300005347 | Ga0070668_100098279 | Ga0070668_1000982791 | 281 |
| 5 | 3300005455 | Ga0070663_100168454 | Ga0070663_1001684542 | 281 |
| 6 | 3300025935 | Ga0207709_10041733 | Ga0207709_100417331 | 281 |
| 7 | 3300048920 | Ga0496117_0011427 | Ga0496117_0011427_864_1823 | 284 |
| 8 | 3300048921 | Ga0496118_0001805 | Ga0496118_0001805_29536_30495 | 284 |
| 9 | 3300005347 | Ga0070668_100005832 | Ga0070668_1000058327 | 286 |
| 10 | 3300005617 | Ga0068859_100383185 | Ga0068859_1003831852 | 286 |
| 11 | 3300005844 | Ga0068862_100035921 | Ga0068862_1000359213 | 286 |
| 12 | 3300006931 | Ga0097620_100383180 | Ga0097620_1003831801 | 286 |
| 13 | 3300009177 | Ga0105248_10044578 | Ga0105248_100445784 | 286 |
| 14 | 3300025907 | Ga0207645_10103240 | Ga0207645_101032402 | 286 |
| 15 | 3300025941 | Ga0207711_10117134 | Ga0207711_101171343 | 286 |
| 16 | 3300025972 | Ga0207668_10000956 | Ga0207668_100009564 | 286 |
| 17 | 3300028380 | Ga0268265_10021796 | Ga0268265_100217962 | 286 |
| 18 | 3300028380 | Ga0268265_10029400 | Ga0268265_100294003 | 286 |
| 19 | 3300031903 | Ga0307407_10242335 | Ga0307407_102423352 | 286 |
| 20 | 3300032002 | Ga0307416_100100577 | Ga0307416_1001005773 | 286 |
| 21 | 3300046492 | Ga0495585_0095908 | Ga0495585_0095908_10_924 | 286 |
| 22 | 3300046499 | Ga0495594_0217482 | Ga0495594_0217482_103_1017 | 286 |
| 23 | 3300046523 | Ga0495644_0073897 | Ga0495644_0073897_64_978 | 286 |
| 24 | 3300046526 | Ga0495666_0107322 | Ga0495666_0107322_137_1051 | 286 |
| 25 | 3300046537 | Ga0495598_0059909 | Ga0495598_0059909_74_988 | 286 |
| 26 | 3300046539 | Ga0495621_0111029 | Ga0495621_0111029_92_1006 | 286 |
| 27 | 3300046558 | Ga0495633_0072774 | Ga0495633_0072774_86_1000 | 286 |
| 28 | 3300046684 | Ga0495669_0137467 | Ga0495669_0137467_118_1032 | 286 |
| 29 | 3300047318 | Ga0495636_0046143 | Ga0495636_0046143_200_1114 | 286 |
| 30 | 3300047321 | Ga0495676_0268884 | Ga0495676_0268884_170_1084 | 286 |
| 31 | 3300048090 | Ga0495615_0052817 | Ga0495615_0052817_19_933 | 286 |
| 32 | 3300048922 | Ga0496119_0127448 | Ga0496119_0127448_101_1015 | 286 |
| 33 | 3300050511 | nmdc:mga08y16_556263_c1 | nmdc:mga08y16_556263_c1_181_1095 | 286 |
| 34 | 3300053131 | Ga0500652_035488 | Ga0500652_035488_493_1446 | 286 |
| 35 | 3300048904 | Ga0496101_0538500 | Ga0496101_0538500_10_885 | 287 |
| 36 | 3300048915 | Ga0496112_0381138 | Ga0496112_0381138_459_1334 | 287 |
| 37 | 3300049571 | Ga0501034_0254770 | Ga0501034_0254770_33_947 | 287 |
| 38 | 3300050494 | nmdc:mga06z11_72694_c1 | nmdc:mga06z11_72694_c1_25_900 | 287 |
| 39 | 3300005356 | Ga0070674_100242565 | Ga0070674_1002425652 | 288 |
| 40 | 3300025933 | Ga0207706_10162509 | Ga0207706_101625092 | 288 |
| 41 | 3300025972 | Ga0207668_10043661 | Ga0207668_100436612 | 288 |
| 42 | 3300046513 | Ga0495616_0084300 | Ga0495616_0084300_107_1021 | 288 |
| 43 | 3300050509 | nmdc:mga0qj67_4921_c1 | nmdc:mga0qj67_4921_c1_6681_7565 | 288 |
| 44 | 3300025986 | Ga0207658_10316488 | Ga0207658_103164881 | 289 |
| 45 | 3300013307 | Ga0157372_10396871 | Ga0157372_103968712 | 290 |
| 46 | 3300044694 | Ga0466963_0284198 | Ga0466963_0284198_100_1020 | 290 |
| 47 | 3300046794 | Ga0495589_0082422 | Ga0495589_0082422_386_1279 | 290 |
| 48 | 3300049568 | Ga0501031_0003990 | Ga0501031_0003990_7061_7975 | 290 |
| 49 | 3300049569 | Ga0501032_0000073 | Ga0501032_0000073_49166_50080 | 290 |
| 50 | 3300049570 | Ga0501033_0000136 | Ga0501033_0000136_11191_12105 | 290 |
| 51 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_29742_30656 | 290 |
| 52 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_58858_59772 | 290 |
| 53 | 3300049573 | Ga0501037_0000040 | Ga0501037_0000040_23342_24256 | 290 |
| 54 | 3300049574 | Ga0501038_0000150 | Ga0501038_0000150_35903_36817 | 290 |
| 55 | 3300049575 | Ga0501039_0003418 | Ga0501039_0003418_1999_2913 | 290 |
| 56 | 3300049578 | Ga0501042_0008136 | Ga0501042_0008136_4332_5246 | 290 |
| 57 | 3300049579 | Ga0501043_0000464 | Ga0501043_0000464_13234_14148 | 290 |
| 58 | 3300049580 | Ga0501046_0000398 | Ga0501046_0000398_29276_30190 | 290 |
| 59 | 3300049581 | Ga0501047_0000656 | Ga0501047_0000656_29512_30426 | 290 |
| 60 | 3300049582 | Ga0501048_0000906 | Ga0501048_0000906_9634_10548 | 290 |
| 61 | 3300049583 | Ga0501067_0000192 | Ga0501067_0000192_21357_22271 | 290 |
| 62 | 3300049584 | Ga0501068_0002765 | Ga0501068_0002765_1915_2829 | 290 |
| 63 | 3300049585 | Ga0501069_0014897 | Ga0501069_0014897_1068_1982 | 290 |
| 64 | 3300049586 | Ga0501070_0076207 | Ga0501070_0076207_1815_2729 | 290 |
| 65 | 3300049587 | Ga0501071_0053825 | Ga0501071_0053825_132_1046 | 290 |
| 66 | 3300049588 | Ga0501072_0002128 | Ga0501072_0002128_8870_9784 | 290 |
| 67 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_27501_28415 | 290 |
| 68 | 3300049590 | Ga0501074_0000133 | Ga0501074_0000133_35416_36330 | 290 |
| 69 | 3300049741 | Ga0501079_0057957 | Ga0501079_0057957_1865_2779 | 290 |
| 70 | 3300049742 | Ga0501080_0000054 | Ga0501080_0000054_32333_33247 | 290 |
| 71 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_56906_57820 | 290 |
| 72 | 3300049823 | Ga0501044_0000985 | Ga0501044_0000985_29742_30656 | 290 |
| 73 | 3300054114 | Ga0501084_0008150 | Ga0501084_0008150_5309_6223 | 290 |
| 74 | 3300060353 | Ga0501082_0005663 | Ga0501082_0005663_1606_2520 | 290 |
| 75 | iso_pu_bacteria | 2602042107 | 2603857124 | 290 |
| 76 | iso_pu_bacteria | 2857524615 | 2857530871 | 290 |
| 77 | iso_pu_bacteria | 2893066018 | 2893066374 | 290 |
| 78 | iso_pu_bacteria | 2919073203 | 2919077915 | 290 |
| 79 | 3300033442 | Ga0315911_1000005 | Ga0315911_100000519 | 291 |
| 80 | 3300050491 | nmdc:mga00v17_271514_c1 | nmdc:mga00v17_271514_c1_173_1054 | 291 |
| 81 | 3300050507 | nmdc:mga05p37_247786_c1 | nmdc:mga05p37_247786_c1_360_1268 | 291 |
| 82 | iso_pu_bacteria | 2513237098 | 2513674950 | 291 |
| 83 | iso_pu_bacteria | 2524023210 | 2524465266 | 291 |
| 84 | iso_pu_bacteria | 2885383462 | 2885388905 | 291 |
| 85 | iso_pu_bacteria | 2903768456 | 2903774681 | 291 |
| 86 | iso_pu_bacteria | 8056681323 | 8056683412 | 291 |
| 87 | 3300048927 | Ga0496124_0205568 | Ga0496124_0205568_117_1010 | 292 |
| 88 | 3300048928 | Ga0496125_0000823 | Ga0496125_0000823_30556_31449 | 292 |
| 89 | iso_pu_bacteria | 2935694250 | 2935696772 | 292 |
| 90 | iso_pu_bacteria | 2935777560 | 2935777749 | 292 |
| 91 | iso_pu_bacteria | 8016595262 | 8016602811 | 292 |
| 92 | iso_pu_bacteria | 8016613128 | 8016617586 | 292 |
| 93 | 3300025294 | Ga0209025_1060712 | Ga0209025_10607121 | 293 |
| 94 | 3300025295 | Ga0209564_1000477 | Ga0209564_10004772 | 293 |
| 95 | 3300045976 | Ga0466967_0164748 | Ga0466967_0164748_551_1432 | 293 |
| 96 | 3300046524 | Ga0495648_0004337 | Ga0495648_0004337_9118_10029 | 293 |
| 97 | 3300050508 | nmdc:mga09592_193281_c1 | nmdc:mga09592_193281_c1_566_1477 | 293 |
| 98 | 3300061719 | Ga0466962_0053690 | Ga0466962_0053690_42_923 | 293 |
| 99 | iso_pu_bacteria | 2904690495 | 2904692070 | 293 |
| 100 | iso_pu_bacteria | 2908756301 | 2908757350 | 293 |
| 101 | 3300005843 | Ga0068860_100000837 | Ga0068860_10000083724 | 294 |
| 102 | 3300006038 | Ga0075365_10043977 | Ga0075365_100439772 | 294 |
| 103 | 3300006038 | Ga0075365_10274096 | Ga0075365_102740962 | 294 |
| 104 | 3300006051 | Ga0075364_10272662 | Ga0075364_102726621 | 294 |
| 105 | 3300006186 | Ga0075369_10010149 | Ga0075369_100101493 | 294 |
| 106 | 3300021377 | Ga0213874_10054518 | Ga0213874_100545182 | 294 |
| 107 | 3300025295 | Ga0209564_1021999 | Ga0209564_10219992 | 294 |
| 108 | 3300026067 | Ga0207678_10105437 | Ga0207678_101054372 | 294 |
| 109 | 3300028381 | Ga0268264_10000537 | Ga0268264_1000053714 | 294 |
| 110 | 3300028794 | Ga0307515_10122964 | Ga0307515_101229642 | 294 |
| 111 | 3300031911 | Ga0307412_10049330 | Ga0307412_100493302 | 294 |
| 112 | 3300039450 | Ga0436363_0959897 | Ga0436363_0959897_845_1747 | 294 |
| 113 | 3300044694 | Ga0466963_0111242 | Ga0466963_0111242_839_1735 | 294 |
| 114 | 3300046474 | Ga0495605_0096947 | Ga0495605_0096947_88_1002 | 294 |
| 115 | 3300046499 | Ga0495594_0242154 | Ga0495594_0242154_60_959 | 294 |
| 116 | 3300046506 | Ga0495583_0108198 | Ga0495583_0108198_46_960 | 294 |
| 117 | 3300046513 | Ga0495616_0037770 | Ga0495616_0037770_56_970 | 294 |
| 118 | 3300046515 | Ga0495620_0013412 | Ga0495620_0013412_1528_2442 | 294 |
| 119 | 3300046520 | Ga0495637_0029569 | Ga0495637_0029569_1433_2347 | 294 |
| 120 | 3300046524 | Ga0495648_0051499 | Ga0495648_0051499_1427_2341 | 294 |
| 121 | 3300046530 | Ga0495654_0091978 | Ga0495654_0091978_300_1214 | 294 |
| 122 | 3300046542 | Ga0495597_0055463 | Ga0495597_0055463_742_1656 | 294 |
| 123 | 3300046557 | Ga0495622_0015036 | Ga0495622_0015036_1628_2542 | 294 |
| 124 | 3300046616 | Ga0495668_0063204 | Ga0495668_0063204_369_1283 | 294 |
| 125 | 3300046691 | Ga0495670_0123993 | Ga0495670_0123993_71_985 | 294 |
| 126 | 3300048091 | Ga0495626_0057165 | Ga0495626_0057165_179_1093 | 294 |
| 127 | 3300048909 | Ga0496106_0017137 | Ga0496106_0017137_4377_5276 | 294 |
| 128 | 3300048919 | Ga0496116_0018470 | Ga0496116_0018470_4252_5166 | 294 |
| 129 | 3300048921 | Ga0496118_0037848 | Ga0496118_0037848_941_1855 | 294 |
| 130 | 3300048924 | Ga0496121_0036588 | Ga0496121_0036588_3412_4326 | 294 |
| 131 | 3300048925 | Ga0496122_0042354 | Ga0496122_0042354_1430_2344 | 294 |
| 132 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_21460_22359 | 294 |
| 133 | 3300048928 | Ga0496125_0004393 | Ga0496125_0004393_8780_9694 | 294 |
| 134 | 3300048928 | Ga0496125_0052663 | Ga0496125_0052663_1480_2394 | 294 |
| 135 | 3300049585 | Ga0501069_0028379 | Ga0501069_0028379_1927_2835 | 294 |
| 136 | 3300049744 | Ga0501083_0026434 | Ga0501083_0026434_640_1548 | 294 |
| 137 | 3300050491 | nmdc:mga00v17_117413_c1 | nmdc:mga00v17_117413_c1_548_1462 | 294 |
| 138 | 3300050492 | nmdc:mga0yw44_79569_c1 | nmdc:mga0yw44_79569_c1_1032_1946 | 294 |
| 139 | 3300050516 | nmdc:mga0sz30_49734_c1 | nmdc:mga0sz30_49734_c1_594_1508 | 294 |
| 140 | 3300053087 | Ga0500643_019615 | Ga0500643_019615_752_1666 | 294 |
| 141 | 3300053088 | Ga0500644_0020873 | Ga0500644_0020873_140_1054 | 294 |
| 142 | 3300053093 | Ga0500651_0026339 | Ga0500651_0026339_361_1275 | 294 |
| 143 | 3300053094 | Ga0500566_0000822 | Ga0500566_0000822_3989_4903 | 294 |
| 144 | 3300053102 | Ga0500554_008660 | Ga0500554_008660_1385_2299 | 294 |
| 145 | 3300053103 | Ga0500555_023816 | Ga0500555_023816_339_1253 | 294 |
| 146 | 3300053104 | Ga0500556_0000047 | Ga0500556_0000047_8796_9710 | 294 |
| 147 | 3300053108 | Ga0500562_054516 | Ga0500562_054516_111_1025 | 294 |
| 148 | 3300053109 | Ga0500569_006898 | Ga0500569_006898_1449_2363 | 294 |
| 149 | 3300053116 | Ga0500592_000485 | Ga0500592_000485_2217_3131 | 294 |
| 150 | 3300053126 | Ga0500621_107476 | Ga0500621_107476_103_1017 | 294 |
| 151 | 3300053130 | Ga0500642_0000142 | Ga0500642_0000142_4101_5015 | 294 |
| 152 | 3300053131 | Ga0500652_001628 | Ga0500652_001628_4014_4928 | 294 |
| 153 | 3300053136 | Ga0500559_0000105 | Ga0500559_0000105_29058_29972 | 294 |
| 154 | 3300053151 | Ga0500604_0002170 | Ga0500604_0002170_1649_2563 | 294 |
| 155 | 3300053153 | Ga0500616_0000784 | Ga0500616_0000784_26682_27596 | 294 |
| 156 | 3300053158 | Ga0500627_0045732 | Ga0500627_0045732_335_1249 | 294 |
| 157 | 3300053161 | Ga0500634_0114185 | Ga0500634_0114185_233_1147 | 294 |
| 158 | 3300053177 | Ga0500636_0003094 | Ga0500636_0003094_6133_7047 | 294 |
| 159 | 3300053730 | Ga0500645_010764 | Ga0500645_010764_1344_2258 | 294 |
| 160 | 3300060353 | Ga0501082_0060179 | Ga0501082_0060179_245_1153 | 294 |
| 161 | 3300060353 | Ga0501082_0082424 | Ga0501082_0082424_716_1624 | 294 |
| 162 | 3300060353 | Ga0501082_0107708 | Ga0501082_0107708_372_1280 | 294 |
| 163 | iso_pu_bacteria | 2932794094 | 2932796039 | 294 |
| 164 | iso_pu_bacteria | 2932801729 | 2932807616 | 294 |
| 165 | iso_pu_bacteria | 2935883170 | 2935887308 | 294 |
| 166 | iso_pu_bacteria | 2941531003 | 2941534579 | 294 |
| 167 | iso_pu_bacteria | 3005710791 | 3005711818 | 294 |
| 168 | iso_pu_bacteria | 8016539877 | 8016545276 | 294 |
| 169 | iso_pu_bacteria | 8016548790 | 8016556812 | 294 |
| 170 | iso_pu_bacteria | 8016557553 | 8016565165 | 294 |
| 171 | iso_pu_bacteria | 8016566248 | 8016570355 | 294 |
| 172 | iso_pu_bacteria | 8016575299 | 8016582901 | 294 |
| 173 | iso_pu_bacteria | 8016603502 | 8016605675 | 294 |
| 174 | iso_pu_bacteria | 8016622563 | 8016623985 | 294 |
| 175 | iso_pu_bacteria | 8019530166 | 8019531882 | 294 |
| 176 | 3300003203 | JGI25406J46586_10000012 | JGI25406J46586_1000001249 | 295 |
| 177 | 3300003215 | JGI25153J46596_10034157 | JGI25153J46596_100341572 | 295 |
| 178 | 3300005439 | Ga0070711_100082494 | Ga0070711_1000824942 | 295 |
| 179 | 3300005841 | Ga0068863_100350823 | Ga0068863_1003508232 | 295 |
| 180 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040214 | 295 |
| 181 | 3300006175 | Ga0070712_100051470 | Ga0070712_1000514702 | 295 |
| 182 | 3300010375 | Ga0105239_10318087 | Ga0105239_103180872 | 295 |
| 183 | 3300013306 | Ga0163162_10248130 | Ga0163162_102481302 | 295 |
| 184 | 3300021384 | Ga0213876_10058440 | Ga0213876_100584402 | 295 |
| 185 | 3300025297 | Ga0209758_1004564 | Ga0209758_10045642 | 295 |
| 186 | 3300025898 | Ga0207692_10110409 | Ga0207692_101104092 | 295 |
| 187 | 3300025915 | Ga0207693_10080113 | Ga0207693_100801132 | 295 |
| 188 | 3300025916 | Ga0207663_10121501 | Ga0207663_101215012 | 295 |
| 189 | 3300025916 | Ga0207663_10293394 | Ga0207663_102933942 | 295 |
| 190 | 3300035085 | Ga0373929_0004365 | Ga0373929_0004365_308_1210 | 295 |
| 191 | 3300035171 | Ga0373946_0064188 | Ga0373946_0064188_483_1379 | 295 |
| 192 | 3300035691 | Ga0373931_0060213 | Ga0373931_0060213_1023_1925 | 295 |
| 193 | 3300035695 | Ga0373927_0035090 | Ga0373927_0035090_1298_2194 | 295 |
| 194 | 3300037471 | Ga0395905_0083368 | Ga0395905_0083368_143_1039 | 295 |
| 195 | 3300037471 | Ga0395905_0119852 | Ga0395905_0119852_144_1040 | 295 |
| 196 | 3300038443 | Ga0395901_0422299 | Ga0395901_0422299_181_1077 | 295 |
| 197 | 3300039437 | Ga0436365_0295600 | Ga0436365_0295600_527_1477 | 295 |
| 198 | 3300039437 | Ga0436365_0526132 | Ga0436365_0526132_1371_2273 | 295 |
| 199 | 3300046507 | Ga0495606_0001350 | Ga0495606_0001350_24067_24969 | 295 |
| 200 | 3300046542 | Ga0495597_0059960 | Ga0495597_0059960_26_928 | 295 |
| 201 | 3300047320 | Ga0495672_0005199 | Ga0495672_0005199_8164_9066 | 295 |
| 202 | 3300048903 | Ga0496100_0341982 | Ga0496100_0341982_217_1113 | 295 |
| 203 | 3300048904 | Ga0496101_0052485 | Ga0496101_0052485_559_1455 | 295 |
| 204 | 3300048908 | Ga0496105_0141191 | Ga0496105_0141191_911_1813 | 295 |
| 205 | 3300048911 | Ga0496108_0074802 | Ga0496108_0074802_1563_2465 | 295 |
| 206 | 3300048912 | Ga0496109_0208775 | Ga0496109_0208775_801_1703 | 295 |
| 207 | 3300048913 | Ga0496110_0067181 | Ga0496110_0067181_372_1274 | 295 |
| 208 | 3300048914 | Ga0496111_0027702 | Ga0496111_0027702_1317_2219 | 295 |
| 209 | 3300048915 | Ga0496112_0000029 | Ga0496112_0000029_14211_15113 | 295 |
| 210 | 3300048915 | Ga0496112_0074363 | Ga0496112_0074363_1818_2720 | 295 |
| 211 | 3300048916 | Ga0496113_0255493 | Ga0496113_0255493_277_1179 | 295 |
| 212 | 3300048923 | Ga0496120_0145843 | Ga0496120_0145843_250_1146 | 295 |
| 213 | 3300048924 | Ga0496121_0003034 | Ga0496121_0003034_16259_17155 | 295 |
| 214 | 3300048924 | Ga0496121_0041193 | Ga0496121_0041193_1824_2726 | 295 |
| 215 | 3300048924 | Ga0496121_0157493 | Ga0496121_0157493_477_1379 | 295 |
| 216 | 3300048925 | Ga0496122_0067457 | Ga0496122_0067457_740_1636 | 295 |
| 217 | 3300048929 | Ga0496126_0011331 | Ga0496126_0011331_7290_8186 | 295 |
| 218 | 3300048929 | Ga0496126_0034249 | Ga0496126_0034249_3085_3981 | 295 |
| 219 | 3300049574 | Ga0501038_0461706 | Ga0501038_0461706_28_939 | 295 |
| 220 | 3300053119 | Ga0500595_006565 | Ga0500595_006565_1974_2870 | 295 |
| 221 | iso_pu_bacteria | 2507262055 | 2507505933 | 295 |
| 222 | iso_pu_bacteria | 2508501009 | 2508540122 | 295 |
| 223 | iso_pu_bacteria | 2508501042 | 2508696196 | 295 |
| 224 | iso_pu_bacteria | 2508501128 | 2509148120 | 295 |
| 225 | iso_pu_bacteria | 2511231028 | 2511396579 | 295 |
| 226 | iso_pu_bacteria | 2513237092 | 2513627431 | 295 |
| 227 | iso_pu_bacteria | 2513237094 | 2513638321 | 295 |
| 228 | iso_pu_bacteria | 2513237095 | 2513649163 | 295 |
| 229 | iso_pu_bacteria | 2513237096 | 2513657472 | 295 |
| 230 | iso_pu_bacteria | 2513237101 | 2513696279 | 295 |
| 231 | iso_pu_bacteria | 2513237102 | 2513700226 | 295 |
| 232 | iso_pu_bacteria | 2513237104 | 2513716104 | 295 |
| 233 | iso_pu_bacteria | 2513237137 | 2513861200 | 295 |
| 234 | iso_pu_bacteria | 2513237139 | 2513877238 | 295 |
| 235 | iso_pu_bacteria | 2513237141 | 2513891601 | 295 |
| 236 | iso_pu_bacteria | 2513237145 | 2513916725 | 295 |
| 237 | iso_pu_bacteria | 2513237161 | 2514014608 | 295 |
| 238 | iso_pu_bacteria | 2515154112 | 2515628525 | 295 |
| 239 | iso_pu_bacteria | 2517572143 | 2517889632 | 295 |
| 240 | iso_pu_bacteria | 2524023228 | 2524533198 | 295 |
| 241 | iso_pu_bacteria | 2528768022 | 2528850700 | 295 |
| 242 | iso_pu_bacteria | 2617270735 | 2617347815 | 295 |
| 243 | iso_pu_bacteria | 2617270741 | 2617374737 | 295 |
| 244 | iso_pu_bacteria | 2643221651 | 2644290487 | 295 |
| 245 | iso_pu_bacteria | 2667528175 | 2671119484 | 295 |
| 246 | iso_pu_bacteria | 2721755755 | 2723842286 | 295 |
| 247 | iso_pu_bacteria | 2728368998 | 2728755274 | 295 |
| 248 | iso_pu_bacteria | 2744054633 | 2745081917 | 295 |
| 249 | iso_pu_bacteria | 2791355196 | 2793061531 | 295 |
| 250 | iso_pu_bacteria | 2791355197 | 2793070387 | 295 |
| 251 | iso_pu_bacteria | 2791355199 | 2793080142 | 295 |
| 252 | iso_pu_bacteria | 2802429603 | 2805916162 | 295 |
| 253 | iso_pu_bacteria | 2816332527 | 2818240554 | 295 |
| 254 | iso_pu_bacteria | 2824600985 | 2824603627 | 295 |
| 255 | iso_pu_bacteria | 2824609381 | 2824610787 | 295 |
| 256 | iso_pu_bacteria | 2824617872 | 2824623207 | 295 |
| 257 | iso_pu_bacteria | 2824626560 | 2824632195 | 295 |
| 258 | iso_pu_bacteria | 2824635225 | 2824640812 | 295 |
| 259 | iso_pu_bacteria | 2824644064 | 2824647964 | 295 |
| 260 | iso_pu_bacteria | 2824653114 | 2824655233 | 295 |
| 261 | iso_pu_bacteria | 2824661429 | 2824667355 | 295 |
| 262 | iso_pu_bacteria | 2824671348 | 2824675050 | 295 |
| 263 | iso_pu_bacteria | 2824679649 | 2824684445 | 295 |
| 264 | iso_pu_bacteria | 2824687955 | 2824691785 | 295 |
| 265 | iso_pu_bacteria | 2824696289 | 2824701064 | 295 |
| 266 | iso_pu_bacteria | 2824704595 | 2824709280 | 295 |
| 267 | iso_pu_bacteria | 2824714736 | 2824717979 | 295 |
| 268 | iso_pu_bacteria | 2824723954 | 2824728195 | 295 |
| 269 | iso_pu_bacteria | 2824732956 | 2824737036 | 295 |
| 270 | iso_pu_bacteria | 2824746037 | 2824750816 | 295 |
| 271 | iso_pu_bacteria | 2824753945 | 2824762004 | 295 |
| 272 | iso_pu_bacteria | 2824763712 | 2824772369 | 295 |
| 273 | iso_pu_bacteria | 2824773399 | 2824775703 | 295 |
| 274 | iso_pu_bacteria | 2838122688 | 2838125078 | 295 |
| 275 | iso_pu_bacteria | 2841941048 | 2841945816 | 295 |
| 276 | iso_pu_bacteria | 2841949485 | 2841956915 | 295 |
| 277 | iso_pu_bacteria | 2841957949 | 2841963962 | 295 |
| 278 | iso_pu_bacteria | 2841966195 | 2841973524 | 295 |
| 279 | iso_pu_bacteria | 2841974524 | 2841981997 | 295 |
| 280 | iso_pu_bacteria | 2841983080 | 2841989412 | 295 |
| 281 | iso_pu_bacteria | 2842038055 | 2842044400 | 295 |
| 282 | iso_pu_bacteria | 2842045827 | 2842051611 | 295 |
| 283 | iso_pu_bacteria | 2842694124 | 2842694207 | 295 |
| 284 | iso_pu_bacteria | 2844315083 | 2844316263 | 295 |
| 285 | iso_pu_bacteria | 2847930680 | 2847939425 | 295 |
| 286 | iso_pu_bacteria | 2847939898 | 2847941186 | 295 |
| 287 | iso_pu_bacteria | 2849076700 | 2849082172 | 295 |
| 288 | iso_pu_bacteria | 2857509624 | 2857513352 | 295 |
| 289 | iso_pu_bacteria | 2874590934 | 2874596331 | 295 |
| 290 | iso_pu_bacteria | 2874604998 | 2874610125 | 295 |
| 291 | iso_pu_bacteria | 2874612657 | 2874616468 | 295 |
| 292 | iso_pu_bacteria | 2874620515 | 2874622487 | 295 |
| 293 | iso_pu_bacteria | 2874628541 | 2874633393 | 295 |
| 294 | iso_pu_bacteria | 2874645413 | 2874650318 | 295 |
| 295 | iso_pu_bacteria | 2876761206 | 2876761653 | 295 |
| 296 | iso_pu_bacteria | 2876771140 | 2876776796 | 295 |
| 297 | iso_pu_bacteria | 2876818435 | 2876824586 | 295 |
| 298 | iso_pu_bacteria | 2879074833 | 2879080933 | 295 |
| 299 | iso_pu_bacteria | 2879083081 | 2879087097 | 295 |
| 300 | iso_pu_bacteria | 2879099564 | 2879104428 | 295 |
| 301 | iso_pu_bacteria | 2879110137 | 2879116992 | 295 |
| 302 | iso_pu_bacteria | 2879127579 | 2879133778 | 295 |
| 303 | iso_pu_bacteria | 2879142872 | 2879148280 | 295 |
| 304 | iso_pu_bacteria | 2881364244 | 2881369589 | 295 |
| 305 | iso_pu_bacteria | 2881665667 | 2881669693 | 295 |
| 306 | iso_pu_bacteria | 2885366525 | 2885367765 | 295 |
| 307 | iso_pu_bacteria | 2885374607 | 2885380887 | 295 |
| 308 | iso_pu_bacteria | 2885409591 | 2885418887 | 295 |
| 309 | iso_pu_bacteria | 2888378607 | 2888387231 | 295 |
| 310 | iso_pu_bacteria | 2888388044 | 2888389922 | 295 |
| 311 | iso_pu_bacteria | 2888419890 | 2888421179 | 295 |
| 312 | iso_pu_bacteria | 2889033259 | 2889036409 | 295 |
| 313 | iso_pu_bacteria | 2903727486 | 2903728401 | 295 |
| 314 | iso_pu_bacteria | 2903748898 | 2903756085 | 295 |
| 315 | iso_pu_bacteria | 2904666416 | 2904671506 | 295 |
| 316 | iso_pu_bacteria | 2904699407 | 2904707612 | 295 |
| 317 | iso_pu_bacteria | 2904711408 | 2904719806 | 295 |
| 318 | iso_pu_bacteria | 2906602504 | 2906606542 | 295 |
| 319 | iso_pu_bacteria | 2906610324 | 2906614610 | 295 |
| 320 | iso_pu_bacteria | 2906626472 | 2906631422 | 295 |
| 321 | iso_pu_bacteria | 2906635258 | 2906641981 | 295 |
| 322 | iso_pu_bacteria | 2906643746 | 2906650658 | 295 |
| 323 | iso_pu_bacteria | 2906660503 | 2906660933 | 295 |
| 324 | iso_pu_bacteria | 2908739725 | 2908746568 | 295 |
| 325 | iso_pu_bacteria | 2908775508 | 2908777219 | 295 |
| 326 | iso_pu_bacteria | 2922361189 | 2922366715 | 295 |
| 327 | iso_pu_bacteria | 2922368715 | 2922377410 | 295 |
| 328 | iso_pu_bacteria | 2922386360 | 2922389381 | 295 |
| 329 | iso_pu_bacteria | 2922393267 | 2922398499 | 295 |
| 330 | iso_pu_bacteria | 2922425934 | 2922426471 | 295 |
| 331 | iso_pu_bacteria | 2929615660 | 2929622198 | 295 |
| 332 | iso_pu_bacteria | 2929624759 | 2929630155 | 295 |
| 333 | iso_pu_bacteria | 2932784394 | 2932787916 | 295 |
| 334 | iso_pu_bacteria | 2932809354 | 2932817642 | 295 |
| 335 | iso_pu_bacteria | 2932818245 | 2932826198 | 295 |
| 336 | iso_pu_bacteria | 2932828146 | 2932835056 | 295 |
| 337 | iso_pu_bacteria | 2933577622 | 2933584187 | 295 |
| 338 | iso_pu_bacteria | 2935608549 | 2935614358 | 295 |
| 339 | iso_pu_bacteria | 2935616580 | 2935620433 | 295 |
| 340 | iso_pu_bacteria | 2935638405 | 2935640756 | 295 |
| 341 | iso_pu_bacteria | 2935648319 | 2935649387 | 295 |
| 342 | iso_pu_bacteria | 2935656913 | 2935657841 | 295 |
| 343 | iso_pu_bacteria | 2935665750 | 2935670259 | 295 |
| 344 | iso_pu_bacteria | 2935675223 | 2935679688 | 295 |
| 345 | iso_pu_bacteria | 2935684952 | 2935687257 | 295 |
| 346 | iso_pu_bacteria | 2935703347 | 2935709136 | 295 |
| 347 | iso_pu_bacteria | 2935713505 | 2935718716 | 295 |
| 348 | iso_pu_bacteria | 2935722832 | 2935728368 | 295 |
| 349 | iso_pu_bacteria | 2935732158 | 2935737035 | 295 |
| 350 | iso_pu_bacteria | 2935741537 | 2935745962 | 295 |
| 351 | iso_pu_bacteria | 2935750917 | 2935753223 | 295 |
| 352 | iso_pu_bacteria | 2935760218 | 2935766385 | 295 |
| 353 | iso_pu_bacteria | 2935769743 | 2935770222 | 295 |
| 354 | iso_pu_bacteria | 2935785616 | 2935786725 | 295 |
| 355 | iso_pu_bacteria | 2935801545 | 2935809065 | 295 |
| 356 | iso_pu_bacteria | 2935810662 | 2935813754 | 295 |
| 357 | iso_pu_bacteria | 2935819856 | 2935826576 | 295 |
| 358 | iso_pu_bacteria | 2935827899 | 2935832263 | 295 |
| 359 | iso_pu_bacteria | 2935837841 | 2935843968 | 295 |
| 360 | iso_pu_bacteria | 2935847175 | 2935851130 | 295 |
| 361 | iso_pu_bacteria | 2935855204 | 2935862759 | 295 |
| 362 | iso_pu_bacteria | 2935864058 | 2935864502 | 295 |
| 363 | iso_pu_bacteria | 2935873716 | 2935875146 | 295 |
| 364 | iso_pu_bacteria | 2935908558 | 2935913180 | 295 |
| 365 | iso_pu_bacteria | 2935926038 | 2935930895 | 295 |
| 366 | iso_pu_bacteria | 2935934488 | 2935939771 | 295 |
| 367 | iso_pu_bacteria | 2935942939 | 2935946720 | 295 |
| 368 | iso_pu_bacteria | 2935951376 | 2935956079 | 295 |
| 369 | iso_pu_bacteria | 2935959822 | 2935964983 | 295 |
| 370 | iso_pu_bacteria | 2935967501 | 2935972872 | 295 |
| 371 | iso_pu_bacteria | 2935975950 | 2935978213 | 295 |
| 372 | iso_pu_bacteria | 2935984226 | 2935985663 | 295 |
| 373 | iso_pu_bacteria | 2935992306 | 2935999235 | 295 |
| 374 | iso_pu_bacteria | 2936002035 | 2936005790 | 295 |
| 375 | iso_pu_bacteria | 2936011229 | 2936012060 | 295 |
| 376 | iso_pu_bacteria | 2936019824 | 2936020859 | 295 |
| 377 | iso_pu_bacteria | 2936028420 | 2936029353 | 295 |
| 378 | iso_pu_bacteria | 2936037263 | 2936039310 | 295 |
| 379 | iso_pu_bacteria | 2936046547 | 2936048323 | 295 |
| 380 | iso_pu_bacteria | 2936055302 | 2936056566 | 295 |
| 381 | iso_pu_bacteria | 2940556831 | 2940559136 | 295 |
| 382 | iso_pu_bacteria | 2941538514 | 2941541831 | 295 |
| 383 | iso_pu_bacteria | 3005474847 | 3005475813 | 295 |
| 384 | iso_pu_bacteria | 3005483717 | 3005491081 | 295 |
| 385 | iso_pu_bacteria | 3005506211 | 3005510922 | 295 |
| 386 | iso_pu_bacteria | 3005587118 | 3005592163 | 295 |
| 387 | iso_pu_bacteria | 3005594810 | 3005595876 | 295 |
| 388 | iso_pu_bacteria | 3005718088 | 3005719072 | 295 |
| 389 | iso_pu_bacteria | 8006926726 | 8006930186 | 295 |
| 390 | iso_pu_bacteria | 8006933436 | 8006937130 | 295 |
| 391 | iso_pu_bacteria | 8006964411 | 8006966309 | 295 |
| 392 | iso_pu_bacteria | 8006973647 | 8006977140 | 295 |
| 393 | iso_pu_bacteria | 8006984368 | 8006993123 | 295 |
| 394 | iso_pu_bacteria | 8006994254 | 8006996976 | 295 |
| 395 | iso_pu_bacteria | 8016511872 | 8016517251 | 295 |
| 396 | iso_pu_bacteria | 8016583857 | 8016585396 | 295 |
| 397 | iso_pu_bacteria | 8016630954 | 8016634875 | 295 |
| 398 | iso_pu_bacteria | 8017057580 | 8017059342 | 295 |
| 399 | iso_pu_bacteria | 8019555841 | 8019561527 | 295 |
| 400 | iso_pu_bacteria | 8019565922 | 8019571605 | 295 |
| 401 | iso_pu_bacteria | 8019576017 | 8019576283 | 295 |
| 402 | iso_pu_bacteria | 8019586578 | 8019594157 | 295 |
| 403 | iso_pu_bacteria | 8019597564 | 8019607406 | 295 |
| 404 | iso_pu_bacteria | 8019608314 | 8019611106 | 295 |
| 405 | iso_pu_bacteria | 8019619141 | 8019621953 | 295 |
| 406 | iso_pu_bacteria | 8019629233 | 8019631369 | 295 |
| 407 | iso_pu_bacteria | 8019648815 | 8019651394 | 295 |
| 408 | iso_pu_bacteria | 8019659431 | 8019668174 | 295 |
| 409 | iso_pu_bacteria | 8019668869 | 8019677636 | 295 |
| 410 | iso_pu_bacteria | 8019678201 | 8019687309 | 295 |
| 411 | iso_pu_bacteria | 8019687851 | 8019693288 | 295 |
| 412 | iso_pu_bacteria | 8055742211 | 8055743552 | 295 |
| 413 | iso_pu_bacteria | 8056673599 | 8056678163 | 295 |
| 414 | iso_pu_bacteria | 8056689827 | 8056690819 | 295 |
| 415 | iso_pu_bacteria | 8056967851 | 8056974153 | 295 |
| 416 | 3300006846 | Ga0075430_100001211 | Ga0075430_10000121127 | 296 |
| 417 | 3300009147 | Ga0114129_10096796 | Ga0114129_100967962 | 296 |
| 418 | 3300027876 | Ga0209974_10014756 | Ga0209974_100147562 | 296 |
| 419 | 3300038443 | Ga0395901_0004987 | Ga0395901_0004987_5221_6126 | 296 |
| 420 | 3300048924 | Ga0496121_0139347 | Ga0496121_0139347_686_1582 | 296 |
| 421 | 3300048929 | Ga0496126_0038680 | Ga0496126_0038680_3204_4100 | 296 |
| 422 | 3300049568 | Ga0501031_0337165 | Ga0501031_0337165_44_952 | 296 |
| 423 | 3300049569 | Ga0501032_0047385 | Ga0501032_0047385_640_1545 | 296 |
| 424 | 3300049570 | Ga0501033_0037424 | Ga0501033_0037424_1395_2300 | 296 |
| 425 | 3300049571 | Ga0501034_0116531 | Ga0501034_0116531_1423_2328 | 296 |
| 426 | 3300049572 | Ga0501036_0067709 | Ga0501036_0067709_259_1164 | 296 |
| 427 | 3300049572 | Ga0501036_0249882 | Ga0501036_0249882_59_967 | 296 |
| 428 | 3300049573 | Ga0501037_0081263 | Ga0501037_0081263_603_1511 | 296 |
| 429 | 3300049575 | Ga0501039_0148562 | Ga0501039_0148562_818_1726 | 296 |
| 430 | 3300049579 | Ga0501043_0127609 | Ga0501043_0127609_1076_1981 | 296 |
| 431 | 3300049581 | Ga0501047_0257601 | Ga0501047_0257601_605_1510 | 296 |
| 432 | 3300049589 | Ga0501073_0213612 | Ga0501073_0213612_281_1186 | 296 |
| 433 | 3300049742 | Ga0501080_0391339 | Ga0501080_0391339_310_1218 | 296 |
| 434 | 3300049744 | Ga0501083_0197123 | Ga0501083_0197123_257_1162 | 296 |
| 435 | 3300049822 | Ga0501035_0259529 | Ga0501035_0259529_510_1418 | 296 |
| 436 | 3300049822 | Ga0501035_0315098 | Ga0501035_0315098_226_1131 | 296 |
| 437 | 3300049823 | Ga0501044_0102936 | Ga0501044_0102936_1406_2311 | 296 |
| 438 | 3300049823 | Ga0501044_0340708 | Ga0501044_0340708_11_919 | 296 |
| 439 | 3300049823 | Ga0501044_0639664 | Ga0501044_0639664_35_943 | 296 |
| 440 | 3300050507 | nmdc:mga05p37_82451_c1 | nmdc:mga05p37_82451_c1_2590_3498 | 296 |
| 441 | 3300053096 | Ga0500641_0108360 | Ga0500641_0108360_191_1153 | 296 |
| 442 | 3300053730 | Ga0500645_067292 | Ga0500645_067292_82_990 | 296 |
| 443 | 3300005327 | Ga0070658_10259088 | Ga0070658_102590882 | 297 |
| 444 | 3300005336 | Ga0070680_100090696 | Ga0070680_1000906963 | 297 |
| 445 | 3300005535 | Ga0070684_100417812 | Ga0070684_1004178121 | 297 |
| 446 | 3300005539 | Ga0068853_100040910 | Ga0068853_1000409103 | 297 |
| 447 | 3300005563 | Ga0068855_100325986 | Ga0068855_1003259861 | 297 |
| 448 | 3300005564 | Ga0070664_100311354 | Ga0070664_1003113542 | 297 |
| 449 | 3300005616 | Ga0068852_100184337 | Ga0068852_1001843372 | 297 |
| 450 | 3300005937 | Ga0081455_10192346 | Ga0081455_101923462 | 297 |
| 451 | 3300009177 | Ga0105248_10570825 | Ga0105248_105708251 | 297 |
| 452 | 3300009545 | Ga0105237_10044776 | Ga0105237_100447762 | 297 |
| 453 | 3300009551 | Ga0105238_10154023 | Ga0105238_101540232 | 297 |
| 454 | 3300010375 | Ga0105239_10189719 | Ga0105239_101897193 | 297 |
| 455 | 3300013105 | Ga0157369_10125716 | Ga0157369_101257162 | 297 |
| 456 | 3300013297 | Ga0157378_10078348 | Ga0157378_100783482 | 297 |
| 457 | 3300020081 | Ga0206354_10107649 | Ga0206354_101076491 | 297 |
| 458 | 3300025912 | Ga0207707_10002207 | Ga0207707_100022072 | 297 |
| 459 | 3300025917 | Ga0207660_10016126 | Ga0207660_100161262 | 297 |
| 460 | 3300025919 | Ga0207657_10033356 | Ga0207657_100333562 | 297 |
| 461 | 3300025921 | Ga0207652_10161285 | Ga0207652_101612852 | 297 |
| 462 | 3300025924 | Ga0207694_10105389 | Ga0207694_101053892 | 297 |
| 463 | 3300026041 | Ga0207639_10042056 | Ga0207639_100420562 | 297 |
| 464 | 3300026116 | Ga0207674_10227285 | Ga0207674_102272852 | 297 |
| 465 | 3300031616 | Ga0307508_10033210 | Ga0307508_100332103 | 297 |
| 466 | 3300031712 | Ga0265342_10077453 | Ga0265342_100774532 | 297 |
| 467 | 3300031730 | Ga0307516_10293693 | Ga0307516_102936931 | 297 |
| 468 | 3300039437 | Ga0436365_1105753 | Ga0436365_1105753_559_1467 | 297 |
| 469 | 3300039437 | Ga0436365_1866057 | Ga0436365_1866057_456_1364 | 297 |
| 470 | 3300046459 | Ga0495629_0252001 | Ga0495629_0252001_45_950 | 297 |
| 471 | 3300047320 | Ga0495672_0081822 | Ga0495672_0081822_637_1566 | 297 |
| 472 | 3300048917 | Ga0496114_0206620 | Ga0496114_0206620_755_1663 | 297 |
| 473 | 3300048918 | Ga0496115_0022325 | Ga0496115_0022325_2611_3534 | 297 |
| 474 | 3300048918 | Ga0496115_0253433 | Ga0496115_0253433_468_1376 | 297 |
| 475 | 3300048925 | Ga0496122_0045370 | Ga0496122_0045370_1800_2801 | 297 |
| 476 | 3300048929 | Ga0496126_0035603 | Ga0496126_0035603_656_1567 | 297 |
| 477 | 3300049571 | Ga0501034_0090938 | Ga0501034_0090938_147_1058 | 297 |
| 478 | 3300049574 | Ga0501038_0283264 | Ga0501038_0283264_294_1205 | 297 |
| 479 | 3300049579 | Ga0501043_0173428 | Ga0501043_0173428_612_1523 | 297 |
| 480 | 3300049580 | Ga0501046_0230322 | Ga0501046_0230322_299_1210 | 297 |
| 481 | 3300049581 | Ga0501047_0212578 | Ga0501047_0212578_149_1060 | 297 |
| 482 | 3300049586 | Ga0501070_0216100 | Ga0501070_0216100_207_1118 | 297 |
| 483 | 3300049822 | Ga0501035_0158389 | Ga0501035_0158389_870_1781 | 297 |
| 484 | 3300049823 | Ga0501044_0091107 | Ga0501044_0091107_384_1295 | 297 |
| 485 | 3300049823 | Ga0501044_0481657 | Ga0501044_0481657_13_924 | 297 |
| 486 | 3300053094 | Ga0500566_0003454 | Ga0500566_0003454_6381_7286 | 297 |
| 487 | 3300053095 | Ga0500640_000302 | Ga0500640_000302_1764_2669 | 297 |
| 488 | 3300053111 | Ga0500572_001002 | Ga0500572_001002_1313_2218 | 297 |
| 489 | 3300053122 | Ga0500608_024516 | Ga0500608_024516_10_915 | 297 |
| 490 | 3300053123 | Ga0500614_004103 | Ga0500614_004103_1359_2264 | 297 |
| 491 | 3300053136 | Ga0500559_0086393 | Ga0500559_0086393_44_949 | 297 |
| 492 | 3300053150 | Ga0500603_000366 | Ga0500603_000366_20_925 | 297 |
| 493 | 3300053159 | Ga0500630_000365 | Ga0500630_000365_16512_17417 | 297 |
| 494 | 3300053163 | Ga0500639_000031 | Ga0500639_000031_36563_37468 | 297 |
| 495 | 3300053735 | Ga0500596_001156 | Ga0500596_001156_2920_3825 | 297 |
| 496 | 3300053737 | Ga0500601_001193 | Ga0500601_001193_493_1398 | 297 |
| 497 | 3300059424 | Ga0590075_031381 | Ga0590075_031381_276_1181 | 297 |
| 498 | iso_pu_bacteria | 2935793552 | 2935794779 | 297 |
| 499 | iso_pu_bacteria | 2935916978 | 2935922602 | 297 |
| 500 | iso_pu_bacteria | 8019638758 | 8019639247 | 297 |
| 501 | 3300001979 | JGI24740J21852_10005937 | JGI24740J21852_100059373 | 298 |
| 502 | 3300005327 | Ga0070658_10076839 | Ga0070658_100768392 | 298 |
| 503 | 3300005336 | Ga0070680_100064099 | Ga0070680_1000640993 | 298 |
| 504 | 3300005434 | Ga0070709_10011241 | Ga0070709_100112412 | 298 |
| 505 | 3300005436 | Ga0070713_100064957 | Ga0070713_1000649572 | 298 |
| 506 | 3300005437 | Ga0070710_10119090 | Ga0070710_101190902 | 298 |
| 507 | 3300005439 | Ga0070711_100031695 | Ga0070711_1000316952 | 298 |
| 508 | 3300005455 | Ga0070663_100036700 | Ga0070663_1000367002 | 298 |
| 509 | 3300005455 | Ga0070663_100043179 | Ga0070663_1000431792 | 298 |
| 510 | 3300005458 | Ga0070681_10045404 | Ga0070681_100454042 | 298 |
| 511 | 3300005530 | Ga0070679_100128586 | Ga0070679_1001285861 | 298 |
| 512 | 3300005539 | Ga0068853_100032830 | Ga0068853_1000328304 | 298 |
| 513 | 3300005563 | Ga0068855_100103075 | Ga0068855_1001030751 | 298 |
| 514 | 3300005563 | Ga0068855_100189821 | Ga0068855_1001898211 | 298 |
| 515 | 3300005563 | Ga0068855_100203952 | Ga0068855_1002039522 | 298 |
| 516 | 3300005563 | Ga0068855_100689100 | Ga0068855_1006891001 | 298 |
| 517 | 3300005563 | Ga0068855_100692157 | Ga0068855_1006921571 | 298 |
| 518 | 3300005577 | Ga0068857_100023618 | Ga0068857_1000236181 | 298 |
| 519 | 3300005577 | Ga0068857_100039537 | Ga0068857_1000395372 | 298 |
| 520 | 3300005578 | Ga0068854_100327352 | Ga0068854_1003273521 | 298 |
| 521 | 3300005578 | Ga0068854_100352193 | Ga0068854_1003521931 | 298 |
| 522 | 3300005614 | Ga0068856_100402031 | Ga0068856_1004020311 | 298 |
| 523 | 3300005616 | Ga0068852_100257164 | Ga0068852_1002571642 | 298 |
| 524 | 3300005834 | Ga0068851_10062866 | Ga0068851_100628661 | 298 |
| 525 | 3300005841 | Ga0068863_100142726 | Ga0068863_1001427261 | 298 |
| 526 | 3300005937 | Ga0081455_10040385 | Ga0081455_100403852 | 298 |
| 527 | 3300006028 | Ga0070717_10086716 | Ga0070717_100867162 | 298 |
| 528 | 3300006175 | Ga0070712_100011969 | Ga0070712_1000119692 | 298 |
| 529 | 3300006177 | Ga0075362_10034532 | Ga0075362_100345322 | 298 |
| 530 | 3300006178 | Ga0075367_10001616 | Ga0075367_100016165 | 298 |
| 531 | 3300006871 | Ga0075434_100118645 | Ga0075434_1001186452 | 298 |
| 532 | 3300009093 | Ga0105240_10069358 | Ga0105240_100693584 | 298 |
| 533 | 3300009093 | Ga0105240_10274693 | Ga0105240_102746932 | 298 |
| 534 | 3300009093 | Ga0105240_10818469 | Ga0105240_108184691 | 298 |
| 535 | 3300009101 | Ga0105247_10169366 | Ga0105247_101693662 | 298 |
| 536 | 3300009174 | Ga0105241_10001280 | Ga0105241_100012808 | 298 |
| 537 | 3300009545 | Ga0105237_10081375 | Ga0105237_100813752 | 298 |
| 538 | 3300009551 | Ga0105238_10044002 | Ga0105238_100440021 | 298 |
| 539 | 3300009551 | Ga0105238_10079710 | Ga0105238_100797103 | 298 |
| 540 | 3300009551 | Ga0105238_10159077 | Ga0105238_101590772 | 298 |
| 541 | 3300009551 | Ga0105238_10318790 | Ga0105238_103187901 | 298 |
| 542 | 3300010375 | Ga0105239_10054114 | Ga0105239_100541144 | 298 |
| 543 | 3300010375 | Ga0105239_10336405 | Ga0105239_103364052 | 298 |
| 544 | 3300010375 | Ga0105239_10870780 | Ga0105239_108707801 | 298 |
| 545 | 3300013104 | Ga0157370_10040880 | Ga0157370_100408802 | 298 |
| 546 | 3300013105 | Ga0157369_10092109 | Ga0157369_100921092 | 298 |
| 547 | 3300013307 | Ga0157372_10100045 | Ga0157372_101000452 | 298 |
| 548 | 3300021358 | Ga0213873_10005563 | Ga0213873_100055632 | 298 |
| 549 | 3300021384 | Ga0213876_10008294 | Ga0213876_100082942 | 298 |
| 550 | 3300025297 | Ga0209758_1018003 | Ga0209758_10180032 | 298 |
| 551 | 3300025321 | Ga0207656_10005846 | Ga0207656_100058462 | 298 |
| 552 | 3300025898 | Ga0207692_10010497 | Ga0207692_100104974 | 298 |
| 553 | 3300025900 | Ga0207710_10148545 | Ga0207710_101485451 | 298 |
| 554 | 3300025904 | Ga0207647_10005671 | Ga0207647_100056712 | 298 |
| 555 | 3300025909 | Ga0207705_10086337 | Ga0207705_100863372 | 298 |
| 556 | 3300025909 | Ga0207705_10150930 | Ga0207705_101509301 | 298 |
| 557 | 3300025911 | Ga0207654_10000153 | Ga0207654_100001533 | 298 |
| 558 | 3300025912 | Ga0207707_10102350 | Ga0207707_101023502 | 298 |
| 559 | 3300025913 | Ga0207695_10000506 | Ga0207695_1000050675 | 298 |
| 560 | 3300025913 | Ga0207695_10051564 | Ga0207695_100515641 | 298 |
| 561 | 3300025913 | Ga0207695_10223007 | Ga0207695_102230071 | 298 |
| 562 | 3300025914 | Ga0207671_10331817 | Ga0207671_103318172 | 298 |
| 563 | 3300025915 | Ga0207693_10010845 | Ga0207693_100108452 | 298 |
| 564 | 3300025916 | Ga0207663_10014563 | Ga0207663_100145632 | 298 |
| 565 | 3300025917 | Ga0207660_10149483 | Ga0207660_101494831 | 298 |
| 566 | 3300025919 | Ga0207657_10046782 | Ga0207657_100467822 | 298 |
| 567 | 3300025921 | Ga0207652_10084447 | Ga0207652_100844472 | 298 |
| 568 | 3300025921 | Ga0207652_10154142 | Ga0207652_101541421 | 298 |
| 569 | 3300025924 | Ga0207694_10003910 | Ga0207694_100039104 | 298 |
| 570 | 3300025924 | Ga0207694_10220145 | Ga0207694_102201452 | 298 |
| 571 | 3300025928 | Ga0207700_10078852 | Ga0207700_100788521 | 298 |
| 572 | 3300025933 | Ga0207706_10062550 | Ga0207706_100625502 | 298 |
| 573 | 3300025949 | Ga0207667_10030376 | Ga0207667_100303763 | 298 |
| 574 | 3300025949 | Ga0207667_10104674 | Ga0207667_101046742 | 298 |
| 575 | 3300025949 | Ga0207667_10332027 | Ga0207667_103320271 | 298 |
| 576 | 3300025981 | Ga0207640_10134907 | Ga0207640_101349071 | 298 |
| 577 | 3300026041 | Ga0207639_10024622 | Ga0207639_100246222 | 298 |
| 578 | 3300026067 | Ga0207678_10022600 | Ga0207678_100226002 | 298 |
| 579 | 3300026078 | Ga0207702_10000006 | Ga0207702_10000006290 | 298 |
| 580 | 3300026078 | Ga0207702_10481793 | Ga0207702_104817931 | 298 |
| 581 | 3300026088 | Ga0207641_10193115 | Ga0207641_101931151 | 298 |
| 582 | 3300026116 | Ga0207674_10048571 | Ga0207674_100485714 | 298 |
| 583 | 3300026116 | Ga0207674_10048718 | Ga0207674_100487181 | 298 |
| 584 | 3300026142 | Ga0207698_10045959 | Ga0207698_100459593 | 298 |
| 585 | 3300028379 | Ga0268266_10188768 | Ga0268266_101887682 | 298 |
| 586 | 3300028577 | Ga0265318_10007950 | Ga0265318_100079504 | 298 |
| 587 | 3300030521 | Ga0307511_10080843 | Ga0307511_100808431 | 298 |
| 588 | 3300031238 | Ga0265332_10040115 | Ga0265332_100401152 | 298 |
| 589 | 3300031247 | Ga0265340_10001799 | Ga0265340_100017995 | 298 |
| 590 | 3300031247 | Ga0265340_10013333 | Ga0265340_100133332 | 298 |
| 591 | 3300031247 | Ga0265340_10068245 | Ga0265340_100682453 | 298 |
| 592 | 3300031249 | Ga0265339_10009279 | Ga0265339_100092794 | 298 |
| 593 | 3300031249 | Ga0265339_10116126 | Ga0265339_101161261 | 298 |
| 594 | 3300031250 | Ga0265331_10130344 | Ga0265331_101303442 | 298 |
| 595 | 3300031344 | Ga0265316_10012755 | Ga0265316_100127553 | 298 |
| 596 | 3300031595 | Ga0265313_10001560 | Ga0265313_1000156015 | 298 |
| 597 | 3300031595 | Ga0265313_10023598 | Ga0265313_100235984 | 298 |
| 598 | 3300031595 | Ga0265313_10107458 | Ga0265313_101074582 | 298 |
| 599 | 3300031711 | Ga0265314_10023091 | Ga0265314_100230911 | 298 |
| 600 | 3300031712 | Ga0265342_10002764 | Ga0265342_100027648 | 298 |
| 601 | 3300031730 | Ga0307516_10014001 | Ga0307516_100140013 | 298 |
| 602 | 3300035692 | Ga0373935_0069494 | Ga0373935_0069494_908_1813 | 298 |
| 603 | 3300035695 | Ga0373927_0038128 | Ga0373927_0038128_1020_1925 | 298 |
| 604 | 3300035724 | Ga0373933_0000267 | Ga0373933_0000267_20418_21329 | 298 |
| 605 | 3300036401 | Ga0373937_0046803 | Ga0373937_0046803_1768_2682 | 298 |
| 606 | 3300037068 | Ga0373925_0117043 | Ga0373925_0117043_560_1465 | 298 |
| 607 | 3300037466 | Ga0395898_0091016 | Ga0395898_0091016_434_1342 | 298 |
| 608 | 3300039450 | Ga0436363_0613006 | Ga0436363_0613006_69_977 | 298 |
| 609 | 3300039453 | Ga0436362_0376169 | Ga0436362_0376169_1084_1992 | 298 |
| 610 | 3300046459 | Ga0495629_0026160 | Ga0495629_0026160_2720_3646 | 298 |
| 611 | 3300046462 | Ga0495651_0217048 | Ga0495651_0217048_292_1218 | 298 |
| 612 | 3300046499 | Ga0495594_0232899 | Ga0495594_0232899_103_1029 | 298 |
| 613 | 3300046507 | Ga0495606_0109676 | Ga0495606_0109676_466_1392 | 298 |
| 614 | 3300046524 | Ga0495648_0040614 | Ga0495648_0040614_1617_2543 | 298 |
| 615 | 3300046557 | Ga0495622_0066030 | Ga0495622_0066030_137_1063 | 298 |
| 616 | 3300046660 | Ga0495625_0161696 | Ga0495625_0161696_443_1369 | 298 |
| 617 | 3300046680 | Ga0495646_0142601 | Ga0495646_0142601_227_1153 | 298 |
| 618 | 3300046689 | Ga0495613_0162765 | Ga0495613_0162765_577_1482 | 298 |
| 619 | 3300046690 | Ga0495624_0019074 | Ga0495624_0019074_3559_4485 | 298 |
| 620 | 3300046694 | Ga0495649_0042903 | Ga0495649_0042903_773_1699 | 298 |
| 621 | 3300047315 | Ga0495581_0067552 | Ga0495581_0067552_33_959 | 298 |
| 622 | 3300047317 | Ga0495604_0057670 | Ga0495604_0057670_413_1339 | 298 |
| 623 | 3300048908 | Ga0496105_0026827 | Ga0496105_0026827_2171_3097 | 298 |
| 624 | 3300048909 | Ga0496106_0011816 | Ga0496106_0011816_28_933 | 298 |
| 625 | 3300048919 | Ga0496116_0105397 | Ga0496116_0105397_729_1634 | 298 |
| 626 | 3300048920 | Ga0496117_0091379 | Ga0496117_0091379_160_1065 | 298 |
| 627 | 3300048921 | Ga0496118_0022933 | Ga0496118_0022933_187_1092 | 298 |
| 628 | 3300048922 | Ga0496119_0007315 | Ga0496119_0007315_891_1817 | 298 |
| 629 | 3300048923 | Ga0496120_0002476 | Ga0496120_0002476_14994_15920 | 298 |
| 630 | 3300048924 | Ga0496121_0004663 | Ga0496121_0004663_13353_14258 | 298 |
| 631 | 3300048927 | Ga0496124_0005242 | Ga0496124_0005242_9798_10703 | 298 |
| 632 | 3300048928 | Ga0496125_0056873 | Ga0496125_0056873_526_1452 | 298 |
| 633 | 3300048929 | Ga0496126_0090551 | Ga0496126_0090551_1762_2667 | 298 |
| 634 | 3300048929 | Ga0496126_0327476 | Ga0496126_0327476_309_1223 | 298 |
| 635 | 3300049579 | Ga0501043_0137677 | Ga0501043_0137677_813_1733 | 298 |
| 636 | 3300049581 | Ga0501047_0086369 | Ga0501047_0086369_609_1532 | 298 |
| 637 | 3300049586 | Ga0501070_0111307 | Ga0501070_0111307_1000_1920 | 298 |
| 638 | 3300049590 | Ga0501074_0148134 | Ga0501074_0148134_172_1092 | 298 |
| 639 | 3300049742 | Ga0501080_0070063 | Ga0501080_0070063_601_1524 | 298 |
| 640 | 3300049744 | Ga0501083_0143614 | Ga0501083_0143614_451_1356 | 298 |
| 641 | 3300049822 | Ga0501035_0088492 | Ga0501035_0088492_1119_2039 | 298 |
| 642 | 3300049823 | Ga0501044_0237579 | Ga0501044_0237579_649_1569 | 298 |
| 643 | 3300050491 | nmdc:mga00v17_9796_c1 | nmdc:mga00v17_9796_c1_664_1584 | 298 |
| 644 | 3300050492 | nmdc:mga0yw44_247952_c1 | nmdc:mga0yw44_247952_c1_189_1109 | 298 |
| 645 | 3300050494 | nmdc:mga06z11_18945_c1 | nmdc:mga06z11_18945_c1_1570_2490 | 298 |
| 646 | 3300050494 | nmdc:mga06z11_3865_c1 | nmdc:mga06z11_3865_c1_1276_2196 | 298 |
| 647 | 3300050495 | nmdc:mga04h51_32126_c1 | nmdc:mga04h51_32126_c1_435_1355 | 298 |
| 648 | 3300050512 | nmdc:mga0n895_357174_c1 | nmdc:mga0n895_357174_c1_108_1019 | 298 |
| 649 | 3300050514 | nmdc:mga08x19_113613_c1 | nmdc:mga08x19_113613_c1_249_1160 | 298 |
| 650 | 3300053119 | Ga0500595_011798 | Ga0500595_011798_1245_2171 | 298 |
| 651 | 3300053153 | Ga0500616_0013923 | Ga0500616_0013923_998_1897 | 298 |
| 652 | 3300053177 | Ga0500636_0130196 | Ga0500636_0130196_431_1336 | 298 |
| 653 | 3300054114 | Ga0501084_0073495 | Ga0501084_0073495_317_1222 | 298 |
| 654 | 3300060353 | Ga0501082_0315271 | Ga0501082_0315271_232_1137 | 298 |
| 655 | 3300003215 | JGI25153J46596_10003697 | JGI25153J46596_100036972 | 299 |
| 656 | 3300003215 | JGI25153J46596_10008046 | JGI25153J46596_100080463 | 299 |
| 657 | 3300003354 | JGI25160J50197_1007198 | JGI25160J50197_10071982 | 299 |
| 658 | 3300005262 | Ga0065165_1000982 | Ga0065165_10009822 | 299 |
| 659 | 3300005262 | Ga0065165_1007672 | Ga0065165_10076723 | 299 |
| 660 | 3300005262 | Ga0065165_1008445 | Ga0065165_10084453 | 299 |
| 661 | 3300005327 | Ga0070658_10117782 | Ga0070658_101177822 | 299 |
| 662 | 3300005334 | Ga0068869_100023869 | Ga0068869_1000238693 | 299 |
| 663 | 3300005335 | Ga0070666_10365109 | Ga0070666_103651091 | 299 |
| 664 | 3300005336 | Ga0070680_100016577 | Ga0070680_1000165777 | 299 |
| 665 | 3300005338 | Ga0068868_100081641 | Ga0068868_1000816412 | 299 |
| 666 | 3300005347 | Ga0070668_100452132 | Ga0070668_1004521321 | 299 |
| 667 | 3300005353 | Ga0070669_100082025 | Ga0070669_1000820252 | 299 |
| 668 | 3300005355 | Ga0070671_100044664 | Ga0070671_1000446642 | 299 |
| 669 | 3300005356 | Ga0070674_100165878 | Ga0070674_1001658782 | 299 |
| 670 | 3300005367 | Ga0070667_100095986 | Ga0070667_1000959861 | 299 |
| 671 | 3300005367 | Ga0070667_100339293 | Ga0070667_1003392931 | 299 |
| 672 | 3300005434 | Ga0070709_10002283 | Ga0070709_100022836 | 299 |
| 673 | 3300005434 | Ga0070709_10008203 | Ga0070709_100082032 | 299 |
| 674 | 3300005435 | Ga0070714_100039738 | Ga0070714_1000397384 | 299 |
| 675 | 3300005435 | Ga0070714_100043482 | Ga0070714_1000434823 | 299 |
| 676 | 3300005435 | Ga0070714_100049678 | Ga0070714_1000496782 | 299 |
| 677 | 3300005435 | Ga0070714_100195587 | Ga0070714_1001955871 | 299 |
| 678 | 3300005436 | Ga0070713_100022749 | Ga0070713_1000227492 | 299 |
| 679 | 3300005436 | Ga0070713_100028352 | Ga0070713_1000283522 | 299 |
| 680 | 3300005436 | Ga0070713_100060987 | Ga0070713_1000609872 | 299 |
| 681 | 3300005437 | Ga0070710_10013667 | Ga0070710_100136671 | 299 |
| 682 | 3300005439 | Ga0070711_100010498 | Ga0070711_1000104982 | 299 |
| 683 | 3300005439 | Ga0070711_100079939 | Ga0070711_1000799392 | 299 |
| 684 | 3300005439 | Ga0070711_100213146 | Ga0070711_1002131461 | 299 |
| 685 | 3300005439 | Ga0070711_100307913 | Ga0070711_1003079132 | 299 |
| 686 | 3300005440 | Ga0070705_100034239 | Ga0070705_1000342392 | 299 |
| 687 | 3300005455 | Ga0070663_100028428 | Ga0070663_1000284282 | 299 |
| 688 | 3300005455 | Ga0070663_100029515 | Ga0070663_1000295152 | 299 |
| 689 | 3300005455 | Ga0070663_100075766 | Ga0070663_1000757662 | 299 |
| 690 | 3300005455 | Ga0070663_100115270 | Ga0070663_1001152702 | 299 |
| 691 | 3300005456 | Ga0070678_100106325 | Ga0070678_1001063252 | 299 |
| 692 | 3300005456 | Ga0070678_100259963 | Ga0070678_1002599632 | 299 |
| 693 | 3300005457 | Ga0070662_100195321 | Ga0070662_1001953212 | 299 |
| 694 | 3300005458 | Ga0070681_10058848 | Ga0070681_100588482 | 299 |
| 695 | 3300005458 | Ga0070681_10080697 | Ga0070681_100806972 | 299 |
| 696 | 3300005459 | Ga0068867_100493130 | Ga0068867_1004931301 | 299 |
| 697 | 3300005468 | Ga0070707_100054763 | Ga0070707_1000547632 | 299 |
| 698 | 3300005518 | Ga0070699_100237581 | Ga0070699_1002375811 | 299 |
| 699 | 3300005530 | Ga0070679_100091315 | Ga0070679_1000913152 | 299 |
| 700 | 3300005535 | Ga0070684_100065197 | Ga0070684_1000651973 | 299 |
| 701 | 3300005536 | Ga0070697_100103757 | Ga0070697_1001037572 | 299 |
| 702 | 3300005548 | Ga0070665_100012864 | Ga0070665_1000128647 | 299 |
| 703 | 3300005548 | Ga0070665_100057373 | Ga0070665_1000573732 | 299 |
| 704 | 3300005548 | Ga0070665_100102558 | Ga0070665_1001025582 | 299 |
| 705 | 3300005548 | Ga0070665_100176149 | Ga0070665_1001761492 | 299 |
| 706 | 3300005548 | Ga0070665_100306449 | Ga0070665_1003064492 | 299 |
| 707 | 3300005563 | Ga0068855_100117639 | Ga0068855_1001176392 | 299 |
| 708 | 3300005614 | Ga0068856_100000137 | Ga0068856_10000013756 | 299 |
| 709 | 3300005614 | Ga0068856_100222278 | Ga0068856_1002222782 | 299 |
| 710 | 3300005616 | Ga0068852_100010212 | Ga0068852_1000102122 | 299 |
| 711 | 3300005616 | Ga0068852_100790806 | Ga0068852_1007908061 | 299 |
| 712 | 3300005617 | Ga0068859_100179390 | Ga0068859_1001793902 | 299 |
| 713 | 3300005618 | Ga0068864_100509629 | Ga0068864_1005096291 | 299 |
| 714 | 3300005719 | Ga0068861_100147039 | Ga0068861_1001470392 | 299 |
| 715 | 3300005842 | Ga0068858_100086107 | Ga0068858_1000861071 | 299 |
| 716 | 3300005842 | Ga0068858_100320806 | Ga0068858_1003208061 | 299 |
| 717 | 3300005937 | Ga0081455_10011276 | Ga0081455_100112764 | 299 |
| 718 | 3300005937 | Ga0081455_10013423 | Ga0081455_100134237 | 299 |
| 719 | 3300005937 | Ga0081455_10032605 | Ga0081455_100326053 | 299 |
| 720 | 3300005937 | Ga0081455_10051423 | Ga0081455_100514232 | 299 |
| 721 | 3300005937 | Ga0081455_10072405 | Ga0081455_100724052 | 299 |
| 722 | 3300005981 | Ga0081538_10016354 | Ga0081538_100163542 | 299 |
| 723 | 3300005983 | Ga0081540_1002034 | Ga0081540_10020349 | 299 |
| 724 | 3300005983 | Ga0081540_1007800 | Ga0081540_10078002 | 299 |
| 725 | 3300005983 | Ga0081540_1008423 | Ga0081540_10084236 | 299 |
| 726 | 3300005983 | Ga0081540_1012078 | Ga0081540_10120784 | 299 |
| 727 | 3300005983 | Ga0081540_1020975 | Ga0081540_10209752 | 299 |
| 728 | 3300005983 | Ga0081540_1023647 | Ga0081540_10236473 | 299 |
| 729 | 3300005983 | Ga0081540_1074654 | Ga0081540_10746542 | 299 |
| 730 | 3300005985 | Ga0081539_10000157 | Ga0081539_1000015717 | 299 |
| 731 | 3300005985 | Ga0081539_10006006 | Ga0081539_100060069 | 299 |
| 732 | 3300006028 | Ga0070717_10017655 | Ga0070717_100176556 | 299 |
| 733 | 3300006028 | Ga0070717_10148538 | Ga0070717_101485382 | 299 |
| 734 | 3300006038 | Ga0075365_10040902 | Ga0075365_100409022 | 299 |
| 735 | 3300006038 | Ga0075365_10211007 | Ga0075365_102110071 | 299 |
| 736 | 3300006042 | Ga0075368_10026242 | Ga0075368_100262422 | 299 |
| 737 | 3300006042 | Ga0075368_10028787 | Ga0075368_100287872 | 299 |
| 738 | 3300006048 | Ga0075363_100012694 | Ga0075363_1000126942 | 299 |
| 739 | 3300006048 | Ga0075363_100082248 | Ga0075363_1000822482 | 299 |
| 740 | 3300006051 | Ga0075364_10092981 | Ga0075364_100929812 | 299 |
| 741 | 3300006163 | Ga0070715_10001709 | Ga0070715_100017092 | 299 |
| 742 | 3300006173 | Ga0070716_100021483 | Ga0070716_1000214832 | 299 |
| 743 | 3300006173 | Ga0070716_100043557 | Ga0070716_1000435572 | 299 |
| 744 | 3300006175 | Ga0070712_100038281 | Ga0070712_1000382812 | 299 |
| 745 | 3300006178 | Ga0075367_10089947 | Ga0075367_100899472 | 299 |
| 746 | 3300006178 | Ga0075367_10112997 | Ga0075367_101129971 | 299 |
| 747 | 3300006195 | Ga0075366_10093184 | Ga0075366_100931842 | 299 |
| 748 | 3300006195 | Ga0075366_10139845 | Ga0075366_101398451 | 299 |
| 749 | 3300006195 | Ga0075366_10233697 | Ga0075366_102336972 | 299 |
| 750 | 3300006237 | Ga0097621_100117702 | Ga0097621_1001177021 | 299 |
| 751 | 3300006353 | Ga0075370_10069232 | Ga0075370_100692322 | 299 |
| 752 | 3300006353 | Ga0075370_10159241 | Ga0075370_101592411 | 299 |
| 753 | 3300006931 | Ga0097620_100179389 | Ga0097620_1001793892 | 299 |
| 754 | 3300006942 | Ga0099824_1008492 | Ga0099824_10084926 | 299 |
| 755 | 3300006943 | Ga0099822_1002961 | Ga0099822_10029612 | 299 |
| 756 | 3300007788 | Ga0099795_10064606 | Ga0099795_100646061 | 299 |
| 757 | 3300009011 | Ga0105251_10170334 | Ga0105251_101703341 | 299 |
| 758 | 3300009093 | Ga0105240_10012243 | Ga0105240_100122436 | 299 |
| 759 | 3300009093 | Ga0105240_10027631 | Ga0105240_100276313 | 299 |
| 760 | 3300009093 | Ga0105240_10228286 | Ga0105240_102282862 | 299 |
| 761 | 3300009093 | Ga0105240_10478354 | Ga0105240_104783541 | 299 |
| 762 | 3300009094 | Ga0111539_10653200 | Ga0111539_106532001 | 299 |
| 763 | 3300009098 | Ga0105245_10189222 | Ga0105245_101892222 | 299 |
| 764 | 3300009101 | Ga0105247_10434623 | Ga0105247_104346231 | 299 |
| 765 | 3300009148 | Ga0105243_10154406 | Ga0105243_101544062 | 299 |
| 766 | 3300009174 | Ga0105241_10030510 | Ga0105241_100305102 | 299 |
| 767 | 3300009177 | Ga0105248_10036476 | Ga0105248_100364762 | 299 |
| 768 | 3300009177 | Ga0105248_10275012 | Ga0105248_102750122 | 299 |
| 769 | 3300009545 | Ga0105237_10095015 | Ga0105237_100950152 | 299 |
| 770 | 3300009545 | Ga0105237_10122555 | Ga0105237_101225552 | 299 |
| 771 | 3300010375 | Ga0105239_10203284 | Ga0105239_102032842 | 299 |
| 772 | 3300010375 | Ga0105239_10241536 | Ga0105239_102415362 | 299 |
| 773 | 3300010375 | Ga0105239_10298975 | Ga0105239_102989752 | 299 |
| 774 | 3300010375 | Ga0105239_10415914 | Ga0105239_104159141 | 299 |
| 775 | 3300011119 | Ga0105246_10254899 | Ga0105246_102548992 | 299 |
| 776 | 3300012508 | Ga0157315_1001210 | Ga0157315_10012102 | 299 |
| 777 | 3300013105 | Ga0157369_10025909 | Ga0157369_100259092 | 299 |
| 778 | 3300013105 | Ga0157369_10127447 | Ga0157369_101274472 | 299 |
| 779 | 3300013307 | Ga0157372_10326812 | Ga0157372_103268122 | 299 |
| 780 | 3300013308 | Ga0157375_10055890 | Ga0157375_100558901 | 299 |
| 781 | 3300013308 | Ga0157375_10201235 | Ga0157375_102012352 | 299 |
| 782 | 3300014325 | Ga0163163_10031448 | Ga0163163_100314482 | 299 |
| 783 | 3300014325 | Ga0163163_10142581 | Ga0163163_101425812 | 299 |
| 784 | 3300014325 | Ga0163163_10302245 | Ga0163163_103022452 | 299 |
| 785 | 3300014969 | Ga0157376_10022471 | Ga0157376_100224715 | 299 |
| 786 | 3300021320 | Ga0214544_1000011 | Ga0214544_1000011119 | 299 |
| 787 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009123 | 299 |
| 788 | 3300021324 | Ga0214545_1000007 | Ga0214545_1000007119 | 299 |
| 789 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020123 | 299 |
| 790 | 3300021384 | Ga0213876_10078985 | Ga0213876_100789851 | 299 |
| 791 | 3300025230 | Ga0209563_103792 | Ga0209563_1037922 | 299 |
| 792 | 3300025253 | Ga0209677_102183 | Ga0209677_1021832 | 299 |
| 793 | 3300025254 | Ga0209148_1000321 | Ga0209148_100032115 | 299 |
| 794 | 3300025261 | Ga0209233_1000907 | Ga0209233_10009079 | 299 |
| 795 | 3300025261 | Ga0209233_1008907 | Ga0209233_10089073 | 299 |
| 796 | 3300025272 | Ga0209455_1000807 | Ga0209455_10008072 | 299 |
| 797 | 3300025295 | Ga0209564_1031051 | Ga0209564_10310512 | 299 |
| 798 | 3300025297 | Ga0209758_1000206 | Ga0209758_10002066 | 299 |
| 799 | 3300025297 | Ga0209758_1000536 | Ga0209758_10005366 | 299 |
| 800 | 3300025297 | Ga0209758_1001539 | Ga0209758_100153914 | 299 |
| 801 | 3300025297 | Ga0209758_1001550 | Ga0209758_100155011 | 299 |
| 802 | 3300025297 | Ga0209758_1002309 | Ga0209758_10023098 | 299 |
| 803 | 3300025297 | Ga0209758_1021635 | Ga0209758_10216352 | 299 |
| 804 | 3300025299 | Ga0209256_1011364 | Ga0209256_10113643 | 299 |
| 805 | 3300025302 | Ga0207426_1000773 | Ga0207426_100077313 | 299 |
| 806 | 3300025302 | Ga0207426_1000990 | Ga0207426_100099019 | 299 |
| 807 | 3300025302 | Ga0207426_1003444 | Ga0207426_10034442 | 299 |
| 808 | 3300025304 | Ga0209257_1000394 | Ga0209257_10003946 | 299 |
| 809 | 3300025304 | Ga0209257_1011695 | Ga0209257_10116952 | 299 |
| 810 | 3300025315 | Ga0207697_10158552 | Ga0207697_101585521 | 299 |
| 811 | 3300025898 | Ga0207692_10000138 | Ga0207692_1000013814 | 299 |
| 812 | 3300025898 | Ga0207692_10008172 | Ga0207692_100081723 | 299 |
| 813 | 3300025900 | Ga0207710_10044682 | Ga0207710_100446822 | 299 |
| 814 | 3300025900 | Ga0207710_10060946 | Ga0207710_100609462 | 299 |
| 815 | 3300025901 | Ga0207688_10101138 | Ga0207688_101011382 | 299 |
| 816 | 3300025903 | Ga0207680_10199770 | Ga0207680_101997702 | 299 |
| 817 | 3300025906 | Ga0207699_10000122 | Ga0207699_1000012213 | 299 |
| 818 | 3300025906 | Ga0207699_10003146 | Ga0207699_100031462 | 299 |
| 819 | 3300025906 | Ga0207699_10135323 | Ga0207699_101353232 | 299 |
| 820 | 3300025906 | Ga0207699_10184435 | Ga0207699_101844351 | 299 |
| 821 | 3300025908 | Ga0207643_10008642 | Ga0207643_100086422 | 299 |
| 822 | 3300025908 | Ga0207643_10128696 | Ga0207643_101286961 | 299 |
| 823 | 3300025910 | Ga0207684_10037662 | Ga0207684_100376622 | 299 |
| 824 | 3300025911 | Ga0207654_10058650 | Ga0207654_100586502 | 299 |
| 825 | 3300025912 | Ga0207707_10000515 | Ga0207707_1000051514 | 299 |
| 826 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006582 | 299 |
| 827 | 3300025913 | Ga0207695_10030436 | Ga0207695_100304361 | 299 |
| 828 | 3300025913 | Ga0207695_10330686 | Ga0207695_103306862 | 299 |
| 829 | 3300025914 | Ga0207671_10021063 | Ga0207671_100210632 | 299 |
| 830 | 3300025915 | Ga0207693_10004906 | Ga0207693_100049062 | 299 |
| 831 | 3300025915 | Ga0207693_10009351 | Ga0207693_100093512 | 299 |
| 832 | 3300025916 | Ga0207663_10000161 | Ga0207663_100001612 | 299 |
| 833 | 3300025916 | Ga0207663_10000623 | Ga0207663_1000062312 | 299 |
| 834 | 3300025917 | Ga0207660_10155763 | Ga0207660_101557631 | 299 |
| 835 | 3300025919 | Ga0207657_10141428 | Ga0207657_101414283 | 299 |
| 836 | 3300025920 | Ga0207649_10312393 | Ga0207649_103123931 | 299 |
| 837 | 3300025921 | Ga0207652_10024532 | Ga0207652_100245322 | 299 |
| 838 | 3300025921 | Ga0207652_10196019 | Ga0207652_101960192 | 299 |
| 839 | 3300025921 | Ga0207652_10246409 | Ga0207652_102464091 | 299 |
| 840 | 3300025922 | Ga0207646_10094693 | Ga0207646_100946932 | 299 |
| 841 | 3300025924 | Ga0207694_10225354 | Ga0207694_102253542 | 299 |
| 842 | 3300025924 | Ga0207694_10350294 | Ga0207694_103502941 | 299 |
| 843 | 3300025927 | Ga0207687_10009895 | Ga0207687_100098952 | 299 |
| 844 | 3300025927 | Ga0207687_10029818 | Ga0207687_100298183 | 299 |
| 845 | 3300025927 | Ga0207687_10301560 | Ga0207687_103015601 | 299 |
| 846 | 3300025928 | Ga0207700_10068098 | Ga0207700_100680981 | 299 |
| 847 | 3300025928 | Ga0207700_10099864 | Ga0207700_100998642 | 299 |
| 848 | 3300025928 | Ga0207700_10157829 | Ga0207700_101578291 | 299 |
| 849 | 3300025929 | Ga0207664_10021734 | Ga0207664_100217342 | 299 |
| 850 | 3300025929 | Ga0207664_10081093 | Ga0207664_100810932 | 299 |
| 851 | 3300025929 | Ga0207664_10122909 | Ga0207664_101229092 | 299 |
| 852 | 3300025929 | Ga0207664_10123809 | Ga0207664_101238092 | 299 |
| 853 | 3300025931 | Ga0207644_10022900 | Ga0207644_100229002 | 299 |
| 854 | 3300025931 | Ga0207644_10293512 | Ga0207644_102935122 | 299 |
| 855 | 3300025933 | Ga0207706_10198139 | Ga0207706_101981392 | 299 |
| 856 | 3300025936 | Ga0207670_10183717 | Ga0207670_101837172 | 299 |
| 857 | 3300025937 | Ga0207669_10311820 | Ga0207669_103118201 | 299 |
| 858 | 3300025938 | Ga0207704_10054979 | Ga0207704_100549792 | 299 |
| 859 | 3300025939 | Ga0207665_10000183 | Ga0207665_1000018338 | 299 |
| 860 | 3300025939 | Ga0207665_10090592 | Ga0207665_100905922 | 299 |
| 861 | 3300025942 | Ga0207689_10244191 | Ga0207689_102441912 | 299 |
| 862 | 3300025944 | Ga0207661_10000828 | Ga0207661_100008282 | 299 |
| 863 | 3300025944 | Ga0207661_10128685 | Ga0207661_101286851 | 299 |
| 864 | 3300025960 | Ga0207651_10199418 | Ga0207651_101994182 | 299 |
| 865 | 3300026023 | Ga0207677_10408896 | Ga0207677_104088962 | 299 |
| 866 | 3300026035 | Ga0207703_10141894 | Ga0207703_101418942 | 299 |
| 867 | 3300026035 | Ga0207703_10416537 | Ga0207703_104165372 | 299 |
| 868 | 3300026067 | Ga0207678_10026771 | Ga0207678_100267712 | 299 |
| 869 | 3300026067 | Ga0207678_10038686 | Ga0207678_100386862 | 299 |
| 870 | 3300026067 | Ga0207678_10096846 | Ga0207678_100968462 | 299 |
| 871 | 3300026067 | Ga0207678_10155774 | Ga0207678_101557742 | 299 |
| 872 | 3300026067 | Ga0207678_10298681 | Ga0207678_102986812 | 299 |
| 873 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006353 | 299 |
| 874 | 3300026078 | Ga0207702_10174014 | Ga0207702_101740142 | 299 |
| 875 | 3300026078 | Ga0207702_10222152 | Ga0207702_102221522 | 299 |
| 876 | 3300026078 | Ga0207702_10421699 | Ga0207702_104216991 | 299 |
| 877 | 3300026095 | Ga0207676_10121038 | Ga0207676_101210382 | 299 |
| 878 | 3300026116 | Ga0207674_10133209 | Ga0207674_101332092 | 299 |
| 879 | 3300026116 | Ga0207674_10171418 | Ga0207674_101714182 | 299 |
| 880 | 3300026118 | Ga0207675_100141890 | Ga0207675_1001418902 | 299 |
| 881 | 3300026118 | Ga0207675_100241858 | Ga0207675_1002418582 | 299 |
| 882 | 3300026118 | Ga0207675_100539240 | Ga0207675_1005392401 | 299 |
| 883 | 3300026121 | Ga0207683_10017647 | Ga0207683_100176473 | 299 |
| 884 | 3300026121 | Ga0207683_10177815 | Ga0207683_101778151 | 299 |
| 885 | 3300026142 | Ga0207698_10297454 | Ga0207698_102974541 | 299 |
| 886 | 3300026142 | Ga0207698_10395256 | Ga0207698_103952562 | 299 |
| 887 | 3300027296 | Ga0209389_1000034 | Ga0209389_1000034114 | 299 |
| 888 | 3300027296 | Ga0209389_1000039 | Ga0209389_1000039113 | 299 |
| 889 | 3300027357 | Ga0209589_1000038 | Ga0209589_10000386 | 299 |
| 890 | 3300027357 | Ga0209589_1000055 | Ga0209589_100005559 | 299 |
| 891 | 3300027361 | Ga0209489_100023 | Ga0209489_100023187 | 299 |
| 892 | 3300027361 | Ga0209489_100087 | Ga0209489_100087113 | 299 |
| 893 | 3300027361 | Ga0209489_100128 | Ga0209489_10012859 | 299 |
| 894 | 3300027363 | Ga0209700_100090 | Ga0209700_1000903 | 299 |
| 895 | 3300027363 | Ga0209700_100137 | Ga0209700_10013759 | 299 |
| 896 | 3300027671 | Ga0209588_1005208 | Ga0209588_10052082 | 299 |
| 897 | 3300027866 | Ga0209813_10020446 | Ga0209813_100204462 | 299 |
| 898 | 3300028379 | Ga0268266_10034702 | Ga0268266_100347022 | 299 |
| 899 | 3300028379 | Ga0268266_10053634 | Ga0268266_100536342 | 299 |
| 900 | 3300028379 | Ga0268266_10115088 | Ga0268266_101150881 | 299 |
| 901 | 3300028379 | Ga0268266_10219944 | Ga0268266_102199441 | 299 |
| 902 | 3300028379 | Ga0268266_10600699 | Ga0268266_106006991 | 299 |
| 903 | 3300028380 | Ga0268265_10130892 | Ga0268265_101308922 | 299 |
| 904 | 3300028556 | Ga0265337_1061197 | Ga0265337_10611971 | 299 |
| 905 | 3300028573 | Ga0265334_10039065 | Ga0265334_100390652 | 299 |
| 906 | 3300028653 | Ga0265323_10012335 | Ga0265323_100123352 | 299 |
| 907 | 3300028666 | Ga0265336_10001738 | Ga0265336_100017385 | 299 |
| 908 | 3300028786 | Ga0307517_10001423 | Ga0307517_1000142333 | 299 |
| 909 | 3300028794 | Ga0307515_10046793 | Ga0307515_100467932 | 299 |
| 910 | 3300028800 | Ga0265338_10000417 | Ga0265338_1000041746 | 299 |
| 911 | 3300031235 | Ga0265330_10034644 | Ga0265330_100346442 | 299 |
| 912 | 3300031235 | Ga0265330_10102948 | Ga0265330_101029482 | 299 |
| 913 | 3300031247 | Ga0265340_10046257 | Ga0265340_100462572 | 299 |
| 914 | 3300031247 | Ga0265340_10105394 | Ga0265340_101053942 | 299 |
| 915 | 3300031249 | Ga0265339_10000281 | Ga0265339_1000028137 | 299 |
| 916 | 3300031250 | Ga0265331_10089716 | Ga0265331_100897162 | 299 |
| 917 | 3300031456 | Ga0307513_10171602 | Ga0307513_101716022 | 299 |
| 918 | 3300031507 | Ga0307509_10053131 | Ga0307509_100531312 | 299 |
| 919 | 3300031616 | Ga0307508_10000012 | Ga0307508_1000001242 | 299 |
| 920 | 3300031616 | Ga0307508_10323996 | Ga0307508_103239961 | 299 |
| 921 | 3300031711 | Ga0265314_10011033 | Ga0265314_100110335 | 299 |
| 922 | 3300031712 | Ga0265342_10079030 | Ga0265342_100790301 | 299 |
| 923 | 3300032002 | Ga0307416_100154960 | Ga0307416_1001549602 | 299 |
| 924 | 3300032005 | Ga0307411_10194970 | Ga0307411_101949701 | 299 |
| 925 | 3300033180 | Ga0307510_10022874 | Ga0307510_100228742 | 299 |
| 926 | 3300033180 | Ga0307510_10031589 | Ga0307510_100315892 | 299 |
| 927 | 3300033180 | Ga0307510_10037361 | Ga0307510_100373612 | 299 |
| 928 | 3300033180 | Ga0307510_10071425 | Ga0307510_100714252 | 299 |
| 929 | 3300035086 | Ga0373934_0024456 | Ga0373934_0024456_1109_2023 | 299 |
| 930 | 3300035086 | Ga0373934_0029496 | Ga0373934_0029496_1101_2015 | 299 |
| 931 | 3300035113 | Ga0373936_0007352 | Ga0373936_0007352_1966_2889 | 299 |
| 932 | 3300035117 | Ga0373953_0001704 | Ga0373953_0001704_938_1852 | 299 |
| 933 | 3300035117 | Ga0373953_0002691 | Ga0373953_0002691_4415_5329 | 299 |
| 934 | 3300035118 | Ga0373954_0007407 | Ga0373954_0007407_1130_2044 | 299 |
| 935 | 3300035119 | Ga0373956_0056817 | Ga0373956_0056817_223_1137 | 299 |
| 936 | 3300035120 | Ga0373957_0050268 | Ga0373957_0050268_372_1286 | 299 |
| 937 | 3300035120 | Ga0373957_0113656 | Ga0373957_0113656_151_1065 | 299 |
| 938 | 3300035170 | Ga0373943_0025951 | Ga0373943_0025951_265_1179 | 299 |
| 939 | 3300035171 | Ga0373946_0008815 | Ga0373946_0008815_1422_2336 | 299 |
| 940 | 3300035171 | Ga0373946_0111979 | Ga0373946_0111979_144_1058 | 299 |
| 941 | 3300035172 | Ga0373955_0038590 | Ga0373955_0038590_1166_2080 | 299 |
| 942 | 3300035172 | Ga0373955_0070775 | Ga0373955_0070775_698_1612 | 299 |
| 943 | 3300035172 | Ga0373955_0091565 | Ga0373955_0091565_187_1101 | 299 |
| 944 | 3300035410 | Ga0373924_0052820 | Ga0373924_0052820_216_1130 | 299 |
| 945 | 3300035692 | Ga0373935_0003730 | Ga0373935_0003730_6060_6974 | 299 |
| 946 | 3300035692 | Ga0373935_0017629 | Ga0373935_0017629_506_1420 | 299 |
| 947 | 3300035695 | Ga0373927_0001492 | Ga0373927_0001492_16406_17320 | 299 |
| 948 | 3300035695 | Ga0373927_0001793 | Ga0373927_0001793_14291_15205 | 299 |
| 949 | 3300035724 | Ga0373933_0035758 | Ga0373933_0035758_899_1813 | 299 |
| 950 | 3300035725 | Ga0373947_0001861 | Ga0373947_0001861_5477_6391 | 299 |
| 951 | 3300035725 | Ga0373947_0083092 | Ga0373947_0083092_966_1880 | 299 |
| 952 | 3300036401 | Ga0373937_0040210 | Ga0373937_0040210_2899_3813 | 299 |
| 953 | 3300036401 | Ga0373937_0055275 | Ga0373937_0055275_457_1371 | 299 |
| 954 | 3300036401 | Ga0373937_0259198 | Ga0373937_0259198_316_1230 | 299 |
| 955 | 3300036401 | Ga0373937_0362752 | Ga0373937_0362752_215_1129 | 299 |
| 956 | 3300036401 | Ga0373937_0376854 | Ga0373937_0376854_410_1324 | 299 |
| 957 | 3300037068 | Ga0373925_0013546 | Ga0373925_0013546_3813_4727 | 299 |
| 958 | 3300037068 | Ga0373925_0058364 | Ga0373925_0058364_330_1244 | 299 |
| 959 | 3300037068 | Ga0373925_0205500 | Ga0373925_0205500_570_1484 | 299 |
| 960 | 3300037418 | Ga0395900_0048769 | Ga0395900_0048769_1751_2665 | 299 |
| 961 | 3300037466 | Ga0395898_0019947 | Ga0395898_0019947_1585_2505 | 299 |
| 962 | 3300037471 | Ga0395905_0004165 | Ga0395905_0004165_9798_10718 | 299 |
| 963 | 3300037471 | Ga0395905_0032236 | Ga0395905_0032236_1006_1932 | 299 |
| 964 | 3300037853 | Ga0436364_0483388 | Ga0436364_0483388_417_1331 | 299 |
| 965 | 3300037853 | Ga0436364_1097754 | Ga0436364_1097754_49_963 | 299 |
| 966 | 3300038443 | Ga0395901_0064055 | Ga0395901_0064055_989_1909 | 299 |
| 967 | 3300038443 | Ga0395901_0111647 | Ga0395901_0111647_1936_2850 | 299 |
| 968 | 3300038443 | Ga0395901_0384405 | Ga0395901_0384405_11_937 | 299 |
| 969 | 3300039437 | Ga0436365_0299351 | Ga0436365_0299351_1393_2307 | 299 |
| 970 | 3300039437 | Ga0436365_1557661 | Ga0436365_1557661_359_1273 | 299 |
| 971 | 3300039437 | Ga0436365_1683113 | Ga0436365_1683113_189_1115 | 299 |
| 972 | 3300039438 | Ga0436360_1250391 | Ga0436360_1250391_328_1239 | 299 |
| 973 | 3300039447 | Ga0436361_0870440 | Ga0436361_0870440_100_1014 | 299 |
| 974 | 3300041452 | Ga0451793_0917594 | Ga0451793_0917594_596_1516 | 299 |
| 975 | 3300041509 | Ga0451843_1211220 | Ga0451843_1211220_402_1322 | 299 |
| 976 | 3300044656 | Ga0466969_0035286 | Ga0466969_0035286_766_1686 | 299 |
| 977 | 3300044658 | Ga0466972_0000053 | Ga0466972_0000053_4105_5025 | 299 |
| 978 | 3300044684 | Ga0466966_0003788 | Ga0466966_0003788_3575_4495 | 299 |
| 979 | 3300044684 | Ga0466966_0033603 | Ga0466966_0033603_191_1105 | 299 |
| 980 | 3300044684 | Ga0466966_0143406 | Ga0466966_0143406_37_951 | 299 |
| 981 | 3300044693 | Ga0466961_0000227 | Ga0466961_0000227_25719_26639 | 299 |
| 982 | 3300044901 | Ga0466960_0198246 | Ga0466960_0198246_22_942 | 299 |
| 983 | 3300045049 | Ga0466959_0024944 | Ga0466959_0024944_735_1649 | 299 |
| 984 | 3300045049 | Ga0466959_0061469 | Ga0466959_0061469_177_1091 | 299 |
| 985 | 3300046454 | Ga0495592_0002227 | Ga0495592_0002227_4128_5042 | 299 |
| 986 | 3300046454 | Ga0495592_0053346 | Ga0495592_0053346_274_1188 | 299 |
| 987 | 3300046454 | Ga0495592_0107893 | Ga0495592_0107893_101_1042 | 299 |
| 988 | 3300046455 | Ga0495603_0000036 | Ga0495603_0000036_54258_55172 | 299 |
| 989 | 3300046455 | Ga0495603_0008447 | Ga0495603_0008447_1089_2003 | 299 |
| 990 | 3300046455 | Ga0495603_0015690 | Ga0495603_0015690_2239_3153 | 299 |
| 991 | 3300046455 | Ga0495603_0017567 | Ga0495603_0017567_143_1057 | 299 |
| 992 | 3300046455 | Ga0495603_0061304 | Ga0495603_0061304_190_1104 | 299 |
| 993 | 3300046459 | Ga0495629_0000148 | Ga0495629_0000148_6354_7268 | 299 |
| 994 | 3300046459 | Ga0495629_0000331 | Ga0495629_0000331_9821_10735 | 299 |
| 995 | 3300046459 | Ga0495629_0108804 | Ga0495629_0108804_42_956 | 299 |
| 996 | 3300046459 | Ga0495629_0214212 | Ga0495629_0214212_21_935 | 299 |
| 997 | 3300046459 | Ga0495629_0326679 | Ga0495629_0326679_107_1021 | 299 |
| 998 | 3300046460 | Ga0495638_0033836 | Ga0495638_0033836_1458_2372 | 299 |
| 999 | 3300046460 | Ga0495638_0046208 | Ga0495638_0046208_1777_2703 | 299 |
| 1000 | 3300046460 | Ga0495638_0254238 | Ga0495638_0254238_35_949 | 299 |
| 1001 | 3300046462 | Ga0495651_0009401 | Ga0495651_0009401_315_1256 | 299 |
| 1002 | 3300046462 | Ga0495651_0016761 | Ga0495651_0016761_3049_3963 | 299 |
| 1003 | 3300046463 | Ga0495653_0000697 | Ga0495653_0000697_12021_12935 | 299 |
| 1004 | 3300046463 | Ga0495653_0033411 | Ga0495653_0033411_567_1481 | 299 |
| 1005 | 3300046463 | Ga0495653_0200113 | Ga0495653_0200113_272_1213 | 299 |
| 1006 | 3300046472 | Ga0495580_0000705 | Ga0495580_0000705_5533_6447 | 299 |
| 1007 | 3300046473 | Ga0495582_0002450 | Ga0495582_0002450_6388_7302 | 299 |
| 1008 | 3300046473 | Ga0495582_0172305 | Ga0495582_0172305_187_1101 | 299 |
| 1009 | 3300046475 | Ga0495639_0000135 | Ga0495639_0000135_9472_10386 | 299 |
| 1010 | 3300046475 | Ga0495639_0004541 | Ga0495639_0004541_160_1074 | 299 |
| 1011 | 3300046476 | Ga0495662_0000811 | Ga0495662_0000811_8041_8955 | 299 |
| 1012 | 3300046477 | Ga0495664_0015540 | Ga0495664_0015540_15_956 | 299 |
| 1013 | 3300046477 | Ga0495664_0024550 | Ga0495664_0024550_900_1814 | 299 |
| 1014 | 3300046477 | Ga0495664_0242264 | Ga0495664_0242264_138_1052 | 299 |
| 1015 | 3300046499 | Ga0495594_0001252 | Ga0495594_0001252_9167_10081 | 299 |
| 1016 | 3300046499 | Ga0495594_0161976 | Ga0495594_0161976_141_1055 | 299 |
| 1017 | 3300046499 | Ga0495594_0234788 | Ga0495594_0234788_73_987 | 299 |
| 1018 | 3300046500 | Ga0495596_0098348 | Ga0495596_0098348_10_924 | 299 |
| 1019 | 3300046501 | Ga0495607_0151071 | Ga0495607_0151071_194_1114 | 299 |
| 1020 | 3300046511 | Ga0495608_0062538 | Ga0495608_0062538_1399_2313 | 299 |
| 1021 | 3300046511 | Ga0495608_0083219 | Ga0495608_0083219_703_1617 | 299 |
| 1022 | 3300046513 | Ga0495616_0124891 | Ga0495616_0124891_137_1057 | 299 |
| 1023 | 3300046514 | Ga0495618_0016165 | Ga0495618_0016165_2323_3237 | 299 |
| 1024 | 3300046514 | Ga0495618_0048606 | Ga0495618_0048606_1114_2028 | 299 |
| 1025 | 3300046514 | Ga0495618_0208057 | Ga0495618_0208057_198_1112 | 299 |
| 1026 | 3300046516 | Ga0495628_0045823 | Ga0495628_0045823_1351_2265 | 299 |
| 1027 | 3300046516 | Ga0495628_0095790 | Ga0495628_0095790_1356_2270 | 299 |
| 1028 | 3300046517 | Ga0495630_0086215 | Ga0495630_0086215_1096_2010 | 299 |
| 1029 | 3300046517 | Ga0495630_0146108 | Ga0495630_0146108_447_1361 | 299 |
| 1030 | 3300046519 | Ga0495632_0050213 | Ga0495632_0050213_544_1458 | 299 |
| 1031 | 3300046522 | Ga0495643_0051759 | Ga0495643_0051759_414_1334 | 299 |
| 1032 | 3300046529 | Ga0495652_0025648 | Ga0495652_0025648_1248_2162 | 299 |
| 1033 | 3300046529 | Ga0495652_0335278 | Ga0495652_0335278_114_1028 | 299 |
| 1034 | 3300046531 | Ga0495665_0000118 | Ga0495665_0000118_6528_7442 | 299 |
| 1035 | 3300046533 | Ga0495640_0057459 | Ga0495640_0057459_1042_1956 | 299 |
| 1036 | 3300046533 | Ga0495640_0083891 | Ga0495640_0083891_731_1645 | 299 |
| 1037 | 3300046536 | Ga0495587_0009426 | Ga0495587_0009426_795_1709 | 299 |
| 1038 | 3300046536 | Ga0495587_0037845 | Ga0495587_0037845_500_1441 | 299 |
| 1039 | 3300046542 | Ga0495597_0071706 | Ga0495597_0071706_138_1058 | 299 |
| 1040 | 3300046543 | Ga0495645_0018632 | Ga0495645_0018632_858_1799 | 299 |
| 1041 | 3300046543 | Ga0495645_0057120 | Ga0495645_0057120_183_1097 | 299 |
| 1042 | 3300046557 | Ga0495622_0027568 | Ga0495622_0027568_1649_2563 | 299 |
| 1043 | 3300046557 | Ga0495622_0053671 | Ga0495622_0053671_295_1209 | 299 |
| 1044 | 3300046559 | Ga0495667_0000379 | Ga0495667_0000379_10394_11308 | 299 |
| 1045 | 3300046559 | Ga0495667_0040798 | Ga0495667_0040798_1399_2340 | 299 |
| 1046 | 3300046559 | Ga0495667_0047491 | Ga0495667_0047491_1493_2407 | 299 |
| 1047 | 3300046616 | Ga0495668_0053348 | Ga0495668_0053348_1048_1962 | 299 |
| 1048 | 3300046616 | Ga0495668_0106545 | Ga0495668_0106545_77_997 | 299 |
| 1049 | 3300046616 | Ga0495668_0173550 | Ga0495668_0173550_222_1136 | 299 |
| 1050 | 3300046642 | Ga0495634_0000969 | Ga0495634_0000969_736_1650 | 299 |
| 1051 | 3300046642 | Ga0495634_0018562 | Ga0495634_0018562_2382_3296 | 299 |
| 1052 | 3300046642 | Ga0495634_0116320 | Ga0495634_0116320_577_1518 | 299 |
| 1053 | 3300046642 | Ga0495634_0221464 | Ga0495634_0221464_100_1026 | 299 |
| 1054 | 3300046663 | Ga0495635_0006242 | Ga0495635_0006242_6457_7371 | 299 |
| 1055 | 3300046665 | Ga0495661_0144082 | Ga0495661_0144082_164_1084 | 299 |
| 1056 | 3300046674 | Ga0495588_0036181 | Ga0495588_0036181_104_1018 | 299 |
| 1057 | 3300046674 | Ga0495588_0046900 | Ga0495588_0046900_1087_2028 | 299 |
| 1058 | 3300046674 | Ga0495588_0131483 | Ga0495588_0131483_95_1009 | 299 |
| 1059 | 3300046675 | Ga0495657_0005912 | Ga0495657_0005912_2750_3691 | 299 |
| 1060 | 3300046675 | Ga0495657_0007977 | Ga0495657_0007977_3700_4614 | 299 |
| 1061 | 3300046678 | Ga0495599_0069200 | Ga0495599_0069200_72_1013 | 299 |
| 1062 | 3300046678 | Ga0495599_0228107 | Ga0495599_0228107_152_1066 | 299 |
| 1063 | 3300046678 | Ga0495599_0231185 | Ga0495599_0231185_199_1113 | 299 |
| 1064 | 3300046679 | Ga0495623_0042152 | Ga0495623_0042152_1526_2467 | 299 |
| 1065 | 3300046680 | Ga0495646_0021600 | Ga0495646_0021600_1619_2533 | 299 |
| 1066 | 3300046681 | Ga0495647_0000360 | Ga0495647_0000360_665_1579 | 299 |
| 1067 | 3300046683 | Ga0495658_0009177 | Ga0495658_0009177_3370_4284 | 299 |
| 1068 | 3300046683 | Ga0495658_0047609 | Ga0495658_0047609_1442_2356 | 299 |
| 1069 | 3300046689 | Ga0495613_0031204 | Ga0495613_0031204_1569_2483 | 299 |
| 1070 | 3300046689 | Ga0495613_0123568 | Ga0495613_0123568_244_1158 | 299 |
| 1071 | 3300046690 | Ga0495624_0000445 | Ga0495624_0000445_6372_7286 | 299 |
| 1072 | 3300046690 | Ga0495624_0210104 | Ga0495624_0210104_121_1035 | 299 |
| 1073 | 3300046692 | Ga0495671_0122925 | Ga0495671_0122925_230_1144 | 299 |
| 1074 | 3300046809 | Ga0495600_0003883 | Ga0495600_0003883_3907_4821 | 299 |
| 1075 | 3300046809 | Ga0495600_0007122 | Ga0495600_0007122_4812_5753 | 299 |
| 1076 | 3300046809 | Ga0495600_0026362 | Ga0495600_0026362_2690_3604 | 299 |
| 1077 | 3300047315 | Ga0495581_0001178 | Ga0495581_0001178_7490_8404 | 299 |
| 1078 | 3300047315 | Ga0495581_0169040 | Ga0495581_0169040_82_996 | 299 |
| 1079 | 3300047315 | Ga0495581_0217217 | Ga0495581_0217217_51_965 | 299 |
| 1080 | 3300047317 | Ga0495604_0012567 | Ga0495604_0012567_4123_5064 | 299 |
| 1081 | 3300047317 | Ga0495604_0093258 | Ga0495604_0093258_1248_2162 | 299 |
| 1082 | 3300047317 | Ga0495604_0101323 | Ga0495604_0101323_964_1878 | 299 |
| 1083 | 3300047319 | Ga0495674_0000443 | Ga0495674_0000443_33617_34531 | 299 |
| 1084 | 3300047319 | Ga0495674_0010317 | Ga0495674_0010317_4042_4956 | 299 |
| 1085 | 3300047319 | Ga0495674_0036232 | Ga0495674_0036232_982_1923 | 299 |
| 1086 | 3300047319 | Ga0495674_0038574 | Ga0495674_0038574_303_1217 | 299 |
| 1087 | 3300047320 | Ga0495672_0123114 | Ga0495672_0123114_116_1030 | 299 |
| 1088 | 3300047320 | Ga0495672_0138500 | Ga0495672_0138500_157_1071 | 299 |
| 1089 | 3300047321 | Ga0495676_0104051 | Ga0495676_0104051_812_1726 | 299 |
| 1090 | 3300047322 | Ga0495680_0001308 | Ga0495680_0001308_10681_11622 | 299 |
| 1091 | 3300047322 | Ga0495680_0247200 | Ga0495680_0247200_37_951 | 299 |
| 1092 | 3300047443 | Ga0495687_058255 | Ga0495687_058255_108_1049 | 299 |
| 1093 | 3300047444 | Ga0495675_0032620 | Ga0495675_0032620_2092_3033 | 299 |
| 1094 | 3300047444 | Ga0495675_0075757 | Ga0495675_0075757_763_1677 | 299 |
| 1095 | 3300047471 | Ga0495684_0002730 | Ga0495684_0002730_4987_5901 | 299 |
| 1096 | 3300047471 | Ga0495684_0054251 | Ga0495684_0054251_698_1612 | 299 |
| 1097 | 3300047471 | Ga0495684_0076841 | Ga0495684_0076841_1430_2344 | 299 |
| 1098 | 3300047471 | Ga0495684_0077562 | Ga0495684_0077562_1557_2498 | 299 |
| 1099 | 3300047673 | Ga0495593_0000495 | Ga0495593_0000495_1416_2330 | 299 |
| 1100 | 3300047673 | Ga0495593_0001203 | Ga0495593_0001203_591_1505 | 299 |
| 1101 | 3300047673 | Ga0495593_0022477 | Ga0495593_0022477_409_1323 | 299 |
| 1102 | 3300047673 | Ga0495593_0105124 | Ga0495593_0105124_347_1261 | 299 |
| 1103 | 3300048088 | Ga0495602_0028623 | Ga0495602_0028623_1670_2611 | 299 |
| 1104 | 3300048088 | Ga0495602_0115902 | Ga0495602_0115902_774_1688 | 299 |
| 1105 | 3300048089 | Ga0495614_0111458 | Ga0495614_0111458_108_1022 | 299 |
| 1106 | 3300048903 | Ga0496100_0011667 | Ga0496100_0011667_3475_4389 | 299 |
| 1107 | 3300048903 | Ga0496100_0016652 | Ga0496100_0016652_1112_2026 | 299 |
| 1108 | 3300048904 | Ga0496101_0003579 | Ga0496101_0003579_4620_5534 | 299 |
| 1109 | 3300048904 | Ga0496101_0064455 | Ga0496101_0064455_1706_2620 | 299 |
| 1110 | 3300048904 | Ga0496101_0185183 | Ga0496101_0185183_270_1190 | 299 |
| 1111 | 3300048905 | Ga0496102_0007923 | Ga0496102_0007923_7991_8911 | 299 |
| 1112 | 3300048905 | Ga0496102_0010957 | Ga0496102_0010957_822_1736 | 299 |
| 1113 | 3300048905 | Ga0496102_0418721 | Ga0496102_0418721_67_981 | 299 |
| 1114 | 3300048906 | Ga0496103_0023579 | Ga0496103_0023579_2587_3507 | 299 |
| 1115 | 3300048907 | Ga0496104_0014455 | Ga0496104_0014455_46_1053 | 299 |
| 1116 | 3300048907 | Ga0496104_0014992 | Ga0496104_0014992_1591_2505 | 299 |
| 1117 | 3300048907 | Ga0496104_0048023 | Ga0496104_0048023_1237_2151 | 299 |
| 1118 | 3300048907 | Ga0496104_0069177 | Ga0496104_0069177_1693_2634 | 299 |
| 1119 | 3300048907 | Ga0496104_0543636 | Ga0496104_0543636_66_986 | 299 |
| 1120 | 3300048908 | Ga0496105_0102035 | Ga0496105_0102035_50_964 | 299 |
| 1121 | 3300048908 | Ga0496105_0102772 | Ga0496105_0102772_1201_2208 | 299 |
| 1122 | 3300048908 | Ga0496105_0102995 | Ga0496105_0102995_955_1875 | 299 |
| 1123 | 3300048909 | Ga0496106_0015817 | Ga0496106_0015817_3180_4094 | 299 |
| 1124 | 3300048910 | Ga0496107_0276695 | Ga0496107_0276695_188_1135 | 299 |
| 1125 | 3300048911 | Ga0496108_0002964 | Ga0496108_0002964_7444_8358 | 299 |
| 1126 | 3300048911 | Ga0496108_0149303 | Ga0496108_0149303_130_1050 | 299 |
| 1127 | 3300048911 | Ga0496108_0287503 | Ga0496108_0287503_281_1195 | 299 |
| 1128 | 3300048911 | Ga0496108_0506769 | Ga0496108_0506769_21_947 | 299 |
| 1129 | 3300048912 | Ga0496109_0002046 | Ga0496109_0002046_1271_2185 | 299 |
| 1130 | 3300048912 | Ga0496109_0053999 | Ga0496109_0053999_1150_2097 | 299 |
| 1131 | 3300048912 | Ga0496109_0222188 | Ga0496109_0222188_767_1681 | 299 |
| 1132 | 3300048912 | Ga0496109_0302962 | Ga0496109_0302962_134_1048 | 299 |
| 1133 | 3300048912 | Ga0496109_0386395 | Ga0496109_0386395_11_931 | 299 |
| 1134 | 3300048913 | Ga0496110_0058569 | Ga0496110_0058569_99_1106 | 299 |
| 1135 | 3300048913 | Ga0496110_0107500 | Ga0496110_0107500_401_1315 | 299 |
| 1136 | 3300048913 | Ga0496110_0163678 | Ga0496110_0163678_271_1191 | 299 |
| 1137 | 3300048913 | Ga0496110_0328459 | Ga0496110_0328459_148_1089 | 299 |
| 1138 | 3300048913 | Ga0496110_0334970 | Ga0496110_0334970_438_1352 | 299 |
| 1139 | 3300048914 | Ga0496111_0158235 | Ga0496111_0158235_532_1452 | 299 |
| 1140 | 3300048915 | Ga0496112_0018491 | Ga0496112_0018491_1216_2130 | 299 |
| 1141 | 3300048915 | Ga0496112_0039371 | Ga0496112_0039371_2941_3855 | 299 |
| 1142 | 3300048915 | Ga0496112_0053414 | Ga0496112_0053414_2955_3869 | 299 |
| 1143 | 3300048915 | Ga0496112_0190119 | Ga0496112_0190119_777_1697 | 299 |
| 1144 | 3300048915 | Ga0496112_0336353 | Ga0496112_0336353_353_1267 | 299 |
| 1145 | 3300048915 | Ga0496112_0458908 | Ga0496112_0458908_178_1119 | 299 |
| 1146 | 3300048916 | Ga0496113_0020258 | Ga0496113_0020258_1176_2090 | 299 |
| 1147 | 3300048916 | Ga0496113_0083060 | Ga0496113_0083060_1243_2157 | 299 |
| 1148 | 3300048916 | Ga0496113_0134356 | Ga0496113_0134356_607_1521 | 299 |
| 1149 | 3300048917 | Ga0496114_0011325 | Ga0496114_0011325_4306_5220 | 299 |
| 1150 | 3300048917 | Ga0496114_0269506 | Ga0496114_0269506_137_1051 | 299 |
| 1151 | 3300048918 | Ga0496115_0000295 | Ga0496115_0000295_6024_6938 | 299 |
| 1152 | 3300048918 | Ga0496115_0018198 | Ga0496115_0018198_137_1051 | 299 |
| 1153 | 3300048918 | Ga0496115_0076474 | Ga0496115_0076474_238_1152 | 299 |
| 1154 | 3300048918 | Ga0496115_0230402 | Ga0496115_0230402_477_1484 | 299 |
| 1155 | 3300048920 | Ga0496117_0196340 | Ga0496117_0196340_73_993 | 299 |
| 1156 | 3300048922 | Ga0496119_0062780 | Ga0496119_0062780_1246_2166 | 299 |
| 1157 | 3300048922 | Ga0496119_0135649 | Ga0496119_0135649_284_1204 | 299 |
| 1158 | 3300048923 | Ga0496120_0018821 | Ga0496120_0018821_815_1741 | 299 |
| 1159 | 3300048924 | Ga0496121_0001687 | Ga0496121_0001687_13533_14444 | 299 |
| 1160 | 3300048924 | Ga0496121_0003702 | Ga0496121_0003702_10421_11335 | 299 |
| 1161 | 3300048924 | Ga0496121_0022584 | Ga0496121_0022584_1774_2715 | 299 |
| 1162 | 3300048924 | Ga0496121_0024664 | Ga0496121_0024664_3701_4621 | 299 |
| 1163 | 3300048924 | Ga0496121_0031082 | Ga0496121_0031082_347_1261 | 299 |
| 1164 | 3300048924 | Ga0496121_0099032 | Ga0496121_0099032_74_994 | 299 |
| 1165 | 3300048924 | Ga0496121_0103994 | Ga0496121_0103994_39_953 | 299 |
| 1166 | 3300048927 | Ga0496124_0165082 | Ga0496124_0165082_759_1673 | 299 |
| 1167 | 3300048927 | Ga0496124_0226395 | Ga0496124_0226395_348_1262 | 299 |
| 1168 | 3300048928 | Ga0496125_0067186 | Ga0496125_0067186_825_1745 | 299 |
| 1169 | 3300048928 | Ga0496125_0074537 | Ga0496125_0074537_1408_2328 | 299 |
| 1170 | 3300048928 | Ga0496125_0086498 | Ga0496125_0086498_437_1354 | 299 |
| 1171 | 3300048928 | Ga0496125_0095367 | Ga0496125_0095367_374_1294 | 299 |
| 1172 | 3300048929 | Ga0496126_0005939 | Ga0496126_0005939_1796_2707 | 299 |
| 1173 | 3300048929 | Ga0496126_0007926 | Ga0496126_0007926_4217_5131 | 299 |
| 1174 | 3300048929 | Ga0496126_0093307 | Ga0496126_0093307_1527_2447 | 299 |
| 1175 | 3300049568 | Ga0501031_0002996 | Ga0501031_0002996_3302_4225 | 299 |
| 1176 | 3300049569 | Ga0501032_0004842 | Ga0501032_0004842_8378_9301 | 299 |
| 1177 | 3300049570 | Ga0501033_0002224 | Ga0501033_0002224_3152_4066 | 299 |
| 1178 | 3300049570 | Ga0501033_0057288 | Ga0501033_0057288_573_1496 | 299 |
| 1179 | 3300049571 | Ga0501034_0030135 | Ga0501034_0030135_2929_3852 | 299 |
| 1180 | 3300049572 | Ga0501036_0015708 | Ga0501036_0015708_1423_2346 | 299 |
| 1181 | 3300049572 | Ga0501036_0057168 | Ga0501036_0057168_326_1240 | 299 |
| 1182 | 3300049573 | Ga0501037_0001428 | Ga0501037_0001428_891_1805 | 299 |
| 1183 | 3300049573 | Ga0501037_0042850 | Ga0501037_0042850_145_1068 | 299 |
| 1184 | 3300049575 | Ga0501039_0096245 | Ga0501039_0096245_463_1386 | 299 |
| 1185 | 3300049578 | Ga0501042_0008268 | Ga0501042_0008268_345_1259 | 299 |
| 1186 | 3300049579 | Ga0501043_0001844 | Ga0501043_0001844_14647_15561 | 299 |
| 1187 | 3300049580 | Ga0501046_0156747 | Ga0501046_0156747_689_1603 | 299 |
| 1188 | 3300049581 | Ga0501047_0038030 | Ga0501047_0038030_2484_3398 | 299 |
| 1189 | 3300049581 | Ga0501047_0077943 | Ga0501047_0077943_382_1296 | 299 |
| 1190 | 3300049583 | Ga0501067_0035211 | Ga0501067_0035211_1753_2667 | 299 |
| 1191 | 3300049585 | Ga0501069_0180108 | Ga0501069_0180108_185_1099 | 299 |
| 1192 | 3300049586 | Ga0501070_0026912 | Ga0501070_0026912_1422_2345 | 299 |
| 1193 | 3300049586 | Ga0501070_0037271 | Ga0501070_0037271_1551_2465 | 299 |
| 1194 | 3300049589 | Ga0501073_0158480 | Ga0501073_0158480_70_984 | 299 |
| 1195 | 3300049590 | Ga0501074_0067059 | Ga0501074_0067059_1483_2397 | 299 |
| 1196 | 3300049592 | Ga0501076_0128311 | Ga0501076_0128311_1025_1939 | 299 |
| 1197 | 3300049742 | Ga0501080_0005201 | Ga0501080_0005201_7032_7946 | 299 |
| 1198 | 3300049744 | Ga0501083_0277349 | Ga0501083_0277349_150_1064 | 299 |
| 1199 | 3300049822 | Ga0501035_0007299 | Ga0501035_0007299_1915_2829 | 299 |
| 1200 | 3300049823 | Ga0501044_0007854 | Ga0501044_0007854_7870_8784 | 299 |
| 1201 | 3300049823 | Ga0501044_0534103 | Ga0501044_0534103_137_1060 | 299 |
| 1202 | 3300050490 | nmdc:mga03n38_33351_c1 | nmdc:mga03n38_33351_c1_86_1000 | 299 |
| 1203 | 3300050491 | nmdc:mga00v17_100632_c1 | nmdc:mga00v17_100632_c1_422_1336 | 299 |
| 1204 | 3300050492 | nmdc:mga0yw44_165167_c1 | nmdc:mga0yw44_165167_c1_369_1289 | 299 |
| 1205 | 3300050492 | nmdc:mga0yw44_20773_c1 | nmdc:mga0yw44_20773_c1_315_1229 | 299 |
| 1206 | 3300050492 | nmdc:mga0yw44_266741_c1 | nmdc:mga0yw44_266741_c1_126_1067 | 299 |
| 1207 | 3300050492 | nmdc:mga0yw44_32589_c1 | nmdc:mga0yw44_32589_c1_397_1311 | 299 |
| 1208 | 3300050492 | nmdc:mga0yw44_39874_c1 | nmdc:mga0yw44_39874_c1_553_1467 | 299 |
| 1209 | 3300050493 | nmdc:mga0k408_125211_c1 | nmdc:mga0k408_125211_c1_188_1102 | 299 |
| 1210 | 3300050493 | nmdc:mga0k408_165274_c1 | nmdc:mga0k408_165274_c1_364_1278 | 299 |
| 1211 | 3300050493 | nmdc:mga0k408_238923_c1 | nmdc:mga0k408_238923_c1_104_1024 | 299 |
| 1212 | 3300050494 | nmdc:mga06z11_132369_c1 | nmdc:mga06z11_132369_c1_162_1076 | 299 |
| 1213 | 3300050495 | nmdc:mga04h51_24381_c1 | nmdc:mga04h51_24381_c1_366_1280 | 299 |
| 1214 | 3300050495 | nmdc:mga04h51_48195_c1 | nmdc:mga04h51_48195_c1_269_1189 | 299 |
| 1215 | 3300050496 | nmdc:mga07m45_36090_c2 | nmdc:mga07m45_36090_c2_888_1802 | 299 |
| 1216 | 3300050496 | nmdc:mga07m45_6998_c1 | nmdc:mga07m45_6998_c1_4295_5209 | 299 |
| 1217 | 3300050512 | nmdc:mga0n895_130855_c1 | nmdc:mga0n895_130855_c1_354_1268 | 299 |
| 1218 | 3300050514 | nmdc:mga08x19_345771_c1 | nmdc:mga08x19_345771_c1_10_924 | 299 |
| 1219 | 3300050516 | nmdc:mga0sz30_60233_c1 | nmdc:mga0sz30_60233_c1_615_1535 | 299 |
| 1220 | 3300053077 | Ga0495601_0013434 | Ga0495601_0013434_2293_3207 | 299 |
| 1221 | 3300053077 | Ga0495601_0060208 | Ga0495601_0060208_996_1910 | 299 |
| 1222 | 3300053077 | Ga0495601_0157802 | Ga0495601_0157802_124_1038 | 299 |
| 1223 | 3300053079 | Ga0500610_0130389 | Ga0500610_0130389_195_1115 | 299 |
| 1224 | 3300053080 | Ga0500635_0005946 | Ga0500635_0005946_2083_2997 | 299 |
| 1225 | 3300053084 | Ga0495595_0000758 | Ga0495595_0000758_11191_12105 | 299 |
| 1226 | 3300053084 | Ga0495595_0028949 | Ga0495595_0028949_1025_1939 | 299 |
| 1227 | 3300053085 | Ga0495619_0000617 | Ga0495619_0000617_18657_19571 | 299 |
| 1228 | 3300053086 | Ga0500578_0170696 | Ga0500578_0170696_35_955 | 299 |
| 1229 | 3300053087 | Ga0500643_000168 | Ga0500643_000168_63821_64747 | 299 |
| 1230 | 3300053091 | Ga0500647_0056019 | Ga0500647_0056019_352_1272 | 299 |
| 1231 | 3300053094 | Ga0500566_0015378 | Ga0500566_0015378_3306_4226 | 299 |
| 1232 | 3300053096 | Ga0500641_0014207 | Ga0500641_0014207_752_1666 | 299 |
| 1233 | 3300053102 | Ga0500554_002374 | Ga0500554_002374_1015_1929 | 299 |
| 1234 | 3300053103 | Ga0500555_003167 | Ga0500555_003167_1180_2106 | 299 |
| 1235 | 3300053105 | Ga0500557_000032 | Ga0500557_000032_52920_53840 | 299 |
| 1236 | 3300053108 | Ga0500562_020004 | Ga0500562_020004_794_1720 | 299 |
| 1237 | 3300053111 | Ga0500572_009776 | Ga0500572_009776_837_1751 | 299 |
| 1238 | 3300053119 | Ga0500595_028598 | Ga0500595_028598_535_1455 | 299 |
| 1239 | 3300053130 | Ga0500642_0000183 | Ga0500642_0000183_15531_16451 | 299 |
| 1240 | 3300053133 | Ga0500655_009751 | Ga0500655_009751_235_1161 | 299 |
| 1241 | 3300053136 | Ga0500559_0001644 | Ga0500559_0001644_10810_11724 | 299 |
| 1242 | 3300053136 | Ga0500559_0004871 | Ga0500559_0004871_993_1913 | 299 |
| 1243 | 3300053150 | Ga0500603_000576 | Ga0500603_000576_3939_4853 | 299 |
| 1244 | 3300053155 | Ga0500620_038702 | Ga0500620_038702_507_1427 | 299 |
| 1245 | 3300053156 | Ga0500622_0008137 | Ga0500622_0008137_221_1147 | 299 |
| 1246 | 3300053162 | Ga0500638_152477 | Ga0500638_152477_89_1009 | 299 |
| 1247 | 3300053177 | Ga0500636_0000592 | Ga0500636_0000592_2579_3499 | 299 |
| 1248 | 3300053177 | Ga0500636_0009727 | Ga0500636_0009727_469_1389 | 299 |
| 1249 | 3300053729 | Ga0500625_000232 | Ga0500625_000232_3825_4745 | 299 |
| 1250 | 3300053730 | Ga0500645_007739 | Ga0500645_007739_2727_3641 | 299 |
| 1251 | 3300053730 | Ga0500645_016840 | Ga0500645_016840_653_1579 | 299 |
| 1252 | 3300053731 | Ga0500609_009207 | Ga0500609_009207_395_1315 | 299 |
| 1253 | 3300053735 | Ga0500596_003966 | Ga0500596_003966_228_1142 | 299 |
| 1254 | 3300053737 | Ga0500601_000888 | Ga0500601_000888_1471_2391 | 299 |
| 1255 | 3300060353 | Ga0501082_0417925 | Ga0501082_0417925_70_984 | 299 |
| 1256 | 3300061734 | Ga0530510_0315050 | Ga0530510_0315050_71_985 | 299 |
| 1257 | iso_pu_bacteria | 2517093001 | 2517103118 | 299 |
| 1258 | iso_pu_bacteria | 2643221547 | 2643755027 | 299 |
| 1259 | iso_pu_bacteria | 2935630451 | 2935632812 | 299 |
| 1260 | iso_pu_bacteria | 2941507105 | 2941508524 | 299 |
| 1261 | iso_pu_bacteria | 2941515067 | 2941516354 | 299 |
| 1262 | iso_pu_bacteria | 2941523033 | 2941524630 | 299 |
| 1263 | 3300006028 | Ga0070717_10032241 | Ga0070717_100322412 | 300 |
| 1264 | 3300025917 | Ga0207660_10145361 | Ga0207660_101453611 | 300 |
| 1265 | 3300025928 | Ga0207700_10015603 | Ga0207700_100156032 | 300 |
| 1266 | 3300031247 | Ga0265340_10068207 | Ga0265340_100682072 | 300 |
| 1267 | 3300031344 | Ga0265316_10159503 | Ga0265316_101595032 | 300 |
| 1268 | 3300035086 | Ga0373934_0006879 | Ga0373934_0006879_1173_2075 | 300 |
| 1269 | 3300035117 | Ga0373953_0007780 | Ga0373953_0007780_1252_2154 | 300 |
| 1270 | 3300035118 | Ga0373954_0037525 | Ga0373954_0037525_155_1057 | 300 |
| 1271 | 3300035119 | Ga0373956_0019212 | Ga0373956_0019212_190_1092 | 300 |
| 1272 | 3300035120 | Ga0373957_0004673 | Ga0373957_0004673_911_1813 | 300 |
| 1273 | 3300035172 | Ga0373955_0009253 | Ga0373955_0009253_1539_2441 | 300 |
| 1274 | 3300036401 | Ga0373937_0022299 | Ga0373937_0022299_866_1768 | 300 |
| 1275 | 3300036401 | Ga0373937_0053422 | Ga0373937_0053422_782_1693 | 300 |
| 1276 | 3300037312 | Ga0395899_0009278 | Ga0395899_0009278_6003_6908 | 300 |
| 1277 | 3300037418 | Ga0395900_0008470 | Ga0395900_0008470_8381_9286 | 300 |
| 1278 | 3300037466 | Ga0395898_0004229 | Ga0395898_0004229_2063_2968 | 300 |
| 1279 | 3300044694 | Ga0466963_0226495 | Ga0466963_0226495_332_1234 | 300 |
| 1280 | 3300044842 | Ga0466957_0173954 | Ga0466957_0173954_449_1351 | 300 |
| 1281 | 3300046462 | Ga0495651_0127727 | Ga0495651_0127727_560_1471 | 300 |
| 1282 | 3300046514 | Ga0495618_0242587 | Ga0495618_0242587_31_942 | 300 |
| 1283 | 3300046533 | Ga0495640_0120148 | Ga0495640_0120148_410_1321 | 300 |
| 1284 | 3300046536 | Ga0495587_0020301 | Ga0495587_0020301_2003_2905 | 300 |
| 1285 | 3300046536 | Ga0495587_0100858 | Ga0495587_0100858_467_1378 | 300 |
| 1286 | 3300046559 | Ga0495667_0013308 | Ga0495667_0013308_3690_4592 | 300 |
| 1287 | 3300046559 | Ga0495667_0035656 | Ga0495667_0035656_1469_2380 | 300 |
| 1288 | 3300046675 | Ga0495657_0017121 | Ga0495657_0017121_3847_4749 | 300 |
| 1289 | 3300047317 | Ga0495604_0075876 | Ga0495604_0075876_288_1199 | 300 |
| 1290 | 3300047317 | Ga0495604_0121326 | Ga0495604_0121326_871_1773 | 300 |
| 1291 | 3300047319 | Ga0495674_0030976 | Ga0495674_0030976_853_1764 | 300 |
| 1292 | 3300047322 | Ga0495680_0024601 | Ga0495680_0024601_2551_3453 | 300 |
| 1293 | 3300047322 | Ga0495680_0024704 | Ga0495680_0024704_3904_4815 | 300 |
| 1294 | 3300048088 | Ga0495602_0048324 | Ga0495602_0048324_1647_2549 | 300 |
| 1295 | 3300053077 | Ga0495601_0000347 | Ga0495601_0000347_5910_6821 | 300 |
| 1296 | 3300053077 | Ga0495601_0000946 | Ga0495601_0000946_1698_2600 | 300 |
| 1297 | 3300053084 | Ga0495595_0015410 | Ga0495595_0015410_500_1411 | 300 |
| 1298 | 3300053085 | Ga0495619_0000083 | Ga0495619_0000083_26175_27086 | 300 |
| 1299 | 3300053085 | Ga0495619_0012446 | Ga0495619_0012446_1795_2697 | 300 |
| 1300 | 3300061734 | Ga0530510_0024112 | Ga0530510_0024112_1837_2757 | 300 |
| 1301 | 3300005434 | Ga0070709_10014093 | Ga0070709_100140934 | 301 |
| 1302 | 3300005437 | Ga0070710_10095144 | Ga0070710_100951442 | 301 |
| 1303 | 3300021384 | Ga0213876_10027481 | Ga0213876_100274812 | 301 |
| 1304 | 3300025898 | Ga0207692_10025398 | Ga0207692_100253982 | 301 |
| 1305 | 3300031241 | Ga0265325_10000030 | Ga0265325_1000003063 | 301 |
| 1306 | 3300031247 | Ga0265340_10069793 | Ga0265340_100697932 | 301 |
| 1307 | 3300031247 | Ga0265340_10070799 | Ga0265340_100707992 | 301 |
| 1308 | 3300031595 | Ga0265313_10005929 | Ga0265313_100059299 | 301 |
| 1309 | 3300032133 | Ga0316583_10001485 | Ga0316583_100014852 | 301 |
| 1310 | 3300035117 | Ga0373953_0081173 | Ga0373953_0081173_335_1240 | 301 |
| 1311 | 3300035119 | Ga0373956_0050946 | Ga0373956_0050946_407_1312 | 301 |
| 1312 | 3300035170 | Ga0373943_0010318 | Ga0373943_0010318_1670_2575 | 301 |
| 1313 | 3300035172 | Ga0373955_0002139 | Ga0373955_0002139_1759_2664 | 301 |
| 1314 | 3300035410 | Ga0373924_0014039 | Ga0373924_0014039_340_1245 | 301 |
| 1315 | 3300035695 | Ga0373927_0049781 | Ga0373927_0049781_205_1110 | 301 |
| 1316 | 3300035724 | Ga0373933_0036074 | Ga0373933_0036074_1477_2382 | 301 |
| 1317 | 3300036401 | Ga0373937_0032052 | Ga0373937_0032052_2722_3627 | 301 |
| 1318 | 3300037068 | Ga0373925_0023355 | Ga0373925_0023355_2758_3663 | 301 |
| 1319 | 3300046454 | Ga0495592_0008094 | Ga0495592_0008094_6006_6911 | 301 |
| 1320 | 3300046462 | Ga0495651_0090115 | Ga0495651_0090115_339_1244 | 301 |
| 1321 | 3300046516 | Ga0495628_0011769 | Ga0495628_0011769_954_1859 | 301 |
| 1322 | 3300046529 | Ga0495652_0010453 | Ga0495652_0010453_2936_3841 | 301 |
| 1323 | 3300046536 | Ga0495587_0087729 | Ga0495587_0087729_445_1350 | 301 |
| 1324 | 3300046543 | Ga0495645_0003334 | Ga0495645_0003334_1808_2713 | 301 |
| 1325 | 3300046559 | Ga0495667_0001880 | Ga0495667_0001880_9395_10300 | 301 |
| 1326 | 3300046663 | Ga0495635_0114367 | Ga0495635_0114367_904_1809 | 301 |
| 1327 | 3300046675 | Ga0495657_0174238 | Ga0495657_0174238_350_1255 | 301 |
| 1328 | 3300046678 | Ga0495599_0006442 | Ga0495599_0006442_856_1761 | 301 |
| 1329 | 3300046679 | Ga0495623_0028685 | Ga0495623_0028685_1609_2514 | 301 |
| 1330 | 3300046809 | Ga0495600_0086189 | Ga0495600_0086189_1089_1994 | 301 |
| 1331 | 3300047317 | Ga0495604_0003605 | Ga0495604_0003605_6704_7609 | 301 |
| 1332 | 3300047322 | Ga0495680_0002772 | Ga0495680_0002772_14259_15164 | 301 |
| 1333 | 3300047444 | Ga0495675_0087197 | Ga0495675_0087197_897_1802 | 301 |
| 1334 | 3300048088 | Ga0495602_0031862 | Ga0495602_0031862_1748_2653 | 301 |
| 1335 | 3300048907 | Ga0496104_0000065 | Ga0496104_0000065_57535_58440 | 301 |
| 1336 | 3300048907 | Ga0496104_0144029 | Ga0496104_0144029_590_1534 | 301 |
| 1337 | 3300048908 | Ga0496105_0000338 | Ga0496105_0000338_7289_8194 | 301 |
| 1338 | 3300048912 | Ga0496109_0213887 | Ga0496109_0213887_64_1008 | 301 |
| 1339 | 3300048918 | Ga0496115_0329554 | Ga0496115_0329554_190_1095 | 301 |
| 1340 | 3300053077 | Ga0495601_0000111 | Ga0495601_0000111_2793_3698 | 301 |
| 1341 | 3300053078 | Ga0495612_0001438 | Ga0495612_0001438_1872_2777 | 301 |
| 1342 | 3300053084 | Ga0495595_0000587 | Ga0495595_0000587_3609_4514 | 301 |
| 1343 | 3300053085 | Ga0495619_0000296 | Ga0495619_0000296_8433_9338 | 301 |
| 1344 | 3300005434 | Ga0070709_10002761 | Ga0070709_100027613 | 302 |
| 1345 | 3300005435 | Ga0070714_100008916 | Ga0070714_1000089161 | 302 |
| 1346 | 3300005436 | Ga0070713_100000399 | Ga0070713_10000039916 | 302 |
| 1347 | 3300005436 | Ga0070713_100193756 | Ga0070713_1001937562 | 302 |
| 1348 | 3300005437 | Ga0070710_10039926 | Ga0070710_100399263 | 302 |
| 1349 | 3300005439 | Ga0070711_100056042 | Ga0070711_1000560423 | 302 |
| 1350 | 3300006163 | Ga0070715_10001341 | Ga0070715_100013413 | 302 |
| 1351 | 3300006175 | Ga0070712_100014542 | Ga0070712_1000145423 | 302 |
| 1352 | 3300009147 | Ga0114129_10344682 | Ga0114129_103446822 | 302 |
| 1353 | 3300025905 | Ga0207685_10021771 | Ga0207685_100217713 | 302 |
| 1354 | 3300025906 | Ga0207699_10008397 | Ga0207699_100083973 | 302 |
| 1355 | 3300025915 | Ga0207693_10052221 | Ga0207693_100522213 | 302 |
| 1356 | 3300025916 | Ga0207663_10000486 | Ga0207663_100004863 | 302 |
| 1357 | 3300025928 | Ga0207700_10002081 | Ga0207700_100020817 | 302 |
| 1358 | 3300025929 | Ga0207664_10012679 | Ga0207664_100126796 | 302 |
| 1359 | 3300025929 | Ga0207664_10496495 | Ga0207664_104964952 | 302 |
| 1360 | 3300025939 | Ga0207665_10016785 | Ga0207665_100167853 | 302 |
| 1361 | 3300034818 | Ga0373950_0002852 | Ga0373950_0002852_1354_2262 | 302 |
| 1362 | 3300035695 | Ga0373927_0272536 | Ga0373927_0272536_48_1061 | 302 |
| 1363 | 3300035725 | Ga0373947_0011238 | Ga0373947_0011238_3949_4869 | 302 |
| 1364 | 3300037068 | Ga0373925_0352427 | Ga0373925_0352427_93_1106 | 302 |
| 1365 | 3300039437 | Ga0436365_0291314 | Ga0436365_0291314_2509_3453 | 302 |
| 1366 | 3300039437 | Ga0436365_0759284 | Ga0436365_0759284_549_1496 | 302 |
| 1367 | 3300046462 | Ga0495651_0079310 | Ga0495651_0079310_1486_2409 | 302 |
| 1368 | 3300046499 | Ga0495594_0247000 | Ga0495594_0247000_47_967 | 302 |
| 1369 | 3300046514 | Ga0495618_0185643 | Ga0495618_0185643_192_1139 | 302 |
| 1370 | 3300046526 | Ga0495666_0081772 | Ga0495666_0081772_388_1308 | 302 |
| 1371 | 3300046536 | Ga0495587_0241562 | Ga0495587_0241562_42_989 | 302 |
| 1372 | 3300046642 | Ga0495634_0129721 | Ga0495634_0129721_25_945 | 302 |
| 1373 | 3300046689 | Ga0495613_0187711 | Ga0495613_0187711_120_1040 | 302 |
| 1374 | 3300046690 | Ga0495624_0065072 | Ga0495624_0065072_665_1585 | 302 |
| 1375 | 3300047319 | Ga0495674_0008197 | Ga0495674_0008197_1998_2918 | 302 |
| 1376 | 3300047322 | Ga0495680_0154704 | Ga0495680_0154704_24_971 | 302 |
| 1377 | 3300048910 | Ga0496107_0099528 | Ga0496107_0099528_758_1723 | 302 |
| 1378 | 3300048913 | Ga0496110_0257349 | Ga0496110_0257349_176_1123 | 302 |
| 1379 | 3300048915 | Ga0496112_0596501 | Ga0496112_0596501_61_1008 | 302 |
| 1380 | 3300048918 | Ga0496115_0215397 | Ga0496115_0215397_511_1500 | 302 |
| 1381 | 3300049571 | Ga0501034_0000295 | Ga0501034_0000295_84714_85658 | 302 |
| 1382 | 3300049571 | Ga0501034_0000772 | Ga0501034_0000772_15949_16893 | 302 |
| 1383 | 3300049571 | Ga0501034_0040486 | Ga0501034_0040486_3534_4478 | 302 |
| 1384 | 3300049571 | Ga0501034_0049417 | Ga0501034_0049417_2726_3670 | 302 |
| 1385 | 3300049572 | Ga0501036_0000331 | Ga0501036_0000331_6105_7049 | 302 |
| 1386 | 3300049572 | Ga0501036_0030837 | Ga0501036_0030837_370_1314 | 302 |
| 1387 | 3300049573 | Ga0501037_0023340 | Ga0501037_0023340_1389_2333 | 302 |
| 1388 | 3300049573 | Ga0501037_0043750 | Ga0501037_0043750_1596_2540 | 302 |
| 1389 | 3300049573 | Ga0501037_0064326 | Ga0501037_0064326_1614_2558 | 302 |
| 1390 | 3300049573 | Ga0501037_0067329 | Ga0501037_0067329_1551_2459 | 302 |
| 1391 | 3300049575 | Ga0501039_0123188 | Ga0501039_0123188_334_1278 | 302 |
| 1392 | 3300049578 | Ga0501042_0372384 | Ga0501042_0372384_78_1022 | 302 |
| 1393 | 3300049579 | Ga0501043_0003336 | Ga0501043_0003336_10106_11050 | 302 |
| 1394 | 3300049579 | Ga0501043_0008689 | Ga0501043_0008689_3854_4798 | 302 |
| 1395 | 3300049579 | Ga0501043_0026869 | Ga0501043_0026869_679_1623 | 302 |
| 1396 | 3300049580 | Ga0501046_0124288 | Ga0501046_0124288_799_1743 | 302 |
| 1397 | 3300049581 | Ga0501047_0024878 | Ga0501047_0024878_4195_5139 | 302 |
| 1398 | 3300049581 | Ga0501047_0060399 | Ga0501047_0060399_879_1823 | 302 |
| 1399 | 3300049581 | Ga0501047_0390827 | Ga0501047_0390827_154_1062 | 302 |
| 1400 | 3300049581 | Ga0501047_0420749 | Ga0501047_0420749_16_960 | 302 |
| 1401 | 3300049582 | Ga0501048_0002157 | Ga0501048_0002157_12867_13811 | 302 |
| 1402 | 3300049582 | Ga0501048_0168602 | Ga0501048_0168602_495_1478 | 302 |
| 1403 | 3300049584 | Ga0501068_0056457 | Ga0501068_0056457_589_1533 | 302 |
| 1404 | 3300049586 | Ga0501070_0014900 | Ga0501070_0014900_3415_4359 | 302 |
| 1405 | 3300049586 | Ga0501070_0336501 | Ga0501070_0336501_117_1061 | 302 |
| 1406 | 3300049589 | Ga0501073_0018625 | Ga0501073_0018625_2672_3616 | 302 |
| 1407 | 3300049589 | Ga0501073_0022099 | Ga0501073_0022099_3575_4546 | 302 |
| 1408 | 3300049590 | Ga0501074_0047785 | Ga0501074_0047785_553_1497 | 302 |
| 1409 | 3300049590 | Ga0501074_0048678 | Ga0501074_0048678_998_1942 | 302 |
| 1410 | 3300049593 | Ga0501077_0156248 | Ga0501077_0156248_148_1092 | 302 |
| 1411 | 3300049742 | Ga0501080_0030702 | Ga0501080_0030702_4021_4965 | 302 |
| 1412 | 3300049742 | Ga0501080_0053747 | Ga0501080_0053747_572_1516 | 302 |
| 1413 | 3300049742 | Ga0501080_0133442 | Ga0501080_0133442_104_1048 | 302 |
| 1414 | 3300049742 | Ga0501080_0186440 | Ga0501080_0186440_914_1897 | 302 |
| 1415 | 3300049744 | Ga0501083_0031513 | Ga0501083_0031513_1554_2498 | 302 |
| 1416 | 3300049744 | Ga0501083_0072454 | Ga0501083_0072454_534_1517 | 302 |
| 1417 | 3300049744 | Ga0501083_0190012 | Ga0501083_0190012_198_1142 | 302 |
| 1418 | 3300049822 | Ga0501035_0083899 | Ga0501035_0083899_117_1100 | 302 |
| 1419 | 3300049822 | Ga0501035_0364180 | Ga0501035_0364180_189_1097 | 302 |
| 1420 | 3300049823 | Ga0501044_0017342 | Ga0501044_0017342_6207_7151 | 302 |
| 1421 | 3300049823 | Ga0501044_0271456 | Ga0501044_0271456_572_1555 | 302 |
| 1422 | 3300050515 | nmdc:mga0a205_398835_c1 | nmdc:mga0a205_398835_c1_53_1018 | 302 |
| 1423 | 3300053077 | Ga0495601_0004646 | Ga0495601_0004646_4473_5393 | 302 |
| 1424 | 3300053078 | Ga0495612_0065498 | Ga0495612_0065498_535_1482 | 302 |
| 1425 | 3300053084 | Ga0495595_0043394 | Ga0495595_0043394_586_1533 | 302 |
| 1426 | 3300053093 | Ga0500651_0007251 | Ga0500651_0007251_4620_5540 | 302 |
| 1427 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_281041_281949 | 302 |
| 1428 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1472464_1473444 | 302 |
| 1429 | 3300053730 | Ga0500645_000675 | Ga0500645_000675_14487_15407 | 302 |
| 1430 | 3300060353 | Ga0501082_0235527 | Ga0501082_0235527_133_1041 | 302 |
| 1431 | 2209111006 | 2214775796 | 2213796913 | 303 |
| 1432 | 3300000041 | ARcpr5oldR_c000014 | ARcpr5oldR_00001413 | 303 |
| 1433 | 3300000042 | ARSoilYngRDRAFT_c00094 | ARSoilYngRDRAFT_0009410 | 303 |
| 1434 | 3300000043 | ARcpr5yngRDRAFT_c000058 | ARcpr5yngRDRAFT_0000584 | 303 |
| 1435 | 3300000044 | ARSoilOldRDRAFT_c000007 | ARSoilOldRDRAFT_00000737 | 303 |
| 1436 | 3300000045 | ARCol0oldRDRAFT_c00221 | ARCol0oldRDRAFT_002213 | 303 |
| 1437 | 3300000652 | ARCol0yngRDRAFT_1000009 | ARCol0yngRDRAFT_100000920 | 303 |
| 1438 | 3300001430 | JGI24032J14994_100677 | JGI24032J14994_1006772 | 303 |
| 1439 | 3300001915 | JGI24741J21665_1011668 | JGI24741J21665_10116682 | 303 |
| 1440 | 3300001976 | JGI24752J21851_1002204 | JGI24752J21851_10022042 | 303 |
| 1441 | 3300001978 | JGI24747J21853_1001137 | JGI24747J21853_10011372 | 303 |
| 1442 | 3300001989 | JGI24739J22299_10010412 | JGI24739J22299_100104122 | 303 |
| 1443 | 3300001990 | JGI24737J22298_10021581 | JGI24737J22298_100215812 | 303 |
| 1444 | 3300002070 | JGI24750J21931_1000699 | JGI24750J21931_10006992 | 303 |
| 1445 | 3300002073 | JGI24745J21846_1000166 | JGI24745J21846_10001662 | 303 |
| 1446 | 3300002075 | JGI24738J21930_10001608 | JGI24738J21930_100016084 | 303 |
| 1447 | 3300002076 | JGI24749J21850_1005910 | JGI24749J21850_10059102 | 303 |
| 1448 | 3300002077 | JGI24744J21845_10011953 | JGI24744J21845_100119532 | 303 |
| 1449 | 3300002126 | JGI24035J26624_1002415 | JGI24035J26624_10024152 | 303 |
| 1450 | 3300002155 | JGI24033J26618_1000651 | JGI24033J26618_10006512 | 303 |
| 1451 | 3300002239 | JGI24034J26672_10004455 | JGI24034J26672_100044552 | 303 |
| 1452 | 3300002244 | JGI24742J22300_10006743 | JGI24742J22300_100067432 | 303 |
| 1453 | 3300002459 | JGI24751J29686_10019326 | JGI24751J29686_100193261 | 303 |
| 1454 | 3300005276 | Ga0065717_1003292 | Ga0065717_10032921 | 303 |
| 1455 | 3300005288 | Ga0065714_10115997 | Ga0065714_101159971 | 303 |
| 1456 | 3300005289 | Ga0065704_10019537 | Ga0065704_100195372 | 303 |
| 1457 | 3300005290 | Ga0065712_10001073 | Ga0065712_100010733 | 303 |
| 1458 | 3300005290 | Ga0065712_10136646 | Ga0065712_101366462 | 303 |
| 1459 | 3300005293 | Ga0065715_10005375 | Ga0065715_100053752 | 303 |
| 1460 | 3300005293 | Ga0065715_10108905 | Ga0065715_101089052 | 303 |
| 1461 | 3300005295 | Ga0065707_10162208 | Ga0065707_101622081 | 303 |
| 1462 | 3300005327 | Ga0070658_10029096 | Ga0070658_100290962 | 303 |
| 1463 | 3300005328 | Ga0070676_10010461 | Ga0070676_100104612 | 303 |
| 1464 | 3300005330 | Ga0070690_100011006 | Ga0070690_1000110063 | 303 |
| 1465 | 3300005331 | Ga0070670_100012145 | Ga0070670_1000121456 | 303 |
| 1466 | 3300005331 | Ga0070670_100135211 | Ga0070670_1001352111 | 303 |
| 1467 | 3300005333 | Ga0070677_10000731 | Ga0070677_1000073111 | 303 |
| 1468 | 3300005334 | Ga0068869_100015435 | Ga0068869_1000154352 | 303 |
| 1469 | 3300005335 | Ga0070666_10024658 | Ga0070666_100246582 | 303 |
| 1470 | 3300005335 | Ga0070666_10128387 | Ga0070666_101283871 | 303 |
| 1471 | 3300005336 | Ga0070680_100019249 | Ga0070680_1000192492 | 303 |
| 1472 | 3300005336 | Ga0070680_100165630 | Ga0070680_1001656302 | 303 |
| 1473 | 3300005337 | Ga0070682_100013849 | Ga0070682_1000138492 | 303 |
| 1474 | 3300005338 | Ga0068868_100056620 | Ga0068868_1000566202 | 303 |
| 1475 | 3300005339 | Ga0070660_100001770 | Ga0070660_1000017702 | 303 |
| 1476 | 3300005340 | Ga0070689_100031509 | Ga0070689_1000315095 | 303 |
| 1477 | 3300005340 | Ga0070689_100122632 | Ga0070689_1001226322 | 303 |
| 1478 | 3300005341 | Ga0070691_10004889 | Ga0070691_100048893 | 303 |
| 1479 | 3300005343 | Ga0070687_100005741 | Ga0070687_1000057412 | 303 |
| 1480 | 3300005344 | Ga0070661_100025157 | Ga0070661_1000251572 | 303 |
| 1481 | 3300005345 | Ga0070692_10006550 | Ga0070692_100065502 | 303 |
| 1482 | 3300005347 | Ga0070668_100001862 | Ga0070668_1000018629 | 303 |
| 1483 | 3300005353 | Ga0070669_100002311 | Ga0070669_10000231114 | 303 |
| 1484 | 3300005354 | Ga0070675_100026314 | Ga0070675_1000263142 | 303 |
| 1485 | 3300005355 | Ga0070671_100027221 | Ga0070671_1000272212 | 303 |
| 1486 | 3300005355 | Ga0070671_100029720 | Ga0070671_1000297202 | 303 |
| 1487 | 3300005356 | Ga0070674_100062573 | Ga0070674_1000625733 | 303 |
| 1488 | 3300005364 | Ga0070673_100012367 | Ga0070673_1000123674 | 303 |
| 1489 | 3300005366 | Ga0070659_100002966 | Ga0070659_10000296611 | 303 |
| 1490 | 3300005435 | Ga0070714_100048021 | Ga0070714_1000480213 | 303 |
| 1491 | 3300005435 | Ga0070714_100093694 | Ga0070714_1000936942 | 303 |
| 1492 | 3300005435 | Ga0070714_100102386 | Ga0070714_1001023862 | 303 |
| 1493 | 3300005436 | Ga0070713_100002808 | Ga0070713_1000028082 | 303 |
| 1494 | 3300005436 | Ga0070713_100073833 | Ga0070713_1000738331 | 303 |
| 1495 | 3300005437 | Ga0070710_10036514 | Ga0070710_100365142 | 303 |
| 1496 | 3300005439 | Ga0070711_100006842 | Ga0070711_1000068427 | 303 |
| 1497 | 3300005439 | Ga0070711_100009346 | Ga0070711_1000093463 | 303 |
| 1498 | 3300005439 | Ga0070711_100145021 | Ga0070711_1001450211 | 303 |
| 1499 | 3300005440 | Ga0070705_100007363 | Ga0070705_1000073632 | 303 |
| 1500 | 3300005441 | Ga0070700_100012996 | Ga0070700_1000129962 | 303 |
| 1501 | 3300005455 | Ga0070663_100123894 | Ga0070663_1001238942 | 303 |
| 1502 | 3300005456 | Ga0070678_100014938 | Ga0070678_1000149382 | 303 |
| 1503 | 3300005456 | Ga0070678_100017054 | Ga0070678_1000170542 | 303 |
| 1504 | 3300005458 | Ga0070681_10006388 | Ga0070681_1000638810 | 303 |
| 1505 | 3300005458 | Ga0070681_10249245 | Ga0070681_102492452 | 303 |
| 1506 | 3300005459 | Ga0068867_100016521 | Ga0068867_1000165212 | 303 |
| 1507 | 3300005530 | Ga0070679_100033931 | Ga0070679_1000339312 | 303 |
| 1508 | 3300005535 | Ga0070684_100029086 | Ga0070684_1000290862 | 303 |
| 1509 | 3300005536 | Ga0070697_100177098 | Ga0070697_1001770982 | 303 |
| 1510 | 3300005539 | Ga0068853_100030191 | Ga0068853_1000301912 | 303 |
| 1511 | 3300005543 | Ga0070672_100002208 | Ga0070672_10000220811 | 303 |
| 1512 | 3300005544 | Ga0070686_100129660 | Ga0070686_1001296602 | 303 |
| 1513 | 3300005545 | Ga0070695_100000800 | Ga0070695_1000008003 | 303 |
| 1514 | 3300005546 | Ga0070696_100026211 | Ga0070696_1000262112 | 303 |
| 1515 | 3300005546 | Ga0070696_100063701 | Ga0070696_1000637013 | 303 |
| 1516 | 3300005547 | Ga0070693_100010396 | Ga0070693_1000103962 | 303 |
| 1517 | 3300005548 | Ga0070665_100059233 | Ga0070665_1000592332 | 303 |
| 1518 | 3300005563 | Ga0068855_100054636 | Ga0068855_1000546362 | 303 |
| 1519 | 3300005563 | Ga0068855_100599507 | Ga0068855_1005995071 | 303 |
| 1520 | 3300005564 | Ga0070664_100018373 | Ga0070664_1000183734 | 303 |
| 1521 | 3300005564 | Ga0070664_100066777 | Ga0070664_1000667773 | 303 |
| 1522 | 3300005564 | Ga0070664_100102414 | Ga0070664_1001024142 | 303 |
| 1523 | 3300005577 | Ga0068857_100000616 | Ga0068857_10000061628 | 303 |
| 1524 | 3300005578 | Ga0068854_100043694 | Ga0068854_1000436943 | 303 |
| 1525 | 3300005578 | Ga0068854_100185442 | Ga0068854_1001854422 | 303 |
| 1526 | 3300005614 | Ga0068856_100002724 | Ga0068856_1000027242 | 303 |
| 1527 | 3300005614 | Ga0068856_100511607 | Ga0068856_1005116072 | 303 |
| 1528 | 3300005615 | Ga0070702_100010977 | Ga0070702_1000109772 | 303 |
| 1529 | 3300005616 | Ga0068852_100011772 | Ga0068852_1000117723 | 303 |
| 1530 | 3300005617 | Ga0068859_100065834 | Ga0068859_1000658343 | 303 |
| 1531 | 3300005617 | Ga0068859_100243352 | Ga0068859_1002433522 | 303 |
| 1532 | 3300005617 | Ga0068859_100678183 | Ga0068859_1006781832 | 303 |
| 1533 | 3300005618 | Ga0068864_100022002 | Ga0068864_1000220025 | 303 |
| 1534 | 3300005618 | Ga0068864_100024791 | Ga0068864_1000247912 | 303 |
| 1535 | 3300005840 | Ga0068870_10008285 | Ga0068870_100082852 | 303 |
| 1536 | 3300005841 | Ga0068863_100001280 | Ga0068863_1000012802 | 303 |
| 1537 | 3300005841 | Ga0068863_100206995 | Ga0068863_1002069952 | 303 |
| 1538 | 3300005842 | Ga0068858_100025278 | Ga0068858_1000252782 | 303 |
| 1539 | 3300005842 | Ga0068858_100052822 | Ga0068858_1000528224 | 303 |
| 1540 | 3300005843 | Ga0068860_100026148 | Ga0068860_1000261483 | 303 |
| 1541 | 3300005844 | Ga0068862_100003249 | Ga0068862_1000032492 | 303 |
| 1542 | 3300005844 | Ga0068862_100080069 | Ga0068862_1000800692 | 303 |
| 1543 | 3300005937 | Ga0081455_10008343 | Ga0081455_100083433 | 303 |
| 1544 | 3300006028 | Ga0070717_10000998 | Ga0070717_1000099810 | 303 |
| 1545 | 3300006058 | Ga0075432_10000490 | Ga0075432_100004905 | 303 |
| 1546 | 3300006163 | Ga0070715_10015189 | Ga0070715_100151892 | 303 |
| 1547 | 3300006173 | Ga0070716_100010682 | Ga0070716_1000106822 | 303 |
| 1548 | 3300006175 | Ga0070712_100112939 | Ga0070712_1001129392 | 303 |
| 1549 | 3300006178 | Ga0075367_10017648 | Ga0075367_100176482 | 303 |
| 1550 | 3300006194 | Ga0075427_10000547 | Ga0075427_100005474 | 303 |
| 1551 | 3300006237 | Ga0097621_100013700 | Ga0097621_1000137003 | 303 |
| 1552 | 3300006237 | Ga0097621_100050975 | Ga0097621_1000509752 | 303 |
| 1553 | 3300006358 | Ga0068871_100002047 | Ga0068871_1000020472 | 303 |
| 1554 | 3300006358 | Ga0068871_100009147 | Ga0068871_1000091476 | 303 |
| 1555 | 3300006844 | Ga0075428_100003603 | Ga0075428_1000036039 | 303 |
| 1556 | 3300006846 | Ga0075430_100003714 | Ga0075430_1000037149 | 303 |
| 1557 | 3300006847 | Ga0075431_100003725 | Ga0075431_1000037254 | 303 |
| 1558 | 3300006852 | Ga0075433_10000029 | Ga0075433_1000002955 | 303 |
| 1559 | 3300006852 | Ga0075433_10068698 | Ga0075433_100686983 | 303 |
| 1560 | 3300006871 | Ga0075434_100002137 | Ga0075434_1000021373 | 303 |
| 1561 | 3300006871 | Ga0075434_100002244 | Ga0075434_1000022449 | 303 |
| 1562 | 3300006871 | Ga0075434_100038251 | Ga0075434_1000382514 | 303 |
| 1563 | 3300006871 | Ga0075434_100056362 | Ga0075434_1000563622 | 303 |
| 1564 | 3300006871 | Ga0075434_100568777 | Ga0075434_1005687772 | 303 |
| 1565 | 3300006880 | Ga0075429_100002021 | Ga0075429_1000020216 | 303 |
| 1566 | 3300006881 | Ga0068865_100017000 | Ga0068865_1000170002 | 303 |
| 1567 | 3300006914 | Ga0075436_100221423 | Ga0075436_1002214232 | 303 |
| 1568 | 3300006931 | Ga0097620_100065832 | Ga0097620_1000658323 | 303 |
| 1569 | 3300006931 | Ga0097620_100243334 | Ga0097620_1002433342 | 303 |
| 1570 | 3300006931 | Ga0097620_100678273 | Ga0097620_1006782732 | 303 |
| 1571 | 3300007076 | Ga0075435_100001612 | Ga0075435_1000016122 | 303 |
| 1572 | 3300007076 | Ga0075435_100052635 | Ga0075435_1000526352 | 303 |
| 1573 | 3300007076 | Ga0075435_100086197 | Ga0075435_1000861972 | 303 |
| 1574 | 3300007076 | Ga0075435_100107854 | Ga0075435_1001078543 | 303 |
| 1575 | 3300009011 | Ga0105251_10064341 | Ga0105251_100643412 | 303 |
| 1576 | 3300009036 | Ga0105244_10069538 | Ga0105244_100695382 | 303 |
| 1577 | 3300009093 | Ga0105240_10284374 | Ga0105240_102843742 | 303 |
| 1578 | 3300009094 | Ga0111539_10000345 | Ga0111539_1000034557 | 303 |
| 1579 | 3300009094 | Ga0111539_10001931 | Ga0111539_100019313 | 303 |
| 1580 | 3300009094 | Ga0111539_10002122 | Ga0111539_100021223 | 303 |
| 1581 | 3300009094 | Ga0111539_10060686 | Ga0111539_100606862 | 303 |
| 1582 | 3300009098 | Ga0105245_10251474 | Ga0105245_102514742 | 303 |
| 1583 | 3300009098 | Ga0105245_10270738 | Ga0105245_102707382 | 303 |
| 1584 | 3300009101 | Ga0105247_10002880 | Ga0105247_100028807 | 303 |
| 1585 | 3300009147 | Ga0114129_10037724 | Ga0114129_100377243 | 303 |
| 1586 | 3300009147 | Ga0114129_10054577 | Ga0114129_100545773 | 303 |
| 1587 | 3300009174 | Ga0105241_10017075 | Ga0105241_100170752 | 303 |
| 1588 | 3300009174 | Ga0105241_10060338 | Ga0105241_100603382 | 303 |
| 1589 | 3300009176 | Ga0105242_10007716 | Ga0105242_100077162 | 303 |
| 1590 | 3300009177 | Ga0105248_10051698 | Ga0105248_100516984 | 303 |
| 1591 | 3300009177 | Ga0105248_10084972 | Ga0105248_100849722 | 303 |
| 1592 | 3300009177 | Ga0105248_10098149 | Ga0105248_100981494 | 303 |
| 1593 | 3300009551 | Ga0105238_10031282 | Ga0105238_100312822 | 303 |
| 1594 | 3300009553 | Ga0105249_10016757 | Ga0105249_100167573 | 303 |
| 1595 | 3300009553 | Ga0105249_10017803 | Ga0105249_100178035 | 303 |
| 1596 | 3300009553 | Ga0105249_10089982 | Ga0105249_100899823 | 303 |
| 1597 | 3300010375 | Ga0105239_10041141 | Ga0105239_100411413 | 303 |
| 1598 | 3300010375 | Ga0105239_10057236 | Ga0105239_100572362 | 303 |
| 1599 | 3300010375 | Ga0105239_10369100 | Ga0105239_103691002 | 303 |
| 1600 | 3300011119 | Ga0105246_10009048 | Ga0105246_100090482 | 303 |
| 1601 | 3300011119 | Ga0105246_10242021 | Ga0105246_102420211 | 303 |
| 1602 | 3300011119 | Ga0105246_10538887 | Ga0105246_105388871 | 303 |
| 1603 | 3300012503 | Ga0157313_1000825 | Ga0157313_10008251 | 303 |
| 1604 | 3300013100 | Ga0157373_10188271 | Ga0157373_101882712 | 303 |
| 1605 | 3300013102 | Ga0157371_10026432 | Ga0157371_100264322 | 303 |
| 1606 | 3300013102 | Ga0157371_10103174 | Ga0157371_101031742 | 303 |
| 1607 | 3300013104 | Ga0157370_10083427 | Ga0157370_100834272 | 303 |
| 1608 | 3300013297 | Ga0157378_10015501 | Ga0157378_100155012 | 303 |
| 1609 | 3300013297 | Ga0157378_10111506 | Ga0157378_101115062 | 303 |
| 1610 | 3300013297 | Ga0157378_10332038 | Ga0157378_103320382 | 303 |
| 1611 | 3300013306 | Ga0163162_10004233 | Ga0163162_100042332 | 303 |
| 1612 | 3300013306 | Ga0163162_10346785 | Ga0163162_103467851 | 303 |
| 1613 | 3300013307 | Ga0157372_10023476 | Ga0157372_100234762 | 303 |
| 1614 | 3300013308 | Ga0157375_10004079 | Ga0157375_100040792 | 303 |
| 1615 | 3300013308 | Ga0157375_10266806 | Ga0157375_102668061 | 303 |
| 1616 | 3300014325 | Ga0163163_10038355 | Ga0163163_100383553 | 303 |
| 1617 | 3300014325 | Ga0163163_10063499 | Ga0163163_100634992 | 303 |
| 1618 | 3300014325 | Ga0163163_10214532 | Ga0163163_102145322 | 303 |
| 1619 | 3300014745 | Ga0157377_10005595 | Ga0157377_100055952 | 303 |
| 1620 | 3300014968 | Ga0157379_10019419 | Ga0157379_100194193 | 303 |
| 1621 | 3300014968 | Ga0157379_10047425 | Ga0157379_100474252 | 303 |
| 1622 | 3300014968 | Ga0157379_10344951 | Ga0157379_103449512 | 303 |
| 1623 | 3300014969 | Ga0157376_10045995 | Ga0157376_100459952 | 303 |
| 1624 | 3300017792 | Ga0163161_10003992 | Ga0163161_100039922 | 303 |
| 1625 | 3300017792 | Ga0163161_10129022 | Ga0163161_101290222 | 303 |
| 1626 | 3300017792 | Ga0163161_10174870 | Ga0163161_101748702 | 303 |
| 1627 | 3300020070 | Ga0206356_11266266 | Ga0206356_112662666 | 303 |
| 1628 | 3300025290 | Ga0207673_1000001 | Ga0207673_100000131 | 303 |
| 1629 | 3300025893 | Ga0207682_10000254 | Ga0207682_100002546 | 303 |
| 1630 | 3300025898 | Ga0207692_10070524 | Ga0207692_100705242 | 303 |
| 1631 | 3300025900 | Ga0207710_10010813 | Ga0207710_100108133 | 303 |
| 1632 | 3300025900 | Ga0207710_10014720 | Ga0207710_100147202 | 303 |
| 1633 | 3300025900 | Ga0207710_10057463 | Ga0207710_100574632 | 303 |
| 1634 | 3300025901 | Ga0207688_10000518 | Ga0207688_100005183 | 303 |
| 1635 | 3300025903 | Ga0207680_10088009 | Ga0207680_100880092 | 303 |
| 1636 | 3300025904 | Ga0207647_10012374 | Ga0207647_100123742 | 303 |
| 1637 | 3300025907 | Ga0207645_10000249 | Ga0207645_1000024945 | 303 |
| 1638 | 3300025908 | Ga0207643_10000978 | Ga0207643_1000097814 | 303 |
| 1639 | 3300025911 | Ga0207654_10017523 | Ga0207654_100175232 | 303 |
| 1640 | 3300025912 | Ga0207707_10016918 | Ga0207707_100169183 | 303 |
| 1641 | 3300025912 | Ga0207707_10036558 | Ga0207707_100365582 | 303 |
| 1642 | 3300025912 | Ga0207707_10110818 | Ga0207707_101108182 | 303 |
| 1643 | 3300025912 | Ga0207707_10286287 | Ga0207707_102862871 | 303 |
| 1644 | 3300025913 | Ga0207695_10200231 | Ga0207695_102002312 | 303 |
| 1645 | 3300025914 | Ga0207671_10205156 | Ga0207671_102051562 | 303 |
| 1646 | 3300025915 | Ga0207693_10001489 | Ga0207693_100014898 | 303 |
| 1647 | 3300025915 | Ga0207693_10042947 | Ga0207693_100429473 | 303 |
| 1648 | 3300025916 | Ga0207663_10012940 | Ga0207663_100129404 | 303 |
| 1649 | 3300025916 | Ga0207663_10152537 | Ga0207663_101525372 | 303 |
| 1650 | 3300025917 | Ga0207660_10001490 | Ga0207660_1000149016 | 303 |
| 1651 | 3300025918 | Ga0207662_10076038 | Ga0207662_100760383 | 303 |
| 1652 | 3300025919 | Ga0207657_10217252 | Ga0207657_102172522 | 303 |
| 1653 | 3300025920 | Ga0207649_10006897 | Ga0207649_100068972 | 303 |
| 1654 | 3300025921 | Ga0207652_10045557 | Ga0207652_100455572 | 303 |
| 1655 | 3300025921 | Ga0207652_10226959 | Ga0207652_102269592 | 303 |
| 1656 | 3300025923 | Ga0207681_10000956 | Ga0207681_100009563 | 303 |
| 1657 | 3300025925 | Ga0207650_10030055 | Ga0207650_100300554 | 303 |
| 1658 | 3300025925 | Ga0207650_10074218 | Ga0207650_100742182 | 303 |
| 1659 | 3300025926 | Ga0207659_10006156 | Ga0207659_100061566 | 303 |
| 1660 | 3300025927 | Ga0207687_10017120 | Ga0207687_100171202 | 303 |
| 1661 | 3300025927 | Ga0207687_10230891 | Ga0207687_102308912 | 303 |
| 1662 | 3300025927 | Ga0207687_10403339 | Ga0207687_104033392 | 303 |
| 1663 | 3300025929 | Ga0207664_10037810 | Ga0207664_100378103 | 303 |
| 1664 | 3300025929 | Ga0207664_10048501 | Ga0207664_100485012 | 303 |
| 1665 | 3300025931 | Ga0207644_10015163 | Ga0207644_100151632 | 303 |
| 1666 | 3300025931 | Ga0207644_10018487 | Ga0207644_100184872 | 303 |
| 1667 | 3300025931 | Ga0207644_10033779 | Ga0207644_100337792 | 303 |
| 1668 | 3300025932 | Ga0207690_10000546 | Ga0207690_1000054624 | 303 |
| 1669 | 3300025932 | Ga0207690_10165952 | Ga0207690_101659522 | 303 |
| 1670 | 3300025932 | Ga0207690_10493916 | Ga0207690_104939161 | 303 |
| 1671 | 3300025933 | Ga0207706_10020138 | Ga0207706_100201385 | 303 |
| 1672 | 3300025933 | Ga0207706_10126312 | Ga0207706_101263122 | 303 |
| 1673 | 3300025934 | Ga0207686_10007493 | Ga0207686_100074933 | 303 |
| 1674 | 3300025935 | Ga0207709_10005105 | Ga0207709_100051055 | 303 |
| 1675 | 3300025936 | Ga0207670_10002637 | Ga0207670_100026373 | 303 |
| 1676 | 3300025936 | Ga0207670_10056573 | Ga0207670_100565732 | 303 |
| 1677 | 3300025936 | Ga0207670_10084579 | Ga0207670_100845792 | 303 |
| 1678 | 3300025937 | Ga0207669_10002362 | Ga0207669_100023622 | 303 |
| 1679 | 3300025938 | Ga0207704_10000964 | Ga0207704_1000096410 | 303 |
| 1680 | 3300025938 | Ga0207704_10098483 | Ga0207704_100984832 | 303 |
| 1681 | 3300025939 | Ga0207665_10002530 | Ga0207665_100025308 | 303 |
| 1682 | 3300025940 | Ga0207691_10001481 | Ga0207691_1000148110 | 303 |
| 1683 | 3300025941 | Ga0207711_10023845 | Ga0207711_100238452 | 303 |
| 1684 | 3300025941 | Ga0207711_10094808 | Ga0207711_100948082 | 303 |
| 1685 | 3300025942 | Ga0207689_10000424 | Ga0207689_1000042415 | 303 |
| 1686 | 3300025942 | Ga0207689_10087700 | Ga0207689_100877002 | 303 |
| 1687 | 3300025944 | Ga0207661_10001905 | Ga0207661_100019055 | 303 |
| 1688 | 3300025944 | Ga0207661_10028196 | Ga0207661_100281962 | 303 |
| 1689 | 3300025945 | Ga0207679_10000595 | Ga0207679_1000059516 | 303 |
| 1690 | 3300025949 | Ga0207667_10058089 | Ga0207667_100580894 | 303 |
| 1691 | 3300025949 | Ga0207667_10064756 | Ga0207667_100647562 | 303 |
| 1692 | 3300025960 | Ga0207651_10020112 | Ga0207651_100201122 | 303 |
| 1693 | 3300025961 | Ga0207712_10018492 | Ga0207712_100184922 | 303 |
| 1694 | 3300025961 | Ga0207712_10023939 | Ga0207712_100239392 | 303 |
| 1695 | 3300025961 | Ga0207712_10121382 | Ga0207712_101213822 | 303 |
| 1696 | 3300025972 | Ga0207668_10006840 | Ga0207668_100068403 | 303 |
| 1697 | 3300025981 | Ga0207640_10007609 | Ga0207640_100076092 | 303 |
| 1698 | 3300025981 | Ga0207640_10023862 | Ga0207640_100238622 | 303 |
| 1699 | 3300025986 | Ga0207658_10020702 | Ga0207658_100207022 | 303 |
| 1700 | 3300025986 | Ga0207658_10067626 | Ga0207658_100676262 | 303 |
| 1701 | 3300026023 | Ga0207677_10032859 | Ga0207677_100328592 | 303 |
| 1702 | 3300026035 | Ga0207703_10035107 | Ga0207703_100351072 | 303 |
| 1703 | 3300026041 | Ga0207639_10006156 | Ga0207639_100061562 | 303 |
| 1704 | 3300026067 | Ga0207678_10059424 | Ga0207678_100594242 | 303 |
| 1705 | 3300026078 | Ga0207702_10043737 | Ga0207702_100437372 | 303 |
| 1706 | 3300026088 | Ga0207641_10024879 | Ga0207641_100248792 | 303 |
| 1707 | 3300026089 | Ga0207648_10001553 | Ga0207648_1000155315 | 303 |
| 1708 | 3300026095 | Ga0207676_10013306 | Ga0207676_100133062 | 303 |
| 1709 | 3300026121 | Ga0207683_10011960 | Ga0207683_100119603 | 303 |
| 1710 | 3300026121 | Ga0207683_10016218 | Ga0207683_100162182 | 303 |
| 1711 | 3300026121 | Ga0207683_10030540 | Ga0207683_100305402 | 303 |
| 1712 | 3300026142 | Ga0207698_10001038 | Ga0207698_1000103811 | 303 |
| 1713 | 3300027364 | Ga0209967_1007987 | Ga0209967_10079872 | 303 |
| 1714 | 3300027526 | Ga0209968_1006106 | Ga0209968_10061063 | 303 |
| 1715 | 3300027552 | Ga0209982_1004320 | Ga0209982_10043202 | 303 |
| 1716 | 3300027614 | Ga0209970_1005990 | Ga0209970_10059902 | 303 |
| 1717 | 3300027695 | Ga0209966_1003959 | Ga0209966_10039592 | 303 |
| 1718 | 3300027717 | Ga0209998_10002627 | Ga0209998_100026272 | 303 |
| 1719 | 3300027876 | Ga0209974_10006301 | Ga0209974_100063012 | 303 |
| 1720 | 3300027907 | Ga0207428_10000150 | Ga0207428_1000015065 | 303 |
| 1721 | 3300027907 | Ga0207428_10000360 | Ga0207428_1000036057 | 303 |
| 1722 | 3300027907 | Ga0207428_10001312 | Ga0207428_1000131226 | 303 |
| 1723 | 3300027907 | Ga0207428_10036448 | Ga0207428_100364485 | 303 |
| 1724 | 3300028379 | Ga0268266_10011617 | Ga0268266_100116177 | 303 |
| 1725 | 3300028380 | Ga0268265_10011427 | Ga0268265_100114272 | 303 |
| 1726 | 3300028381 | Ga0268264_10004770 | Ga0268264_100047703 | 303 |
| 1727 | 3300028800 | Ga0265338_10085973 | Ga0265338_100859732 | 303 |
| 1728 | 3300031235 | Ga0265330_10025682 | Ga0265330_100256822 | 303 |
| 1729 | 3300031247 | Ga0265340_10144623 | Ga0265340_101446231 | 303 |
| 1730 | 3300031712 | Ga0265342_10046678 | Ga0265342_100466782 | 303 |
| 1731 | 3300034816 | Ga0373930_0001257 | Ga0373930_0001257_2275_3186 | 303 |
| 1732 | 3300034817 | Ga0373948_0000908 | Ga0373948_0000908_1043_1954 | 303 |
| 1733 | 3300034819 | Ga0373958_0000355 | Ga0373958_0000355_1382_2293 | 303 |
| 1734 | 3300034820 | Ga0373959_0000802 | Ga0373959_0000802_65_976 | 303 |
| 1735 | 3300034957 | Ga0373938_0000819 | Ga0373938_0000819_244_1155 | 303 |
| 1736 | 3300034957 | Ga0373938_0004439 | Ga0373938_0004439_1384_2295 | 303 |
| 1737 | 3300035083 | Ga0373926_0014919 | Ga0373926_0014919_1659_2585 | 303 |
| 1738 | 3300035084 | Ga0373928_0004165 | Ga0373928_0004165_1781_2692 | 303 |
| 1739 | 3300035085 | Ga0373929_0000724 | Ga0373929_0000724_4226_5137 | 303 |
| 1740 | 3300035085 | Ga0373929_0001327 | Ga0373929_0001327_3403_4314 | 303 |
| 1741 | 3300035085 | Ga0373929_0008227 | Ga0373929_0008227_956_1888 | 303 |
| 1742 | 3300035088 | Ga0373940_0000119 | Ga0373940_0000119_5562_6473 | 303 |
| 1743 | 3300035089 | Ga0373944_0030301 | Ga0373944_0030301_115_1047 | 303 |
| 1744 | 3300035090 | Ga0373949_0001280 | Ga0373949_0001280_5046_5957 | 303 |
| 1745 | 3300035090 | Ga0373949_0013053 | Ga0373949_0013053_882_1814 | 303 |
| 1746 | 3300035091 | Ga0373951_0002117 | Ga0373951_0002117_1453_2364 | 303 |
| 1747 | 3300035091 | Ga0373951_0007708 | Ga0373951_0007708_1229_2140 | 303 |
| 1748 | 3300035091 | Ga0373951_0034361 | Ga0373951_0034361_189_1115 | 303 |
| 1749 | 3300035092 | Ga0373952_0000988 | Ga0373952_0000988_3379_4290 | 303 |
| 1750 | 3300035092 | Ga0373952_0003629 | Ga0373952_0003629_771_1703 | 303 |
| 1751 | 3300035111 | Ga0373923_0002058 | Ga0373923_0002058_375_1307 | 303 |
| 1752 | 3300035111 | Ga0373923_0073674 | Ga0373923_0073674_322_1248 | 303 |
| 1753 | 3300035112 | Ga0373932_0002403 | Ga0373932_0002403_724_1635 | 303 |
| 1754 | 3300035112 | Ga0373932_0008557 | Ga0373932_0008557_1366_2277 | 303 |
| 1755 | 3300035113 | Ga0373936_0003648 | Ga0373936_0003648_104_1036 | 303 |
| 1756 | 3300035113 | Ga0373936_0083421 | Ga0373936_0083421_15_941 | 303 |
| 1757 | 3300035114 | Ga0373939_0001166 | Ga0373939_0001166_4286_5197 | 303 |
| 1758 | 3300035114 | Ga0373939_0034470 | Ga0373939_0034470_291_1223 | 303 |
| 1759 | 3300035115 | Ga0373941_0009208 | Ga0373941_0009208_1395_2327 | 303 |
| 1760 | 3300035115 | Ga0373941_0011011 | Ga0373941_0011011_178_1089 | 303 |
| 1761 | 3300035117 | Ga0373953_0005593 | Ga0373953_0005593_3055_3981 | 303 |
| 1762 | 3300035118 | Ga0373954_0003012 | Ga0373954_0003012_2162_3088 | 303 |
| 1763 | 3300035118 | Ga0373954_0005688 | Ga0373954_0005688_1274_2206 | 303 |
| 1764 | 3300035121 | Ga0373960_0022622 | Ga0373960_0022622_91_1002 | 303 |
| 1765 | 3300035121 | Ga0373960_0025006 | Ga0373960_0025006_661_1593 | 303 |
| 1766 | 3300035170 | Ga0373943_0001786 | Ga0373943_0001786_1993_2925 | 303 |
| 1767 | 3300035170 | Ga0373943_0113383 | Ga0373943_0113383_286_1218 | 303 |
| 1768 | 3300035171 | Ga0373946_0013746 | Ga0373946_0013746_1993_2925 | 303 |
| 1769 | 3300035171 | Ga0373946_0023480 | Ga0373946_0023480_99_1025 | 303 |
| 1770 | 3300035172 | Ga0373955_0002129 | Ga0373955_0002129_456_1382 | 303 |
| 1771 | 3300035172 | Ga0373955_0048106 | Ga0373955_0048106_342_1274 | 303 |
| 1772 | 3300035207 | Ga0373942_0003873 | Ga0373942_0003873_240_1151 | 303 |
| 1773 | 3300035207 | Ga0373942_0020819 | Ga0373942_0020819_408_1340 | 303 |
| 1774 | 3300035241 | Ga0373961_0001933 | Ga0373961_0001933_2002_2934 | 303 |
| 1775 | 3300035241 | Ga0373961_0002392 | Ga0373961_0002392_484_1395 | 303 |
| 1776 | 3300035242 | Ga0373962_0001833 | Ga0373962_0001833_2167_3078 | 303 |
| 1777 | 3300035242 | Ga0373962_0024304 | Ga0373962_0024304_264_1196 | 303 |
| 1778 | 3300035242 | Ga0373962_0071171 | Ga0373962_0071171_51_962 | 303 |
| 1779 | 3300035410 | Ga0373924_0012594 | Ga0373924_0012594_804_1730 | 303 |
| 1780 | 3300035691 | Ga0373931_0003840 | Ga0373931_0003840_1182_2114 | 303 |
| 1781 | 3300035691 | Ga0373931_0011514 | Ga0373931_0011514_1057_1968 | 303 |
| 1782 | 3300035691 | Ga0373931_0079578 | Ga0373931_0079578_257_1168 | 303 |
| 1783 | 3300035691 | Ga0373931_0245685 | Ga0373931_0245685_141_1067 | 303 |
| 1784 | 3300035692 | Ga0373935_0002000 | Ga0373935_0002000_2421_3353 | 303 |
| 1785 | 3300035692 | Ga0373935_0034724 | Ga0373935_0034724_582_1508 | 303 |
| 1786 | 3300035695 | Ga0373927_0015381 | Ga0373927_0015381_2276_3208 | 303 |
| 1787 | 3300035724 | Ga0373933_0013540 | Ga0373933_0013540_254_1186 | 303 |
| 1788 | 3300035724 | Ga0373933_0016394 | Ga0373933_0016394_1307_2233 | 303 |
| 1789 | 3300035725 | Ga0373947_0019083 | Ga0373947_0019083_2540_3472 | 303 |
| 1790 | 3300035725 | Ga0373947_0265768 | Ga0373947_0265768_170_1096 | 303 |
| 1791 | 3300036401 | Ga0373937_0020562 | Ga0373937_0020562_3263_4189 | 303 |
| 1792 | 3300037068 | Ga0373925_0006016 | Ga0373925_0006016_190_1101 | 303 |
| 1793 | 3300037068 | Ga0373925_0071715 | Ga0373925_0071715_687_1613 | 303 |
| 1794 | 3300038996 | Ga0242420_005885 | Ga0242420_005885_211_1122 | 303 |
| 1795 | 3300042016 | Ga0439463_020241 | Ga0439463_020241_347_1258 | 303 |
| 1796 | 3300044694 | Ga0466963_0079443 | Ga0466963_0079443_341_1255 | 303 |
| 1797 | 3300044842 | Ga0466957_0024689 | Ga0466957_0024689_1888_2802 | 303 |
| 1798 | 3300046452 | Ga0495617_020125 | Ga0495617_020125_255_1187 | 303 |
| 1799 | 3300046454 | Ga0495592_0033791 | Ga0495592_0033791_2491_3417 | 303 |
| 1800 | 3300046454 | Ga0495592_0047131 | Ga0495592_0047131_1993_2925 | 303 |
| 1801 | 3300046455 | Ga0495603_0015820 | Ga0495603_0015820_1293_2219 | 303 |
| 1802 | 3300046455 | Ga0495603_0090677 | Ga0495603_0090677_208_1140 | 303 |
| 1803 | 3300046458 | Ga0495591_036395 | Ga0495591_036395_196_1128 | 303 |
| 1804 | 3300046459 | Ga0495629_0000026 | Ga0495629_0000026_87435_88367 | 303 |
| 1805 | 3300046461 | Ga0495641_0004773 | Ga0495641_0004773_8250_9182 | 303 |
| 1806 | 3300046461 | Ga0495641_0023447 | Ga0495641_0023447_1996_2922 | 303 |
| 1807 | 3300046462 | Ga0495651_0000808 | Ga0495651_0000808_3849_4775 | 303 |
| 1808 | 3300046462 | Ga0495651_0026176 | Ga0495651_0026176_2115_3047 | 303 |
| 1809 | 3300046463 | Ga0495653_0010076 | Ga0495653_0010076_5205_6131 | 303 |
| 1810 | 3300046472 | Ga0495580_0005369 | Ga0495580_0005369_9360_10292 | 303 |
| 1811 | 3300046472 | Ga0495580_0097515 | Ga0495580_0097515_10_936 | 303 |
| 1812 | 3300046473 | Ga0495582_0003391 | Ga0495582_0003391_472_1404 | 303 |
| 1813 | 3300046473 | Ga0495582_0005700 | Ga0495582_0005700_206_1138 | 303 |
| 1814 | 3300046475 | Ga0495639_0009129 | Ga0495639_0009129_1197_2129 | 303 |
| 1815 | 3300046476 | Ga0495662_0010232 | Ga0495662_0010232_1993_2925 | 303 |
| 1816 | 3300046477 | Ga0495664_0002195 | Ga0495664_0002195_9066_9998 | 303 |
| 1817 | 3300046477 | Ga0495664_0020709 | Ga0495664_0020709_2302_3228 | 303 |
| 1818 | 3300046491 | Ga0495584_0024184 | Ga0495584_0024184_277_1188 | 303 |
| 1819 | 3300046491 | Ga0495584_0127502 | Ga0495584_0127502_301_1212 | 303 |
| 1820 | 3300046492 | Ga0495585_0005952 | Ga0495585_0005952_2082_3014 | 303 |
| 1821 | 3300046501 | Ga0495607_0022960 | Ga0495607_0022960_938_1870 | 303 |
| 1822 | 3300046506 | Ga0495583_0094855 | Ga0495583_0094855_245_1177 | 303 |
| 1823 | 3300046511 | Ga0495608_0004227 | Ga0495608_0004227_2506_3438 | 303 |
| 1824 | 3300046511 | Ga0495608_0045151 | Ga0495608_0045151_739_1665 | 303 |
| 1825 | 3300046514 | Ga0495618_0012417 | Ga0495618_0012417_4146_5072 | 303 |
| 1826 | 3300046514 | Ga0495618_0022928 | Ga0495618_0022928_2563_3495 | 303 |
| 1827 | 3300046516 | Ga0495628_0024473 | Ga0495628_0024473_2234_3160 | 303 |
| 1828 | 3300046517 | Ga0495630_0067195 | Ga0495630_0067195_236_1162 | 303 |
| 1829 | 3300046520 | Ga0495637_0017430 | Ga0495637_0017430_891_1823 | 303 |
| 1830 | 3300046523 | Ga0495644_0000215 | Ga0495644_0000215_14690_15622 | 303 |
| 1831 | 3300046531 | Ga0495665_0005110 | Ga0495665_0005110_5451_6383 | 303 |
| 1832 | 3300046531 | Ga0495665_0037705 | Ga0495665_0037705_502_1428 | 303 |
| 1833 | 3300046533 | Ga0495640_0029993 | Ga0495640_0029993_368_1294 | 303 |
| 1834 | 3300046535 | Ga0495586_0019590 | Ga0495586_0019590_2053_2979 | 303 |
| 1835 | 3300046535 | Ga0495586_0030611 | Ga0495586_0030611_808_1740 | 303 |
| 1836 | 3300046536 | Ga0495587_0003557 | Ga0495587_0003557_3853_4779 | 303 |
| 1837 | 3300046536 | Ga0495587_0021420 | Ga0495587_0021420_148_1080 | 303 |
| 1838 | 3300046543 | Ga0495645_0124722 | Ga0495645_0124722_370_1302 | 303 |
| 1839 | 3300046557 | Ga0495622_0074657 | Ga0495622_0074657_406_1338 | 303 |
| 1840 | 3300046558 | Ga0495633_0001472 | Ga0495633_0001472_4702_5634 | 303 |
| 1841 | 3300046559 | Ga0495667_0001178 | Ga0495667_0001178_15391_16317 | 303 |
| 1842 | 3300046559 | Ga0495667_0003467 | Ga0495667_0003467_5454_6386 | 303 |
| 1843 | 3300046615 | Ga0495656_0000808 | Ga0495656_0000808_4104_5036 | 303 |
| 1844 | 3300046642 | Ga0495634_0115284 | Ga0495634_0115284_477_1403 | 303 |
| 1845 | 3300046642 | Ga0495634_0261542 | Ga0495634_0261542_118_1044 | 303 |
| 1846 | 3300046648 | Ga0495611_0056620 | Ga0495611_0056620_474_1406 | 303 |
| 1847 | 3300046663 | Ga0495635_0062342 | Ga0495635_0062342_1211_2143 | 303 |
| 1848 | 3300046664 | Ga0495659_0009514 | Ga0495659_0009514_1852_2784 | 303 |
| 1849 | 3300046665 | Ga0495661_0021971 | Ga0495661_0021971_2181_3113 | 303 |
| 1850 | 3300046674 | Ga0495588_0092873 | Ga0495588_0092873_180_1112 | 303 |
| 1851 | 3300046675 | Ga0495657_0008887 | Ga0495657_0008887_2026_2952 | 303 |
| 1852 | 3300046678 | Ga0495599_0035010 | Ga0495599_0035010_316_1242 | 303 |
| 1853 | 3300046678 | Ga0495599_0130701 | Ga0495599_0130701_342_1274 | 303 |
| 1854 | 3300046679 | Ga0495623_0005999 | Ga0495623_0005999_3717_4643 | 303 |
| 1855 | 3300046680 | Ga0495646_0000395 | Ga0495646_0000395_18095_19021 | 303 |
| 1856 | 3300046680 | Ga0495646_0008527 | Ga0495646_0008527_2563_3495 | 303 |
| 1857 | 3300046681 | Ga0495647_0050904 | Ga0495647_0050904_250_1182 | 303 |
| 1858 | 3300046683 | Ga0495658_0001322 | Ga0495658_0001322_10231_11163 | 303 |
| 1859 | 3300046683 | Ga0495658_0107060 | Ga0495658_0107060_602_1534 | 303 |
| 1860 | 3300046684 | Ga0495669_0083495 | Ga0495669_0083495_502_1413 | 303 |
| 1861 | 3300046689 | Ga0495613_0012017 | Ga0495613_0012017_4887_5819 | 303 |
| 1862 | 3300046689 | Ga0495613_0053959 | Ga0495613_0053959_95_1021 | 303 |
| 1863 | 3300046690 | Ga0495624_0078421 | Ga0495624_0078421_124_1056 | 303 |
| 1864 | 3300046691 | Ga0495670_0005172 | Ga0495670_0005172_1665_2597 | 303 |
| 1865 | 3300046809 | Ga0495600_0002559 | Ga0495600_0002559_6298_7224 | 303 |
| 1866 | 3300046809 | Ga0495600_0012284 | Ga0495600_0012284_370_1302 | 303 |
| 1867 | 3300047317 | Ga0495604_0105349 | Ga0495604_0105349_207_1139 | 303 |
| 1868 | 3300047319 | Ga0495674_0014605 | Ga0495674_0014605_5737_6663 | 303 |
| 1869 | 3300047319 | Ga0495674_0201991 | Ga0495674_0201991_343_1275 | 303 |
| 1870 | 3300047321 | Ga0495676_0040035 | Ga0495676_0040035_378_1310 | 303 |
| 1871 | 3300047322 | Ga0495680_0000825 | Ga0495680_0000825_27638_28564 | 303 |
| 1872 | 3300047322 | Ga0495680_0019969 | Ga0495680_0019969_2595_3527 | 303 |
| 1873 | 3300047446 | Ga0495679_019573 | Ga0495679_019573_327_1259 | 303 |
| 1874 | 3300047673 | Ga0495593_0009453 | Ga0495593_0009453_1439_2371 | 303 |
| 1875 | 3300047673 | Ga0495593_0009518 | Ga0495593_0009518_192_1124 | 303 |
| 1876 | 3300047673 | Ga0495593_0041048 | Ga0495593_0041048_1045_1971 | 303 |
| 1877 | 3300047673 | Ga0495593_0057475 | Ga0495593_0057475_436_1362 | 303 |
| 1878 | 3300048089 | Ga0495614_0025736 | Ga0495614_0025736_576_1508 | 303 |
| 1879 | 3300048903 | Ga0496100_0025723 | Ga0496100_0025723_785_1696 | 303 |
| 1880 | 3300048904 | Ga0496101_0003853 | Ga0496101_0003853_3744_4655 | 303 |
| 1881 | 3300048904 | Ga0496101_0023337 | Ga0496101_0023337_1864_2790 | 303 |
| 1882 | 3300048905 | Ga0496102_0045197 | Ga0496102_0045197_2970_3881 | 303 |
| 1883 | 3300048905 | Ga0496102_0208063 | Ga0496102_0208063_576_1508 | 303 |
| 1884 | 3300048906 | Ga0496103_0008374 | Ga0496103_0008374_3093_4025 | 303 |
| 1885 | 3300048906 | Ga0496103_0027759 | Ga0496103_0027759_2405_3316 | 303 |
| 1886 | 3300048906 | Ga0496103_0053736 | Ga0496103_0053736_110_1021 | 303 |
| 1887 | 3300048907 | Ga0496104_0079488 | Ga0496104_0079488_507_1439 | 303 |
| 1888 | 3300048907 | Ga0496104_0168221 | Ga0496104_0168221_292_1218 | 303 |
| 1889 | 3300048907 | Ga0496104_0184407 | Ga0496104_0184407_401_1333 | 303 |
| 1890 | 3300048908 | Ga0496105_0007095 | Ga0496105_0007095_4705_5652 | 303 |
| 1891 | 3300048908 | Ga0496105_0030697 | Ga0496105_0030697_1737_2648 | 303 |
| 1892 | 3300048909 | Ga0496106_0003403 | Ga0496106_0003403_6062_6973 | 303 |
| 1893 | 3300048909 | Ga0496106_0012418 | Ga0496106_0012418_1339_2250 | 303 |
| 1894 | 3300048909 | Ga0496106_0168052 | Ga0496106_0168052_390_1301 | 303 |
| 1895 | 3300048910 | Ga0496107_0020448 | Ga0496107_0020448_2896_3828 | 303 |
| 1896 | 3300048910 | Ga0496107_0035807 | Ga0496107_0035807_514_1425 | 303 |
| 1897 | 3300048910 | Ga0496107_0052763 | Ga0496107_0052763_117_1028 | 303 |
| 1898 | 3300048911 | Ga0496108_0004356 | Ga0496108_0004356_6464_7375 | 303 |
| 1899 | 3300048911 | Ga0496108_0074602 | Ga0496108_0074602_818_1729 | 303 |
| 1900 | 3300048912 | Ga0496109_0003207 | Ga0496109_0003207_5299_6210 | 303 |
| 1901 | 3300048912 | Ga0496109_0014486 | Ga0496109_0014486_4336_5247 | 303 |
| 1902 | 3300048912 | Ga0496109_0068598 | Ga0496109_0068598_2275_3201 | 303 |
| 1903 | 3300048913 | Ga0496110_0026611 | Ga0496110_0026611_111_1043 | 303 |
| 1904 | 3300048913 | Ga0496110_0029454 | Ga0496110_0029454_3200_4111 | 303 |
| 1905 | 3300048914 | Ga0496111_0016724 | Ga0496111_0016724_1419_2330 | 303 |
| 1906 | 3300048914 | Ga0496111_0249161 | Ga0496111_0249161_50_961 | 303 |
| 1907 | 3300048915 | Ga0496112_0005532 | Ga0496112_0005532_7079_7990 | 303 |
| 1908 | 3300048915 | Ga0496112_0015369 | Ga0496112_0015369_2209_3141 | 303 |
| 1909 | 3300048915 | Ga0496112_0175826 | Ga0496112_0175826_277_1188 | 303 |
| 1910 | 3300048916 | Ga0496113_0003527 | Ga0496113_0003527_4426_5337 | 303 |
| 1911 | 3300048916 | Ga0496113_0047943 | Ga0496113_0047943_1309_2220 | 303 |
| 1912 | 3300048916 | Ga0496113_0055955 | Ga0496113_0055955_861_1772 | 303 |
| 1913 | 3300048917 | Ga0496114_0012027 | Ga0496114_0012027_3093_4025 | 303 |
| 1914 | 3300048917 | Ga0496114_0021000 | Ga0496114_0021000_3763_4674 | 303 |
| 1915 | 3300048917 | Ga0496114_0523529 | Ga0496114_0523529_77_1003 | 303 |
| 1916 | 3300048918 | Ga0496115_0003483 | Ga0496115_0003483_8236_9147 | 303 |
| 1917 | 3300049590 | Ga0501074_0215398 | Ga0501074_0215398_270_1181 | 303 |
| 1918 | 3300049592 | Ga0501076_0043461 | Ga0501076_0043461_786_1697 | 303 |
| 1919 | 3300049593 | Ga0501077_0087268 | Ga0501077_0087268_634_1545 | 303 |
| 1920 | 3300050494 | nmdc:mga06z11_19780_c1 | nmdc:mga06z11_19780_c1_1759_2670 | 303 |
| 1921 | 3300050507 | nmdc:mga05p37_25974_c1 | nmdc:mga05p37_25974_c1_2011_2958 | 303 |
| 1922 | 3300050507 | nmdc:mga05p37_2764_c1 | nmdc:mga05p37_2764_c1_11738_12685 | 303 |
| 1923 | 3300050508 | nmdc:mga09592_524_c1 | nmdc:mga09592_524_c1_3413_4360 | 303 |
| 1924 | 3300050509 | nmdc:mga0qj67_34036_c1 | nmdc:mga0qj67_34036_c1_1036_1983 | 303 |
| 1925 | 3300050510 | nmdc:mga06r32_121_c1 | nmdc:mga06r32_121_c1_47239_48186 | 303 |
| 1926 | 3300050511 | nmdc:mga08y16_1115_c1 | nmdc:mga08y16_1115_c1_24210_25121 | 303 |
| 1927 | 3300050511 | nmdc:mga08y16_5266_c1 | nmdc:mga08y16_5266_c1_4655_5602 | 303 |
| 1928 | 3300050511 | nmdc:mga08y16_56605_c1 | nmdc:mga08y16_56605_c1_2918_3829 | 303 |
| 1929 | 3300050511 | nmdc:mga08y16_940_c1 | nmdc:mga08y16_940_c1_26033_26944 | 303 |
| 1930 | 3300050512 | nmdc:mga0n895_12320_c1 | nmdc:mga0n895_12320_c1_4659_5606 | 303 |
| 1931 | 3300050512 | nmdc:mga0n895_2636_c1 | nmdc:mga0n895_2636_c1_2732_3679 | 303 |
| 1932 | 3300050512 | nmdc:mga0n895_34687_c1 | nmdc:mga0n895_34687_c1_1639_2571 | 303 |
| 1933 | 3300050512 | nmdc:mga0n895_471786_c1 | nmdc:mga0n895_471786_c1_143_1069 | 303 |
| 1934 | 3300050512 | nmdc:mga0n895_534_c1 | nmdc:mga0n895_534_c1_16423_17334 | 303 |
| 1935 | 3300050513 | nmdc:mga0rr50_20867_c1 | nmdc:mga0rr50_20867_c1_1105_2052 | 303 |
| 1936 | 3300050513 | nmdc:mga0rr50_31337_c1 | nmdc:mga0rr50_31337_c1_805_1716 | 303 |
| 1937 | 3300050513 | nmdc:mga0rr50_3849_c1 | nmdc:mga0rr50_3849_c1_3342_4289 | 303 |
| 1938 | 3300050513 | nmdc:mga0rr50_38987_c1 | nmdc:mga0rr50_38987_c1_2259_3191 | 303 |
| 1939 | 3300050513 | nmdc:mga0rr50_6636_c1 | nmdc:mga0rr50_6636_c1_3082_4014 | 303 |
| 1940 | 3300050514 | nmdc:mga08x19_106448_c1 | nmdc:mga08x19_106448_c1_488_1435 | 303 |
| 1941 | 3300050514 | nmdc:mga08x19_143622_c1 | nmdc:mga08x19_143622_c1_154_1086 | 303 |
| 1942 | 3300050515 | nmdc:mga0a205_145005_c1 | nmdc:mga0a205_145005_c1_1178_2110 | 303 |
| 1943 | 3300050515 | nmdc:mga0a205_213_c1 | nmdc:mga0a205_213_c1_31432_32343 | 303 |
| 1944 | 3300050515 | nmdc:mga0a205_549_c1 | nmdc:mga0a205_549_c1_20955_21902 | 303 |
| 1945 | 3300050515 | nmdc:mga0a205_61189_c1 | nmdc:mga0a205_61189_c1_817_1764 | 303 |
| 1946 | 3300053077 | Ga0495601_0069781 | Ga0495601_0069781_836_1768 | 303 |
| 1947 | 3300053077 | Ga0495601_0123720 | Ga0495601_0123720_188_1114 | 303 |
| 1948 | 3300053078 | Ga0495612_0004407 | Ga0495612_0004407_106_1038 | 303 |
| 1949 | 3300053084 | Ga0495595_0000735 | Ga0495595_0000735_6192_7124 | 303 |
| 1950 | 3300053084 | Ga0495595_0001611 | Ga0495595_0001611_7192_8118 | 303 |
| 1951 | 3300053085 | Ga0495619_0000672 | Ga0495619_0000672_4895_5827 | 303 |
| 1952 | 3300053085 | Ga0495619_0007396 | Ga0495619_0007396_3999_4931 | 303 |
| 1953 | 3300053085 | Ga0495619_0008615 | Ga0495619_0008615_1902_2828 | 303 |
| 1954 | 3300053094 | Ga0500566_0103886 | Ga0500566_0103886_576_1508 | 303 |
| 1955 | 3300054114 | Ga0501084_0169083 | Ga0501084_0169083_199_1110 | 303 |
| 1956 | 3300060353 | Ga0501082_0100493 | Ga0501082_0100493_322_1311 | 303 |
| 1957 | 3300061734 | Ga0530510_0213573 | Ga0530510_0213573_112_1101 | 303 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zp4-assembly1.cif.gz_B | glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate | 0.9798 | 17 | 297 |
| 2fmo-assembly1.cif.gz_A | ala177val mutant of e. coli methylenetetrahydrofolate reductase | 0.9795 | 17 | 297 |
| 2fmo-assembly1.cif.gz_A | ala177val mutant of e. coli methylenetetrahydrofolate reductase | 0.9758 | 17 | 297 |
| 3fst-assembly1.cif.gz_C | crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 | 0.9756 | 17 | 297 |
| 3fsu-assembly1.cif.gz_C | crystal structure of escherichia coli methylenetetrahydrofolate reductase double mutant phe223leuglu28gln complexed with methyltetrahydrofolate | 0.9756 | 17 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zp3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9602 | 6 | 297 | 3.20.20.220 |
| 1v93A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9288 | 9 | 298 | 3.20.20.220 |
| af_A0A1D6GER4_1_215_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9283 | 89 | 293 | 3.20.20.220 |
| 1zp3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9247 | 6 | 297 | 3.20.20.220 |
| af_Q75HE6_1_304_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9171 | 5 | 295 | 3.20.20.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1PXK4-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9863 | 125 | 300 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A2J4RD57-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9829 | 134 | 298 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A258CT94-F1-model_v4 | Methylenetetrahydrofolate reductase (EC 1.5.1.54) | 0.9824 | 45 | 300 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A6P5UD17-F1-model_v4 | deleted | 0.9815 | 33 | 246 |
|
| AF-A0A0F5FME8-F1-model_v4 | Methylenetetrahydrofolate reductase (EC 1.5.1.54) | 0.9811 | 17 | 297 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar