F496144

General Info

Members Datasets Scaffolds Average Seq Length
1957 799 1725 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935630451|2935632812
Length 363
Sequence DEPSITHRVCPAVNFYQLLAGSGPFPISDGLFDPPRFAYLRGFISRPDVYPPVAEPLRIMTQTISSVPNGQRAPKTPKISFEFFPPKTEEMERNLWETINRLAPLTPNFVSVTYGAGGSTRERTHSTITRILRETDLLPAAHLTCVSASRGEIDDIVDRYHEVGVRHIVALRGDPPGGIGTPYFTHPDGYQSSAELVAGIKKRHADIEISVSAYPEKHPEAADFDADIDTLKAKVDAGATRAITQVFFDNDLYHRYVDKVRTRGIEIPIVPGIMPMHNFKQARNFVTRAGTSVPDWLAEKFDGLDNDAETRKLVAATVAAGQVQKLFKHGVDTFHFYTMNRADLVFAISHLLGIRPNGAQKAA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
22 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
30 2643221651 Afipia sp. Root123D2 Isolate Unclassified
31 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
32 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
33 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
34 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
35 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
36 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
37 2791355199
38 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
39 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
40 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
41 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
42 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
43 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
44 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
45 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
46 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
47 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
48 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
49 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
50 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
51 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
52 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
53 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
54 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
55 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
56 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
57 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
58 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
59 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
60 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
61 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
62 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
63 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
64 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
65 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
66 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
67 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
68 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
69 2842694124 Methylopila sp. R-72369 Isolate Unclassified
70 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
71 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
72 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
73 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
74 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
75 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
76 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
77 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
78 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
79 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
80 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
81 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
82 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
83 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
84 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
85 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
86 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
87 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
88 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
89 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
90 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
91 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
92 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
93 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
94 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
95 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
96 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
97 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
98 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
99 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
100 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
101 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
102 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
103 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
104 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
105 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
106 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
107 2904699407
108 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
109 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
110 2906610324
111 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
112 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
113 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
114 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
115 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
116 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
117 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
118 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
119 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
120 2922368715
121 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
122 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
123 2922425934
124 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
125 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
126 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
127 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
128 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
129 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
130 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
131 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
132 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
133 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
134 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
135 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
136 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
137 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
138 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
139 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
140 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
141 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
142 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
143 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
144 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
145 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
146 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
147 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
148 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
149 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
150 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
151 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
152 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
153 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
154 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
155 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
156 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
157 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
158 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
159 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
160 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
161 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
162 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
163 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
164 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
165 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
166 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
167 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
168 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
169 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
170 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
171 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
172 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
173 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
174 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
175 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
176 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
177 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
178 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
179 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
180 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
181 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
182 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
183 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
184 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
185 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
186 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
187 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
188 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
189 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
190 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
191 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
192 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
193 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
194 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
195 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
196 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
197 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
198 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
199 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
200 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
201 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
202 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
203 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
204 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
205 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
206 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
207 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
208 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
209 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
210 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
211 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
212 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
213 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
214 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
215 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
216 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
217 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
218 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
219 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
220 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
221 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
222 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
223 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
224 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
225 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
226 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
227 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
228 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
229 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
230 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
231 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
232 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
233 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
234 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
235 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
236 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
237 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
238 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
239 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
240 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
241 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
242 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
243 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
244 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
245 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
246 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
247 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
248 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
249 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
250 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
251 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
252 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
253 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
254 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
255 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
256 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
257 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
258 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
259 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
260 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
261 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
262 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
263 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
264 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
265 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
266 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
267 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
268 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
269 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
270 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
271 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
272 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
273 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
274 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
275 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
276 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
277 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
278 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
279 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
280 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
281 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
282 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
283 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
284 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
285 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
286 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
287 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
288 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
289 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
290 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
291 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
292 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
293 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
294 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
295 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
296 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
297 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
298 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
299 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
300 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
301 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
302 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
303 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
304 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
305 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
306 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
307 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
308 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
309 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
310 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
311 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
312 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
313 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
314 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
315 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
316 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
317 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
318 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
319 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
320 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
321 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
322 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
323 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
324 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
325 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
326 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
327 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
328 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
329 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
330 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
331 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
332 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
333 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
334 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
335 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
336 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
337 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
338 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
339 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
340 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
341 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
342 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
343 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
344 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
345 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
346 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
347 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
348 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
349 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
350 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
351 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
352 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
353 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
354 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
355 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
356 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
357 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
358 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
359 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
360 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
361 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
362 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
363 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
364 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
365 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
366 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
370 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
372 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
373 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
374 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
375 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
377 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
444 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
445 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
446 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
447 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
448 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
449 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
451 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
453 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
454 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
455 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
456 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
457 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
461 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
462 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
463 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
464 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
465 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
466 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
467 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
468 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
469 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
470 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
471 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
472 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
473 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
474 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
475 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
476 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
477 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
478 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
479 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
480 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
481 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
482 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
483 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
484 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
485 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
486 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
487 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
488 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
489 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
490 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
491 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
492 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
493 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
494 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
495 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
496 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
497 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
498 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
499 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
500 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
501 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
502 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
503 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
504 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
505 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
506 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
507 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
508 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
509 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
510 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
511 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
512 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
513 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
514 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
515 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
516 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
517 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
518 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
519 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
520 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
521 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
522 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
523 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
524 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
525 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
526 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
527 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
528 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
529 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
530 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
531 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
532 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
533 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
534 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
535 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
536 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
537 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
538 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
539 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
540 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
541 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
542 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
543 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
544 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
545 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
546 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
547 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
548 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
549 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
550 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
551 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
552 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
553 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
554 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
555 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
556 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
557 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
558 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
559 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
560 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
561 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
562 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
563 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
564 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
565 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
566 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
567 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
568 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
569 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
570 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
571 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
572 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
573 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
574 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
575 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
576 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
577 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
578 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
579 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
580 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
581 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
582 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
583 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
584 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
585 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
586 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
587 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
588 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
589 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
590 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
591 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
592 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
593 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
594 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
595 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
596 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
597 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
598 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
599 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
600 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
601 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
602 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
603 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
604 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
605 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
606 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
607 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
608 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
609 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
610 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
611 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
612 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
613 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
614 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
615 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
616 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
617 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
618 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
619 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
620 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
621 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
622 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
623 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
624 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
625 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
626 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
627 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
628 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
629 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
630 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
631 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
632 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
633 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
634 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
635 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
636 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
637 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
638 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
639 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
640 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
641 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
642 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
643 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
644 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
645 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
646 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
647 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
648 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
649 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
650 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
651 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
652 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
653 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
654 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
655 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
656 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
657 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
658 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
659 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
660 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
661 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
662 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
663 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
664 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
665 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
666 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
668 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
669 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
670 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
673 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
674 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
675 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
677 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
678 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
679 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
680 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
681 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
682 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
683 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
684 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
685 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
686 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
687 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
688 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
689 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
690 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
691 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
692 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
693 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
694 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
695 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
696 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
697 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
698 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
699 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
700 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
701 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
702 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
703 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
704 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
705 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
706 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
707 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
708 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
709 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
710 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
711 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
712 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
713 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
714 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
715 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
716 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
717 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
718 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
719 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
720 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
721 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
722 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
723 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
724 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
725 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
726 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
727 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
728 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
729 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
730 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
731 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
732 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
733 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
734 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
735 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
736 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
737 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
738 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
739 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
740 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
741 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
742 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
743 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
744 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
745 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
746 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
747 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
748 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
749 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
750 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
751 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
752 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
753 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
754 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
755 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
756 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
757 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
758 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
759 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
760 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
761 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
762 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
763 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
764 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
765 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
766 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
767 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
768 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
769 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
770 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
771 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
772 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
773 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
774 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
775 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
776 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
777 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
778 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
779 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
780 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
781 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
782 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
783 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
784 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
785 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
786 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
787 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
788 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
789 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
790 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
791 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
792 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
793 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
794 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
795 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
796 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
797 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
798 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
799 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.27
Metatranscriptomes 0.1
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.77
Nodule 9.15
Rhizoplane 5.98
Rhizosphere 69.29
Stem 0
Stem Tuber 0
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214775796 2209111006 Bacteria 2534
2 ARcpr5oldR_c000014 3300000041 Bacteria 37047
3 ARSoilYngRDRAFT_c00094 3300000042 Bacteria 15087
4 ARcpr5yngRDRAFT_c000058 3300000043 Bacteria 17826
5 ARSoilOldRDRAFT_c000007 3300000044 Bacteria 55959
6 ARCol0oldRDRAFT_c00221 3300000045 Bacteria 5288
7 ARCol0yngRDRAFT_1000009 3300000652 Bacteria 43473
8 JGI24032J14994_100677 3300001430 Bacteria 1760
9 JGI24741J21665_1011668 3300001915 Bacteria 1529
10 JGI24752J21851_1002204 3300001976 Bacteria 2604
11 JGI24747J21853_1001137 3300001978 Bacteria 1929
12 JGI24740J21852_10005937 3300001979 Bacteria 5113
13 JGI24739J22299_10010412 3300001989 Bacteria 3454
14 JGI24737J22298_10021581 3300001990 Bacteria 2051
15 JGI24750J21931_1000699 3300002070 Bacteria 4845
16 JGI24745J21846_1000166 3300002073 Bacteria 5259
17 JGI24738J21930_10001608 3300002075 Bacteria 6219
18 JGI24749J21850_1005910 3300002076 Bacteria 1706
19 JGI24744J21845_10011953 3300002077 Bacteria 1767
20 JGI24035J26624_1002415 3300002126 Bacteria 1745
21 JGI24033J26618_1000651 3300002155 Bacteria 3316
22 JGI24034J26672_10004455 3300002239 Bacteria 1987
23 JGI24742J22300_10006743 3300002244 Bacteria 1894
24 JGI24751J29686_10019326 3300002459 Bacteria 1410
25 JGI25406J46586_10000012 3300003203 Bacteria 102438
26 JGI25153J46596_10003697 3300003215 Bacteria 8457
27 JGI25153J46596_10008046 3300003215 Bacteria 5094
28 JGI25153J46596_10034157 3300003215 Bacteria 1666
29 JGI25160J50197_1007198 3300003354 Bacteria 4383
30 Ga0065165_1000982 3300005262 Bacteria 35331
31 Ga0065165_1007672 3300005262 Bacteria 5235
32 Ga0065165_1008445 3300005262 Bacteria 4816
33 Ga0065717_1003292 3300005276 Bacteria 1335
34 Ga0065714_10115997 3300005288 Bacteria 1397
35 Ga0065704_10019537 3300005289 Bacteria 1689
36 Ga0065712_10001073 3300005290 Bacteria 6956
37 Ga0065712_10136646 3300005290 Bacteria 1491
38 Ga0065715_10005375 3300005293 Bacteria 4394
39 Ga0065715_10108905 3300005293 Bacteria 2695
40 Ga0065707_10162208 3300005295 Bacteria 1553
41 Ga0070658_10029096 3300005327 Bacteria 4437
42 Ga0070658_10076839 3300005327 Bacteria 2739
43 Ga0070658_10117782 3300005327 Bacteria 2205
44 Ga0070658_10259088 3300005327 Bacteria 1477
45 Ga0070676_10010461 3300005328 Bacteria 5036
46 Ga0070690_100011006 3300005330 Bacteria 5282
47 Ga0070670_100012145 3300005331 Bacteria 7367
48 Ga0070670_100135211 3300005331 Bacteria 2130
49 Ga0070677_10000731 3300005333 Bacteria 10938
50 Ga0068869_100015435 3300005334 Bacteria 5124
51 Ga0068869_100023869 3300005334 Bacteria 4232
52 Ga0070666_10024658 3300005335 Bacteria 3920
53 Ga0070666_10128387 3300005335 Bacteria 1760
54 Ga0070666_10365109 3300005335 Bacteria 1035
55 Ga0070680_100016577 3300005336 Bacteria 5798
56 Ga0070680_100019249 3300005336 Bacteria 5409
57 Ga0070680_100064099 3300005336 Bacteria 3011
58 Ga0070680_100090696 3300005336 Bacteria 2530
59 Ga0070680_100165630 3300005336 Bacteria 1858
60 Ga0070682_100013849 3300005337 Bacteria 4650
61 Ga0068868_100056620 3300005338 Bacteria 3096
62 Ga0068868_100081641 3300005338 Bacteria 2592
63 Ga0070660_100001770 3300005339 Bacteria 14832
64 Ga0070689_100031509 3300005340 Bacteria 4030
65 Ga0070689_100122632 3300005340 Bacteria 2077
66 Ga0070689_100270099 3300005340 Bacteria 1408
67 Ga0070691_10004889 3300005341 Bacteria 6096
68 Ga0070687_100005741 3300005343 Bacteria 5036
69 Ga0070661_100025157 3300005344 Bacteria 4276
70 Ga0070692_10006550 3300005345 Bacteria 5064
71 Ga0070668_100001862 3300005347 Bacteria 15407
72 Ga0070668_100005832 3300005347 Bacteria 9133
73 Ga0070668_100098279 3300005347 Bacteria 2316
74 Ga0070668_100452132 3300005347 Bacteria 1104
75 Ga0070669_100002311 3300005353 Bacteria 13796
76 Ga0070669_100082025 3300005353 Bacteria 2403
77 Ga0070675_100026314 3300005354 Bacteria 4669
78 Ga0070671_100027221 3300005355 Bacteria 4704
79 Ga0070671_100029720 3300005355 Bacteria 4507
80 Ga0070671_100044664 3300005355 Bacteria 3682
81 Ga0070674_100062573 3300005356 Bacteria 2601
82 Ga0070674_100165878 3300005356 Bacteria 1680
83 Ga0070674_100242565 3300005356 Bacteria 1412
84 Ga0070673_100012367 3300005364 Bacteria 5858
85 Ga0070659_100002966 3300005366 Bacteria 12095
86 Ga0070667_100095986 3300005367 Bacteria 2557
87 Ga0070667_100339293 3300005367 Bacteria 1359
88 Ga0070709_10002283 3300005434 Bacteria 10401
89 Ga0070709_10002761 3300005434 Bacteria 9496
90 Ga0070709_10008203 3300005434 Bacteria 5734
91 Ga0070709_10011241 3300005434 Bacteria 4981
92 Ga0070709_10014093 3300005434 Bacteria 4514
93 Ga0070714_100008916 3300005435 Bacteria 7848
94 Ga0070714_100039738 3300005435 Bacteria 3962
95 Ga0070714_100043482 3300005435 Bacteria 3799
96 Ga0070714_100048021 3300005435 Bacteria 3629
97 Ga0070714_100049678 3300005435 Bacteria 3571
98 Ga0070714_100093694 3300005435 Bacteria 2635
99 Ga0070714_100102386 3300005435 Bacteria 2525
100 Ga0070714_100195587 3300005435 Bacteria 1847
101 Ga0070713_100000399 3300005436 Bacteria 27898
102 Ga0070713_100002808 3300005436 Bacteria 11387
103 Ga0070713_100022749 3300005436 Bacteria 4849
104 Ga0070713_100028352 3300005436 Bacteria 4421
105 Ga0070713_100060987 3300005436 Bacteria 3155
106 Ga0070713_100064957 3300005436 Bacteria 3064
107 Ga0070713_100073833 3300005436 Bacteria 2888
108 Ga0070713_100193756 3300005436 Bacteria 1833
109 Ga0070710_10013667 3300005437 Bacteria 4073
110 Ga0070710_10036514 3300005437 Bacteria 2687
111 Ga0070710_10039926 3300005437 Bacteria 2584
112 Ga0070710_10095144 3300005437 Bacteria 1764
113 Ga0070710_10119090 3300005437 Bacteria 1596
114 Ga0070711_100006842 3300005439 Bacteria 6903
115 Ga0070711_100009346 3300005439 Bacteria 6035
116 Ga0070711_100010498 3300005439 Bacteria 5735
117 Ga0070711_100031695 3300005439 Bacteria 3511
118 Ga0070711_100056042 3300005439 Bacteria 2724
119 Ga0070711_100079939 3300005439 Bacteria 2326
120 Ga0070711_100082494 3300005439 Bacteria 2295
121 Ga0070711_100145021 3300005439 Bacteria 1784
122 Ga0070711_100213146 3300005439 Bacteria 1497
123 Ga0070711_100307913 3300005439 Bacteria 1262
124 Ga0070705_100007363 3300005440 Bacteria 5418
125 Ga0070705_100034239 3300005440 Bacteria 2838
126 Ga0070700_100012996 3300005441 Bacteria 4669
127 Ga0070663_100028428 3300005455 Bacteria 3806
128 Ga0070663_100029515 3300005455 Bacteria 3748
129 Ga0070663_100036700 3300005455 Bacteria 3406
130 Ga0070663_100043179 3300005455 Bacteria 3172
131 Ga0070663_100075766 3300005455 Bacteria 2459
132 Ga0070663_100115270 3300005455 Bacteria 2024
133 Ga0070663_100123894 3300005455 Bacteria 1955
134 Ga0070663_100168454 3300005455 Bacteria 1691
135 Ga0070678_100014938 3300005456 Bacteria 4917
136 Ga0070678_100017054 3300005456 Bacteria 4664
137 Ga0070678_100106325 3300005456 Bacteria 2186
138 Ga0070678_100259963 3300005456 Bacteria 1459
139 Ga0070662_100195321 3300005457 Bacteria 1602
140 Ga0070681_10006388 3300005458 Bacteria 11462
141 Ga0070681_10045404 3300005458 Bacteria 4395
142 Ga0070681_10058848 3300005458 Bacteria 3822
143 Ga0070681_10080697 3300005458 Bacteria 3209
144 Ga0070681_10249245 3300005458 Bacteria 1689
145 Ga0068867_100016521 3300005459 Bacteria 5241
146 Ga0068867_100493130 3300005459 Bacteria 1052
147 Ga0070707_100054763 3300005468 Bacteria 3825
148 Ga0070699_100237581 3300005518 Bacteria 1625
149 Ga0070679_100033931 3300005530 Bacteria 5055
150 Ga0070679_100091315 3300005530 Bacteria 3033
151 Ga0070679_100128586 3300005530 Bacteria 2514
152 Ga0070684_100029086 3300005535 Bacteria 4679
153 Ga0070684_100065197 3300005535 Bacteria 3196
154 Ga0070684_100417812 3300005535 Bacteria 1238
155 Ga0070697_100103757 3300005536 Bacteria 2364
156 Ga0070697_100177098 3300005536 Bacteria 1807
157 Ga0068853_100030191 3300005539 Bacteria 4577
158 Ga0068853_100032830 3300005539 Bacteria 4400
159 Ga0068853_100040910 3300005539 Bacteria 3957
160 Ga0070672_100002208 3300005543 Bacteria 12274
161 Ga0070686_100129660 3300005544 Bacteria 1742
162 Ga0070695_100000800 3300005545 Bacteria 16940
163 Ga0070696_100026211 3300005546 Bacteria 3965
164 Ga0070696_100063701 3300005546 Bacteria 2583
165 Ga0070693_100010396 3300005547 Bacteria 4664
166 Ga0070665_100012864 3300005548 Bacteria 8426
167 Ga0070665_100057373 3300005548 Bacteria 3903
168 Ga0070665_100059233 3300005548 Bacteria 3838
169 Ga0070665_100102558 3300005548 Bacteria 2864
170 Ga0070665_100176149 3300005548 Bacteria 2140
171 Ga0070665_100306449 3300005548 Bacteria 1591
172 Ga0068855_100054636 3300005563 Bacteria 4693
173 Ga0068855_100103075 3300005563 Bacteria 3283
174 Ga0068855_100117639 3300005563 Bacteria 3044
175 Ga0068855_100189821 3300005563 Bacteria 2318
176 Ga0068855_100203952 3300005563 Bacteria 2225
177 Ga0068855_100325986 3300005563 Bacteria 1696
178 Ga0068855_100599507 3300005563 Bacteria 1188
179 Ga0068855_100689100 3300005563 Bacteria 1094
180 Ga0068855_100692157 3300005563 Bacteria 1092
181 Ga0070664_100018373 3300005564 Bacteria 5742
182 Ga0070664_100066777 3300005564 Bacteria 3072
183 Ga0070664_100102414 3300005564 Bacteria 2491
184 Ga0070664_100311354 3300005564 Bacteria 1425
185 Ga0068857_100000616 3300005577 Bacteria 26168
186 Ga0068857_100023618 3300005577 Bacteria 5413
187 Ga0068857_100039537 3300005577 Bacteria 4178
188 Ga0068854_100043694 3300005578 Bacteria 3178
189 Ga0068854_100185442 3300005578 Bacteria 1627
190 Ga0068854_100327352 3300005578 Bacteria 1247
191 Ga0068854_100352193 3300005578 Bacteria 1205
192 Ga0068856_100000137 3300005614 Bacteria 73762
193 Ga0068856_100002724 3300005614 Bacteria 18087
194 Ga0068856_100222278 3300005614 Bacteria 1904
195 Ga0068856_100402031 3300005614 Bacteria 1389
196 Ga0068856_100511607 3300005614 Bacteria 1222
197 Ga0070702_100010977 3300005615 Bacteria 4489
198 Ga0068852_100010212 3300005616 Bacteria 6998
199 Ga0068852_100011772 3300005616 Bacteria 6605
200 Ga0068852_100184337 3300005616 Bacteria 1965
201 Ga0068852_100257164 3300005616 Bacteria 1675
202 Ga0068852_100790806 3300005616 Bacteria 962
203 Ga0068859_100065834 3300005617 Bacteria 3657
204 Ga0068859_100179390 3300005617 Bacteria 2200
205 Ga0068859_100243352 3300005617 Bacteria 1888
206 Ga0068859_100383185 3300005617 Bacteria 1501
207 Ga0068859_100678183 3300005617 Bacteria 1122
208 Ga0068864_100022002 3300005618 Bacteria 5344
209 Ga0068864_100024791 3300005618 Bacteria 5046
210 Ga0068864_100509629 3300005618 Bacteria 1159
211 Ga0068861_100147039 3300005719 Bacteria 1929
212 Ga0068851_10062866 3300005834 Bacteria 1905
213 Ga0068870_10008285 3300005840 Bacteria 4669
214 Ga0068863_100001280 3300005841 Bacteria 25093
215 Ga0068863_100142726 3300005841 Bacteria 2289
216 Ga0068863_100206995 3300005841 Bacteria 1888
217 Ga0068863_100350823 3300005841 Bacteria 1437
218 Ga0068858_100025278 3300005842 Bacteria 5526
219 Ga0068858_100052822 3300005842 Bacteria 3760
220 Ga0068858_100086107 3300005842 Bacteria 2923
221 Ga0068858_100320806 3300005842 Bacteria 1481
222 Ga0068860_100000837 3300005843 Bacteria 34452
223 Ga0068860_100026148 3300005843 Bacteria 5629
224 Ga0068862_100003249 3300005844 Bacteria 14059
225 Ga0068862_100035921 3300005844 Bacteria 4199
226 Ga0068862_100080069 3300005844 Bacteria 2832
227 Ga0081455_10008343 3300005937 Bacteria 10788
228 Ga0081455_10011276 3300005937 Bacteria 8994
229 Ga0081455_10013423 3300005937 Bacteria 8097
230 Ga0081455_10032605 3300005937 Bacteria 4692
231 Ga0081455_10040385 3300005937 Bacteria 4114
232 Ga0081455_10051423 3300005937 Bacteria 3535
233 Ga0081455_10072405 3300005937 Bacteria 2853
234 Ga0081455_10192346 3300005937 Bacteria 1535
235 Ga0081538_10016354 3300005981 Bacteria 5693
236 Ga0081540_1002034 3300005983 Bacteria 16870
237 Ga0081540_1007800 3300005983 Bacteria 7574
238 Ga0081540_1008423 3300005983 Bacteria 7210
239 Ga0081540_1012078 3300005983 Bacteria 5714
240 Ga0081540_1020975 3300005983 Bacteria 3910
241 Ga0081540_1023647 3300005983 Bacteria 3588
242 Ga0081540_1074654 3300005983 Bacteria 1553
243 Ga0081539_10000040 3300005985 Bacteria 292753
244 Ga0081539_10000157 3300005985 Bacteria 158278
245 Ga0081539_10006006 3300005985 Bacteria 11928
246 Ga0070717_10000998 3300006028 Bacteria 18942
247 Ga0070717_10017655 3300006028 Bacteria 5555
248 Ga0070717_10032241 3300006028 Bacteria 4221
249 Ga0070717_10086716 3300006028 Bacteria 2635
250 Ga0070717_10148538 3300006028 Bacteria 2026
251 Ga0075365_10040902 3300006038 Bacteria 3025
252 Ga0075365_10043977 3300006038 Bacteria 2925
253 Ga0075365_10211007 3300006038 Bacteria 1361
254 Ga0075365_10274096 3300006038 Bacteria 1187
255 Ga0075368_10026242 3300006042 Bacteria 2241
256 Ga0075368_10028787 3300006042 Bacteria 2147
257 Ga0075363_100012694 3300006048 Bacteria 4065
258 Ga0075363_100082248 3300006048 Bacteria 1762
259 Ga0075364_10092981 3300006051 Bacteria 2002
260 Ga0075364_10272662 3300006051 Bacteria 1151
261 Ga0075432_10000490 3300006058 Bacteria 11811
262 Ga0070715_10001341 3300006163 Bacteria 7098
263 Ga0070715_10001709 3300006163 Bacteria 6529
264 Ga0070715_10015189 3300006163 Bacteria 2866
265 Ga0070716_100010682 3300006173 Bacteria 4612
266 Ga0070716_100021483 3300006173 Bacteria 3402
267 Ga0070716_100043557 3300006173 Bacteria 2510
268 Ga0070712_100011969 3300006175 Bacteria 5515
269 Ga0070712_100014542 3300006175 Bacteria 5051
270 Ga0070712_100038281 3300006175 Bacteria 3277
271 Ga0070712_100051470 3300006175 Bacteria 2869
272 Ga0070712_100112939 3300006175 Bacteria 2031
273 Ga0075362_10034532 3300006177 Bacteria 2205
274 Ga0075367_10001616 3300006178 Bacteria 9781
275 Ga0075367_10017648 3300006178 Bacteria 3922
276 Ga0075367_10089947 3300006178 Bacteria 1867
277 Ga0075367_10112997 3300006178 Bacteria 1668
278 Ga0075369_10010149 3300006186 Bacteria 3680
279 Ga0075427_10000547 3300006194 Bacteria 4345
280 Ga0075366_10093184 3300006195 Bacteria 1805
281 Ga0075366_10139845 3300006195 Bacteria 1463
282 Ga0075366_10233697 3300006195 Bacteria 1120
283 Ga0097621_100013700 3300006237 Bacteria 6054
284 Ga0097621_100050975 3300006237 Bacteria 3367
285 Ga0097621_100117702 3300006237 Bacteria 2251
286 Ga0075370_10069232 3300006353 Bacteria 2016
287 Ga0075370_10159241 3300006353 Bacteria 1324
288 Ga0068871_100002047 3300006358 Bacteria 13660
289 Ga0068871_100009147 3300006358 Bacteria 7159
290 Ga0075428_100003603 3300006844 Bacteria 16973
291 Ga0075430_100001211 3300006846 Bacteria 20749
292 Ga0075430_100003714 3300006846 Bacteria 12823
293 Ga0075431_100003725 3300006847 Bacteria 14811
294 Ga0075433_10000029 3300006852 Bacteria 55893
295 Ga0075433_10068698 3300006852 Bacteria 3111
296 Ga0075434_100002137 3300006871 Bacteria 17203
297 Ga0075434_100002244 3300006871 Bacteria 16889
298 Ga0075434_100038251 3300006871 Bacteria 4752
299 Ga0075434_100056362 3300006871 Bacteria 3905
300 Ga0075434_100118645 3300006871 Bacteria 2660
301 Ga0075434_100568777 3300006871 Bacteria 1153
302 Ga0075429_100002021 3300006880 Bacteria 16869
303 Ga0068865_100017000 3300006881 Bacteria 4669
304 Ga0075436_100221423 3300006914 Bacteria 1343
305 Ga0097620_100065832 3300006931 Bacteria 3657
306 Ga0097620_100179389 3300006931 Bacteria 2200
307 Ga0097620_100243334 3300006931 Bacteria 1888
308 Ga0097620_100383180 3300006931 Bacteria 1501
309 Ga0097620_100678273 3300006931 Bacteria 1122
310 Ga0099824_1008492 3300006942 Bacteria 13119
311 Ga0099822_1002961 3300006943 Bacteria 21559
312 Ga0075435_100001612 3300007076 Bacteria 14589
313 Ga0075435_100052635 3300007076 Bacteria 3281
314 Ga0075435_100086197 3300007076 Bacteria 2586
315 Ga0075435_100107854 3300007076 Bacteria 2313
316 Ga0099795_10064606 3300007788 Bacteria 1367
317 Ga0105251_10064341 3300009011 Bacteria 1719
318 Ga0105251_10170334 3300009011 Bacteria 981
319 Ga0105244_10069538 3300009036 Bacteria 1758
320 Ga0105240_10012243 3300009093 Bacteria 11853
321 Ga0105240_10027631 3300009093 Bacteria 7427
322 Ga0105240_10069358 3300009093 Bacteria 4364
323 Ga0105240_10228286 3300009093 Bacteria 2165
324 Ga0105240_10274693 3300009093 Bacteria 1939
325 Ga0105240_10284374 3300009093 Bacteria 1898
326 Ga0105240_10478354 3300009093 Bacteria 1389
327 Ga0105240_10818469 3300009093 Bacteria 1008
328 Ga0111539_10000345 3300009094 Bacteria 57093
329 Ga0111539_10001931 3300009094 Bacteria 27629
330 Ga0111539_10002122 3300009094 Bacteria 26499
331 Ga0111539_10060686 3300009094 Bacteria 4481
332 Ga0111539_10653200 3300009094 Bacteria 1225
333 Ga0105245_10189222 3300009098 Bacteria 1971
334 Ga0105245_10251474 3300009098 Bacteria 1717
335 Ga0105245_10270738 3300009098 Bacteria 1657
336 Ga0105247_10002880 3300009101 Bacteria 11453
337 Ga0105247_10169366 3300009101 Bacteria 1451
338 Ga0105247_10434623 3300009101 Bacteria 943
339 Ga0114129_10037724 3300009147 Bacteria 6822
340 Ga0114129_10054577 3300009147 Bacteria 5602
341 Ga0114129_10096796 3300009147 Bacteria 4086
342 Ga0114129_10344682 3300009147 Bacteria 1975
343 Ga0105243_10154406 3300009148 Bacteria 1972
344 Ga0105241_10001280 3300009174 Bacteria 19200
345 Ga0105241_10017075 3300009174 Bacteria 5329
346 Ga0105241_10030510 3300009174 Bacteria 4030
347 Ga0105241_10060338 3300009174 Bacteria 2918
348 Ga0105242_10007716 3300009176 Bacteria 8277
349 Ga0105248_10036476 3300009177 Bacteria 5498
350 Ga0105248_10044578 3300009177 Bacteria 4974
351 Ga0105248_10051698 3300009177 Bacteria 4610
352 Ga0105248_10084972 3300009177 Bacteria 3561
353 Ga0105248_10098149 3300009177 Bacteria 3300
354 Ga0105248_10275012 3300009177 Bacteria 1896
355 Ga0105248_10570825 3300009177 Bacteria 1276
356 Ga0105237_10044776 3300009545 Bacteria 4455
357 Ga0105237_10081375 3300009545 Bacteria 3229
358 Ga0105237_10095015 3300009545 Bacteria 2970
359 Ga0105237_10122555 3300009545 Bacteria 2594
360 Ga0105238_10031282 3300009551 Bacteria 5418
361 Ga0105238_10044002 3300009551 Bacteria 4517
362 Ga0105238_10079710 3300009551 Bacteria 3264
363 Ga0105238_10154023 3300009551 Bacteria 2273
364 Ga0105238_10159077 3300009551 Bacteria 2234
365 Ga0105238_10318790 3300009551 Bacteria 1540
366 Ga0105249_10016757 3300009553 Bacteria 6502
367 Ga0105249_10017803 3300009553 Bacteria 6313
368 Ga0105249_10089982 3300009553 Bacteria 2869
369 Ga0105239_10041141 3300010375 Bacteria 5064
370 Ga0105239_10054114 3300010375 Bacteria 4401
371 Ga0105239_10057236 3300010375 Bacteria 4276
372 Ga0105239_10189719 3300010375 Bacteria 2301
373 Ga0105239_10203284 3300010375 Bacteria 2219
374 Ga0105239_10241536 3300010375 Bacteria 2027
375 Ga0105239_10298975 3300010375 Bacteria 1813
376 Ga0105239_10318087 3300010375 Bacteria 1755
377 Ga0105239_10336405 3300010375 Bacteria 1703
378 Ga0105239_10369100 3300010375 Bacteria 1622
379 Ga0105239_10415914 3300010375 Bacteria 1522
380 Ga0105239_10870780 3300010375 Bacteria 1033
381 Ga0105246_10009048 3300011119 Bacteria 6133
382 Ga0105246_10242021 3300011119 Bacteria 1427
383 Ga0105246_10254899 3300011119 Bacteria 1395
384 Ga0105246_10538887 3300011119 Bacteria 998
385 Ga0157313_1000825 3300012503 Bacteria 1527
386 Ga0157315_1001210 3300012508 Bacteria 1387
387 Ga0157373_10188271 3300013100 Bacteria 1454
388 Ga0157371_10026432 3300013102 Bacteria 4219
389 Ga0157371_10103174 3300013102 Bacteria 2024
390 Ga0157370_10040880 3300013104 Bacteria 4475
391 Ga0157370_10083427 3300013104 Bacteria 3004
392 Ga0157369_10025909 3300013105 Bacteria 6506
393 Ga0157369_10092109 3300013105 Bacteria 3235
394 Ga0157369_10125716 3300013105 Bacteria 2719
395 Ga0157369_10127447 3300013105 Bacteria 2698
396 Ga0157378_10015501 3300013297 Bacteria 6677
397 Ga0157378_10078348 3300013297 Bacteria 2981
398 Ga0157378_10111506 3300013297 Bacteria 2508
399 Ga0157378_10332038 3300013297 Bacteria 1480
400 Ga0163162_10004233 3300013306 Bacteria 13796
401 Ga0163162_10248130 3300013306 Bacteria 1912
402 Ga0163162_10346785 3300013306 Bacteria 1617
403 Ga0157372_10023476 3300013307 Bacteria 6686
404 Ga0157372_10100045 3300013307 Bacteria 3308
405 Ga0157372_10326812 3300013307 Bacteria 1786
406 Ga0157372_10396871 3300013307 Bacteria 1607
407 Ga0157375_10004079 3300013308 Bacteria 12661
408 Ga0157375_10055890 3300013308 Bacteria 3893
409 Ga0157375_10201235 3300013308 Bacteria 2148
410 Ga0157375_10266806 3300013308 Bacteria 1873
411 Ga0163163_10031448 3300014325 Bacteria 5123
412 Ga0163163_10038355 3300014325 Bacteria 4669
413 Ga0163163_10063499 3300014325 Bacteria 3662
414 Ga0163163_10142581 3300014325 Bacteria 2438
415 Ga0163163_10214532 3300014325 Bacteria 1974
416 Ga0163163_10302245 3300014325 Bacteria 1653
417 Ga0157377_10005595 3300014745 Bacteria 5921
418 Ga0157379_10019419 3300014968 Bacteria 6002
419 Ga0157379_10047425 3300014968 Bacteria 3833
420 Ga0157379_10344951 3300014968 Bacteria 1362
421 Ga0157376_10022471 3300014969 Bacteria 4919
422 Ga0157376_10045995 3300014969 Bacteria 3596
423 Ga0163161_10003992 3300017792 Bacteria 10336
424 Ga0163161_10129022 3300017792 Bacteria 1906
425 Ga0163161_10174870 3300017792 Bacteria 1643
426 Ga0206356_11266266 3300020070 Bacteria 5495
427 Ga0206354_10107649 3300020081 Bacteria 997
428 Ga0214544_1000011 3300021320 Bacteria 262952
429 Ga0214542_1000009 3300021321 Bacteria 262861
430 Ga0214545_1000007 3300021324 Bacteria 262984
431 Ga0214543_1000020 3300021327 Bacteria 262861
432 Ga0213873_10005563 3300021358 Bacteria 2427
433 Ga0213874_10054518 3300021377 Bacteria 1236
434 Ga0213876_10008294 3300021384 Bacteria 5620
435 Ga0213876_10027481 3300021384 Bacteria 3001
436 Ga0213876_10058440 3300021384 Bacteria 2036
437 Ga0213876_10078985 3300021384 Bacteria 1739
438 Ga0209563_103792 3300025230 Bacteria 3037
439 Ga0209677_102183 3300025253 Bacteria 7623
440 Ga0209148_1000321 3300025254 Bacteria 66604
441 Ga0209233_1000907 3300025261 Bacteria 12948
442 Ga0209233_1008907 3300025261 Bacteria 3075
443 Ga0209455_1000807 3300025272 Bacteria 17148
444 Ga0207673_1000001 3300025290 Bacteria 29268
445 Ga0209025_1060712 3300025294 Bacteria 1417
446 Ga0209564_1000477 3300025295 Bacteria 66843
447 Ga0209564_1021999 3300025295 Bacteria 2268
448 Ga0209564_1031051 3300025295 Bacteria 1641
449 Ga0209758_1000206 3300025297 Bacteria 130177
450 Ga0209758_1000536 3300025297 Bacteria 60374
451 Ga0209758_1001539 3300025297 Bacteria 26507
452 Ga0209758_1001550 3300025297 Bacteria 26398
453 Ga0209758_1002309 3300025297 Bacteria 19718
454 Ga0209758_1004564 3300025297 Bacteria 11423
455 Ga0209758_1018003 3300025297 Bacteria 3487
456 Ga0209758_1021635 3300025297 Bacteria 2990
457 Ga0209256_1011364 3300025299 Bacteria 3571
458 Ga0207426_1000773 3300025302 Bacteria 35199
459 Ga0207426_1000990 3300025302 Bacteria 27830
460 Ga0207426_1003444 3300025302 Bacteria 8596
461 Ga0209257_1000394 3300025304 Bacteria 86654
462 Ga0209257_1011695 3300025304 Bacteria 4183
463 Ga0207697_10158552 3300025315 Bacteria 986
464 Ga0207656_10005846 3300025321 Bacteria 4382
465 Ga0207682_10000254 3300025893 Bacteria 24104
466 Ga0207692_10000138 3300025898 Bacteria 22336
467 Ga0207692_10008172 3300025898 Bacteria 4323
468 Ga0207692_10010497 3300025898 Bacteria 3906
469 Ga0207692_10025398 3300025898 Bacteria 2766
470 Ga0207692_10070524 3300025898 Bacteria 1840
471 Ga0207692_10110409 3300025898 Bacteria 1524
472 Ga0207710_10010813 3300025900 Bacteria 3843
473 Ga0207710_10014720 3300025900 Bacteria 3302
474 Ga0207710_10044682 3300025900 Bacteria 1973
475 Ga0207710_10057463 3300025900 Bacteria 1757
476 Ga0207710_10060946 3300025900 Bacteria 1711
477 Ga0207710_10148545 3300025900 Bacteria 1136
478 Ga0207688_10000518 3300025901 Bacteria 18635
479 Ga0207688_10101138 3300025901 Bacteria 1665
480 Ga0207680_10088009 3300025903 Bacteria 1968
481 Ga0207680_10199770 3300025903 Bacteria 1362
482 Ga0207647_10005671 3300025904 Bacteria 9117
483 Ga0207647_10012374 3300025904 Bacteria 5941
484 Ga0207685_10021771 3300025905 Bacteria 2155
485 Ga0207699_10000122 3300025906 Bacteria 55116
486 Ga0207699_10003146 3300025906 Bacteria 7851
487 Ga0207699_10008397 3300025906 Bacteria 5096
488 Ga0207699_10135323 3300025906 Bacteria 1613
489 Ga0207699_10184435 3300025906 Bacteria 1404
490 Ga0207645_10000249 3300025907 Bacteria 44921
491 Ga0207645_10103240 3300025907 Bacteria 1840
492 Ga0207643_10000978 3300025908 Bacteria 17143
493 Ga0207643_10008642 3300025908 Bacteria 5462
494 Ga0207643_10128696 3300025908 Bacteria 1505
495 Ga0207705_10086337 3300025909 Bacteria 2293
496 Ga0207705_10150930 3300025909 Bacteria 1741
497 Ga0207684_10037662 3300025910 Bacteria 4104
498 Ga0207654_10000153 3300025911 Bacteria 43627
499 Ga0207654_10017523 3300025911 Bacteria 3746
500 Ga0207654_10058650 3300025911 Bacteria 2242
501 Ga0207707_10000515 3300025912 Bacteria 39696
502 Ga0207707_10002207 3300025912 Bacteria 17632
503 Ga0207707_10016918 3300025912 Bacteria 6351
504 Ga0207707_10036558 3300025912 Bacteria 4293
505 Ga0207707_10102350 3300025912 Bacteria 2503
506 Ga0207707_10110818 3300025912 Bacteria 2399
507 Ga0207707_10286287 3300025912 Bacteria 1426
508 Ga0207695_10000006 3300025913 Bacteria 1135309
509 Ga0207695_10000506 3300025913 Bacteria 82904
510 Ga0207695_10030436 3300025913 Bacteria 5941
511 Ga0207695_10051564 3300025913 Bacteria 4318
512 Ga0207695_10200231 3300025913 Bacteria 1911
513 Ga0207695_10223007 3300025913 Bacteria 1792
514 Ga0207695_10330686 3300025913 Bacteria 1412
515 Ga0207671_10021063 3300025914 Bacteria 4952
516 Ga0207671_10205156 3300025914 Bacteria 1540
517 Ga0207671_10331817 3300025914 Bacteria 1205
518 Ga0207693_10001489 3300025915 Bacteria 20660
519 Ga0207693_10004906 3300025915 Bacteria 11244
520 Ga0207693_10009351 3300025915 Bacteria 7991
521 Ga0207693_10010845 3300025915 Bacteria 7394
522 Ga0207693_10042947 3300025915 Bacteria 3559
523 Ga0207693_10052221 3300025915 Bacteria 3206
524 Ga0207693_10080113 3300025915 Bacteria 2556
525 Ga0207663_10000161 3300025916 Bacteria 30665
526 Ga0207663_10000486 3300025916 Bacteria 17287
527 Ga0207663_10000623 3300025916 Bacteria 15689
528 Ga0207663_10012940 3300025916 Bacteria 4524
529 Ga0207663_10014563 3300025916 Bacteria 4310
530 Ga0207663_10121501 3300025916 Bacteria 1789
531 Ga0207663_10152537 3300025916 Bacteria 1622
532 Ga0207663_10293394 3300025916 Bacteria 1212
533 Ga0207660_10001490 3300025917 Bacteria 15757
534 Ga0207660_10016126 3300025917 Bacteria 4941
535 Ga0207660_10145361 3300025917 Bacteria 1817
536 Ga0207660_10149483 3300025917 Bacteria 1793
537 Ga0207660_10155763 3300025917 Bacteria 1758
538 Ga0207662_10076038 3300025918 Bacteria 2040
539 Ga0207657_10033356 3300025919 Bacteria 4642
540 Ga0207657_10046782 3300025919 Bacteria 3788
541 Ga0207657_10141428 3300025919 Bacteria 1966
542 Ga0207657_10217252 3300025919 Bacteria 1533
543 Ga0207649_10006897 3300025920 Bacteria 6172
544 Ga0207649_10312393 3300025920 Bacteria 1152
545 Ga0207652_10024532 3300025921 Bacteria 5004
546 Ga0207652_10045557 3300025921 Bacteria 3740
547 Ga0207652_10084447 3300025921 Bacteria 2781
548 Ga0207652_10154142 3300025921 Bacteria 2058
549 Ga0207652_10161285 3300025921 Bacteria 2010
550 Ga0207652_10196019 3300025921 Bacteria 1817
551 Ga0207652_10226959 3300025921 Bacteria 1683
552 Ga0207652_10246409 3300025921 Bacteria 1611
553 Ga0207646_10094693 3300025922 Bacteria 2675
554 Ga0207681_10000956 3300025923 Bacteria 18860
555 Ga0207694_10003910 3300025924 Bacteria 11770
556 Ga0207694_10105389 3300025924 Bacteria 2238
557 Ga0207694_10220145 3300025924 Bacteria 1548
558 Ga0207694_10225354 3300025924 Bacteria 1530
559 Ga0207694_10350294 3300025924 Bacteria 1222
560 Ga0207650_10030055 3300025925 Bacteria 3911
561 Ga0207650_10074218 3300025925 Bacteria 2563
562 Ga0207659_10006156 3300025926 Bacteria 7335
563 Ga0207687_10009895 3300025927 Bacteria 6243
564 Ga0207687_10017120 3300025927 Bacteria 4765
565 Ga0207687_10029818 3300025927 Bacteria 3672
566 Ga0207687_10230891 3300025927 Bacteria 1461
567 Ga0207687_10301560 3300025927 Bacteria 1291
568 Ga0207687_10403339 3300025927 Bacteria 1125
569 Ga0207700_10002081 3300025928 Bacteria 11427
570 Ga0207700_10015603 3300025928 Bacteria 5017
571 Ga0207700_10068098 3300025928 Bacteria 2727
572 Ga0207700_10078852 3300025928 Bacteria 2563
573 Ga0207700_10099864 3300025928 Bacteria 2312
574 Ga0207700_10157829 3300025928 Bacteria 1881
575 Ga0207664_10012679 3300025929 Bacteria 6031
576 Ga0207664_10021734 3300025929 Bacteria 4779
577 Ga0207664_10037810 3300025929 Bacteria 3738
578 Ga0207664_10048501 3300025929 Bacteria 3340
579 Ga0207664_10081093 3300025929 Bacteria 2639
580 Ga0207664_10122909 3300025929 Bacteria 2175
581 Ga0207664_10123809 3300025929 Bacteria 2168
582 Ga0207664_10496495 3300025929 Bacteria 1093
583 Ga0207644_10015163 3300025931 Bacteria 5170
584 Ga0207644_10018487 3300025931 Bacteria 4716
585 Ga0207644_10022900 3300025931 Bacteria 4272
586 Ga0207644_10033779 3300025931 Bacteria 3577
587 Ga0207644_10293512 3300025931 Bacteria 1308
588 Ga0207690_10000546 3300025932 Bacteria 24592
589 Ga0207690_10165952 3300025932 Bacteria 1650
590 Ga0207690_10493916 3300025932 Bacteria 989
591 Ga0207706_10020138 3300025933 Bacteria 5995
592 Ga0207706_10062550 3300025933 Bacteria 3278
593 Ga0207706_10126312 3300025933 Bacteria 2249
594 Ga0207706_10162509 3300025933 Bacteria 1963
595 Ga0207706_10198139 3300025933 Bacteria 1761
596 Ga0207686_10007493 3300025934 Bacteria 5874
597 Ga0207709_10005105 3300025935 Bacteria 7493
598 Ga0207709_10041733 3300025935 Bacteria 2755
599 Ga0207670_10002637 3300025936 Bacteria 9436
600 Ga0207670_10056573 3300025936 Bacteria 2656
601 Ga0207670_10084579 3300025936 Bacteria 2227
602 Ga0207670_10183717 3300025936 Bacteria 1577
603 Ga0207669_10002362 3300025937 Bacteria 8026
604 Ga0207669_10311820 3300025937 Bacteria 1200
605 Ga0207704_10000964 3300025938 Bacteria 12727
606 Ga0207704_10054979 3300025938 Bacteria 2430
607 Ga0207704_10098483 3300025938 Bacteria 1942
608 Ga0207665_10000183 3300025939 Bacteria 41938
609 Ga0207665_10002530 3300025939 Bacteria 12310
610 Ga0207665_10016785 3300025939 Bacteria 4808
611 Ga0207665_10090592 3300025939 Bacteria 2119
612 Ga0207691_10001481 3300025940 Bacteria 23425
613 Ga0207711_10023845 3300025941 Bacteria 5122
614 Ga0207711_10094808 3300025941 Bacteria 2631
615 Ga0207711_10117134 3300025941 Bacteria 2375
616 Ga0207689_10000424 3300025942 Bacteria 39635
617 Ga0207689_10087700 3300025942 Bacteria 2556
618 Ga0207689_10244191 3300025942 Bacteria 1484
619 Ga0207661_10000828 3300025944 Bacteria 20288
620 Ga0207661_10001905 3300025944 Bacteria 14307
621 Ga0207661_10028196 3300025944 Bacteria 4298
622 Ga0207661_10128685 3300025944 Bacteria 2165
623 Ga0207679_10000595 3300025945 Bacteria 24139
624 Ga0207667_10030376 3300025949 Bacteria 5846
625 Ga0207667_10058089 3300025949 Bacteria 4059
626 Ga0207667_10064756 3300025949 Bacteria 3815
627 Ga0207667_10104674 3300025949 Bacteria 2919
628 Ga0207667_10332027 3300025949 Bacteria 1552
629 Ga0207651_10020112 3300025960 Bacteria 4020
630 Ga0207651_10199418 3300025960 Bacteria 1603
631 Ga0207712_10018492 3300025961 Bacteria 4540
632 Ga0207712_10023939 3300025961 Bacteria 4036
633 Ga0207712_10121382 3300025961 Bacteria 1978
634 Ga0207668_10000956 3300025972 Bacteria 17416
635 Ga0207668_10006840 3300025972 Bacteria 6761
636 Ga0207668_10043661 3300025972 Bacteria 3044
637 Ga0207640_10007609 3300025981 Bacteria 5979
638 Ga0207640_10023862 3300025981 Bacteria 3682
639 Ga0207640_10134907 3300025981 Bacteria 1790
640 Ga0207658_10020702 3300025986 Bacteria 4556
641 Ga0207658_10067626 3300025986 Bacteria 2692
642 Ga0207658_10316488 3300025986 Bacteria 1350
643 Ga0207677_10032859 3300026023 Bacteria 3340
644 Ga0207677_10408896 3300026023 Bacteria 1153
645 Ga0207703_10035107 3300026035 Bacteria 3984
646 Ga0207703_10141894 3300026035 Bacteria 2086
647 Ga0207703_10416537 3300026035 Bacteria 1249
648 Ga0207639_10006156 3300026041 Bacteria 8146
649 Ga0207639_10024622 3300026041 Bacteria 4358
650 Ga0207639_10042056 3300026041 Bacteria 3423
651 Ga0207678_10022600 3300026067 Bacteria 5508
652 Ga0207678_10026771 3300026067 Bacteria 5030
653 Ga0207678_10038686 3300026067 Bacteria 4143
654 Ga0207678_10059424 3300026067 Bacteria 3289
655 Ga0207678_10096846 3300026067 Bacteria 2522
656 Ga0207678_10105437 3300026067 Bacteria 2405
657 Ga0207678_10155774 3300026067 Bacteria 1951
658 Ga0207678_10298681 3300026067 Bacteria 1384
659 Ga0207702_10000006 3300026078 Bacteria 346370
660 Ga0207702_10000063 3300026078 Bacteria 123034
661 Ga0207702_10043737 3300026078 Bacteria 3762
662 Ga0207702_10174014 3300026078 Bacteria 1977
663 Ga0207702_10222152 3300026078 Bacteria 1761
664 Ga0207702_10421699 3300026078 Bacteria 1290
665 Ga0207702_10481793 3300026078 Bacteria 1207
666 Ga0207641_10024879 3300026088 Bacteria 4935
667 Ga0207641_10193115 3300026088 Bacteria 1872
668 Ga0207648_10001553 3300026089 Bacteria 25292
669 Ga0207676_10013306 3300026095 Bacteria 5910
670 Ga0207676_10121038 3300026095 Bacteria 2207
671 Ga0207674_10048571 3300026116 Bacteria 4343
672 Ga0207674_10048718 3300026116 Bacteria 4336
673 Ga0207674_10133209 3300026116 Bacteria 2448
674 Ga0207674_10171418 3300026116 Bacteria 2123
675 Ga0207674_10227285 3300026116 Bacteria 1814
676 Ga0207675_100141890 3300026118 Bacteria 2282
677 Ga0207675_100241858 3300026118 Bacteria 1744
678 Ga0207675_100539240 3300026118 Bacteria 1165
679 Ga0207683_10011960 3300026121 Bacteria 7408
680 Ga0207683_10016218 3300026121 Bacteria 6341
681 Ga0207683_10017647 3300026121 Bacteria 6084
682 Ga0207683_10030540 3300026121 Bacteria 4669
683 Ga0207683_10177815 3300026121 Bacteria 1929
684 Ga0207698_10001038 3300026142 Bacteria 16161
685 Ga0207698_10045959 3300026142 Bacteria 3293
686 Ga0207698_10297454 3300026142 Bacteria 1501
687 Ga0207698_10395256 3300026142 Bacteria 1319
688 Ga0209389_1000034 3300027296 Bacteria 127289
689 Ga0209389_1000039 3300027296 Bacteria 124545
690 Ga0209589_1000038 3300027357 Bacteria 127285
691 Ga0209589_1000055 3300027357 Bacteria 111890
692 Ga0209489_100023 3300027361 Bacteria 198829
693 Ga0209489_100087 3300027361 Bacteria 124545
694 Ga0209489_100128 3300027361 Bacteria 111890
695 Ga0209700_100090 3300027363 Bacteria 124545
696 Ga0209700_100137 3300027363 Bacteria 111890
697 Ga0209967_1007987 3300027364 Bacteria 1451
698 Ga0209968_1006106 3300027526 Bacteria 1813
699 Ga0209982_1004320 3300027552 Bacteria 2036
700 Ga0209970_1005990 3300027614 Bacteria 1995
701 Ga0209588_1005208 3300027671 Bacteria 3711
702 Ga0209966_1003959 3300027695 Bacteria 2500
703 Ga0209998_10002627 3300027717 Bacteria 4070
704 Ga0209813_10020446 3300027866 Bacteria 1852
705 Ga0209974_10006301 3300027876 Bacteria 4147
706 Ga0209974_10014756 3300027876 Bacteria 2596
707 Ga0207428_10000150 3300027907 Bacteria 94699
708 Ga0207428_10000360 3300027907 Bacteria 58478
709 Ga0207428_10001312 3300027907 Bacteria 26468
710 Ga0207428_10036448 3300027907 Bacteria 4011
711 Ga0268266_10011617 3300028379 Bacteria 7644
712 Ga0268266_10034702 3300028379 Bacteria 4290
713 Ga0268266_10053634 3300028379 Bacteria 3464
714 Ga0268266_10115088 3300028379 Bacteria 2387
715 Ga0268266_10188768 3300028379 Bacteria 1881
716 Ga0268266_10219944 3300028379 Bacteria 1745
717 Ga0268266_10600699 3300028379 Bacteria 1057
718 Ga0268265_10011427 3300028380 Bacteria 6001
719 Ga0268265_10021796 3300028380 Bacteria 4493
720 Ga0268265_10029400 3300028380 Bacteria 3943
721 Ga0268265_10130892 3300028380 Bacteria 2085
722 Ga0268264_10000537 3300028381 Bacteria 48029
723 Ga0268264_10004770 3300028381 Bacteria 11508
724 Ga0265337_1061197 3300028556 Bacteria 1043
725 Ga0265334_10039065 3300028573 Bacteria 1864
726 Ga0265318_10007950 3300028577 Bacteria 4756
727 Ga0265323_10012335 3300028653 Bacteria 3428
728 Ga0265336_10001738 3300028666 Bacteria 9568
729 Ga0307517_10001423 3300028786 Bacteria 40213
730 Ga0307515_10046793 3300028794 Bacteria 6600
731 Ga0307515_10122964 3300028794 Bacteria 2923
732 Ga0265338_10000417 3300028800 Bacteria 76249
733 Ga0265338_10085973 3300028800 Bacteria 2619
734 Ga0307511_10080843 3300030521 Bacteria 2286
735 Ga0265330_10025682 3300031235 Bacteria 2669
736 Ga0265330_10034644 3300031235 Bacteria 2254
737 Ga0265330_10102948 3300031235 Bacteria 1221
738 Ga0265332_10040115 3300031238 Bacteria 2027
739 Ga0265325_10000030 3300031241 Bacteria 103532
740 Ga0265340_10001799 3300031247 Bacteria 12236
741 Ga0265340_10013333 3300031247 Bacteria 4319
742 Ga0265340_10046257 3300031247 Bacteria 2123
743 Ga0265340_10068207 3300031247 Bacteria 1689
744 Ga0265340_10068245 3300031247 Bacteria 1689
745 Ga0265340_10069793 3300031247 Bacteria 1667
746 Ga0265340_10070799 3300031247 Bacteria 1654
747 Ga0265340_10105394 3300031247 Bacteria 1307
748 Ga0265340_10144623 3300031247 Bacteria 1086
749 Ga0265339_10000281 3300031249 Bacteria 41044
750 Ga0265339_10009279 3300031249 Bacteria 6197
751 Ga0265339_10116126 3300031249 Bacteria 1380
752 Ga0265331_10089716 3300031250 Bacteria 1422
753 Ga0265331_10130344 3300031250 Bacteria 1147
754 Ga0265316_10012755 3300031344 Bacteria 7510
755 Ga0265316_10159503 3300031344 Bacteria 1687
756 Ga0307513_10171602 3300031456 Bacteria 2046
757 Ga0307509_10053131 3300031507 Bacteria 4322
758 Ga0265313_10001560 3300031595 Bacteria 21251
759 Ga0265313_10005929 3300031595 Bacteria 8842
760 Ga0265313_10023598 3300031595 Bacteria 3310
761 Ga0265313_10107458 3300031595 Bacteria 1230
762 Ga0307508_10000012 3300031616 Bacteria 243167
763 Ga0307508_10033210 3300031616 Bacteria 4657
764 Ga0307508_10323996 3300031616 Bacteria 1133
765 Ga0265314_10011033 3300031711 Bacteria 7493
766 Ga0265314_10023091 3300031711 Bacteria 4752
767 Ga0265342_10002764 3300031712 Bacteria 14883
768 Ga0265342_10046678 3300031712 Bacteria 2602
769 Ga0265342_10077453 3300031712 Bacteria 1925
770 Ga0265342_10079030 3300031712 Bacteria 1903
771 Ga0307516_10014001 3300031730 Bacteria 8506
772 Ga0307516_10293693 3300031730 Bacteria 1303
773 Ga0307407_10242335 3300031903 Bacteria 1231
774 Ga0307412_10049330 3300031911 Bacteria 2773
775 Ga0307416_100100577 3300032002 Bacteria 2515
776 Ga0307416_100154960 3300032002 Bacteria 2108
777 Ga0307411_10194970 3300032005 Bacteria 1550
778 Ga0316583_10001485 3300032133 Bacteria 7857
779 Ga0307510_10022874 3300033180 Bacteria 7250
780 Ga0307510_10031589 3300033180 Bacteria 5980
781 Ga0307510_10037361 3300033180 Bacteria 5388
782 Ga0307510_10071425 3300033180 Bacteria 3456
783 Ga0315911_1000005 3300033442 Bacteria 426255
784 Ga0373930_0001257 3300034816 Bacteria 3742
785 Ga0373948_0000908 3300034817 Bacteria 3960
786 Ga0373950_0002852 3300034818 Bacteria 2422
787 Ga0373958_0000355 3300034819 Bacteria 5513
788 Ga0373959_0000802 3300034820 Bacteria 5367
789 Ga0373938_0000819 3300034957 Bacteria 5030
790 Ga0373938_0004439 3300034957 Bacteria 2345
791 Ga0373926_0014919 3300035083 Bacteria 2646
792 Ga0373928_0004165 3300035084 Bacteria 2757
793 Ga0373929_0000724 3300035085 Bacteria 6375
794 Ga0373929_0001327 3300035085 Bacteria 4770
795 Ga0373929_0004365 3300035085 Bacteria 2537
796 Ga0373929_0008227 3300035085 Bacteria 1921
797 Ga0373934_0006879 3300035086 Bacteria 4222
798 Ga0373934_0024456 3300035086 Bacteria 2335
799 Ga0373934_0029496 3300035086 Bacteria 2143
800 Ga0373940_0000119 3300035088 Bacteria 9863
801 Ga0373944_0030301 3300035089 Bacteria 1622
802 Ga0373949_0001280 3300035090 Bacteria 7323
803 Ga0373949_0013053 3300035090 Bacteria 1841
804 Ga0373951_0002117 3300035091 Bacteria 5077
805 Ga0373951_0007708 3300035091 Bacteria 2442
806 Ga0373951_0034361 3300035091 Bacteria 1204
807 Ga0373952_0000988 3300035092 Bacteria 5183
808 Ga0373952_0003629 3300035092 Bacteria 2783
809 Ga0373923_0002058 3300035111 Bacteria 6070
810 Ga0373923_0073674 3300035111 Bacteria 1471
811 Ga0373932_0002403 3300035112 Bacteria 4749
812 Ga0373932_0008557 3300035112 Bacteria 2447
813 Ga0373936_0003648 3300035113 Bacteria 5778
814 Ga0373936_0007352 3300035113 Bacteria 4145
815 Ga0373936_0083421 3300035113 Bacteria 1332
816 Ga0373939_0001166 3300035114 Bacteria 6435
817 Ga0373939_0034470 3300035114 Bacteria 1485
818 Ga0373941_0009208 3300035115 Bacteria 2479
819 Ga0373941_0011011 3300035115 Bacteria 2327
820 Ga0373953_0001704 3300035117 Bacteria 6467
821 Ga0373953_0002691 3300035117 Bacteria 5390
822 Ga0373953_0005593 3300035117 Bacteria 4090
823 Ga0373953_0007780 3300035117 Bacteria 3609
824 Ga0373953_0081173 3300035117 Bacteria 1348
825 Ga0373954_0003012 3300035118 Bacteria 7106
826 Ga0373954_0005688 3300035118 Bacteria 5407
827 Ga0373954_0007407 3300035118 Bacteria 4802
828 Ga0373954_0037525 3300035118 Bacteria 2252
829 Ga0373956_0019212 3300035119 Bacteria 2898
830 Ga0373956_0050946 3300035119 Bacteria 1860
831 Ga0373956_0056817 3300035119 Bacteria 1767
832 Ga0373957_0004673 3300035120 Bacteria 4187
833 Ga0373957_0050268 3300035120 Bacteria 1593
834 Ga0373957_0113656 3300035120 Bacteria 1092
835 Ga0373960_0022622 3300035121 Bacteria 1685
836 Ga0373960_0025006 3300035121 Bacteria 1620
837 Ga0373943_0001786 3300035170 Bacteria 9742
838 Ga0373943_0010318 3300035170 Bacteria 4190
839 Ga0373943_0025951 3300035170 Bacteria 2741
840 Ga0373943_0113383 3300035170 Bacteria 1432
841 Ga0373943_0212634 3300035170 Bacteria 1074
842 Ga0373946_0008815 3300035171 Bacteria 3702
843 Ga0373946_0013746 3300035171 Bacteria 3046
844 Ga0373946_0023480 3300035171 Bacteria 2409
845 Ga0373946_0064188 3300035171 Bacteria 1570
846 Ga0373946_0111979 3300035171 Bacteria 1236
847 Ga0373955_0002129 3300035172 Bacteria 8555
848 Ga0373955_0002139 3300035172 Bacteria 8536
849 Ga0373955_0009253 3300035172 Bacteria 4612
850 Ga0373955_0038590 3300035172 Bacteria 2545
851 Ga0373955_0048106 3300035172 Bacteria 2311
852 Ga0373955_0070775 3300035172 Bacteria 1949
853 Ga0373955_0091565 3300035172 Bacteria 1733
854 Ga0373942_0003873 3300035207 Bacteria 3499
855 Ga0373942_0020819 3300035207 Bacteria 1650
856 Ga0373961_0001933 3300035241 Bacteria 5614
857 Ga0373961_0002392 3300035241 Bacteria 4881
858 Ga0373962_0001833 3300035242 Bacteria 5059
859 Ga0373962_0024304 3300035242 Bacteria 1619
860 Ga0373962_0071171 3300035242 Bacteria 1039
861 Ga0373924_0012594 3300035410 Bacteria 3163
862 Ga0373924_0014039 3300035410 Bacteria 3021
863 Ga0373924_0052820 3300035410 Bacteria 1687
864 Ga0373931_0003840 3300035691 Bacteria 6792
865 Ga0373931_0011514 3300035691 Bacteria 4275
866 Ga0373931_0060213 3300035691 Bacteria 2043
867 Ga0373931_0079578 3300035691 Bacteria 1805
868 Ga0373931_0245685 3300035691 Bacteria 1086
869 Ga0373935_0002000 3300035692 Bacteria 11490
870 Ga0373935_0003730 3300035692 Bacteria 8891
871 Ga0373935_0017629 3300035692 Bacteria 4335
872 Ga0373935_0034724 3300035692 Bacteria 3145
873 Ga0373935_0069494 3300035692 Bacteria 2268
874 Ga0373927_0001492 3300035695 Bacteria 17635
875 Ga0373927_0001793 3300035695 Bacteria 16018
876 Ga0373927_0015381 3300035695 Bacteria 5057
877 Ga0373927_0035090 3300035695 Bacteria 3261
878 Ga0373927_0038128 3300035695 Bacteria 3121
879 Ga0373927_0049781 3300035695 Bacteria 2709
880 Ga0373927_0272536 3300035695 Bacteria 1113
881 Ga0373933_0000267 3300035724 Bacteria 34008
882 Ga0373933_0013540 3300035724 Bacteria 4523
883 Ga0373933_0016394 3300035724 Bacteria 4142
884 Ga0373933_0035758 3300035724 Bacteria 2903
885 Ga0373933_0036074 3300035724 Bacteria 2892
886 Ga0373947_0001861 3300035725 Bacteria 12857
887 Ga0373947_0011238 3300035725 Bacteria 5137
888 Ga0373947_0019083 3300035725 Bacteria 3952
889 Ga0373947_0083092 3300035725 Bacteria 1985
890 Ga0373947_0265768 3300035725 Bacteria 1137
891 Ga0373937_0020562 3300036401 Bacteria 5917
892 Ga0373937_0022299 3300036401 Bacteria 5693
893 Ga0373937_0032052 3300036401 Bacteria 4765
894 Ga0373937_0040210 3300036401 Bacteria 4262
895 Ga0373937_0046803 3300036401 Bacteria 3956
896 Ga0373937_0053422 3300036401 Bacteria 3706
897 Ga0373937_0055275 3300036401 Bacteria 3644
898 Ga0373937_0259198 3300036401 Bacteria 1639
899 Ga0373937_0362752 3300036401 Bacteria 1373
900 Ga0373937_0376854 3300036401 Bacteria 1345
901 Ga0373925_0006016 3300037068 Bacteria 8981
902 Ga0373925_0013546 3300037068 Bacteria 5904
903 Ga0373925_0023355 3300037068 Bacteria 4512
904 Ga0373925_0058364 3300037068 Bacteria 2894
905 Ga0373925_0071715 3300037068 Bacteria 2620
906 Ga0373925_0117043 3300037068 Bacteria 2065
907 Ga0373925_0205500 3300037068 Bacteria 1567
908 Ga0373925_0352427 3300037068 Bacteria 1195
909 Ga0395899_0009278 3300037312 Bacteria 7554
910 Ga0395900_0008470 3300037418 Bacteria 10576
911 Ga0395900_0048769 3300037418 Bacteria 4362
912 Ga0395898_0004229 3300037466 Bacteria 15742
913 Ga0395898_0019947 3300037466 Bacteria 6816
914 Ga0395898_0091016 3300037466 Bacteria 2935
915 Ga0395905_0004165 3300037471 Bacteria 15125
916 Ga0395905_0032236 3300037471 Bacteria 4928
917 Ga0395905_0083368 3300037471 Bacteria 2995
918 Ga0395905_0119852 3300037471 Bacteria 2473
919 Ga0436364_0483388 3300037853 Bacteria 1691
920 Ga0436364_1097754 3300037853 Bacteria 1005
921 Ga0395901_0004987 3300038443 Bacteria 13397
922 Ga0395901_0064055 3300038443 Bacteria 3826
923 Ga0395901_0111647 3300038443 Bacteria 2871
924 Ga0395901_0384405 3300038443 Bacteria 1444
925 Ga0395901_0422299 3300038443 Bacteria 1367
926 Ga0242420_005885 3300038996 Bacteria 1920
927 Ga0436365_0291314 3300039437 Bacteria 8395
928 Ga0436365_0295600 3300039437 Bacteria 1990
929 Ga0436365_0299351 3300039437 Bacteria 2929
930 Ga0436365_0526132 3300039437 Bacteria 2401
931 Ga0436365_0759284 3300039437 Bacteria 2431
932 Ga0436365_1105753 3300039437 Bacteria 2073
933 Ga0436365_1557661 3300039437 Bacteria 1979
934 Ga0436365_1683113 3300039437 Bacteria 1215
935 Ga0436365_1866057 3300039437 Bacteria 1751
936 Ga0436360_1250391 3300039438 Bacteria 1411
937 Ga0436361_0870440 3300039447 Bacteria 2125
938 Ga0436363_0613006 3300039450 Bacteria 1604
939 Ga0436363_0959897 3300039450 Bacteria 2854
940 Ga0436362_0256641 3300039453 Bacteria 1524
941 Ga0436362_0376169 3300039453 Bacteria 3797
942 Ga0451793_0917594 3300041452 Bacteria 1792
943 Ga0451843_1211220 3300041509 Bacteria 1408
944 Ga0439463_020241 3300042016 Bacteria 1659
945 Ga0466969_0035286 3300044656 Bacteria 2529
946 Ga0466972_0000053 3300044658 Bacteria 112876
947 Ga0466966_0003788 3300044684 Bacteria 9975
948 Ga0466966_0033603 3300044684 Bacteria 3321
949 Ga0466966_0143406 3300044684 Bacteria 1459
950 Ga0466961_0000227 3300044693 Bacteria 38175
951 Ga0466963_0079443 3300044694 Bacteria 2219
952 Ga0466963_0111242 3300044694 Bacteria 1880
953 Ga0466963_0226495 3300044694 Bacteria 1310
954 Ga0466963_0284198 3300044694 Bacteria 1163
955 Ga0466957_0024689 3300044842 Bacteria 3559
956 Ga0466957_0173954 3300044842 Bacteria 1403
957 Ga0466960_0198246 3300044901 Bacteria 1095
958 Ga0466959_0024944 3300045049 Bacteria 4429
959 Ga0466959_0061469 3300045049 Bacteria 2731
960 Ga0466967_0164748 3300045976 Bacteria 2083
961 Ga0495617_020125 3300046452 Bacteria 2255
962 Ga0495592_0002227 3300046454 Bacteria 13684
963 Ga0495592_0008094 3300046454 Bacteria 7894
964 Ga0495592_0033791 3300046454 Bacteria 3857
965 Ga0495592_0047131 3300046454 Bacteria 3210
966 Ga0495592_0053346 3300046454 Bacteria 2999
967 Ga0495592_0107893 3300046454 Bacteria 1974
968 Ga0495603_0000036 3300046455 Bacteria 57443
969 Ga0495603_0008447 3300046455 Bacteria 6220
970 Ga0495603_0015690 3300046455 Bacteria 4583
971 Ga0495603_0015820 3300046455 Bacteria 4560
972 Ga0495603_0017567 3300046455 Bacteria 4331
973 Ga0495603_0061304 3300046455 Bacteria 2221
974 Ga0495603_0090677 3300046455 Bacteria 1787
975 Ga0495591_036395 3300046458 Bacteria 1433
976 Ga0495629_0000026 3300046459 Bacteria 134719
977 Ga0495629_0000148 3300046459 Bacteria 61440
978 Ga0495629_0000331 3300046459 Bacteria 40528
979 Ga0495629_0026160 3300046459 Bacteria 4146
980 Ga0495629_0108804 3300046459 Bacteria 1933
981 Ga0495629_0214212 3300046459 Bacteria 1330
982 Ga0495629_0252001 3300046459 Bacteria 1215
983 Ga0495629_0326679 3300046459 Bacteria 1048
984 Ga0495638_0033836 3300046460 Bacteria 3265
985 Ga0495638_0046208 3300046460 Bacteria 2736
986 Ga0495638_0254238 3300046460 Bacteria 967
987 Ga0495641_0004773 3300046461 Bacteria 9436
988 Ga0495641_0023447 3300046461 Bacteria 3065
989 Ga0495651_0000808 3300046462 Bacteria 24239
990 Ga0495651_0009401 3300046462 Bacteria 7508
991 Ga0495651_0016761 3300046462 Bacteria 5675
992 Ga0495651_0026176 3300046462 Bacteria 4543
993 Ga0495651_0079310 3300046462 Bacteria 2482
994 Ga0495651_0090115 3300046462 Bacteria 2301
995 Ga0495651_0127727 3300046462 Bacteria 1860
996 Ga0495651_0217048 3300046462 Bacteria 1326
997 Ga0495653_0000697 3300046463 Bacteria 25621
998 Ga0495653_0010076 3300046463 Bacteria 7731
999 Ga0495653_0033411 3300046463 Bacteria 4076
1000 Ga0495653_0200113 3300046463 Bacteria 1356
1001 Ga0495580_0000705 3300046472 Bacteria 28569
1002 Ga0495580_0005369 3300046472 Bacteria 10609
1003 Ga0495580_0097515 3300046472 Bacteria 2044
1004 Ga0495582_0002450 3300046473 Bacteria 10340
1005 Ga0495582_0003391 3300046473 Bacteria 8970
1006 Ga0495582_0005700 3300046473 Bacteria 6937
1007 Ga0495582_0172305 3300046473 Bacteria 1232
1008 Ga0495605_0096947 3300046474 Bacteria 1360
1009 Ga0495639_0000135 3300046475 Bacteria 38122
1010 Ga0495639_0004541 3300046475 Bacteria 5951
1011 Ga0495639_0009129 3300046475 Bacteria 4249
1012 Ga0495662_0000811 3300046476 Bacteria 15187
1013 Ga0495662_0010232 3300046476 Bacteria 4596
1014 Ga0495664_0002195 3300046477 Bacteria 10450
1015 Ga0495664_0015540 3300046477 Bacteria 4328
1016 Ga0495664_0020709 3300046477 Bacteria 3795
1017 Ga0495664_0024550 3300046477 Bacteria 3505
1018 Ga0495664_0242264 3300046477 Bacteria 1091
1019 Ga0495584_0024184 3300046491 Bacteria 3080
1020 Ga0495584_0127502 3300046491 Bacteria 1290
1021 Ga0495585_0005952 3300046492 Bacteria 7630
1022 Ga0495585_0095908 3300046492 Bacteria 1592
1023 Ga0495594_0001252 3300046499 Bacteria 13306
1024 Ga0495594_0161976 3300046499 Bacteria 1272
1025 Ga0495594_0217482 3300046499 Bacteria 1089
1026 Ga0495594_0232899 3300046499 Bacteria 1050
1027 Ga0495594_0234788 3300046499 Bacteria 1045
1028 Ga0495594_0242154 3300046499 Bacteria 1028
1029 Ga0495594_0247000 3300046499 Bacteria 1017
1030 Ga0495596_0098348 3300046500 Bacteria 1136
1031 Ga0495607_0022960 3300046501 Bacteria 3910
1032 Ga0495607_0151071 3300046501 Bacteria 1189
1033 Ga0495583_0094855 3300046506 Bacteria 1280
1034 Ga0495583_0108198 3300046506 Bacteria 1180
1035 Ga0495606_0001350 3300046507 Bacteria 33317
1036 Ga0495606_0109676 3300046507 Bacteria 1666
1037 Ga0495608_0004227 3300046511 Bacteria 10294
1038 Ga0495608_0045151 3300046511 Bacteria 2938
1039 Ga0495608_0062538 3300046511 Bacteria 2445
1040 Ga0495608_0083219 3300046511 Bacteria 2077
1041 Ga0495616_0037770 3300046513 Bacteria 2482
1042 Ga0495616_0084300 3300046513 Bacteria 1515
1043 Ga0495616_0124891 3300046513 Bacteria 1184
1044 Ga0495618_0012417 3300046514 Bacteria 5174
1045 Ga0495618_0016165 3300046514 Bacteria 4561
1046 Ga0495618_0022928 3300046514 Bacteria 3856
1047 Ga0495618_0048606 3300046514 Bacteria 2678
1048 Ga0495618_0185643 3300046514 Bacteria 1320
1049 Ga0495618_0208057 3300046514 Bacteria 1237
1050 Ga0495618_0242587 3300046514 Bacteria 1132
1051 Ga0495620_0013412 3300046515 Bacteria 4195
1052 Ga0495628_0011769 3300046516 Bacteria 7386
1053 Ga0495628_0024473 3300046516 Bacteria 4942
1054 Ga0495628_0045823 3300046516 Bacteria 3475
1055 Ga0495628_0095790 3300046516 Bacteria 2293
1056 Ga0495630_0067195 3300046517 Bacteria 2694
1057 Ga0495630_0086215 3300046517 Bacteria 2371
1058 Ga0495630_0146108 3300046517 Bacteria 1798
1059 Ga0495632_0050213 3300046519 Bacteria 2058
1060 Ga0495637_0017430 3300046520 Bacteria 3347
1061 Ga0495637_0029569 3300046520 Bacteria 2438
1062 Ga0495643_0051759 3300046522 Bacteria 2207
1063 Ga0495644_0000215 3300046523 Bacteria 27294
1064 Ga0495644_0073897 3300046523 Bacteria 1282
1065 Ga0495648_0004337 3300046524 Bacteria 12150
1066 Ga0495648_0040614 3300046524 Bacteria 2948
1067 Ga0495648_0051499 3300046524 Bacteria 2508
1068 Ga0495666_0081772 3300046526 Bacteria 1528
1069 Ga0495666_0107322 3300046526 Bacteria 1313
1070 Ga0495652_0010453 3300046529 Bacteria 8412
1071 Ga0495652_0025648 3300046529 Bacteria 5210
1072 Ga0495652_0335278 3300046529 Bacteria 1088
1073 Ga0495654_0091978 3300046530 Bacteria 1406
1074 Ga0495665_0000118 3300046531 Bacteria 37731
1075 Ga0495665_0005110 3300046531 Bacteria 7077
1076 Ga0495665_0037705 3300046531 Bacteria 2579
1077 Ga0495640_0029993 3300046533 Bacteria 3898
1078 Ga0495640_0057459 3300046533 Bacteria 2655
1079 Ga0495640_0083891 3300046533 Bacteria 2114
1080 Ga0495640_0120148 3300046533 Bacteria 1709
1081 Ga0495586_0019590 3300046535 Bacteria 3603
1082 Ga0495586_0030611 3300046535 Bacteria 2880
1083 Ga0495587_0003557 3300046536 Bacteria 10385
1084 Ga0495587_0009426 3300046536 Bacteria 6257
1085 Ga0495587_0020301 3300046536 Bacteria 4102
1086 Ga0495587_0021420 3300046536 Bacteria 3986
1087 Ga0495587_0037845 3300046536 Bacteria 2894
1088 Ga0495587_0087729 3300046536 Bacteria 1800
1089 Ga0495587_0100858 3300046536 Bacteria 1664
1090 Ga0495587_0241562 3300046536 Bacteria 1016
1091 Ga0495598_0059909 3300046537 Bacteria 1171
1092 Ga0495621_0111029 3300046539 Bacteria 1051
1093 Ga0495597_0055463 3300046542 Bacteria 1738
1094 Ga0495597_0059960 3300046542 Bacteria 1661
1095 Ga0495597_0071706 3300046542 Bacteria 1491
1096 Ga0495645_0003334 3300046543 Bacteria 10884
1097 Ga0495645_0018632 3300046543 Bacteria 4988
1098 Ga0495645_0057120 3300046543 Bacteria 2834
1099 Ga0495645_0124722 3300046543 Bacteria 1810
1100 Ga0495622_0015036 3300046557 Bacteria 3598
1101 Ga0495622_0027568 3300046557 Bacteria 2651
1102 Ga0495622_0053671 3300046557 Bacteria 1870
1103 Ga0495622_0066030 3300046557 Bacteria 1672
1104 Ga0495622_0074657 3300046557 Bacteria 1563
1105 Ga0495633_0001472 3300046558 Bacteria 18264
1106 Ga0495633_0072774 3300046558 Bacteria 1602
1107 Ga0495667_0000379 3300046559 Bacteria 28161
1108 Ga0495667_0001178 3300046559 Bacteria 17087
1109 Ga0495667_0001880 3300046559 Bacteria 13932
1110 Ga0495667_0003467 3300046559 Bacteria 10570
1111 Ga0495667_0013308 3300046559 Bacteria 5570
1112 Ga0495667_0035656 3300046559 Bacteria 3323
1113 Ga0495667_0040798 3300046559 Bacteria 3080
1114 Ga0495667_0047491 3300046559 Bacteria 2837
1115 Ga0495656_0000808 3300046615 Bacteria 10125
1116 Ga0495668_0053348 3300046616 Bacteria 2235
1117 Ga0495668_0063204 3300046616 Bacteria 2039
1118 Ga0495668_0106545 3300046616 Bacteria 1533
1119 Ga0495668_0173550 3300046616 Bacteria 1181
1120 Ga0495634_0000969 3300046642 Bacteria 27075
1121 Ga0495634_0018562 3300046642 Bacteria 4949
1122 Ga0495634_0115284 3300046642 Bacteria 1724
1123 Ga0495634_0116320 3300046642 Bacteria 1715
1124 Ga0495634_0129721 3300046642 Bacteria 1608
1125 Ga0495634_0221464 3300046642 Bacteria 1168
1126 Ga0495634_0261542 3300046642 Bacteria 1055
1127 Ga0495611_0056620 3300046648 Bacteria 1775
1128 Ga0495625_0161696 3300046660 Bacteria 1500
1129 Ga0495635_0006242 3300046663 Bacteria 8302
1130 Ga0495635_0062342 3300046663 Bacteria 2561
1131 Ga0495635_0114367 3300046663 Bacteria 1842
1132 Ga0495659_0009514 3300046664 Bacteria 3104
1133 Ga0495661_0021971 3300046665 Bacteria 4153
1134 Ga0495661_0144082 3300046665 Bacteria 1293
1135 Ga0495588_0036181 3300046674 Bacteria 2504
1136 Ga0495588_0046900 3300046674 Bacteria 2217
1137 Ga0495588_0092873 3300046674 Bacteria 1581
1138 Ga0495588_0131483 3300046674 Bacteria 1320
1139 Ga0495657_0005912 3300046675 Bacteria 9612
1140 Ga0495657_0007977 3300046675 Bacteria 8117
1141 Ga0495657_0008887 3300046675 Bacteria 7648
1142 Ga0495657_0017121 3300046675 Bacteria 5268
1143 Ga0495657_0174238 3300046675 Bacteria 1323
1144 Ga0495599_0006442 3300046678 Bacteria 7081
1145 Ga0495599_0035010 3300046678 Bacteria 3152
1146 Ga0495599_0069200 3300046678 Bacteria 2203
1147 Ga0495599_0130701 3300046678 Bacteria 1559
1148 Ga0495599_0228107 3300046678 Bacteria 1138
1149 Ga0495599_0231185 3300046678 Bacteria 1129
1150 Ga0495623_0005999 3300046679 Bacteria 7904
1151 Ga0495623_0028685 3300046679 Bacteria 3580
1152 Ga0495623_0042152 3300046679 Bacteria 2908
1153 Ga0495646_0000395 3300046680 Bacteria 22931
1154 Ga0495646_0008527 3300046680 Bacteria 6511
1155 Ga0495646_0021600 3300046680 Bacteria 4066
1156 Ga0495646_0142601 3300046680 Bacteria 1338
1157 Ga0495647_0000360 3300046681 Bacteria 12869
1158 Ga0495647_0050904 3300046681 Bacteria 1608
1159 Ga0495658_0001322 3300046683 Bacteria 12988
1160 Ga0495658_0009177 3300046683 Bacteria 4918
1161 Ga0495658_0047609 3300046683 Bacteria 2415
1162 Ga0495658_0107060 3300046683 Bacteria 1676
1163 Ga0495669_0083495 3300046684 Bacteria 1468
1164 Ga0495669_0137467 3300046684 Bacteria 1152
1165 Ga0495613_0012017 3300046689 Bacteria 6434
1166 Ga0495613_0031204 3300046689 Bacteria 3957
1167 Ga0495613_0053959 3300046689 Bacteria 2955
1168 Ga0495613_0123568 3300046689 Bacteria 1857
1169 Ga0495613_0162765 3300046689 Bacteria 1586
1170 Ga0495613_0187711 3300046689 Bacteria 1462
1171 Ga0495624_0000445 3300046690 Bacteria 32525
1172 Ga0495624_0019074 3300046690 Bacteria 4582
1173 Ga0495624_0065072 3300046690 Bacteria 2278
1174 Ga0495624_0078421 3300046690 Bacteria 2048
1175 Ga0495624_0210104 3300046690 Bacteria 1181
1176 Ga0495670_0005172 3300046691 Bacteria 6420
1177 Ga0495670_0123993 3300046691 Bacteria 1343
1178 Ga0495671_0122925 3300046692 Bacteria 1266
1179 Ga0495649_0042903 3300046694 Bacteria 2470
1180 Ga0495589_0082422 3300046794 Bacteria 1564
1181 Ga0495600_0002559 3300046809 Bacteria 10484
1182 Ga0495600_0003883 3300046809 Bacteria 8870
1183 Ga0495600_0007122 3300046809 Bacteria 6833
1184 Ga0495600_0012284 3300046809 Bacteria 5350
1185 Ga0495600_0026362 3300046809 Bacteria 3751
1186 Ga0495600_0086189 3300046809 Bacteria 2049
1187 Ga0495581_0001178 3300047315 Bacteria 14344
1188 Ga0495581_0067552 3300047315 Bacteria 2067
1189 Ga0495581_0169040 3300047315 Bacteria 1278
1190 Ga0495581_0217217 3300047315 Bacteria 1118
1191 Ga0495604_0003605 3300047317 Bacteria 12338
1192 Ga0495604_0012567 3300047317 Bacteria 6733
1193 Ga0495604_0057670 3300047317 Bacteria 2985
1194 Ga0495604_0075876 3300047317 Bacteria 2530
1195 Ga0495604_0093258 3300047317 Bacteria 2228
1196 Ga0495604_0101323 3300047317 Bacteria 2115
1197 Ga0495604_0105349 3300047317 Bacteria 2064
1198 Ga0495604_0121326 3300047317 Bacteria 1892
1199 Ga0495636_0046143 3300047318 Bacteria 1817
1200 Ga0495674_0000443 3300047319 Bacteria 37259
1201 Ga0495674_0008197 3300047319 Bacteria 9970
1202 Ga0495674_0010317 3300047319 Bacteria 8845
1203 Ga0495674_0014605 3300047319 Bacteria 7349
1204 Ga0495674_0030976 3300047319 Bacteria 4861
1205 Ga0495674_0036232 3300047319 Bacteria 4443
1206 Ga0495674_0038574 3300047319 Bacteria 4287
1207 Ga0495674_0201991 3300047319 Bacteria 1648
1208 Ga0495672_0005199 3300047320 Bacteria 10374
1209 Ga0495672_0081822 3300047320 Bacteria 1797
1210 Ga0495672_0123114 3300047320 Bacteria 1375
1211 Ga0495672_0138500 3300047320 Bacteria 1273
1212 Ga0495676_0040035 3300047321 Bacteria 3872
1213 Ga0495676_0104051 3300047321 Bacteria 2095
1214 Ga0495676_0268884 3300047321 Bacteria 1157
1215 Ga0495680_0000825 3300047322 Bacteria 34510
1216 Ga0495680_0001308 3300047322 Bacteria 27152
1217 Ga0495680_0002772 3300047322 Bacteria 17676
1218 Ga0495680_0019969 3300047322 Bacteria 5647
1219 Ga0495680_0024601 3300047322 Bacteria 4994
1220 Ga0495680_0024704 3300047322 Bacteria 4981
1221 Ga0495680_0154704 3300047322 Bacteria 1669
1222 Ga0495680_0247200 3300047322 Bacteria 1265
1223 Ga0495687_058255 3300047443 Bacteria 1603
1224 Ga0495675_0032620 3300047444 Bacteria 3323
1225 Ga0495675_0075757 3300047444 Bacteria 2120
1226 Ga0495675_0087197 3300047444 Bacteria 1961
1227 Ga0495679_019573 3300047446 Bacteria 2375
1228 Ga0495684_0002730 3300047471 Bacteria 13961
1229 Ga0495684_0054251 3300047471 Bacteria 3057
1230 Ga0495684_0076841 3300047471 Bacteria 2536
1231 Ga0495684_0077562 3300047471 Bacteria 2522
1232 Ga0495593_0000495 3300047673 Bacteria 22212
1233 Ga0495593_0001203 3300047673 Bacteria 15131
1234 Ga0495593_0009453 3300047673 Bacteria 5657
1235 Ga0495593_0009518 3300047673 Bacteria 5637
1236 Ga0495593_0022477 3300047673 Bacteria 3513
1237 Ga0495593_0041048 3300047673 Bacteria 2489
1238 Ga0495593_0057475 3300047673 Bacteria 2042
1239 Ga0495593_0105124 3300047673 Bacteria 1445
1240 Ga0495602_0028623 3300048088 Bacteria 5327
1241 Ga0495602_0031862 3300048088 Bacteria 4975
1242 Ga0495602_0048324 3300048088 Bacteria 3825
1243 Ga0495602_0115902 3300048088 Bacteria 2166
1244 Ga0495614_0025736 3300048089 Bacteria 2537
1245 Ga0495614_0111458 3300048089 Bacteria 1201
1246 Ga0495615_0052817 3300048090 Bacteria 1051
1247 Ga0495626_0057165 3300048091 Bacteria 1785
1248 Ga0496100_0011667 3300048903 Bacteria 5008
1249 Ga0496100_0016652 3300048903 Bacteria 4322
1250 Ga0496100_0025723 3300048903 Bacteria 3600
1251 Ga0496100_0341982 3300048903 Bacteria 1128
1252 Ga0496101_0003579 3300048904 Bacteria 9698
1253 Ga0496101_0003853 3300048904 Bacteria 9381
1254 Ga0496101_0023337 3300048904 Bacteria 4272
1255 Ga0496101_0052485 3300048904 Bacteria 2940
1256 Ga0496101_0064455 3300048904 Bacteria 2669
1257 Ga0496101_0185183 3300048904 Bacteria 1605
1258 Ga0496101_0538500 3300048904 Bacteria 923
1259 Ga0496102_0007923 3300048905 Bacteria 9080
1260 Ga0496102_0010957 3300048905 Bacteria 7811
1261 Ga0496102_0045197 3300048905 Bacteria 3997
1262 Ga0496102_0208063 3300048905 Bacteria 1844
1263 Ga0496102_0418721 3300048905 Bacteria 1258
1264 Ga0496103_0008374 3300048906 Bacteria 6143
1265 Ga0496103_0023579 3300048906 Bacteria 3712
1266 Ga0496103_0027759 3300048906 Bacteria 3432
1267 Ga0496103_0053736 3300048906 Bacteria 2496
1268 Ga0496104_0000065 3300048907 Bacteria 108770
1269 Ga0496104_0014455 3300048907 Bacteria 7131
1270 Ga0496104_0014992 3300048907 Bacteria 7010
1271 Ga0496104_0048023 3300048907 Bacteria 4025
1272 Ga0496104_0069177 3300048907 Bacteria 3355
1273 Ga0496104_0079488 3300048907 Bacteria 3125
1274 Ga0496104_0144029 3300048907 Bacteria 2289
1275 Ga0496104_0168221 3300048907 Bacteria 2102
1276 Ga0496104_0184407 3300048907 Bacteria 1997
1277 Ga0496104_0543636 3300048907 Bacteria 1072
1278 Ga0496105_0000338 3300048908 Bacteria 30721
1279 Ga0496105_0007095 3300048908 Bacteria 8640
1280 Ga0496105_0026827 3300048908 Bacteria 4701
1281 Ga0496105_0030697 3300048908 Bacteria 4404
1282 Ga0496105_0102035 3300048908 Bacteria 2369
1283 Ga0496105_0102772 3300048908 Bacteria 2360
1284 Ga0496105_0102995 3300048908 Bacteria 2357
1285 Ga0496105_0141191 3300048908 Bacteria 1982
1286 Ga0496106_0003403 3300048909 Bacteria 11849
1287 Ga0496106_0011816 3300048909 Bacteria 6446
1288 Ga0496106_0012418 3300048909 Bacteria 6289
1289 Ga0496106_0015817 3300048909 Bacteria 5580
1290 Ga0496106_0017137 3300048909 Bacteria 5363
1291 Ga0496106_0168052 3300048909 Bacteria 1737
1292 Ga0496107_0020448 3300048910 Bacteria 4675
1293 Ga0496107_0035807 3300048910 Bacteria 3559
1294 Ga0496107_0052763 3300048910 Bacteria 2932
1295 Ga0496107_0099528 3300048910 Bacteria 2131
1296 Ga0496107_0276695 3300048910 Bacteria 1249
1297 Ga0496108_0002964 3300048911 Bacteria 13649
1298 Ga0496108_0004356 3300048911 Bacteria 11383
1299 Ga0496108_0074602 3300048911 Bacteria 2865
1300 Ga0496108_0074802 3300048911 Bacteria 2861
1301 Ga0496108_0149303 3300048911 Bacteria 2016
1302 Ga0496108_0287503 3300048911 Bacteria 1431
1303 Ga0496108_0506769 3300048911 Bacteria 1054
1304 Ga0496109_0002046 3300048912 Bacteria 16718
1305 Ga0496109_0003207 3300048912 Bacteria 13613
1306 Ga0496109_0014486 3300048912 Bacteria 6860
1307 Ga0496109_0053999 3300048912 Bacteria 3666
1308 Ga0496109_0068598 3300048912 Bacteria 3250
1309 Ga0496109_0208775 3300048912 Bacteria 1836
1310 Ga0496109_0213887 3300048912 Bacteria 1813
1311 Ga0496109_0222188 3300048912 Bacteria 1776
1312 Ga0496109_0302962 3300048912 Bacteria 1507
1313 Ga0496109_0386395 3300048912 Bacteria 1322
1314 Ga0496110_0026611 3300048913 Bacteria 4952
1315 Ga0496110_0029454 3300048913 Bacteria 4725
1316 Ga0496110_0058569 3300048913 Bacteria 3393
1317 Ga0496110_0067181 3300048913 Bacteria 3172
1318 Ga0496110_0107500 3300048913 Bacteria 2504
1319 Ga0496110_0163678 3300048913 Bacteria 2017
1320 Ga0496110_0257349 3300048913 Bacteria 1589
1321 Ga0496110_0328459 3300048913 Bacteria 1393
1322 Ga0496110_0334970 3300048913 Bacteria 1378
1323 Ga0496111_0016724 3300048914 Bacteria 5060
1324 Ga0496111_0027702 3300048914 Bacteria 4012
1325 Ga0496111_0158235 3300048914 Bacteria 1681
1326 Ga0496111_0249161 3300048914 Bacteria 1318
1327 Ga0496112_0000029 3300048915 Bacteria 122291
1328 Ga0496112_0005532 3300048915 Bacteria 10946
1329 Ga0496112_0015369 3300048915 Bacteria 7140
1330 Ga0496112_0018491 3300048915 Bacteria 6562
1331 Ga0496112_0039371 3300048915 Bacteria 4619
1332 Ga0496112_0053414 3300048915 Bacteria 3968
1333 Ga0496112_0074363 3300048915 Bacteria 3359
1334 Ga0496112_0175826 3300048915 Bacteria 2106
1335 Ga0496112_0190119 3300048915 Bacteria 2015
1336 Ga0496112_0336353 3300048915 Bacteria 1453
1337 Ga0496112_0381138 3300048915 Bacteria 1351
1338 Ga0496112_0458908 3300048915 Bacteria 1212
1339 Ga0496112_0596501 3300048915 Bacteria 1037
1340 Ga0496113_0003527 3300048916 Bacteria 9389
1341 Ga0496113_0020258 3300048916 Bacteria 4673
1342 Ga0496113_0047943 3300048916 Bacteria 3177
1343 Ga0496113_0055955 3300048916 Bacteria 2959
1344 Ga0496113_0083060 3300048916 Bacteria 2457
1345 Ga0496113_0134356 3300048916 Bacteria 1943
1346 Ga0496113_0255493 3300048916 Bacteria 1399
1347 Ga0496114_0011325 3300048917 Bacteria 7124
1348 Ga0496114_0012027 3300048917 Bacteria 6922
1349 Ga0496114_0021000 3300048917 Bacteria 5305
1350 Ga0496114_0206620 3300048917 Bacteria 1721
1351 Ga0496114_0269506 3300048917 Bacteria 1500
1352 Ga0496114_0523529 3300048917 Bacteria 1048
1353 Ga0496115_0000295 3300048918 Bacteria 42998
1354 Ga0496115_0003483 3300048918 Bacteria 11315
1355 Ga0496115_0018198 3300048918 Bacteria 5389
1356 Ga0496115_0022325 3300048918 Bacteria 4901
1357 Ga0496115_0076474 3300048918 Bacteria 2721
1358 Ga0496115_0215397 3300048918 Bacteria 1586
1359 Ga0496115_0230402 3300048918 Bacteria 1528
1360 Ga0496115_0253433 3300048918 Bacteria 1448
1361 Ga0496115_0329554 3300048918 Bacteria 1247
1362 Ga0496116_0018470 3300048919 Bacteria 5376
1363 Ga0496116_0105397 3300048919 Bacteria 1673
1364 Ga0496117_0011427 3300048920 Bacteria 7954
1365 Ga0496117_0091379 3300048920 Bacteria 1958
1366 Ga0496117_0196340 3300048920 Bacteria 1144
1367 Ga0496118_0001805 3300048921 Bacteria 30834
1368 Ga0496118_0022933 3300048921 Bacteria 5439
1369 Ga0496118_0037848 3300048921 Bacteria 3875
1370 Ga0496119_0007315 3300048922 Bacteria 9989
1371 Ga0496119_0062780 3300048922 Bacteria 2212
1372 Ga0496119_0127448 3300048922 Bacteria 1391
1373 Ga0496119_0135649 3300048922 Bacteria 1335
1374 Ga0496120_0002476 3300048923 Bacteria 18594
1375 Ga0496120_0018821 3300048923 Bacteria 4437
1376 Ga0496120_0145843 3300048923 Bacteria 1196
1377 Ga0496121_0001687 3300048924 Bacteria 36333
1378 Ga0496121_0003034 3300048924 Bacteria 24376
1379 Ga0496121_0003702 3300048924 Bacteria 21459
1380 Ga0496121_0004663 3300048924 Bacteria 18208
1381 Ga0496121_0022584 3300048924 Bacteria 6095
1382 Ga0496121_0024664 3300048924 Bacteria 5741
1383 Ga0496121_0031082 3300048924 Bacteria 4889
1384 Ga0496121_0036588 3300048924 Bacteria 4372
1385 Ga0496121_0041193 3300048924 Bacteria 4041
1386 Ga0496121_0099032 3300048924 Bacteria 2254
1387 Ga0496121_0103994 3300048924 Bacteria 2183
1388 Ga0496121_0139347 3300048924 Bacteria 1802
1389 Ga0496121_0157493 3300048924 Bacteria 1665
1390 Ga0496122_0042354 3300048925 Bacteria 3584
1391 Ga0496122_0045370 3300048925 Bacteria 3417
1392 Ga0496122_0067457 3300048925 Bacteria 2577
1393 Ga0496124_0005242 3300048927 Bacteria 14692
1394 Ga0496124_0165082 3300048927 Bacteria 1722
1395 Ga0496124_0205568 3300048927 Bacteria 1494
1396 Ga0496124_0226395 3300048927 Bacteria 1402
1397 Ga0496125_0000154 3300048928 Bacteria 152240
1398 Ga0496125_0000823 3300048928 Bacteria 50271
1399 Ga0496125_0004393 3300048928 Bacteria 16325
1400 Ga0496125_0052663 3300048928 Bacteria 3345
1401 Ga0496125_0056873 3300048928 Bacteria 3173
1402 Ga0496125_0067186 3300048928 Bacteria 2827
1403 Ga0496125_0074537 3300048928 Bacteria 2631
1404 Ga0496125_0086498 3300048928 Bacteria 2370
1405 Ga0496125_0095367 3300048928 Bacteria 2213
1406 Ga0496126_0005939 3300048929 Bacteria 13755
1407 Ga0496126_0007926 3300048929 Bacteria 11546
1408 Ga0496126_0011331 3300048929 Bacteria 9244
1409 Ga0496126_0034249 3300048929 Bacteria 4771
1410 Ga0496126_0035603 3300048929 Bacteria 4664
1411 Ga0496126_0038680 3300048929 Bacteria 4435
1412 Ga0496126_0090551 3300048929 Bacteria 2691
1413 Ga0496126_0093307 3300048929 Bacteria 2643
1414 Ga0496126_0327476 3300048929 Bacteria 1258
1415 Ga0501031_0002996 3300049568 Bacteria 10804
1416 Ga0501031_0003990 3300049568 Bacteria 9517
1417 Ga0501031_0337165 3300049568 Bacteria 976
1418 Ga0501032_0000073 3300049569 Bacteria 85584
1419 Ga0501032_0004842 3300049569 Bacteria 10092
1420 Ga0501032_0047385 3300049569 Bacteria 2902
1421 Ga0501033_0000136 3300049570 Bacteria 70952
1422 Ga0501033_0002224 3300049570 Bacteria 16678
1423 Ga0501033_0037424 3300049570 Bacteria 3632
1424 Ga0501033_0057288 3300049570 Bacteria 2880
1425 Ga0501034_0000251 3300049571 Bacteria 99406
1426 Ga0501034_0000295 3300049571 Bacteria 88435
1427 Ga0501034_0000772 3300049571 Bacteria 47902
1428 Ga0501034_0030135 3300049571 Bacteria 5514
1429 Ga0501034_0040486 3300049571 Bacteria 4717
1430 Ga0501034_0049417 3300049571 Bacteria 4243
1431 Ga0501034_0090938 3300049571 Bacteria 3050
1432 Ga0501034_0116531 3300049571 Bacteria 2659
1433 Ga0501034_0254770 3300049571 Bacteria 1699
1434 Ga0501036_0000036 3300049572 Bacteria 87244
1435 Ga0501036_0000331 3300049572 Bacteria 33074
1436 Ga0501036_0015708 3300049572 Bacteria 6322
1437 Ga0501036_0030837 3300049572 Bacteria 4530
1438 Ga0501036_0057168 3300049572 Bacteria 3304
1439 Ga0501036_0067709 3300049572 Bacteria 3021
1440 Ga0501036_0249882 3300049572 Bacteria 1486
1441 Ga0501037_0000040 3300049573 Bacteria 119364
1442 Ga0501037_0001428 3300049573 Bacteria 17519
1443 Ga0501037_0023340 3300049573 Bacteria 4574
1444 Ga0501037_0042850 3300049573 Bacteria 3326
1445 Ga0501037_0043750 3300049573 Bacteria 3290
1446 Ga0501037_0064326 3300049573 Bacteria 2673
1447 Ga0501037_0067329 3300049573 Bacteria 2608
1448 Ga0501037_0081263 3300049573 Bacteria 2350
1449 Ga0501038_0000150 3300049574 Bacteria 59508
1450 Ga0501038_0283264 3300049574 Bacteria 1304
1451 Ga0501038_0461706 3300049574 Bacteria 975
1452 Ga0501039_0003418 3300049575 Bacteria 11852
1453 Ga0501039_0096245 3300049575 Bacteria 2308
1454 Ga0501039_0123188 3300049575 Bacteria 2032
1455 Ga0501039_0148562 3300049575 Bacteria 1842
1456 Ga0501042_0008136 3300049578 Bacteria 6907
1457 Ga0501042_0008268 3300049578 Bacteria 6859
1458 Ga0501042_0372384 3300049578 Bacteria 1034
1459 Ga0501043_0000464 3300049579 Bacteria 36232
1460 Ga0501043_0001844 3300049579 Bacteria 18171
1461 Ga0501043_0003336 3300049579 Bacteria 13229
1462 Ga0501043_0008689 3300049579 Bacteria 7991
1463 Ga0501043_0026869 3300049579 Bacteria 4516
1464 Ga0501043_0127609 3300049579 Bacteria 1994
1465 Ga0501043_0137677 3300049579 Bacteria 1913
1466 Ga0501043_0173428 3300049579 Bacteria 1682
1467 Ga0501046_0000398 3300049580 Bacteria 43497
1468 Ga0501046_0124288 3300049580 Bacteria 1961
1469 Ga0501046_0156747 3300049580 Bacteria 1714
1470 Ga0501046_0230322 3300049580 Bacteria 1369
1471 Ga0501047_0000656 3300049581 Bacteria 36126
1472 Ga0501047_0024878 3300049581 Bacteria 5749
1473 Ga0501047_0038030 3300049581 Bacteria 4655
1474 Ga0501047_0060399 3300049581 Bacteria 3658
1475 Ga0501047_0077943 3300049581 Bacteria 3187
1476 Ga0501047_0086369 3300049581 Bacteria 3014
1477 Ga0501047_0212578 3300049581 Bacteria 1792
1478 Ga0501047_0257601 3300049581 Bacteria 1592
1479 Ga0501047_0390827 3300049581 Bacteria 1224
1480 Ga0501047_0420749 3300049581 Bacteria 1167
1481 Ga0501048_0000906 3300049582 Bacteria 21866
1482 Ga0501048_0002157 3300049582 Bacteria 14989
1483 Ga0501048_0168602 3300049582 Bacteria 1550
1484 Ga0501067_0000192 3300049583 Bacteria 34520
1485 Ga0501067_0035211 3300049583 Bacteria 2780
1486 Ga0501068_0002765 3300049584 Bacteria 9319
1487 Ga0501068_0056457 3300049584 Bacteria 2380
1488 Ga0501069_0014897 3300049585 Bacteria 4163
1489 Ga0501069_0028379 3300049585 Bacteria 3068
1490 Ga0501069_0180108 3300049585 Bacteria 1221
1491 Ga0501070_0014900 3300049586 Bacteria 6539
1492 Ga0501070_0026912 3300049586 Bacteria 4823
1493 Ga0501070_0037271 3300049586 Bacteria 4060
1494 Ga0501070_0076207 3300049586 Bacteria 2776
1495 Ga0501070_0111307 3300049586 Bacteria 2263
1496 Ga0501070_0216100 3300049586 Bacteria 1573
1497 Ga0501070_0336501 3300049586 Bacteria 1226
1498 Ga0501071_0053825 3300049587 Bacteria 2903
1499 Ga0501072_0002128 3300049588 Bacteria 14764
1500 Ga0501073_0000037 3300049589 Bacteria 87345
1501 Ga0501073_0018625 3300049589 Bacteria 5018
1502 Ga0501073_0022099 3300049589 Bacteria 4584
1503 Ga0501073_0158480 3300049589 Bacteria 1568
1504 Ga0501073_0213612 3300049589 Bacteria 1333
1505 Ga0501074_0000133 3300049590 Bacteria 38342
1506 Ga0501074_0047785 3300049590 Bacteria 3092
1507 Ga0501074_0048678 3300049590 Bacteria 3062
1508 Ga0501074_0067059 3300049590 Bacteria 2581
1509 Ga0501074_0148134 3300049590 Bacteria 1679
1510 Ga0501074_0215398 3300049590 Bacteria 1368
1511 Ga0501076_0043461 3300049592 Bacteria 3541
1512 Ga0501076_0128311 3300049592 Bacteria 2056
1513 Ga0501077_0087268 3300049593 Bacteria 1977
1514 Ga0501077_0156248 3300049593 Bacteria 1448
1515 Ga0501079_0057957 3300049741 Bacteria 2988
1516 Ga0501080_0000054 3300049742 Bacteria 74316
1517 Ga0501080_0005201 3300049742 Bacteria 11597
1518 Ga0501080_0030702 3300049742 Bacteria 5006
1519 Ga0501080_0053747 3300049742 Bacteria 3751
1520 Ga0501080_0070063 3300049742 Bacteria 3261
1521 Ga0501080_0133442 3300049742 Bacteria 2298
1522 Ga0501080_0186440 3300049742 Bacteria 1907
1523 Ga0501080_0391339 3300049742 Bacteria 1251
1524 Ga0501083_0026434 3300049744 Bacteria 4011
1525 Ga0501083_0031513 3300049744 Bacteria 3639
1526 Ga0501083_0072454 3300049744 Bacteria 2290
1527 Ga0501083_0143614 3300049744 Bacteria 1562
1528 Ga0501083_0190012 3300049744 Bacteria 1340
1529 Ga0501083_0197123 3300049744 Bacteria 1314
1530 Ga0501083_0277349 3300049744 Bacteria 1090
1531 Ga0501035_0000142 3300049822 Bacteria 87561
1532 Ga0501035_0007299 3300049822 Bacteria 10336
1533 Ga0501035_0083899 3300049822 Bacteria 2810
1534 Ga0501035_0088492 3300049822 Bacteria 2729
1535 Ga0501035_0158389 3300049822 Bacteria 1961
1536 Ga0501035_0259529 3300049822 Bacteria 1473
1537 Ga0501035_0315098 3300049822 Bacteria 1315
1538 Ga0501035_0364180 3300049822 Bacteria 1208
1539 Ga0501044_0000985 3300049823 Bacteria 34233
1540 Ga0501044_0007854 3300049823 Bacteria 11731
1541 Ga0501044_0017342 3300049823 Bacteria 7722
1542 Ga0501044_0091107 3300049823 Bacteria 3075
1543 Ga0501044_0102936 3300049823 Bacteria 2870
1544 Ga0501044_0237579 3300049823 Bacteria 1767
1545 Ga0501044_0271456 3300049823 Bacteria 1631
1546 Ga0501044_0340708 3300049823 Bacteria 1420
1547 Ga0501044_0481657 3300049823 Bacteria 1144
1548 Ga0501044_0534103 3300049823 Bacteria 1071
1549 Ga0501044_0639664 3300049823 Bacteria 953
1550 nmdc:mga03n38_33351_c1 3300050490 Bacteria 2190
1551 nmdc:mga00v17_100632_c1 3300050491 Bacteria 1824
1552 nmdc:mga00v17_117413_c1 3300050491 Bacteria 1692
1553 nmdc:mga00v17_271514_c1 3300050491 Bacteria 1100
1554 nmdc:mga00v17_9796_c1 3300050491 Bacteria 3923
1555 nmdc:mga0yw44_165167_c1 3300050492 Bacteria 1451
1556 nmdc:mga0yw44_20773_c1 3300050492 Bacteria 3650
1557 nmdc:mga0yw44_247952_c1 3300050492 Bacteria 1185
1558 nmdc:mga0yw44_266741_c1 3300050492 Bacteria 1142
1559 nmdc:mga0yw44_32589_c1 3300050492 Bacteria 1414
1560 nmdc:mga0yw44_39874_c1 3300050492 Bacteria 2787
1561 nmdc:mga0yw44_79569_c1 3300050492 Bacteria 2051
1562 nmdc:mga0k408_125211_c1 3300050493 Bacteria 1167
1563 nmdc:mga0k408_165274_c1 3300050493 Bacteria 1319
1564 nmdc:mga0k408_238923_c1 3300050493 Bacteria 1085
1565 nmdc:mga06z11_132369_c1 3300050494 Bacteria 1402
1566 nmdc:mga06z11_18945_c1 3300050494 Bacteria 3154
1567 nmdc:mga06z11_19780_c1 3300050494 Bacteria 3103
1568 nmdc:mga06z11_3865_c1 3300050494 Bacteria 5838
1569 nmdc:mga06z11_72694_c1 3300050494 Bacteria 1824
1570 nmdc:mga04h51_24381_c1 3300050495 Bacteria 1852
1571 nmdc:mga04h51_32126_c1 3300050495 Bacteria 1663
1572 nmdc:mga04h51_48195_c1 3300050495 Bacteria 1419
1573 nmdc:mga07m45_36090_c2 3300050496 Bacteria 1843
1574 nmdc:mga07m45_6998_c1 3300050496 Bacteria 5738
1575 nmdc:mga05p37_247786_c1 3300050507 Bacteria 2138
1576 nmdc:mga05p37_25974_c1 3300050507 Bacteria 7121
1577 nmdc:mga05p37_2764_c1 3300050507 Bacteria 20392
1578 nmdc:mga05p37_82451_c1 3300050507 Bacteria 3962
1579 nmdc:mga09592_193281_c1 3300050508 Bacteria 1761
1580 nmdc:mga09592_524_c1 3300050508 Bacteria 28956
1581 nmdc:mga0qj67_34036_c1 3300050509 Bacteria 3979
1582 nmdc:mga0qj67_4921_c1 3300050509 Bacteria 9716
1583 nmdc:mga06r32_121_c1 3300050510 Bacteria 55968
1584 nmdc:mga08y16_1115_c1 3300050511 Bacteria 26487
1585 nmdc:mga08y16_5266_c1 3300050511 Bacteria 13515
1586 nmdc:mga08y16_556263_c1 3300050511 Bacteria 1160
1587 nmdc:mga08y16_56605_c1 3300050511 Bacteria 4097
1588 nmdc:mga08y16_940_c1 3300050511 Bacteria 28306
1589 nmdc:mga0n895_12320_c1 3300050512 Bacteria 7667
1590 nmdc:mga0n895_130855_c1 3300050512 Bacteria 2534
1591 nmdc:mga0n895_2636_c1 3300050512 Bacteria 14138
1592 nmdc:mga0n895_34687_c1 3300050512 Bacteria 4859
1593 nmdc:mga0n895_357174_c1 3300050512 Bacteria 1480
1594 nmdc:mga0n895_471786_c1 3300050512 Bacteria 1266
1595 nmdc:mga0n895_534_c1 3300050512 Bacteria 25950
1596 nmdc:mga0rr50_20867_c1 3300050513 Bacteria 4460
1597 nmdc:mga0rr50_31337_c1 3300050513 Bacteria 3775
1598 nmdc:mga0rr50_3849_c1 3300050513 Bacteria 8721
1599 nmdc:mga0rr50_38987_c1 3300050513 Bacteria 3443
1600 nmdc:mga0rr50_6636_c1 3300050513 Bacteria 7072
1601 nmdc:mga08x19_106448_c1 3300050514 Bacteria 1866
1602 nmdc:mga08x19_113613_c1 3300050514 Bacteria 1808
1603 nmdc:mga08x19_143622_c1 3300050514 Bacteria 1613
1604 nmdc:mga08x19_345771_c1 3300050514 Bacteria 1038
1605 nmdc:mga0a205_145005_c1 3300050515 Bacteria 2274
1606 nmdc:mga0a205_213_c1 3300050515 Bacteria 40801
1607 nmdc:mga0a205_398835_c1 3300050515 Bacteria 1239
1608 nmdc:mga0a205_549_c1 3300050515 Bacteria 29737
1609 nmdc:mga0a205_61189_c1 3300050515 Bacteria 3636
1610 nmdc:mga0sz30_49734_c1 3300050516 Bacteria 1777
1611 nmdc:mga0sz30_60233_c1 3300050516 Bacteria 1621
1612 Ga0495601_0000111 3300053077 Bacteria 44773
1613 Ga0495601_0000347 3300053077 Bacteria 24383
1614 Ga0495601_0000946 3300053077 Bacteria 15808
1615 Ga0495601_0004646 3300053077 Bacteria 7952
1616 Ga0495601_0013434 3300053077 Bacteria 4926
1617 Ga0495601_0060208 3300053077 Bacteria 2409
1618 Ga0495601_0069781 3300053077 Bacteria 2241
1619 Ga0495601_0123720 3300053077 Bacteria 1681
1620 Ga0495601_0157802 3300053077 Bacteria 1482
1621 Ga0495612_0001438 3300053078 Bacteria 9789
1622 Ga0495612_0004407 3300053078 Bacteria 5838
1623 Ga0495612_0065498 3300053078 Bacteria 1509
1624 Ga0500610_0130389 3300053079 Bacteria 1279
1625 Ga0500635_0005946 3300053080 Bacteria 3236
1626 Ga0495595_0000587 3300053084 Bacteria 13888
1627 Ga0495595_0000735 3300053084 Bacteria 12432
1628 Ga0495595_0000758 3300053084 Bacteria 12258
1629 Ga0495595_0001611 3300053084 Bacteria 8813
1630 Ga0495595_0015410 3300053084 Bacteria 3261
1631 Ga0495595_0028949 3300053084 Bacteria 2475
1632 Ga0495595_0043394 3300053084 Bacteria 2062
1633 Ga0495619_0000083 3300053085 Bacteria 70312
1634 Ga0495619_0000296 3300053085 Bacteria 35155
1635 Ga0495619_0000617 3300053085 Bacteria 23526
1636 Ga0495619_0000672 3300053085 Bacteria 22398
1637 Ga0495619_0007396 3300053085 Bacteria 6958
1638 Ga0495619_0008615 3300053085 Bacteria 6451
1639 Ga0495619_0012446 3300053085 Bacteria 5358
1640 Ga0500578_0170696 3300053086 Bacteria 1345
1641 Ga0500643_000168 3300053087 Bacteria 64858
1642 Ga0500643_019615 3300053087 Bacteria 2222
1643 Ga0500644_0020873 3300053088 Bacteria 1954
1644 Ga0500647_0056019 3300053091 Bacteria 1896
1645 Ga0500651_0007251 3300053093 Bacteria 6463
1646 Ga0500651_0026339 3300053093 Bacteria 3654
1647 Ga0500566_0000822 3300053094 Bacteria 17706
1648 Ga0500566_0003454 3300053094 Bacteria 9426
1649 Ga0500566_0015378 3300053094 Bacteria 4489
1650 Ga0500566_0103886 3300053094 Bacteria 1554
1651 Ga0500640_000302 3300053095 Bacteria 11174
1652 Ga0500641_0014207 3300053096 Bacteria 2936
1653 Ga0500641_0108360 3300053096 Bacteria 1195
1654 Ga0500554_002374 3300053102 Bacteria 3691
1655 Ga0500554_008660 3300053102 Bacteria 2402
1656 Ga0500555_003167 3300053103 Bacteria 4691
1657 Ga0500555_023816 3300053103 Bacteria 1756
1658 Ga0500556_0000047 3300053104 Bacteria 126199
1659 Ga0500557_000032 3300053105 Bacteria 74032
1660 Ga0500562_020004 3300053108 Bacteria 1736
1661 Ga0500562_054516 3300053108 Bacteria 1071
1662 Ga0500569_006898 3300053109 Bacteria 2519
1663 Ga0500572_001002 3300053111 Bacteria 8555
1664 Ga0500572_009776 3300053111 Bacteria 2275
1665 Ga0500592_000485 3300053116 Bacteria 6580
1666 Ga0500595_000003 3300053119 Bacteria 419332
1667 Ga0500595_006565 3300053119 Bacteria 4919
1668 Ga0500595_011798 3300053119 Bacteria 3403
1669 Ga0500595_028598 3300053119 Bacteria 1900
1670 Ga0500608_024516 3300053122 Bacteria 2817
1671 Ga0500614_004103 3300053123 Bacteria 3097
1672 Ga0500621_107476 3300053126 Bacteria 1094
1673 Ga0500642_0000142 3300053130 Bacteria 32016
1674 Ga0500642_0000183 3300053130 Bacteria 25867
1675 Ga0500652_001628 3300053131 Bacteria 6828
1676 Ga0500652_035488 3300053131 Bacteria 1981
1677 Ga0500655_009751 3300053133 Bacteria 1733
1678 Ga0500559_0000105 3300053136 Bacteria 65809
1679 Ga0500559_0001644 3300053136 Bacteria 12374
1680 Ga0500559_0004871 3300053136 Bacteria 6261
1681 Ga0500559_0086393 3300053136 Bacteria 1431
1682 Ga0500603_000366 3300053150 Bacteria 11817
1683 Ga0500603_000576 3300053150 Bacteria 9221
1684 Ga0500604_0002170 3300053151 Bacteria 5398
1685 Ga0500616_0000002 3300053153 Bacteria 1611257
1686 Ga0500616_0000784 3300053153 Bacteria 36530
1687 Ga0500616_0013923 3300053153 Bacteria 4642
1688 Ga0500620_038702 3300053155 Bacteria 1554
1689 Ga0500622_0008137 3300053156 Bacteria 5893
1690 Ga0500627_0045732 3300053158 Bacteria 1895
1691 Ga0500630_000365 3300053159 Bacteria 19125
1692 Ga0500634_0114185 3300053161 Bacteria 1326
1693 Ga0500638_152477 3300053162 Bacteria 1026
1694 Ga0500639_000031 3300053163 Bacteria 69938
1695 Ga0500636_0000592 3300053177 Bacteria 19795
1696 Ga0500636_0003094 3300053177 Bacteria 9326
1697 Ga0500636_0009727 3300053177 Bacteria 5600
1698 Ga0500636_0130196 3300053177 Bacteria 1402
1699 Ga0500625_000232 3300053729 Bacteria 12898
1700 Ga0500645_000675 3300053730 Bacteria 21406
1701 Ga0500645_007739 3300053730 Bacteria 3717
1702 Ga0500645_010764 3300053730 Bacteria 3009
1703 Ga0500645_016840 3300053730 Bacteria 2298
1704 Ga0500645_067292 3300053730 Bacteria 1031
1705 Ga0500609_009207 3300053731 Bacteria 1332
1706 Ga0500596_001156 3300053735 Bacteria 5308
1707 Ga0500596_003966 3300053735 Bacteria 2756
1708 Ga0500601_000888 3300053737 Bacteria 3585
1709 Ga0500601_001193 3300053737 Bacteria 2892
1710 Ga0501084_0008150 3300054114 Bacteria 8638
1711 Ga0501084_0073495 3300054114 Bacteria 2863
1712 Ga0501084_0169083 3300054114 Bacteria 1845
1713 Ga0590075_031381 3300059424 Bacteria 1347
1714 Ga0501082_0005663 3300060353 Bacteria 10842
1715 Ga0501082_0060179 3300060353 Bacteria 3271
1716 Ga0501082_0082424 3300060353 Bacteria 2775
1717 Ga0501082_0100493 3300060353 Bacteria 2502
1718 Ga0501082_0107708 3300060353 Bacteria 2411
1719 Ga0501082_0235527 3300060353 Bacteria 1593
1720 Ga0501082_0315271 3300060353 Bacteria 1362
1721 Ga0501082_0417925 3300060353 Bacteria 1171
1722 Ga0466962_0053690 3300061719 Bacteria 1926
1723 Ga0530510_0024112 3300061734 Bacteria 4340
1724 Ga0530510_0213573 3300061734 Bacteria 1433
1725 Ga0530510_0315050 3300061734 Bacteria 1172

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0212634 Ga0373943_0212634_214_1032 271
2 3300039453 Ga0436362_0256641 Ga0436362_0256641_42_860 271
3 3300005340 Ga0070689_100270099 Ga0070689_1002700991 281
4 3300005347 Ga0070668_100098279 Ga0070668_1000982791 281
5 3300005455 Ga0070663_100168454 Ga0070663_1001684542 281
6 3300025935 Ga0207709_10041733 Ga0207709_100417331 281
7 3300048920 Ga0496117_0011427 Ga0496117_0011427_864_1823 284
8 3300048921 Ga0496118_0001805 Ga0496118_0001805_29536_30495 284
9 3300005347 Ga0070668_100005832 Ga0070668_1000058327 286
10 3300005617 Ga0068859_100383185 Ga0068859_1003831852 286
11 3300005844 Ga0068862_100035921 Ga0068862_1000359213 286
12 3300006931 Ga0097620_100383180 Ga0097620_1003831801 286
13 3300009177 Ga0105248_10044578 Ga0105248_100445784 286
14 3300025907 Ga0207645_10103240 Ga0207645_101032402 286
15 3300025941 Ga0207711_10117134 Ga0207711_101171343 286
16 3300025972 Ga0207668_10000956 Ga0207668_100009564 286
17 3300028380 Ga0268265_10021796 Ga0268265_100217962 286
18 3300028380 Ga0268265_10029400 Ga0268265_100294003 286
19 3300031903 Ga0307407_10242335 Ga0307407_102423352 286
20 3300032002 Ga0307416_100100577 Ga0307416_1001005773 286
21 3300046492 Ga0495585_0095908 Ga0495585_0095908_10_924 286
22 3300046499 Ga0495594_0217482 Ga0495594_0217482_103_1017 286
23 3300046523 Ga0495644_0073897 Ga0495644_0073897_64_978 286
24 3300046526 Ga0495666_0107322 Ga0495666_0107322_137_1051 286
25 3300046537 Ga0495598_0059909 Ga0495598_0059909_74_988 286
26 3300046539 Ga0495621_0111029 Ga0495621_0111029_92_1006 286
27 3300046558 Ga0495633_0072774 Ga0495633_0072774_86_1000 286
28 3300046684 Ga0495669_0137467 Ga0495669_0137467_118_1032 286
29 3300047318 Ga0495636_0046143 Ga0495636_0046143_200_1114 286
30 3300047321 Ga0495676_0268884 Ga0495676_0268884_170_1084 286
31 3300048090 Ga0495615_0052817 Ga0495615_0052817_19_933 286
32 3300048922 Ga0496119_0127448 Ga0496119_0127448_101_1015 286
33 3300050511 nmdc:mga08y16_556263_c1 nmdc:mga08y16_556263_c1_181_1095 286
34 3300053131 Ga0500652_035488 Ga0500652_035488_493_1446 286
35 3300048904 Ga0496101_0538500 Ga0496101_0538500_10_885 287
36 3300048915 Ga0496112_0381138 Ga0496112_0381138_459_1334 287
37 3300049571 Ga0501034_0254770 Ga0501034_0254770_33_947 287
38 3300050494 nmdc:mga06z11_72694_c1 nmdc:mga06z11_72694_c1_25_900 287
39 3300005356 Ga0070674_100242565 Ga0070674_1002425652 288
40 3300025933 Ga0207706_10162509 Ga0207706_101625092 288
41 3300025972 Ga0207668_10043661 Ga0207668_100436612 288
42 3300046513 Ga0495616_0084300 Ga0495616_0084300_107_1021 288
43 3300050509 nmdc:mga0qj67_4921_c1 nmdc:mga0qj67_4921_c1_6681_7565 288
44 3300025986 Ga0207658_10316488 Ga0207658_103164881 289
45 3300013307 Ga0157372_10396871 Ga0157372_103968712 290
46 3300044694 Ga0466963_0284198 Ga0466963_0284198_100_1020 290
47 3300046794 Ga0495589_0082422 Ga0495589_0082422_386_1279 290
48 3300049568 Ga0501031_0003990 Ga0501031_0003990_7061_7975 290
49 3300049569 Ga0501032_0000073 Ga0501032_0000073_49166_50080 290
50 3300049570 Ga0501033_0000136 Ga0501033_0000136_11191_12105 290
51 3300049571 Ga0501034_0000251 Ga0501034_0000251_29742_30656 290
52 3300049572 Ga0501036_0000036 Ga0501036_0000036_58858_59772 290
53 3300049573 Ga0501037_0000040 Ga0501037_0000040_23342_24256 290
54 3300049574 Ga0501038_0000150 Ga0501038_0000150_35903_36817 290
55 3300049575 Ga0501039_0003418 Ga0501039_0003418_1999_2913 290
56 3300049578 Ga0501042_0008136 Ga0501042_0008136_4332_5246 290
57 3300049579 Ga0501043_0000464 Ga0501043_0000464_13234_14148 290
58 3300049580 Ga0501046_0000398 Ga0501046_0000398_29276_30190 290
59 3300049581 Ga0501047_0000656 Ga0501047_0000656_29512_30426 290
60 3300049582 Ga0501048_0000906 Ga0501048_0000906_9634_10548 290
61 3300049583 Ga0501067_0000192 Ga0501067_0000192_21357_22271 290
62 3300049584 Ga0501068_0002765 Ga0501068_0002765_1915_2829 290
63 3300049585 Ga0501069_0014897 Ga0501069_0014897_1068_1982 290
64 3300049586 Ga0501070_0076207 Ga0501070_0076207_1815_2729 290
65 3300049587 Ga0501071_0053825 Ga0501071_0053825_132_1046 290
66 3300049588 Ga0501072_0002128 Ga0501072_0002128_8870_9784 290
67 3300049589 Ga0501073_0000037 Ga0501073_0000037_27501_28415 290
68 3300049590 Ga0501074_0000133 Ga0501074_0000133_35416_36330 290
69 3300049741 Ga0501079_0057957 Ga0501079_0057957_1865_2779 290
70 3300049742 Ga0501080_0000054 Ga0501080_0000054_32333_33247 290
71 3300049822 Ga0501035_0000142 Ga0501035_0000142_56906_57820 290
72 3300049823 Ga0501044_0000985 Ga0501044_0000985_29742_30656 290
73 3300054114 Ga0501084_0008150 Ga0501084_0008150_5309_6223 290
74 3300060353 Ga0501082_0005663 Ga0501082_0005663_1606_2520 290
75 iso_pu_bacteria 2602042107 2603857124 290
76 iso_pu_bacteria 2857524615 2857530871 290
77 iso_pu_bacteria 2893066018 2893066374 290
78 iso_pu_bacteria 2919073203 2919077915 290
79 3300033442 Ga0315911_1000005 Ga0315911_100000519 291
80 3300050491 nmdc:mga00v17_271514_c1 nmdc:mga00v17_271514_c1_173_1054 291
81 3300050507 nmdc:mga05p37_247786_c1 nmdc:mga05p37_247786_c1_360_1268 291
82 iso_pu_bacteria 2513237098 2513674950 291
83 iso_pu_bacteria 2524023210 2524465266 291
84 iso_pu_bacteria 2885383462 2885388905 291
85 iso_pu_bacteria 2903768456 2903774681 291
86 iso_pu_bacteria 8056681323 8056683412 291
87 3300048927 Ga0496124_0205568 Ga0496124_0205568_117_1010 292
88 3300048928 Ga0496125_0000823 Ga0496125_0000823_30556_31449 292
89 iso_pu_bacteria 2935694250 2935696772 292
90 iso_pu_bacteria 2935777560 2935777749 292
91 iso_pu_bacteria 8016595262 8016602811 292
92 iso_pu_bacteria 8016613128 8016617586 292
93 3300025294 Ga0209025_1060712 Ga0209025_10607121 293
94 3300025295 Ga0209564_1000477 Ga0209564_10004772 293
95 3300045976 Ga0466967_0164748 Ga0466967_0164748_551_1432 293
96 3300046524 Ga0495648_0004337 Ga0495648_0004337_9118_10029 293
97 3300050508 nmdc:mga09592_193281_c1 nmdc:mga09592_193281_c1_566_1477 293
98 3300061719 Ga0466962_0053690 Ga0466962_0053690_42_923 293
99 iso_pu_bacteria 2904690495 2904692070 293
100 iso_pu_bacteria 2908756301 2908757350 293
101 3300005843 Ga0068860_100000837 Ga0068860_10000083724 294
102 3300006038 Ga0075365_10043977 Ga0075365_100439772 294
103 3300006038 Ga0075365_10274096 Ga0075365_102740962 294
104 3300006051 Ga0075364_10272662 Ga0075364_102726621 294
105 3300006186 Ga0075369_10010149 Ga0075369_100101493 294
106 3300021377 Ga0213874_10054518 Ga0213874_100545182 294
107 3300025295 Ga0209564_1021999 Ga0209564_10219992 294
108 3300026067 Ga0207678_10105437 Ga0207678_101054372 294
109 3300028381 Ga0268264_10000537 Ga0268264_1000053714 294
110 3300028794 Ga0307515_10122964 Ga0307515_101229642 294
111 3300031911 Ga0307412_10049330 Ga0307412_100493302 294
112 3300039450 Ga0436363_0959897 Ga0436363_0959897_845_1747 294
113 3300044694 Ga0466963_0111242 Ga0466963_0111242_839_1735 294
114 3300046474 Ga0495605_0096947 Ga0495605_0096947_88_1002 294
115 3300046499 Ga0495594_0242154 Ga0495594_0242154_60_959 294
116 3300046506 Ga0495583_0108198 Ga0495583_0108198_46_960 294
117 3300046513 Ga0495616_0037770 Ga0495616_0037770_56_970 294
118 3300046515 Ga0495620_0013412 Ga0495620_0013412_1528_2442 294
119 3300046520 Ga0495637_0029569 Ga0495637_0029569_1433_2347 294
120 3300046524 Ga0495648_0051499 Ga0495648_0051499_1427_2341 294
121 3300046530 Ga0495654_0091978 Ga0495654_0091978_300_1214 294
122 3300046542 Ga0495597_0055463 Ga0495597_0055463_742_1656 294
123 3300046557 Ga0495622_0015036 Ga0495622_0015036_1628_2542 294
124 3300046616 Ga0495668_0063204 Ga0495668_0063204_369_1283 294
125 3300046691 Ga0495670_0123993 Ga0495670_0123993_71_985 294
126 3300048091 Ga0495626_0057165 Ga0495626_0057165_179_1093 294
127 3300048909 Ga0496106_0017137 Ga0496106_0017137_4377_5276 294
128 3300048919 Ga0496116_0018470 Ga0496116_0018470_4252_5166 294
129 3300048921 Ga0496118_0037848 Ga0496118_0037848_941_1855 294
130 3300048924 Ga0496121_0036588 Ga0496121_0036588_3412_4326 294
131 3300048925 Ga0496122_0042354 Ga0496122_0042354_1430_2344 294
132 3300048928 Ga0496125_0000154 Ga0496125_0000154_21460_22359 294
133 3300048928 Ga0496125_0004393 Ga0496125_0004393_8780_9694 294
134 3300048928 Ga0496125_0052663 Ga0496125_0052663_1480_2394 294
135 3300049585 Ga0501069_0028379 Ga0501069_0028379_1927_2835 294
136 3300049744 Ga0501083_0026434 Ga0501083_0026434_640_1548 294
137 3300050491 nmdc:mga00v17_117413_c1 nmdc:mga00v17_117413_c1_548_1462 294
138 3300050492 nmdc:mga0yw44_79569_c1 nmdc:mga0yw44_79569_c1_1032_1946 294
139 3300050516 nmdc:mga0sz30_49734_c1 nmdc:mga0sz30_49734_c1_594_1508 294
140 3300053087 Ga0500643_019615 Ga0500643_019615_752_1666 294
141 3300053088 Ga0500644_0020873 Ga0500644_0020873_140_1054 294
142 3300053093 Ga0500651_0026339 Ga0500651_0026339_361_1275 294
143 3300053094 Ga0500566_0000822 Ga0500566_0000822_3989_4903 294
144 3300053102 Ga0500554_008660 Ga0500554_008660_1385_2299 294
145 3300053103 Ga0500555_023816 Ga0500555_023816_339_1253 294
146 3300053104 Ga0500556_0000047 Ga0500556_0000047_8796_9710 294
147 3300053108 Ga0500562_054516 Ga0500562_054516_111_1025 294
148 3300053109 Ga0500569_006898 Ga0500569_006898_1449_2363 294
149 3300053116 Ga0500592_000485 Ga0500592_000485_2217_3131 294
150 3300053126 Ga0500621_107476 Ga0500621_107476_103_1017 294
151 3300053130 Ga0500642_0000142 Ga0500642_0000142_4101_5015 294
152 3300053131 Ga0500652_001628 Ga0500652_001628_4014_4928 294
153 3300053136 Ga0500559_0000105 Ga0500559_0000105_29058_29972 294
154 3300053151 Ga0500604_0002170 Ga0500604_0002170_1649_2563 294
155 3300053153 Ga0500616_0000784 Ga0500616_0000784_26682_27596 294
156 3300053158 Ga0500627_0045732 Ga0500627_0045732_335_1249 294
157 3300053161 Ga0500634_0114185 Ga0500634_0114185_233_1147 294
158 3300053177 Ga0500636_0003094 Ga0500636_0003094_6133_7047 294
159 3300053730 Ga0500645_010764 Ga0500645_010764_1344_2258 294
160 3300060353 Ga0501082_0060179 Ga0501082_0060179_245_1153 294
161 3300060353 Ga0501082_0082424 Ga0501082_0082424_716_1624 294
162 3300060353 Ga0501082_0107708 Ga0501082_0107708_372_1280 294
163 iso_pu_bacteria 2932794094 2932796039 294
164 iso_pu_bacteria 2932801729 2932807616 294
165 iso_pu_bacteria 2935883170 2935887308 294
166 iso_pu_bacteria 2941531003 2941534579 294
167 iso_pu_bacteria 3005710791 3005711818 294
168 iso_pu_bacteria 8016539877 8016545276 294
169 iso_pu_bacteria 8016548790 8016556812 294
170 iso_pu_bacteria 8016557553 8016565165 294
171 iso_pu_bacteria 8016566248 8016570355 294
172 iso_pu_bacteria 8016575299 8016582901 294
173 iso_pu_bacteria 8016603502 8016605675 294
174 iso_pu_bacteria 8016622563 8016623985 294
175 iso_pu_bacteria 8019530166 8019531882 294
176 3300003203 JGI25406J46586_10000012 JGI25406J46586_1000001249 295
177 3300003215 JGI25153J46596_10034157 JGI25153J46596_100341572 295
178 3300005439 Ga0070711_100082494 Ga0070711_1000824942 295
179 3300005841 Ga0068863_100350823 Ga0068863_1003508232 295
180 3300005985 Ga0081539_10000040 Ga0081539_10000040214 295
181 3300006175 Ga0070712_100051470 Ga0070712_1000514702 295
182 3300010375 Ga0105239_10318087 Ga0105239_103180872 295
183 3300013306 Ga0163162_10248130 Ga0163162_102481302 295
184 3300021384 Ga0213876_10058440 Ga0213876_100584402 295
185 3300025297 Ga0209758_1004564 Ga0209758_10045642 295
186 3300025898 Ga0207692_10110409 Ga0207692_101104092 295
187 3300025915 Ga0207693_10080113 Ga0207693_100801132 295
188 3300025916 Ga0207663_10121501 Ga0207663_101215012 295
189 3300025916 Ga0207663_10293394 Ga0207663_102933942 295
190 3300035085 Ga0373929_0004365 Ga0373929_0004365_308_1210 295
191 3300035171 Ga0373946_0064188 Ga0373946_0064188_483_1379 295
192 3300035691 Ga0373931_0060213 Ga0373931_0060213_1023_1925 295
193 3300035695 Ga0373927_0035090 Ga0373927_0035090_1298_2194 295
194 3300037471 Ga0395905_0083368 Ga0395905_0083368_143_1039 295
195 3300037471 Ga0395905_0119852 Ga0395905_0119852_144_1040 295
196 3300038443 Ga0395901_0422299 Ga0395901_0422299_181_1077 295
197 3300039437 Ga0436365_0295600 Ga0436365_0295600_527_1477 295
198 3300039437 Ga0436365_0526132 Ga0436365_0526132_1371_2273 295
199 3300046507 Ga0495606_0001350 Ga0495606_0001350_24067_24969 295
200 3300046542 Ga0495597_0059960 Ga0495597_0059960_26_928 295
201 3300047320 Ga0495672_0005199 Ga0495672_0005199_8164_9066 295
202 3300048903 Ga0496100_0341982 Ga0496100_0341982_217_1113 295
203 3300048904 Ga0496101_0052485 Ga0496101_0052485_559_1455 295
204 3300048908 Ga0496105_0141191 Ga0496105_0141191_911_1813 295
205 3300048911 Ga0496108_0074802 Ga0496108_0074802_1563_2465 295
206 3300048912 Ga0496109_0208775 Ga0496109_0208775_801_1703 295
207 3300048913 Ga0496110_0067181 Ga0496110_0067181_372_1274 295
208 3300048914 Ga0496111_0027702 Ga0496111_0027702_1317_2219 295
209 3300048915 Ga0496112_0000029 Ga0496112_0000029_14211_15113 295
210 3300048915 Ga0496112_0074363 Ga0496112_0074363_1818_2720 295
211 3300048916 Ga0496113_0255493 Ga0496113_0255493_277_1179 295
212 3300048923 Ga0496120_0145843 Ga0496120_0145843_250_1146 295
213 3300048924 Ga0496121_0003034 Ga0496121_0003034_16259_17155 295
214 3300048924 Ga0496121_0041193 Ga0496121_0041193_1824_2726 295
215 3300048924 Ga0496121_0157493 Ga0496121_0157493_477_1379 295
216 3300048925 Ga0496122_0067457 Ga0496122_0067457_740_1636 295
217 3300048929 Ga0496126_0011331 Ga0496126_0011331_7290_8186 295
218 3300048929 Ga0496126_0034249 Ga0496126_0034249_3085_3981 295
219 3300049574 Ga0501038_0461706 Ga0501038_0461706_28_939 295
220 3300053119 Ga0500595_006565 Ga0500595_006565_1974_2870 295
221 iso_pu_bacteria 2507262055 2507505933 295
222 iso_pu_bacteria 2508501009 2508540122 295
223 iso_pu_bacteria 2508501042 2508696196 295
224 iso_pu_bacteria 2508501128 2509148120 295
225 iso_pu_bacteria 2511231028 2511396579 295
226 iso_pu_bacteria 2513237092 2513627431 295
227 iso_pu_bacteria 2513237094 2513638321 295
228 iso_pu_bacteria 2513237095 2513649163 295
229 iso_pu_bacteria 2513237096 2513657472 295
230 iso_pu_bacteria 2513237101 2513696279 295
231 iso_pu_bacteria 2513237102 2513700226 295
232 iso_pu_bacteria 2513237104 2513716104 295
233 iso_pu_bacteria 2513237137 2513861200 295
234 iso_pu_bacteria 2513237139 2513877238 295
235 iso_pu_bacteria 2513237141 2513891601 295
236 iso_pu_bacteria 2513237145 2513916725 295
237 iso_pu_bacteria 2513237161 2514014608 295
238 iso_pu_bacteria 2515154112 2515628525 295
239 iso_pu_bacteria 2517572143 2517889632 295
240 iso_pu_bacteria 2524023228 2524533198 295
241 iso_pu_bacteria 2528768022 2528850700 295
242 iso_pu_bacteria 2617270735 2617347815 295
243 iso_pu_bacteria 2617270741 2617374737 295
244 iso_pu_bacteria 2643221651 2644290487 295
245 iso_pu_bacteria 2667528175 2671119484 295
246 iso_pu_bacteria 2721755755 2723842286 295
247 iso_pu_bacteria 2728368998 2728755274 295
248 iso_pu_bacteria 2744054633 2745081917 295
249 iso_pu_bacteria 2791355196 2793061531 295
250 iso_pu_bacteria 2791355197 2793070387 295
251 iso_pu_bacteria 2791355199 2793080142 295
252 iso_pu_bacteria 2802429603 2805916162 295
253 iso_pu_bacteria 2816332527 2818240554 295
254 iso_pu_bacteria 2824600985 2824603627 295
255 iso_pu_bacteria 2824609381 2824610787 295
256 iso_pu_bacteria 2824617872 2824623207 295
257 iso_pu_bacteria 2824626560 2824632195 295
258 iso_pu_bacteria 2824635225 2824640812 295
259 iso_pu_bacteria 2824644064 2824647964 295
260 iso_pu_bacteria 2824653114 2824655233 295
261 iso_pu_bacteria 2824661429 2824667355 295
262 iso_pu_bacteria 2824671348 2824675050 295
263 iso_pu_bacteria 2824679649 2824684445 295
264 iso_pu_bacteria 2824687955 2824691785 295
265 iso_pu_bacteria 2824696289 2824701064 295
266 iso_pu_bacteria 2824704595 2824709280 295
267 iso_pu_bacteria 2824714736 2824717979 295
268 iso_pu_bacteria 2824723954 2824728195 295
269 iso_pu_bacteria 2824732956 2824737036 295
270 iso_pu_bacteria 2824746037 2824750816 295
271 iso_pu_bacteria 2824753945 2824762004 295
272 iso_pu_bacteria 2824763712 2824772369 295
273 iso_pu_bacteria 2824773399 2824775703 295
274 iso_pu_bacteria 2838122688 2838125078 295
275 iso_pu_bacteria 2841941048 2841945816 295
276 iso_pu_bacteria 2841949485 2841956915 295
277 iso_pu_bacteria 2841957949 2841963962 295
278 iso_pu_bacteria 2841966195 2841973524 295
279 iso_pu_bacteria 2841974524 2841981997 295
280 iso_pu_bacteria 2841983080 2841989412 295
281 iso_pu_bacteria 2842038055 2842044400 295
282 iso_pu_bacteria 2842045827 2842051611 295
283 iso_pu_bacteria 2842694124 2842694207 295
284 iso_pu_bacteria 2844315083 2844316263 295
285 iso_pu_bacteria 2847930680 2847939425 295
286 iso_pu_bacteria 2847939898 2847941186 295
287 iso_pu_bacteria 2849076700 2849082172 295
288 iso_pu_bacteria 2857509624 2857513352 295
289 iso_pu_bacteria 2874590934 2874596331 295
290 iso_pu_bacteria 2874604998 2874610125 295
291 iso_pu_bacteria 2874612657 2874616468 295
292 iso_pu_bacteria 2874620515 2874622487 295
293 iso_pu_bacteria 2874628541 2874633393 295
294 iso_pu_bacteria 2874645413 2874650318 295
295 iso_pu_bacteria 2876761206 2876761653 295
296 iso_pu_bacteria 2876771140 2876776796 295
297 iso_pu_bacteria 2876818435 2876824586 295
298 iso_pu_bacteria 2879074833 2879080933 295
299 iso_pu_bacteria 2879083081 2879087097 295
300 iso_pu_bacteria 2879099564 2879104428 295
301 iso_pu_bacteria 2879110137 2879116992 295
302 iso_pu_bacteria 2879127579 2879133778 295
303 iso_pu_bacteria 2879142872 2879148280 295
304 iso_pu_bacteria 2881364244 2881369589 295
305 iso_pu_bacteria 2881665667 2881669693 295
306 iso_pu_bacteria 2885366525 2885367765 295
307 iso_pu_bacteria 2885374607 2885380887 295
308 iso_pu_bacteria 2885409591 2885418887 295
309 iso_pu_bacteria 2888378607 2888387231 295
310 iso_pu_bacteria 2888388044 2888389922 295
311 iso_pu_bacteria 2888419890 2888421179 295
312 iso_pu_bacteria 2889033259 2889036409 295
313 iso_pu_bacteria 2903727486 2903728401 295
314 iso_pu_bacteria 2903748898 2903756085 295
315 iso_pu_bacteria 2904666416 2904671506 295
316 iso_pu_bacteria 2904699407 2904707612 295
317 iso_pu_bacteria 2904711408 2904719806 295
318 iso_pu_bacteria 2906602504 2906606542 295
319 iso_pu_bacteria 2906610324 2906614610 295
320 iso_pu_bacteria 2906626472 2906631422 295
321 iso_pu_bacteria 2906635258 2906641981 295
322 iso_pu_bacteria 2906643746 2906650658 295
323 iso_pu_bacteria 2906660503 2906660933 295
324 iso_pu_bacteria 2908739725 2908746568 295
325 iso_pu_bacteria 2908775508 2908777219 295
326 iso_pu_bacteria 2922361189 2922366715 295
327 iso_pu_bacteria 2922368715 2922377410 295
328 iso_pu_bacteria 2922386360 2922389381 295
329 iso_pu_bacteria 2922393267 2922398499 295
330 iso_pu_bacteria 2922425934 2922426471 295
331 iso_pu_bacteria 2929615660 2929622198 295
332 iso_pu_bacteria 2929624759 2929630155 295
333 iso_pu_bacteria 2932784394 2932787916 295
334 iso_pu_bacteria 2932809354 2932817642 295
335 iso_pu_bacteria 2932818245 2932826198 295
336 iso_pu_bacteria 2932828146 2932835056 295
337 iso_pu_bacteria 2933577622 2933584187 295
338 iso_pu_bacteria 2935608549 2935614358 295
339 iso_pu_bacteria 2935616580 2935620433 295
340 iso_pu_bacteria 2935638405 2935640756 295
341 iso_pu_bacteria 2935648319 2935649387 295
342 iso_pu_bacteria 2935656913 2935657841 295
343 iso_pu_bacteria 2935665750 2935670259 295
344 iso_pu_bacteria 2935675223 2935679688 295
345 iso_pu_bacteria 2935684952 2935687257 295
346 iso_pu_bacteria 2935703347 2935709136 295
347 iso_pu_bacteria 2935713505 2935718716 295
348 iso_pu_bacteria 2935722832 2935728368 295
349 iso_pu_bacteria 2935732158 2935737035 295
350 iso_pu_bacteria 2935741537 2935745962 295
351 iso_pu_bacteria 2935750917 2935753223 295
352 iso_pu_bacteria 2935760218 2935766385 295
353 iso_pu_bacteria 2935769743 2935770222 295
354 iso_pu_bacteria 2935785616 2935786725 295
355 iso_pu_bacteria 2935801545 2935809065 295
356 iso_pu_bacteria 2935810662 2935813754 295
357 iso_pu_bacteria 2935819856 2935826576 295
358 iso_pu_bacteria 2935827899 2935832263 295
359 iso_pu_bacteria 2935837841 2935843968 295
360 iso_pu_bacteria 2935847175 2935851130 295
361 iso_pu_bacteria 2935855204 2935862759 295
362 iso_pu_bacteria 2935864058 2935864502 295
363 iso_pu_bacteria 2935873716 2935875146 295
364 iso_pu_bacteria 2935908558 2935913180 295
365 iso_pu_bacteria 2935926038 2935930895 295
366 iso_pu_bacteria 2935934488 2935939771 295
367 iso_pu_bacteria 2935942939 2935946720 295
368 iso_pu_bacteria 2935951376 2935956079 295
369 iso_pu_bacteria 2935959822 2935964983 295
370 iso_pu_bacteria 2935967501 2935972872 295
371 iso_pu_bacteria 2935975950 2935978213 295
372 iso_pu_bacteria 2935984226 2935985663 295
373 iso_pu_bacteria 2935992306 2935999235 295
374 iso_pu_bacteria 2936002035 2936005790 295
375 iso_pu_bacteria 2936011229 2936012060 295
376 iso_pu_bacteria 2936019824 2936020859 295
377 iso_pu_bacteria 2936028420 2936029353 295
378 iso_pu_bacteria 2936037263 2936039310 295
379 iso_pu_bacteria 2936046547 2936048323 295
380 iso_pu_bacteria 2936055302 2936056566 295
381 iso_pu_bacteria 2940556831 2940559136 295
382 iso_pu_bacteria 2941538514 2941541831 295
383 iso_pu_bacteria 3005474847 3005475813 295
384 iso_pu_bacteria 3005483717 3005491081 295
385 iso_pu_bacteria 3005506211 3005510922 295
386 iso_pu_bacteria 3005587118 3005592163 295
387 iso_pu_bacteria 3005594810 3005595876 295
388 iso_pu_bacteria 3005718088 3005719072 295
389 iso_pu_bacteria 8006926726 8006930186 295
390 iso_pu_bacteria 8006933436 8006937130 295
391 iso_pu_bacteria 8006964411 8006966309 295
392 iso_pu_bacteria 8006973647 8006977140 295
393 iso_pu_bacteria 8006984368 8006993123 295
394 iso_pu_bacteria 8006994254 8006996976 295
395 iso_pu_bacteria 8016511872 8016517251 295
396 iso_pu_bacteria 8016583857 8016585396 295
397 iso_pu_bacteria 8016630954 8016634875 295
398 iso_pu_bacteria 8017057580 8017059342 295
399 iso_pu_bacteria 8019555841 8019561527 295
400 iso_pu_bacteria 8019565922 8019571605 295
401 iso_pu_bacteria 8019576017 8019576283 295
402 iso_pu_bacteria 8019586578 8019594157 295
403 iso_pu_bacteria 8019597564 8019607406 295
404 iso_pu_bacteria 8019608314 8019611106 295
405 iso_pu_bacteria 8019619141 8019621953 295
406 iso_pu_bacteria 8019629233 8019631369 295
407 iso_pu_bacteria 8019648815 8019651394 295
408 iso_pu_bacteria 8019659431 8019668174 295
409 iso_pu_bacteria 8019668869 8019677636 295
410 iso_pu_bacteria 8019678201 8019687309 295
411 iso_pu_bacteria 8019687851 8019693288 295
412 iso_pu_bacteria 8055742211 8055743552 295
413 iso_pu_bacteria 8056673599 8056678163 295
414 iso_pu_bacteria 8056689827 8056690819 295
415 iso_pu_bacteria 8056967851 8056974153 295
416 3300006846 Ga0075430_100001211 Ga0075430_10000121127 296
417 3300009147 Ga0114129_10096796 Ga0114129_100967962 296
418 3300027876 Ga0209974_10014756 Ga0209974_100147562 296
419 3300038443 Ga0395901_0004987 Ga0395901_0004987_5221_6126 296
420 3300048924 Ga0496121_0139347 Ga0496121_0139347_686_1582 296
421 3300048929 Ga0496126_0038680 Ga0496126_0038680_3204_4100 296
422 3300049568 Ga0501031_0337165 Ga0501031_0337165_44_952 296
423 3300049569 Ga0501032_0047385 Ga0501032_0047385_640_1545 296
424 3300049570 Ga0501033_0037424 Ga0501033_0037424_1395_2300 296
425 3300049571 Ga0501034_0116531 Ga0501034_0116531_1423_2328 296
426 3300049572 Ga0501036_0067709 Ga0501036_0067709_259_1164 296
427 3300049572 Ga0501036_0249882 Ga0501036_0249882_59_967 296
428 3300049573 Ga0501037_0081263 Ga0501037_0081263_603_1511 296
429 3300049575 Ga0501039_0148562 Ga0501039_0148562_818_1726 296
430 3300049579 Ga0501043_0127609 Ga0501043_0127609_1076_1981 296
431 3300049581 Ga0501047_0257601 Ga0501047_0257601_605_1510 296
432 3300049589 Ga0501073_0213612 Ga0501073_0213612_281_1186 296
433 3300049742 Ga0501080_0391339 Ga0501080_0391339_310_1218 296
434 3300049744 Ga0501083_0197123 Ga0501083_0197123_257_1162 296
435 3300049822 Ga0501035_0259529 Ga0501035_0259529_510_1418 296
436 3300049822 Ga0501035_0315098 Ga0501035_0315098_226_1131 296
437 3300049823 Ga0501044_0102936 Ga0501044_0102936_1406_2311 296
438 3300049823 Ga0501044_0340708 Ga0501044_0340708_11_919 296
439 3300049823 Ga0501044_0639664 Ga0501044_0639664_35_943 296
440 3300050507 nmdc:mga05p37_82451_c1 nmdc:mga05p37_82451_c1_2590_3498 296
441 3300053096 Ga0500641_0108360 Ga0500641_0108360_191_1153 296
442 3300053730 Ga0500645_067292 Ga0500645_067292_82_990 296
443 3300005327 Ga0070658_10259088 Ga0070658_102590882 297
444 3300005336 Ga0070680_100090696 Ga0070680_1000906963 297
445 3300005535 Ga0070684_100417812 Ga0070684_1004178121 297
446 3300005539 Ga0068853_100040910 Ga0068853_1000409103 297
447 3300005563 Ga0068855_100325986 Ga0068855_1003259861 297
448 3300005564 Ga0070664_100311354 Ga0070664_1003113542 297
449 3300005616 Ga0068852_100184337 Ga0068852_1001843372 297
450 3300005937 Ga0081455_10192346 Ga0081455_101923462 297
451 3300009177 Ga0105248_10570825 Ga0105248_105708251 297
452 3300009545 Ga0105237_10044776 Ga0105237_100447762 297
453 3300009551 Ga0105238_10154023 Ga0105238_101540232 297
454 3300010375 Ga0105239_10189719 Ga0105239_101897193 297
455 3300013105 Ga0157369_10125716 Ga0157369_101257162 297
456 3300013297 Ga0157378_10078348 Ga0157378_100783482 297
457 3300020081 Ga0206354_10107649 Ga0206354_101076491 297
458 3300025912 Ga0207707_10002207 Ga0207707_100022072 297
459 3300025917 Ga0207660_10016126 Ga0207660_100161262 297
460 3300025919 Ga0207657_10033356 Ga0207657_100333562 297
461 3300025921 Ga0207652_10161285 Ga0207652_101612852 297
462 3300025924 Ga0207694_10105389 Ga0207694_101053892 297
463 3300026041 Ga0207639_10042056 Ga0207639_100420562 297
464 3300026116 Ga0207674_10227285 Ga0207674_102272852 297
465 3300031616 Ga0307508_10033210 Ga0307508_100332103 297
466 3300031712 Ga0265342_10077453 Ga0265342_100774532 297
467 3300031730 Ga0307516_10293693 Ga0307516_102936931 297
468 3300039437 Ga0436365_1105753 Ga0436365_1105753_559_1467 297
469 3300039437 Ga0436365_1866057 Ga0436365_1866057_456_1364 297
470 3300046459 Ga0495629_0252001 Ga0495629_0252001_45_950 297
471 3300047320 Ga0495672_0081822 Ga0495672_0081822_637_1566 297
472 3300048917 Ga0496114_0206620 Ga0496114_0206620_755_1663 297
473 3300048918 Ga0496115_0022325 Ga0496115_0022325_2611_3534 297
474 3300048918 Ga0496115_0253433 Ga0496115_0253433_468_1376 297
475 3300048925 Ga0496122_0045370 Ga0496122_0045370_1800_2801 297
476 3300048929 Ga0496126_0035603 Ga0496126_0035603_656_1567 297
477 3300049571 Ga0501034_0090938 Ga0501034_0090938_147_1058 297
478 3300049574 Ga0501038_0283264 Ga0501038_0283264_294_1205 297
479 3300049579 Ga0501043_0173428 Ga0501043_0173428_612_1523 297
480 3300049580 Ga0501046_0230322 Ga0501046_0230322_299_1210 297
481 3300049581 Ga0501047_0212578 Ga0501047_0212578_149_1060 297
482 3300049586 Ga0501070_0216100 Ga0501070_0216100_207_1118 297
483 3300049822 Ga0501035_0158389 Ga0501035_0158389_870_1781 297
484 3300049823 Ga0501044_0091107 Ga0501044_0091107_384_1295 297
485 3300049823 Ga0501044_0481657 Ga0501044_0481657_13_924 297
486 3300053094 Ga0500566_0003454 Ga0500566_0003454_6381_7286 297
487 3300053095 Ga0500640_000302 Ga0500640_000302_1764_2669 297
488 3300053111 Ga0500572_001002 Ga0500572_001002_1313_2218 297
489 3300053122 Ga0500608_024516 Ga0500608_024516_10_915 297
490 3300053123 Ga0500614_004103 Ga0500614_004103_1359_2264 297
491 3300053136 Ga0500559_0086393 Ga0500559_0086393_44_949 297
492 3300053150 Ga0500603_000366 Ga0500603_000366_20_925 297
493 3300053159 Ga0500630_000365 Ga0500630_000365_16512_17417 297
494 3300053163 Ga0500639_000031 Ga0500639_000031_36563_37468 297
495 3300053735 Ga0500596_001156 Ga0500596_001156_2920_3825 297
496 3300053737 Ga0500601_001193 Ga0500601_001193_493_1398 297
497 3300059424 Ga0590075_031381 Ga0590075_031381_276_1181 297
498 iso_pu_bacteria 2935793552 2935794779 297
499 iso_pu_bacteria 2935916978 2935922602 297
500 iso_pu_bacteria 8019638758 8019639247 297
501 3300001979 JGI24740J21852_10005937 JGI24740J21852_100059373 298
502 3300005327 Ga0070658_10076839 Ga0070658_100768392 298
503 3300005336 Ga0070680_100064099 Ga0070680_1000640993 298
504 3300005434 Ga0070709_10011241 Ga0070709_100112412 298
505 3300005436 Ga0070713_100064957 Ga0070713_1000649572 298
506 3300005437 Ga0070710_10119090 Ga0070710_101190902 298
507 3300005439 Ga0070711_100031695 Ga0070711_1000316952 298
508 3300005455 Ga0070663_100036700 Ga0070663_1000367002 298
509 3300005455 Ga0070663_100043179 Ga0070663_1000431792 298
510 3300005458 Ga0070681_10045404 Ga0070681_100454042 298
511 3300005530 Ga0070679_100128586 Ga0070679_1001285861 298
512 3300005539 Ga0068853_100032830 Ga0068853_1000328304 298
513 3300005563 Ga0068855_100103075 Ga0068855_1001030751 298
514 3300005563 Ga0068855_100189821 Ga0068855_1001898211 298
515 3300005563 Ga0068855_100203952 Ga0068855_1002039522 298
516 3300005563 Ga0068855_100689100 Ga0068855_1006891001 298
517 3300005563 Ga0068855_100692157 Ga0068855_1006921571 298
518 3300005577 Ga0068857_100023618 Ga0068857_1000236181 298
519 3300005577 Ga0068857_100039537 Ga0068857_1000395372 298
520 3300005578 Ga0068854_100327352 Ga0068854_1003273521 298
521 3300005578 Ga0068854_100352193 Ga0068854_1003521931 298
522 3300005614 Ga0068856_100402031 Ga0068856_1004020311 298
523 3300005616 Ga0068852_100257164 Ga0068852_1002571642 298
524 3300005834 Ga0068851_10062866 Ga0068851_100628661 298
525 3300005841 Ga0068863_100142726 Ga0068863_1001427261 298
526 3300005937 Ga0081455_10040385 Ga0081455_100403852 298
527 3300006028 Ga0070717_10086716 Ga0070717_100867162 298
528 3300006175 Ga0070712_100011969 Ga0070712_1000119692 298
529 3300006177 Ga0075362_10034532 Ga0075362_100345322 298
530 3300006178 Ga0075367_10001616 Ga0075367_100016165 298
531 3300006871 Ga0075434_100118645 Ga0075434_1001186452 298
532 3300009093 Ga0105240_10069358 Ga0105240_100693584 298
533 3300009093 Ga0105240_10274693 Ga0105240_102746932 298
534 3300009093 Ga0105240_10818469 Ga0105240_108184691 298
535 3300009101 Ga0105247_10169366 Ga0105247_101693662 298
536 3300009174 Ga0105241_10001280 Ga0105241_100012808 298
537 3300009545 Ga0105237_10081375 Ga0105237_100813752 298
538 3300009551 Ga0105238_10044002 Ga0105238_100440021 298
539 3300009551 Ga0105238_10079710 Ga0105238_100797103 298
540 3300009551 Ga0105238_10159077 Ga0105238_101590772 298
541 3300009551 Ga0105238_10318790 Ga0105238_103187901 298
542 3300010375 Ga0105239_10054114 Ga0105239_100541144 298
543 3300010375 Ga0105239_10336405 Ga0105239_103364052 298
544 3300010375 Ga0105239_10870780 Ga0105239_108707801 298
545 3300013104 Ga0157370_10040880 Ga0157370_100408802 298
546 3300013105 Ga0157369_10092109 Ga0157369_100921092 298
547 3300013307 Ga0157372_10100045 Ga0157372_101000452 298
548 3300021358 Ga0213873_10005563 Ga0213873_100055632 298
549 3300021384 Ga0213876_10008294 Ga0213876_100082942 298
550 3300025297 Ga0209758_1018003 Ga0209758_10180032 298
551 3300025321 Ga0207656_10005846 Ga0207656_100058462 298
552 3300025898 Ga0207692_10010497 Ga0207692_100104974 298
553 3300025900 Ga0207710_10148545 Ga0207710_101485451 298
554 3300025904 Ga0207647_10005671 Ga0207647_100056712 298
555 3300025909 Ga0207705_10086337 Ga0207705_100863372 298
556 3300025909 Ga0207705_10150930 Ga0207705_101509301 298
557 3300025911 Ga0207654_10000153 Ga0207654_100001533 298
558 3300025912 Ga0207707_10102350 Ga0207707_101023502 298
559 3300025913 Ga0207695_10000506 Ga0207695_1000050675 298
560 3300025913 Ga0207695_10051564 Ga0207695_100515641 298
561 3300025913 Ga0207695_10223007 Ga0207695_102230071 298
562 3300025914 Ga0207671_10331817 Ga0207671_103318172 298
563 3300025915 Ga0207693_10010845 Ga0207693_100108452 298
564 3300025916 Ga0207663_10014563 Ga0207663_100145632 298
565 3300025917 Ga0207660_10149483 Ga0207660_101494831 298
566 3300025919 Ga0207657_10046782 Ga0207657_100467822 298
567 3300025921 Ga0207652_10084447 Ga0207652_100844472 298
568 3300025921 Ga0207652_10154142 Ga0207652_101541421 298
569 3300025924 Ga0207694_10003910 Ga0207694_100039104 298
570 3300025924 Ga0207694_10220145 Ga0207694_102201452 298
571 3300025928 Ga0207700_10078852 Ga0207700_100788521 298
572 3300025933 Ga0207706_10062550 Ga0207706_100625502 298
573 3300025949 Ga0207667_10030376 Ga0207667_100303763 298
574 3300025949 Ga0207667_10104674 Ga0207667_101046742 298
575 3300025949 Ga0207667_10332027 Ga0207667_103320271 298
576 3300025981 Ga0207640_10134907 Ga0207640_101349071 298
577 3300026041 Ga0207639_10024622 Ga0207639_100246222 298
578 3300026067 Ga0207678_10022600 Ga0207678_100226002 298
579 3300026078 Ga0207702_10000006 Ga0207702_10000006290 298
580 3300026078 Ga0207702_10481793 Ga0207702_104817931 298
581 3300026088 Ga0207641_10193115 Ga0207641_101931151 298
582 3300026116 Ga0207674_10048571 Ga0207674_100485714 298
583 3300026116 Ga0207674_10048718 Ga0207674_100487181 298
584 3300026142 Ga0207698_10045959 Ga0207698_100459593 298
585 3300028379 Ga0268266_10188768 Ga0268266_101887682 298
586 3300028577 Ga0265318_10007950 Ga0265318_100079504 298
587 3300030521 Ga0307511_10080843 Ga0307511_100808431 298
588 3300031238 Ga0265332_10040115 Ga0265332_100401152 298
589 3300031247 Ga0265340_10001799 Ga0265340_100017995 298
590 3300031247 Ga0265340_10013333 Ga0265340_100133332 298
591 3300031247 Ga0265340_10068245 Ga0265340_100682453 298
592 3300031249 Ga0265339_10009279 Ga0265339_100092794 298
593 3300031249 Ga0265339_10116126 Ga0265339_101161261 298
594 3300031250 Ga0265331_10130344 Ga0265331_101303442 298
595 3300031344 Ga0265316_10012755 Ga0265316_100127553 298
596 3300031595 Ga0265313_10001560 Ga0265313_1000156015 298
597 3300031595 Ga0265313_10023598 Ga0265313_100235984 298
598 3300031595 Ga0265313_10107458 Ga0265313_101074582 298
599 3300031711 Ga0265314_10023091 Ga0265314_100230911 298
600 3300031712 Ga0265342_10002764 Ga0265342_100027648 298
601 3300031730 Ga0307516_10014001 Ga0307516_100140013 298
602 3300035692 Ga0373935_0069494 Ga0373935_0069494_908_1813 298
603 3300035695 Ga0373927_0038128 Ga0373927_0038128_1020_1925 298
604 3300035724 Ga0373933_0000267 Ga0373933_0000267_20418_21329 298
605 3300036401 Ga0373937_0046803 Ga0373937_0046803_1768_2682 298
606 3300037068 Ga0373925_0117043 Ga0373925_0117043_560_1465 298
607 3300037466 Ga0395898_0091016 Ga0395898_0091016_434_1342 298
608 3300039450 Ga0436363_0613006 Ga0436363_0613006_69_977 298
609 3300039453 Ga0436362_0376169 Ga0436362_0376169_1084_1992 298
610 3300046459 Ga0495629_0026160 Ga0495629_0026160_2720_3646 298
611 3300046462 Ga0495651_0217048 Ga0495651_0217048_292_1218 298
612 3300046499 Ga0495594_0232899 Ga0495594_0232899_103_1029 298
613 3300046507 Ga0495606_0109676 Ga0495606_0109676_466_1392 298
614 3300046524 Ga0495648_0040614 Ga0495648_0040614_1617_2543 298
615 3300046557 Ga0495622_0066030 Ga0495622_0066030_137_1063 298
616 3300046660 Ga0495625_0161696 Ga0495625_0161696_443_1369 298
617 3300046680 Ga0495646_0142601 Ga0495646_0142601_227_1153 298
618 3300046689 Ga0495613_0162765 Ga0495613_0162765_577_1482 298
619 3300046690 Ga0495624_0019074 Ga0495624_0019074_3559_4485 298
620 3300046694 Ga0495649_0042903 Ga0495649_0042903_773_1699 298
621 3300047315 Ga0495581_0067552 Ga0495581_0067552_33_959 298
622 3300047317 Ga0495604_0057670 Ga0495604_0057670_413_1339 298
623 3300048908 Ga0496105_0026827 Ga0496105_0026827_2171_3097 298
624 3300048909 Ga0496106_0011816 Ga0496106_0011816_28_933 298
625 3300048919 Ga0496116_0105397 Ga0496116_0105397_729_1634 298
626 3300048920 Ga0496117_0091379 Ga0496117_0091379_160_1065 298
627 3300048921 Ga0496118_0022933 Ga0496118_0022933_187_1092 298
628 3300048922 Ga0496119_0007315 Ga0496119_0007315_891_1817 298
629 3300048923 Ga0496120_0002476 Ga0496120_0002476_14994_15920 298
630 3300048924 Ga0496121_0004663 Ga0496121_0004663_13353_14258 298
631 3300048927 Ga0496124_0005242 Ga0496124_0005242_9798_10703 298
632 3300048928 Ga0496125_0056873 Ga0496125_0056873_526_1452 298
633 3300048929 Ga0496126_0090551 Ga0496126_0090551_1762_2667 298
634 3300048929 Ga0496126_0327476 Ga0496126_0327476_309_1223 298
635 3300049579 Ga0501043_0137677 Ga0501043_0137677_813_1733 298
636 3300049581 Ga0501047_0086369 Ga0501047_0086369_609_1532 298
637 3300049586 Ga0501070_0111307 Ga0501070_0111307_1000_1920 298
638 3300049590 Ga0501074_0148134 Ga0501074_0148134_172_1092 298
639 3300049742 Ga0501080_0070063 Ga0501080_0070063_601_1524 298
640 3300049744 Ga0501083_0143614 Ga0501083_0143614_451_1356 298
641 3300049822 Ga0501035_0088492 Ga0501035_0088492_1119_2039 298
642 3300049823 Ga0501044_0237579 Ga0501044_0237579_649_1569 298
643 3300050491 nmdc:mga00v17_9796_c1 nmdc:mga00v17_9796_c1_664_1584 298
644 3300050492 nmdc:mga0yw44_247952_c1 nmdc:mga0yw44_247952_c1_189_1109 298
645 3300050494 nmdc:mga06z11_18945_c1 nmdc:mga06z11_18945_c1_1570_2490 298
646 3300050494 nmdc:mga06z11_3865_c1 nmdc:mga06z11_3865_c1_1276_2196 298
647 3300050495 nmdc:mga04h51_32126_c1 nmdc:mga04h51_32126_c1_435_1355 298
648 3300050512 nmdc:mga0n895_357174_c1 nmdc:mga0n895_357174_c1_108_1019 298
649 3300050514 nmdc:mga08x19_113613_c1 nmdc:mga08x19_113613_c1_249_1160 298
650 3300053119 Ga0500595_011798 Ga0500595_011798_1245_2171 298
651 3300053153 Ga0500616_0013923 Ga0500616_0013923_998_1897 298
652 3300053177 Ga0500636_0130196 Ga0500636_0130196_431_1336 298
653 3300054114 Ga0501084_0073495 Ga0501084_0073495_317_1222 298
654 3300060353 Ga0501082_0315271 Ga0501082_0315271_232_1137 298
655 3300003215 JGI25153J46596_10003697 JGI25153J46596_100036972 299
656 3300003215 JGI25153J46596_10008046 JGI25153J46596_100080463 299
657 3300003354 JGI25160J50197_1007198 JGI25160J50197_10071982 299
658 3300005262 Ga0065165_1000982 Ga0065165_10009822 299
659 3300005262 Ga0065165_1007672 Ga0065165_10076723 299
660 3300005262 Ga0065165_1008445 Ga0065165_10084453 299
661 3300005327 Ga0070658_10117782 Ga0070658_101177822 299
662 3300005334 Ga0068869_100023869 Ga0068869_1000238693 299
663 3300005335 Ga0070666_10365109 Ga0070666_103651091 299
664 3300005336 Ga0070680_100016577 Ga0070680_1000165777 299
665 3300005338 Ga0068868_100081641 Ga0068868_1000816412 299
666 3300005347 Ga0070668_100452132 Ga0070668_1004521321 299
667 3300005353 Ga0070669_100082025 Ga0070669_1000820252 299
668 3300005355 Ga0070671_100044664 Ga0070671_1000446642 299
669 3300005356 Ga0070674_100165878 Ga0070674_1001658782 299
670 3300005367 Ga0070667_100095986 Ga0070667_1000959861 299
671 3300005367 Ga0070667_100339293 Ga0070667_1003392931 299
672 3300005434 Ga0070709_10002283 Ga0070709_100022836 299
673 3300005434 Ga0070709_10008203 Ga0070709_100082032 299
674 3300005435 Ga0070714_100039738 Ga0070714_1000397384 299
675 3300005435 Ga0070714_100043482 Ga0070714_1000434823 299
676 3300005435 Ga0070714_100049678 Ga0070714_1000496782 299
677 3300005435 Ga0070714_100195587 Ga0070714_1001955871 299
678 3300005436 Ga0070713_100022749 Ga0070713_1000227492 299
679 3300005436 Ga0070713_100028352 Ga0070713_1000283522 299
680 3300005436 Ga0070713_100060987 Ga0070713_1000609872 299
681 3300005437 Ga0070710_10013667 Ga0070710_100136671 299
682 3300005439 Ga0070711_100010498 Ga0070711_1000104982 299
683 3300005439 Ga0070711_100079939 Ga0070711_1000799392 299
684 3300005439 Ga0070711_100213146 Ga0070711_1002131461 299
685 3300005439 Ga0070711_100307913 Ga0070711_1003079132 299
686 3300005440 Ga0070705_100034239 Ga0070705_1000342392 299
687 3300005455 Ga0070663_100028428 Ga0070663_1000284282 299
688 3300005455 Ga0070663_100029515 Ga0070663_1000295152 299
689 3300005455 Ga0070663_100075766 Ga0070663_1000757662 299
690 3300005455 Ga0070663_100115270 Ga0070663_1001152702 299
691 3300005456 Ga0070678_100106325 Ga0070678_1001063252 299
692 3300005456 Ga0070678_100259963 Ga0070678_1002599632 299
693 3300005457 Ga0070662_100195321 Ga0070662_1001953212 299
694 3300005458 Ga0070681_10058848 Ga0070681_100588482 299
695 3300005458 Ga0070681_10080697 Ga0070681_100806972 299
696 3300005459 Ga0068867_100493130 Ga0068867_1004931301 299
697 3300005468 Ga0070707_100054763 Ga0070707_1000547632 299
698 3300005518 Ga0070699_100237581 Ga0070699_1002375811 299
699 3300005530 Ga0070679_100091315 Ga0070679_1000913152 299
700 3300005535 Ga0070684_100065197 Ga0070684_1000651973 299
701 3300005536 Ga0070697_100103757 Ga0070697_1001037572 299
702 3300005548 Ga0070665_100012864 Ga0070665_1000128647 299
703 3300005548 Ga0070665_100057373 Ga0070665_1000573732 299
704 3300005548 Ga0070665_100102558 Ga0070665_1001025582 299
705 3300005548 Ga0070665_100176149 Ga0070665_1001761492 299
706 3300005548 Ga0070665_100306449 Ga0070665_1003064492 299
707 3300005563 Ga0068855_100117639 Ga0068855_1001176392 299
708 3300005614 Ga0068856_100000137 Ga0068856_10000013756 299
709 3300005614 Ga0068856_100222278 Ga0068856_1002222782 299
710 3300005616 Ga0068852_100010212 Ga0068852_1000102122 299
711 3300005616 Ga0068852_100790806 Ga0068852_1007908061 299
712 3300005617 Ga0068859_100179390 Ga0068859_1001793902 299
713 3300005618 Ga0068864_100509629 Ga0068864_1005096291 299
714 3300005719 Ga0068861_100147039 Ga0068861_1001470392 299
715 3300005842 Ga0068858_100086107 Ga0068858_1000861071 299
716 3300005842 Ga0068858_100320806 Ga0068858_1003208061 299
717 3300005937 Ga0081455_10011276 Ga0081455_100112764 299
718 3300005937 Ga0081455_10013423 Ga0081455_100134237 299
719 3300005937 Ga0081455_10032605 Ga0081455_100326053 299
720 3300005937 Ga0081455_10051423 Ga0081455_100514232 299
721 3300005937 Ga0081455_10072405 Ga0081455_100724052 299
722 3300005981 Ga0081538_10016354 Ga0081538_100163542 299
723 3300005983 Ga0081540_1002034 Ga0081540_10020349 299
724 3300005983 Ga0081540_1007800 Ga0081540_10078002 299
725 3300005983 Ga0081540_1008423 Ga0081540_10084236 299
726 3300005983 Ga0081540_1012078 Ga0081540_10120784 299
727 3300005983 Ga0081540_1020975 Ga0081540_10209752 299
728 3300005983 Ga0081540_1023647 Ga0081540_10236473 299
729 3300005983 Ga0081540_1074654 Ga0081540_10746542 299
730 3300005985 Ga0081539_10000157 Ga0081539_1000015717 299
731 3300005985 Ga0081539_10006006 Ga0081539_100060069 299
732 3300006028 Ga0070717_10017655 Ga0070717_100176556 299
733 3300006028 Ga0070717_10148538 Ga0070717_101485382 299
734 3300006038 Ga0075365_10040902 Ga0075365_100409022 299
735 3300006038 Ga0075365_10211007 Ga0075365_102110071 299
736 3300006042 Ga0075368_10026242 Ga0075368_100262422 299
737 3300006042 Ga0075368_10028787 Ga0075368_100287872 299
738 3300006048 Ga0075363_100012694 Ga0075363_1000126942 299
739 3300006048 Ga0075363_100082248 Ga0075363_1000822482 299
740 3300006051 Ga0075364_10092981 Ga0075364_100929812 299
741 3300006163 Ga0070715_10001709 Ga0070715_100017092 299
742 3300006173 Ga0070716_100021483 Ga0070716_1000214832 299
743 3300006173 Ga0070716_100043557 Ga0070716_1000435572 299
744 3300006175 Ga0070712_100038281 Ga0070712_1000382812 299
745 3300006178 Ga0075367_10089947 Ga0075367_100899472 299
746 3300006178 Ga0075367_10112997 Ga0075367_101129971 299
747 3300006195 Ga0075366_10093184 Ga0075366_100931842 299
748 3300006195 Ga0075366_10139845 Ga0075366_101398451 299
749 3300006195 Ga0075366_10233697 Ga0075366_102336972 299
750 3300006237 Ga0097621_100117702 Ga0097621_1001177021 299
751 3300006353 Ga0075370_10069232 Ga0075370_100692322 299
752 3300006353 Ga0075370_10159241 Ga0075370_101592411 299
753 3300006931 Ga0097620_100179389 Ga0097620_1001793892 299
754 3300006942 Ga0099824_1008492 Ga0099824_10084926 299
755 3300006943 Ga0099822_1002961 Ga0099822_10029612 299
756 3300007788 Ga0099795_10064606 Ga0099795_100646061 299
757 3300009011 Ga0105251_10170334 Ga0105251_101703341 299
758 3300009093 Ga0105240_10012243 Ga0105240_100122436 299
759 3300009093 Ga0105240_10027631 Ga0105240_100276313 299
760 3300009093 Ga0105240_10228286 Ga0105240_102282862 299
761 3300009093 Ga0105240_10478354 Ga0105240_104783541 299
762 3300009094 Ga0111539_10653200 Ga0111539_106532001 299
763 3300009098 Ga0105245_10189222 Ga0105245_101892222 299
764 3300009101 Ga0105247_10434623 Ga0105247_104346231 299
765 3300009148 Ga0105243_10154406 Ga0105243_101544062 299
766 3300009174 Ga0105241_10030510 Ga0105241_100305102 299
767 3300009177 Ga0105248_10036476 Ga0105248_100364762 299
768 3300009177 Ga0105248_10275012 Ga0105248_102750122 299
769 3300009545 Ga0105237_10095015 Ga0105237_100950152 299
770 3300009545 Ga0105237_10122555 Ga0105237_101225552 299
771 3300010375 Ga0105239_10203284 Ga0105239_102032842 299
772 3300010375 Ga0105239_10241536 Ga0105239_102415362 299
773 3300010375 Ga0105239_10298975 Ga0105239_102989752 299
774 3300010375 Ga0105239_10415914 Ga0105239_104159141 299
775 3300011119 Ga0105246_10254899 Ga0105246_102548992 299
776 3300012508 Ga0157315_1001210 Ga0157315_10012102 299
777 3300013105 Ga0157369_10025909 Ga0157369_100259092 299
778 3300013105 Ga0157369_10127447 Ga0157369_101274472 299
779 3300013307 Ga0157372_10326812 Ga0157372_103268122 299
780 3300013308 Ga0157375_10055890 Ga0157375_100558901 299
781 3300013308 Ga0157375_10201235 Ga0157375_102012352 299
782 3300014325 Ga0163163_10031448 Ga0163163_100314482 299
783 3300014325 Ga0163163_10142581 Ga0163163_101425812 299
784 3300014325 Ga0163163_10302245 Ga0163163_103022452 299
785 3300014969 Ga0157376_10022471 Ga0157376_100224715 299
786 3300021320 Ga0214544_1000011 Ga0214544_1000011119 299
787 3300021321 Ga0214542_1000009 Ga0214542_1000009123 299
788 3300021324 Ga0214545_1000007 Ga0214545_1000007119 299
789 3300021327 Ga0214543_1000020 Ga0214543_1000020123 299
790 3300021384 Ga0213876_10078985 Ga0213876_100789851 299
791 3300025230 Ga0209563_103792 Ga0209563_1037922 299
792 3300025253 Ga0209677_102183 Ga0209677_1021832 299
793 3300025254 Ga0209148_1000321 Ga0209148_100032115 299
794 3300025261 Ga0209233_1000907 Ga0209233_10009079 299
795 3300025261 Ga0209233_1008907 Ga0209233_10089073 299
796 3300025272 Ga0209455_1000807 Ga0209455_10008072 299
797 3300025295 Ga0209564_1031051 Ga0209564_10310512 299
798 3300025297 Ga0209758_1000206 Ga0209758_10002066 299
799 3300025297 Ga0209758_1000536 Ga0209758_10005366 299
800 3300025297 Ga0209758_1001539 Ga0209758_100153914 299
801 3300025297 Ga0209758_1001550 Ga0209758_100155011 299
802 3300025297 Ga0209758_1002309 Ga0209758_10023098 299
803 3300025297 Ga0209758_1021635 Ga0209758_10216352 299
804 3300025299 Ga0209256_1011364 Ga0209256_10113643 299
805 3300025302 Ga0207426_1000773 Ga0207426_100077313 299
806 3300025302 Ga0207426_1000990 Ga0207426_100099019 299
807 3300025302 Ga0207426_1003444 Ga0207426_10034442 299
808 3300025304 Ga0209257_1000394 Ga0209257_10003946 299
809 3300025304 Ga0209257_1011695 Ga0209257_10116952 299
810 3300025315 Ga0207697_10158552 Ga0207697_101585521 299
811 3300025898 Ga0207692_10000138 Ga0207692_1000013814 299
812 3300025898 Ga0207692_10008172 Ga0207692_100081723 299
813 3300025900 Ga0207710_10044682 Ga0207710_100446822 299
814 3300025900 Ga0207710_10060946 Ga0207710_100609462 299
815 3300025901 Ga0207688_10101138 Ga0207688_101011382 299
816 3300025903 Ga0207680_10199770 Ga0207680_101997702 299
817 3300025906 Ga0207699_10000122 Ga0207699_1000012213 299
818 3300025906 Ga0207699_10003146 Ga0207699_100031462 299
819 3300025906 Ga0207699_10135323 Ga0207699_101353232 299
820 3300025906 Ga0207699_10184435 Ga0207699_101844351 299
821 3300025908 Ga0207643_10008642 Ga0207643_100086422 299
822 3300025908 Ga0207643_10128696 Ga0207643_101286961 299
823 3300025910 Ga0207684_10037662 Ga0207684_100376622 299
824 3300025911 Ga0207654_10058650 Ga0207654_100586502 299
825 3300025912 Ga0207707_10000515 Ga0207707_1000051514 299
826 3300025913 Ga0207695_10000006 Ga0207695_10000006582 299
827 3300025913 Ga0207695_10030436 Ga0207695_100304361 299
828 3300025913 Ga0207695_10330686 Ga0207695_103306862 299
829 3300025914 Ga0207671_10021063 Ga0207671_100210632 299
830 3300025915 Ga0207693_10004906 Ga0207693_100049062 299
831 3300025915 Ga0207693_10009351 Ga0207693_100093512 299
832 3300025916 Ga0207663_10000161 Ga0207663_100001612 299
833 3300025916 Ga0207663_10000623 Ga0207663_1000062312 299
834 3300025917 Ga0207660_10155763 Ga0207660_101557631 299
835 3300025919 Ga0207657_10141428 Ga0207657_101414283 299
836 3300025920 Ga0207649_10312393 Ga0207649_103123931 299
837 3300025921 Ga0207652_10024532 Ga0207652_100245322 299
838 3300025921 Ga0207652_10196019 Ga0207652_101960192 299
839 3300025921 Ga0207652_10246409 Ga0207652_102464091 299
840 3300025922 Ga0207646_10094693 Ga0207646_100946932 299
841 3300025924 Ga0207694_10225354 Ga0207694_102253542 299
842 3300025924 Ga0207694_10350294 Ga0207694_103502941 299
843 3300025927 Ga0207687_10009895 Ga0207687_100098952 299
844 3300025927 Ga0207687_10029818 Ga0207687_100298183 299
845 3300025927 Ga0207687_10301560 Ga0207687_103015601 299
846 3300025928 Ga0207700_10068098 Ga0207700_100680981 299
847 3300025928 Ga0207700_10099864 Ga0207700_100998642 299
848 3300025928 Ga0207700_10157829 Ga0207700_101578291 299
849 3300025929 Ga0207664_10021734 Ga0207664_100217342 299
850 3300025929 Ga0207664_10081093 Ga0207664_100810932 299
851 3300025929 Ga0207664_10122909 Ga0207664_101229092 299
852 3300025929 Ga0207664_10123809 Ga0207664_101238092 299
853 3300025931 Ga0207644_10022900 Ga0207644_100229002 299
854 3300025931 Ga0207644_10293512 Ga0207644_102935122 299
855 3300025933 Ga0207706_10198139 Ga0207706_101981392 299
856 3300025936 Ga0207670_10183717 Ga0207670_101837172 299
857 3300025937 Ga0207669_10311820 Ga0207669_103118201 299
858 3300025938 Ga0207704_10054979 Ga0207704_100549792 299
859 3300025939 Ga0207665_10000183 Ga0207665_1000018338 299
860 3300025939 Ga0207665_10090592 Ga0207665_100905922 299
861 3300025942 Ga0207689_10244191 Ga0207689_102441912 299
862 3300025944 Ga0207661_10000828 Ga0207661_100008282 299
863 3300025944 Ga0207661_10128685 Ga0207661_101286851 299
864 3300025960 Ga0207651_10199418 Ga0207651_101994182 299
865 3300026023 Ga0207677_10408896 Ga0207677_104088962 299
866 3300026035 Ga0207703_10141894 Ga0207703_101418942 299
867 3300026035 Ga0207703_10416537 Ga0207703_104165372 299
868 3300026067 Ga0207678_10026771 Ga0207678_100267712 299
869 3300026067 Ga0207678_10038686 Ga0207678_100386862 299
870 3300026067 Ga0207678_10096846 Ga0207678_100968462 299
871 3300026067 Ga0207678_10155774 Ga0207678_101557742 299
872 3300026067 Ga0207678_10298681 Ga0207678_102986812 299
873 3300026078 Ga0207702_10000063 Ga0207702_1000006353 299
874 3300026078 Ga0207702_10174014 Ga0207702_101740142 299
875 3300026078 Ga0207702_10222152 Ga0207702_102221522 299
876 3300026078 Ga0207702_10421699 Ga0207702_104216991 299
877 3300026095 Ga0207676_10121038 Ga0207676_101210382 299
878 3300026116 Ga0207674_10133209 Ga0207674_101332092 299
879 3300026116 Ga0207674_10171418 Ga0207674_101714182 299
880 3300026118 Ga0207675_100141890 Ga0207675_1001418902 299
881 3300026118 Ga0207675_100241858 Ga0207675_1002418582 299
882 3300026118 Ga0207675_100539240 Ga0207675_1005392401 299
883 3300026121 Ga0207683_10017647 Ga0207683_100176473 299
884 3300026121 Ga0207683_10177815 Ga0207683_101778151 299
885 3300026142 Ga0207698_10297454 Ga0207698_102974541 299
886 3300026142 Ga0207698_10395256 Ga0207698_103952562 299
887 3300027296 Ga0209389_1000034 Ga0209389_1000034114 299
888 3300027296 Ga0209389_1000039 Ga0209389_1000039113 299
889 3300027357 Ga0209589_1000038 Ga0209589_10000386 299
890 3300027357 Ga0209589_1000055 Ga0209589_100005559 299
891 3300027361 Ga0209489_100023 Ga0209489_100023187 299
892 3300027361 Ga0209489_100087 Ga0209489_100087113 299
893 3300027361 Ga0209489_100128 Ga0209489_10012859 299
894 3300027363 Ga0209700_100090 Ga0209700_1000903 299
895 3300027363 Ga0209700_100137 Ga0209700_10013759 299
896 3300027671 Ga0209588_1005208 Ga0209588_10052082 299
897 3300027866 Ga0209813_10020446 Ga0209813_100204462 299
898 3300028379 Ga0268266_10034702 Ga0268266_100347022 299
899 3300028379 Ga0268266_10053634 Ga0268266_100536342 299
900 3300028379 Ga0268266_10115088 Ga0268266_101150881 299
901 3300028379 Ga0268266_10219944 Ga0268266_102199441 299
902 3300028379 Ga0268266_10600699 Ga0268266_106006991 299
903 3300028380 Ga0268265_10130892 Ga0268265_101308922 299
904 3300028556 Ga0265337_1061197 Ga0265337_10611971 299
905 3300028573 Ga0265334_10039065 Ga0265334_100390652 299
906 3300028653 Ga0265323_10012335 Ga0265323_100123352 299
907 3300028666 Ga0265336_10001738 Ga0265336_100017385 299
908 3300028786 Ga0307517_10001423 Ga0307517_1000142333 299
909 3300028794 Ga0307515_10046793 Ga0307515_100467932 299
910 3300028800 Ga0265338_10000417 Ga0265338_1000041746 299
911 3300031235 Ga0265330_10034644 Ga0265330_100346442 299
912 3300031235 Ga0265330_10102948 Ga0265330_101029482 299
913 3300031247 Ga0265340_10046257 Ga0265340_100462572 299
914 3300031247 Ga0265340_10105394 Ga0265340_101053942 299
915 3300031249 Ga0265339_10000281 Ga0265339_1000028137 299
916 3300031250 Ga0265331_10089716 Ga0265331_100897162 299
917 3300031456 Ga0307513_10171602 Ga0307513_101716022 299
918 3300031507 Ga0307509_10053131 Ga0307509_100531312 299
919 3300031616 Ga0307508_10000012 Ga0307508_1000001242 299
920 3300031616 Ga0307508_10323996 Ga0307508_103239961 299
921 3300031711 Ga0265314_10011033 Ga0265314_100110335 299
922 3300031712 Ga0265342_10079030 Ga0265342_100790301 299
923 3300032002 Ga0307416_100154960 Ga0307416_1001549602 299
924 3300032005 Ga0307411_10194970 Ga0307411_101949701 299
925 3300033180 Ga0307510_10022874 Ga0307510_100228742 299
926 3300033180 Ga0307510_10031589 Ga0307510_100315892 299
927 3300033180 Ga0307510_10037361 Ga0307510_100373612 299
928 3300033180 Ga0307510_10071425 Ga0307510_100714252 299
929 3300035086 Ga0373934_0024456 Ga0373934_0024456_1109_2023 299
930 3300035086 Ga0373934_0029496 Ga0373934_0029496_1101_2015 299
931 3300035113 Ga0373936_0007352 Ga0373936_0007352_1966_2889 299
932 3300035117 Ga0373953_0001704 Ga0373953_0001704_938_1852 299
933 3300035117 Ga0373953_0002691 Ga0373953_0002691_4415_5329 299
934 3300035118 Ga0373954_0007407 Ga0373954_0007407_1130_2044 299
935 3300035119 Ga0373956_0056817 Ga0373956_0056817_223_1137 299
936 3300035120 Ga0373957_0050268 Ga0373957_0050268_372_1286 299
937 3300035120 Ga0373957_0113656 Ga0373957_0113656_151_1065 299
938 3300035170 Ga0373943_0025951 Ga0373943_0025951_265_1179 299
939 3300035171 Ga0373946_0008815 Ga0373946_0008815_1422_2336 299
940 3300035171 Ga0373946_0111979 Ga0373946_0111979_144_1058 299
941 3300035172 Ga0373955_0038590 Ga0373955_0038590_1166_2080 299
942 3300035172 Ga0373955_0070775 Ga0373955_0070775_698_1612 299
943 3300035172 Ga0373955_0091565 Ga0373955_0091565_187_1101 299
944 3300035410 Ga0373924_0052820 Ga0373924_0052820_216_1130 299
945 3300035692 Ga0373935_0003730 Ga0373935_0003730_6060_6974 299
946 3300035692 Ga0373935_0017629 Ga0373935_0017629_506_1420 299
947 3300035695 Ga0373927_0001492 Ga0373927_0001492_16406_17320 299
948 3300035695 Ga0373927_0001793 Ga0373927_0001793_14291_15205 299
949 3300035724 Ga0373933_0035758 Ga0373933_0035758_899_1813 299
950 3300035725 Ga0373947_0001861 Ga0373947_0001861_5477_6391 299
951 3300035725 Ga0373947_0083092 Ga0373947_0083092_966_1880 299
952 3300036401 Ga0373937_0040210 Ga0373937_0040210_2899_3813 299
953 3300036401 Ga0373937_0055275 Ga0373937_0055275_457_1371 299
954 3300036401 Ga0373937_0259198 Ga0373937_0259198_316_1230 299
955 3300036401 Ga0373937_0362752 Ga0373937_0362752_215_1129 299
956 3300036401 Ga0373937_0376854 Ga0373937_0376854_410_1324 299
957 3300037068 Ga0373925_0013546 Ga0373925_0013546_3813_4727 299
958 3300037068 Ga0373925_0058364 Ga0373925_0058364_330_1244 299
959 3300037068 Ga0373925_0205500 Ga0373925_0205500_570_1484 299
960 3300037418 Ga0395900_0048769 Ga0395900_0048769_1751_2665 299
961 3300037466 Ga0395898_0019947 Ga0395898_0019947_1585_2505 299
962 3300037471 Ga0395905_0004165 Ga0395905_0004165_9798_10718 299
963 3300037471 Ga0395905_0032236 Ga0395905_0032236_1006_1932 299
964 3300037853 Ga0436364_0483388 Ga0436364_0483388_417_1331 299
965 3300037853 Ga0436364_1097754 Ga0436364_1097754_49_963 299
966 3300038443 Ga0395901_0064055 Ga0395901_0064055_989_1909 299
967 3300038443 Ga0395901_0111647 Ga0395901_0111647_1936_2850 299
968 3300038443 Ga0395901_0384405 Ga0395901_0384405_11_937 299
969 3300039437 Ga0436365_0299351 Ga0436365_0299351_1393_2307 299
970 3300039437 Ga0436365_1557661 Ga0436365_1557661_359_1273 299
971 3300039437 Ga0436365_1683113 Ga0436365_1683113_189_1115 299
972 3300039438 Ga0436360_1250391 Ga0436360_1250391_328_1239 299
973 3300039447 Ga0436361_0870440 Ga0436361_0870440_100_1014 299
974 3300041452 Ga0451793_0917594 Ga0451793_0917594_596_1516 299
975 3300041509 Ga0451843_1211220 Ga0451843_1211220_402_1322 299
976 3300044656 Ga0466969_0035286 Ga0466969_0035286_766_1686 299
977 3300044658 Ga0466972_0000053 Ga0466972_0000053_4105_5025 299
978 3300044684 Ga0466966_0003788 Ga0466966_0003788_3575_4495 299
979 3300044684 Ga0466966_0033603 Ga0466966_0033603_191_1105 299
980 3300044684 Ga0466966_0143406 Ga0466966_0143406_37_951 299
981 3300044693 Ga0466961_0000227 Ga0466961_0000227_25719_26639 299
982 3300044901 Ga0466960_0198246 Ga0466960_0198246_22_942 299
983 3300045049 Ga0466959_0024944 Ga0466959_0024944_735_1649 299
984 3300045049 Ga0466959_0061469 Ga0466959_0061469_177_1091 299
985 3300046454 Ga0495592_0002227 Ga0495592_0002227_4128_5042 299
986 3300046454 Ga0495592_0053346 Ga0495592_0053346_274_1188 299
987 3300046454 Ga0495592_0107893 Ga0495592_0107893_101_1042 299
988 3300046455 Ga0495603_0000036 Ga0495603_0000036_54258_55172 299
989 3300046455 Ga0495603_0008447 Ga0495603_0008447_1089_2003 299
990 3300046455 Ga0495603_0015690 Ga0495603_0015690_2239_3153 299
991 3300046455 Ga0495603_0017567 Ga0495603_0017567_143_1057 299
992 3300046455 Ga0495603_0061304 Ga0495603_0061304_190_1104 299
993 3300046459 Ga0495629_0000148 Ga0495629_0000148_6354_7268 299
994 3300046459 Ga0495629_0000331 Ga0495629_0000331_9821_10735 299
995 3300046459 Ga0495629_0108804 Ga0495629_0108804_42_956 299
996 3300046459 Ga0495629_0214212 Ga0495629_0214212_21_935 299
997 3300046459 Ga0495629_0326679 Ga0495629_0326679_107_1021 299
998 3300046460 Ga0495638_0033836 Ga0495638_0033836_1458_2372 299
999 3300046460 Ga0495638_0046208 Ga0495638_0046208_1777_2703 299
1000 3300046460 Ga0495638_0254238 Ga0495638_0254238_35_949 299
1001 3300046462 Ga0495651_0009401 Ga0495651_0009401_315_1256 299
1002 3300046462 Ga0495651_0016761 Ga0495651_0016761_3049_3963 299
1003 3300046463 Ga0495653_0000697 Ga0495653_0000697_12021_12935 299
1004 3300046463 Ga0495653_0033411 Ga0495653_0033411_567_1481 299
1005 3300046463 Ga0495653_0200113 Ga0495653_0200113_272_1213 299
1006 3300046472 Ga0495580_0000705 Ga0495580_0000705_5533_6447 299
1007 3300046473 Ga0495582_0002450 Ga0495582_0002450_6388_7302 299
1008 3300046473 Ga0495582_0172305 Ga0495582_0172305_187_1101 299
1009 3300046475 Ga0495639_0000135 Ga0495639_0000135_9472_10386 299
1010 3300046475 Ga0495639_0004541 Ga0495639_0004541_160_1074 299
1011 3300046476 Ga0495662_0000811 Ga0495662_0000811_8041_8955 299
1012 3300046477 Ga0495664_0015540 Ga0495664_0015540_15_956 299
1013 3300046477 Ga0495664_0024550 Ga0495664_0024550_900_1814 299
1014 3300046477 Ga0495664_0242264 Ga0495664_0242264_138_1052 299
1015 3300046499 Ga0495594_0001252 Ga0495594_0001252_9167_10081 299
1016 3300046499 Ga0495594_0161976 Ga0495594_0161976_141_1055 299
1017 3300046499 Ga0495594_0234788 Ga0495594_0234788_73_987 299
1018 3300046500 Ga0495596_0098348 Ga0495596_0098348_10_924 299
1019 3300046501 Ga0495607_0151071 Ga0495607_0151071_194_1114 299
1020 3300046511 Ga0495608_0062538 Ga0495608_0062538_1399_2313 299
1021 3300046511 Ga0495608_0083219 Ga0495608_0083219_703_1617 299
1022 3300046513 Ga0495616_0124891 Ga0495616_0124891_137_1057 299
1023 3300046514 Ga0495618_0016165 Ga0495618_0016165_2323_3237 299
1024 3300046514 Ga0495618_0048606 Ga0495618_0048606_1114_2028 299
1025 3300046514 Ga0495618_0208057 Ga0495618_0208057_198_1112 299
1026 3300046516 Ga0495628_0045823 Ga0495628_0045823_1351_2265 299
1027 3300046516 Ga0495628_0095790 Ga0495628_0095790_1356_2270 299
1028 3300046517 Ga0495630_0086215 Ga0495630_0086215_1096_2010 299
1029 3300046517 Ga0495630_0146108 Ga0495630_0146108_447_1361 299
1030 3300046519 Ga0495632_0050213 Ga0495632_0050213_544_1458 299
1031 3300046522 Ga0495643_0051759 Ga0495643_0051759_414_1334 299
1032 3300046529 Ga0495652_0025648 Ga0495652_0025648_1248_2162 299
1033 3300046529 Ga0495652_0335278 Ga0495652_0335278_114_1028 299
1034 3300046531 Ga0495665_0000118 Ga0495665_0000118_6528_7442 299
1035 3300046533 Ga0495640_0057459 Ga0495640_0057459_1042_1956 299
1036 3300046533 Ga0495640_0083891 Ga0495640_0083891_731_1645 299
1037 3300046536 Ga0495587_0009426 Ga0495587_0009426_795_1709 299
1038 3300046536 Ga0495587_0037845 Ga0495587_0037845_500_1441 299
1039 3300046542 Ga0495597_0071706 Ga0495597_0071706_138_1058 299
1040 3300046543 Ga0495645_0018632 Ga0495645_0018632_858_1799 299
1041 3300046543 Ga0495645_0057120 Ga0495645_0057120_183_1097 299
1042 3300046557 Ga0495622_0027568 Ga0495622_0027568_1649_2563 299
1043 3300046557 Ga0495622_0053671 Ga0495622_0053671_295_1209 299
1044 3300046559 Ga0495667_0000379 Ga0495667_0000379_10394_11308 299
1045 3300046559 Ga0495667_0040798 Ga0495667_0040798_1399_2340 299
1046 3300046559 Ga0495667_0047491 Ga0495667_0047491_1493_2407 299
1047 3300046616 Ga0495668_0053348 Ga0495668_0053348_1048_1962 299
1048 3300046616 Ga0495668_0106545 Ga0495668_0106545_77_997 299
1049 3300046616 Ga0495668_0173550 Ga0495668_0173550_222_1136 299
1050 3300046642 Ga0495634_0000969 Ga0495634_0000969_736_1650 299
1051 3300046642 Ga0495634_0018562 Ga0495634_0018562_2382_3296 299
1052 3300046642 Ga0495634_0116320 Ga0495634_0116320_577_1518 299
1053 3300046642 Ga0495634_0221464 Ga0495634_0221464_100_1026 299
1054 3300046663 Ga0495635_0006242 Ga0495635_0006242_6457_7371 299
1055 3300046665 Ga0495661_0144082 Ga0495661_0144082_164_1084 299
1056 3300046674 Ga0495588_0036181 Ga0495588_0036181_104_1018 299
1057 3300046674 Ga0495588_0046900 Ga0495588_0046900_1087_2028 299
1058 3300046674 Ga0495588_0131483 Ga0495588_0131483_95_1009 299
1059 3300046675 Ga0495657_0005912 Ga0495657_0005912_2750_3691 299
1060 3300046675 Ga0495657_0007977 Ga0495657_0007977_3700_4614 299
1061 3300046678 Ga0495599_0069200 Ga0495599_0069200_72_1013 299
1062 3300046678 Ga0495599_0228107 Ga0495599_0228107_152_1066 299
1063 3300046678 Ga0495599_0231185 Ga0495599_0231185_199_1113 299
1064 3300046679 Ga0495623_0042152 Ga0495623_0042152_1526_2467 299
1065 3300046680 Ga0495646_0021600 Ga0495646_0021600_1619_2533 299
1066 3300046681 Ga0495647_0000360 Ga0495647_0000360_665_1579 299
1067 3300046683 Ga0495658_0009177 Ga0495658_0009177_3370_4284 299
1068 3300046683 Ga0495658_0047609 Ga0495658_0047609_1442_2356 299
1069 3300046689 Ga0495613_0031204 Ga0495613_0031204_1569_2483 299
1070 3300046689 Ga0495613_0123568 Ga0495613_0123568_244_1158 299
1071 3300046690 Ga0495624_0000445 Ga0495624_0000445_6372_7286 299
1072 3300046690 Ga0495624_0210104 Ga0495624_0210104_121_1035 299
1073 3300046692 Ga0495671_0122925 Ga0495671_0122925_230_1144 299
1074 3300046809 Ga0495600_0003883 Ga0495600_0003883_3907_4821 299
1075 3300046809 Ga0495600_0007122 Ga0495600_0007122_4812_5753 299
1076 3300046809 Ga0495600_0026362 Ga0495600_0026362_2690_3604 299
1077 3300047315 Ga0495581_0001178 Ga0495581_0001178_7490_8404 299
1078 3300047315 Ga0495581_0169040 Ga0495581_0169040_82_996 299
1079 3300047315 Ga0495581_0217217 Ga0495581_0217217_51_965 299
1080 3300047317 Ga0495604_0012567 Ga0495604_0012567_4123_5064 299
1081 3300047317 Ga0495604_0093258 Ga0495604_0093258_1248_2162 299
1082 3300047317 Ga0495604_0101323 Ga0495604_0101323_964_1878 299
1083 3300047319 Ga0495674_0000443 Ga0495674_0000443_33617_34531 299
1084 3300047319 Ga0495674_0010317 Ga0495674_0010317_4042_4956 299
1085 3300047319 Ga0495674_0036232 Ga0495674_0036232_982_1923 299
1086 3300047319 Ga0495674_0038574 Ga0495674_0038574_303_1217 299
1087 3300047320 Ga0495672_0123114 Ga0495672_0123114_116_1030 299
1088 3300047320 Ga0495672_0138500 Ga0495672_0138500_157_1071 299
1089 3300047321 Ga0495676_0104051 Ga0495676_0104051_812_1726 299
1090 3300047322 Ga0495680_0001308 Ga0495680_0001308_10681_11622 299
1091 3300047322 Ga0495680_0247200 Ga0495680_0247200_37_951 299
1092 3300047443 Ga0495687_058255 Ga0495687_058255_108_1049 299
1093 3300047444 Ga0495675_0032620 Ga0495675_0032620_2092_3033 299
1094 3300047444 Ga0495675_0075757 Ga0495675_0075757_763_1677 299
1095 3300047471 Ga0495684_0002730 Ga0495684_0002730_4987_5901 299
1096 3300047471 Ga0495684_0054251 Ga0495684_0054251_698_1612 299
1097 3300047471 Ga0495684_0076841 Ga0495684_0076841_1430_2344 299
1098 3300047471 Ga0495684_0077562 Ga0495684_0077562_1557_2498 299
1099 3300047673 Ga0495593_0000495 Ga0495593_0000495_1416_2330 299
1100 3300047673 Ga0495593_0001203 Ga0495593_0001203_591_1505 299
1101 3300047673 Ga0495593_0022477 Ga0495593_0022477_409_1323 299
1102 3300047673 Ga0495593_0105124 Ga0495593_0105124_347_1261 299
1103 3300048088 Ga0495602_0028623 Ga0495602_0028623_1670_2611 299
1104 3300048088 Ga0495602_0115902 Ga0495602_0115902_774_1688 299
1105 3300048089 Ga0495614_0111458 Ga0495614_0111458_108_1022 299
1106 3300048903 Ga0496100_0011667 Ga0496100_0011667_3475_4389 299
1107 3300048903 Ga0496100_0016652 Ga0496100_0016652_1112_2026 299
1108 3300048904 Ga0496101_0003579 Ga0496101_0003579_4620_5534 299
1109 3300048904 Ga0496101_0064455 Ga0496101_0064455_1706_2620 299
1110 3300048904 Ga0496101_0185183 Ga0496101_0185183_270_1190 299
1111 3300048905 Ga0496102_0007923 Ga0496102_0007923_7991_8911 299
1112 3300048905 Ga0496102_0010957 Ga0496102_0010957_822_1736 299
1113 3300048905 Ga0496102_0418721 Ga0496102_0418721_67_981 299
1114 3300048906 Ga0496103_0023579 Ga0496103_0023579_2587_3507 299
1115 3300048907 Ga0496104_0014455 Ga0496104_0014455_46_1053 299
1116 3300048907 Ga0496104_0014992 Ga0496104_0014992_1591_2505 299
1117 3300048907 Ga0496104_0048023 Ga0496104_0048023_1237_2151 299
1118 3300048907 Ga0496104_0069177 Ga0496104_0069177_1693_2634 299
1119 3300048907 Ga0496104_0543636 Ga0496104_0543636_66_986 299
1120 3300048908 Ga0496105_0102035 Ga0496105_0102035_50_964 299
1121 3300048908 Ga0496105_0102772 Ga0496105_0102772_1201_2208 299
1122 3300048908 Ga0496105_0102995 Ga0496105_0102995_955_1875 299
1123 3300048909 Ga0496106_0015817 Ga0496106_0015817_3180_4094 299
1124 3300048910 Ga0496107_0276695 Ga0496107_0276695_188_1135 299
1125 3300048911 Ga0496108_0002964 Ga0496108_0002964_7444_8358 299
1126 3300048911 Ga0496108_0149303 Ga0496108_0149303_130_1050 299
1127 3300048911 Ga0496108_0287503 Ga0496108_0287503_281_1195 299
1128 3300048911 Ga0496108_0506769 Ga0496108_0506769_21_947 299
1129 3300048912 Ga0496109_0002046 Ga0496109_0002046_1271_2185 299
1130 3300048912 Ga0496109_0053999 Ga0496109_0053999_1150_2097 299
1131 3300048912 Ga0496109_0222188 Ga0496109_0222188_767_1681 299
1132 3300048912 Ga0496109_0302962 Ga0496109_0302962_134_1048 299
1133 3300048912 Ga0496109_0386395 Ga0496109_0386395_11_931 299
1134 3300048913 Ga0496110_0058569 Ga0496110_0058569_99_1106 299
1135 3300048913 Ga0496110_0107500 Ga0496110_0107500_401_1315 299
1136 3300048913 Ga0496110_0163678 Ga0496110_0163678_271_1191 299
1137 3300048913 Ga0496110_0328459 Ga0496110_0328459_148_1089 299
1138 3300048913 Ga0496110_0334970 Ga0496110_0334970_438_1352 299
1139 3300048914 Ga0496111_0158235 Ga0496111_0158235_532_1452 299
1140 3300048915 Ga0496112_0018491 Ga0496112_0018491_1216_2130 299
1141 3300048915 Ga0496112_0039371 Ga0496112_0039371_2941_3855 299
1142 3300048915 Ga0496112_0053414 Ga0496112_0053414_2955_3869 299
1143 3300048915 Ga0496112_0190119 Ga0496112_0190119_777_1697 299
1144 3300048915 Ga0496112_0336353 Ga0496112_0336353_353_1267 299
1145 3300048915 Ga0496112_0458908 Ga0496112_0458908_178_1119 299
1146 3300048916 Ga0496113_0020258 Ga0496113_0020258_1176_2090 299
1147 3300048916 Ga0496113_0083060 Ga0496113_0083060_1243_2157 299
1148 3300048916 Ga0496113_0134356 Ga0496113_0134356_607_1521 299
1149 3300048917 Ga0496114_0011325 Ga0496114_0011325_4306_5220 299
1150 3300048917 Ga0496114_0269506 Ga0496114_0269506_137_1051 299
1151 3300048918 Ga0496115_0000295 Ga0496115_0000295_6024_6938 299
1152 3300048918 Ga0496115_0018198 Ga0496115_0018198_137_1051 299
1153 3300048918 Ga0496115_0076474 Ga0496115_0076474_238_1152 299
1154 3300048918 Ga0496115_0230402 Ga0496115_0230402_477_1484 299
1155 3300048920 Ga0496117_0196340 Ga0496117_0196340_73_993 299
1156 3300048922 Ga0496119_0062780 Ga0496119_0062780_1246_2166 299
1157 3300048922 Ga0496119_0135649 Ga0496119_0135649_284_1204 299
1158 3300048923 Ga0496120_0018821 Ga0496120_0018821_815_1741 299
1159 3300048924 Ga0496121_0001687 Ga0496121_0001687_13533_14444 299
1160 3300048924 Ga0496121_0003702 Ga0496121_0003702_10421_11335 299
1161 3300048924 Ga0496121_0022584 Ga0496121_0022584_1774_2715 299
1162 3300048924 Ga0496121_0024664 Ga0496121_0024664_3701_4621 299
1163 3300048924 Ga0496121_0031082 Ga0496121_0031082_347_1261 299
1164 3300048924 Ga0496121_0099032 Ga0496121_0099032_74_994 299
1165 3300048924 Ga0496121_0103994 Ga0496121_0103994_39_953 299
1166 3300048927 Ga0496124_0165082 Ga0496124_0165082_759_1673 299
1167 3300048927 Ga0496124_0226395 Ga0496124_0226395_348_1262 299
1168 3300048928 Ga0496125_0067186 Ga0496125_0067186_825_1745 299
1169 3300048928 Ga0496125_0074537 Ga0496125_0074537_1408_2328 299
1170 3300048928 Ga0496125_0086498 Ga0496125_0086498_437_1354 299
1171 3300048928 Ga0496125_0095367 Ga0496125_0095367_374_1294 299
1172 3300048929 Ga0496126_0005939 Ga0496126_0005939_1796_2707 299
1173 3300048929 Ga0496126_0007926 Ga0496126_0007926_4217_5131 299
1174 3300048929 Ga0496126_0093307 Ga0496126_0093307_1527_2447 299
1175 3300049568 Ga0501031_0002996 Ga0501031_0002996_3302_4225 299
1176 3300049569 Ga0501032_0004842 Ga0501032_0004842_8378_9301 299
1177 3300049570 Ga0501033_0002224 Ga0501033_0002224_3152_4066 299
1178 3300049570 Ga0501033_0057288 Ga0501033_0057288_573_1496 299
1179 3300049571 Ga0501034_0030135 Ga0501034_0030135_2929_3852 299
1180 3300049572 Ga0501036_0015708 Ga0501036_0015708_1423_2346 299
1181 3300049572 Ga0501036_0057168 Ga0501036_0057168_326_1240 299
1182 3300049573 Ga0501037_0001428 Ga0501037_0001428_891_1805 299
1183 3300049573 Ga0501037_0042850 Ga0501037_0042850_145_1068 299
1184 3300049575 Ga0501039_0096245 Ga0501039_0096245_463_1386 299
1185 3300049578 Ga0501042_0008268 Ga0501042_0008268_345_1259 299
1186 3300049579 Ga0501043_0001844 Ga0501043_0001844_14647_15561 299
1187 3300049580 Ga0501046_0156747 Ga0501046_0156747_689_1603 299
1188 3300049581 Ga0501047_0038030 Ga0501047_0038030_2484_3398 299
1189 3300049581 Ga0501047_0077943 Ga0501047_0077943_382_1296 299
1190 3300049583 Ga0501067_0035211 Ga0501067_0035211_1753_2667 299
1191 3300049585 Ga0501069_0180108 Ga0501069_0180108_185_1099 299
1192 3300049586 Ga0501070_0026912 Ga0501070_0026912_1422_2345 299
1193 3300049586 Ga0501070_0037271 Ga0501070_0037271_1551_2465 299
1194 3300049589 Ga0501073_0158480 Ga0501073_0158480_70_984 299
1195 3300049590 Ga0501074_0067059 Ga0501074_0067059_1483_2397 299
1196 3300049592 Ga0501076_0128311 Ga0501076_0128311_1025_1939 299
1197 3300049742 Ga0501080_0005201 Ga0501080_0005201_7032_7946 299
1198 3300049744 Ga0501083_0277349 Ga0501083_0277349_150_1064 299
1199 3300049822 Ga0501035_0007299 Ga0501035_0007299_1915_2829 299
1200 3300049823 Ga0501044_0007854 Ga0501044_0007854_7870_8784 299
1201 3300049823 Ga0501044_0534103 Ga0501044_0534103_137_1060 299
1202 3300050490 nmdc:mga03n38_33351_c1 nmdc:mga03n38_33351_c1_86_1000 299
1203 3300050491 nmdc:mga00v17_100632_c1 nmdc:mga00v17_100632_c1_422_1336 299
1204 3300050492 nmdc:mga0yw44_165167_c1 nmdc:mga0yw44_165167_c1_369_1289 299
1205 3300050492 nmdc:mga0yw44_20773_c1 nmdc:mga0yw44_20773_c1_315_1229 299
1206 3300050492 nmdc:mga0yw44_266741_c1 nmdc:mga0yw44_266741_c1_126_1067 299
1207 3300050492 nmdc:mga0yw44_32589_c1 nmdc:mga0yw44_32589_c1_397_1311 299
1208 3300050492 nmdc:mga0yw44_39874_c1 nmdc:mga0yw44_39874_c1_553_1467 299
1209 3300050493 nmdc:mga0k408_125211_c1 nmdc:mga0k408_125211_c1_188_1102 299
1210 3300050493 nmdc:mga0k408_165274_c1 nmdc:mga0k408_165274_c1_364_1278 299
1211 3300050493 nmdc:mga0k408_238923_c1 nmdc:mga0k408_238923_c1_104_1024 299
1212 3300050494 nmdc:mga06z11_132369_c1 nmdc:mga06z11_132369_c1_162_1076 299
1213 3300050495 nmdc:mga04h51_24381_c1 nmdc:mga04h51_24381_c1_366_1280 299
1214 3300050495 nmdc:mga04h51_48195_c1 nmdc:mga04h51_48195_c1_269_1189 299
1215 3300050496 nmdc:mga07m45_36090_c2 nmdc:mga07m45_36090_c2_888_1802 299
1216 3300050496 nmdc:mga07m45_6998_c1 nmdc:mga07m45_6998_c1_4295_5209 299
1217 3300050512 nmdc:mga0n895_130855_c1 nmdc:mga0n895_130855_c1_354_1268 299
1218 3300050514 nmdc:mga08x19_345771_c1 nmdc:mga08x19_345771_c1_10_924 299
1219 3300050516 nmdc:mga0sz30_60233_c1 nmdc:mga0sz30_60233_c1_615_1535 299
1220 3300053077 Ga0495601_0013434 Ga0495601_0013434_2293_3207 299
1221 3300053077 Ga0495601_0060208 Ga0495601_0060208_996_1910 299
1222 3300053077 Ga0495601_0157802 Ga0495601_0157802_124_1038 299
1223 3300053079 Ga0500610_0130389 Ga0500610_0130389_195_1115 299
1224 3300053080 Ga0500635_0005946 Ga0500635_0005946_2083_2997 299
1225 3300053084 Ga0495595_0000758 Ga0495595_0000758_11191_12105 299
1226 3300053084 Ga0495595_0028949 Ga0495595_0028949_1025_1939 299
1227 3300053085 Ga0495619_0000617 Ga0495619_0000617_18657_19571 299
1228 3300053086 Ga0500578_0170696 Ga0500578_0170696_35_955 299
1229 3300053087 Ga0500643_000168 Ga0500643_000168_63821_64747 299
1230 3300053091 Ga0500647_0056019 Ga0500647_0056019_352_1272 299
1231 3300053094 Ga0500566_0015378 Ga0500566_0015378_3306_4226 299
1232 3300053096 Ga0500641_0014207 Ga0500641_0014207_752_1666 299
1233 3300053102 Ga0500554_002374 Ga0500554_002374_1015_1929 299
1234 3300053103 Ga0500555_003167 Ga0500555_003167_1180_2106 299
1235 3300053105 Ga0500557_000032 Ga0500557_000032_52920_53840 299
1236 3300053108 Ga0500562_020004 Ga0500562_020004_794_1720 299
1237 3300053111 Ga0500572_009776 Ga0500572_009776_837_1751 299
1238 3300053119 Ga0500595_028598 Ga0500595_028598_535_1455 299
1239 3300053130 Ga0500642_0000183 Ga0500642_0000183_15531_16451 299
1240 3300053133 Ga0500655_009751 Ga0500655_009751_235_1161 299
1241 3300053136 Ga0500559_0001644 Ga0500559_0001644_10810_11724 299
1242 3300053136 Ga0500559_0004871 Ga0500559_0004871_993_1913 299
1243 3300053150 Ga0500603_000576 Ga0500603_000576_3939_4853 299
1244 3300053155 Ga0500620_038702 Ga0500620_038702_507_1427 299
1245 3300053156 Ga0500622_0008137 Ga0500622_0008137_221_1147 299
1246 3300053162 Ga0500638_152477 Ga0500638_152477_89_1009 299
1247 3300053177 Ga0500636_0000592 Ga0500636_0000592_2579_3499 299
1248 3300053177 Ga0500636_0009727 Ga0500636_0009727_469_1389 299
1249 3300053729 Ga0500625_000232 Ga0500625_000232_3825_4745 299
1250 3300053730 Ga0500645_007739 Ga0500645_007739_2727_3641 299
1251 3300053730 Ga0500645_016840 Ga0500645_016840_653_1579 299
1252 3300053731 Ga0500609_009207 Ga0500609_009207_395_1315 299
1253 3300053735 Ga0500596_003966 Ga0500596_003966_228_1142 299
1254 3300053737 Ga0500601_000888 Ga0500601_000888_1471_2391 299
1255 3300060353 Ga0501082_0417925 Ga0501082_0417925_70_984 299
1256 3300061734 Ga0530510_0315050 Ga0530510_0315050_71_985 299
1257 iso_pu_bacteria 2517093001 2517103118 299
1258 iso_pu_bacteria 2643221547 2643755027 299
1259 iso_pu_bacteria 2935630451 2935632812 299
1260 iso_pu_bacteria 2941507105 2941508524 299
1261 iso_pu_bacteria 2941515067 2941516354 299
1262 iso_pu_bacteria 2941523033 2941524630 299
1263 3300006028 Ga0070717_10032241 Ga0070717_100322412 300
1264 3300025917 Ga0207660_10145361 Ga0207660_101453611 300
1265 3300025928 Ga0207700_10015603 Ga0207700_100156032 300
1266 3300031247 Ga0265340_10068207 Ga0265340_100682072 300
1267 3300031344 Ga0265316_10159503 Ga0265316_101595032 300
1268 3300035086 Ga0373934_0006879 Ga0373934_0006879_1173_2075 300
1269 3300035117 Ga0373953_0007780 Ga0373953_0007780_1252_2154 300
1270 3300035118 Ga0373954_0037525 Ga0373954_0037525_155_1057 300
1271 3300035119 Ga0373956_0019212 Ga0373956_0019212_190_1092 300
1272 3300035120 Ga0373957_0004673 Ga0373957_0004673_911_1813 300
1273 3300035172 Ga0373955_0009253 Ga0373955_0009253_1539_2441 300
1274 3300036401 Ga0373937_0022299 Ga0373937_0022299_866_1768 300
1275 3300036401 Ga0373937_0053422 Ga0373937_0053422_782_1693 300
1276 3300037312 Ga0395899_0009278 Ga0395899_0009278_6003_6908 300
1277 3300037418 Ga0395900_0008470 Ga0395900_0008470_8381_9286 300
1278 3300037466 Ga0395898_0004229 Ga0395898_0004229_2063_2968 300
1279 3300044694 Ga0466963_0226495 Ga0466963_0226495_332_1234 300
1280 3300044842 Ga0466957_0173954 Ga0466957_0173954_449_1351 300
1281 3300046462 Ga0495651_0127727 Ga0495651_0127727_560_1471 300
1282 3300046514 Ga0495618_0242587 Ga0495618_0242587_31_942 300
1283 3300046533 Ga0495640_0120148 Ga0495640_0120148_410_1321 300
1284 3300046536 Ga0495587_0020301 Ga0495587_0020301_2003_2905 300
1285 3300046536 Ga0495587_0100858 Ga0495587_0100858_467_1378 300
1286 3300046559 Ga0495667_0013308 Ga0495667_0013308_3690_4592 300
1287 3300046559 Ga0495667_0035656 Ga0495667_0035656_1469_2380 300
1288 3300046675 Ga0495657_0017121 Ga0495657_0017121_3847_4749 300
1289 3300047317 Ga0495604_0075876 Ga0495604_0075876_288_1199 300
1290 3300047317 Ga0495604_0121326 Ga0495604_0121326_871_1773 300
1291 3300047319 Ga0495674_0030976 Ga0495674_0030976_853_1764 300
1292 3300047322 Ga0495680_0024601 Ga0495680_0024601_2551_3453 300
1293 3300047322 Ga0495680_0024704 Ga0495680_0024704_3904_4815 300
1294 3300048088 Ga0495602_0048324 Ga0495602_0048324_1647_2549 300
1295 3300053077 Ga0495601_0000347 Ga0495601_0000347_5910_6821 300
1296 3300053077 Ga0495601_0000946 Ga0495601_0000946_1698_2600 300
1297 3300053084 Ga0495595_0015410 Ga0495595_0015410_500_1411 300
1298 3300053085 Ga0495619_0000083 Ga0495619_0000083_26175_27086 300
1299 3300053085 Ga0495619_0012446 Ga0495619_0012446_1795_2697 300
1300 3300061734 Ga0530510_0024112 Ga0530510_0024112_1837_2757 300
1301 3300005434 Ga0070709_10014093 Ga0070709_100140934 301
1302 3300005437 Ga0070710_10095144 Ga0070710_100951442 301
1303 3300021384 Ga0213876_10027481 Ga0213876_100274812 301
1304 3300025898 Ga0207692_10025398 Ga0207692_100253982 301
1305 3300031241 Ga0265325_10000030 Ga0265325_1000003063 301
1306 3300031247 Ga0265340_10069793 Ga0265340_100697932 301
1307 3300031247 Ga0265340_10070799 Ga0265340_100707992 301
1308 3300031595 Ga0265313_10005929 Ga0265313_100059299 301
1309 3300032133 Ga0316583_10001485 Ga0316583_100014852 301
1310 3300035117 Ga0373953_0081173 Ga0373953_0081173_335_1240 301
1311 3300035119 Ga0373956_0050946 Ga0373956_0050946_407_1312 301
1312 3300035170 Ga0373943_0010318 Ga0373943_0010318_1670_2575 301
1313 3300035172 Ga0373955_0002139 Ga0373955_0002139_1759_2664 301
1314 3300035410 Ga0373924_0014039 Ga0373924_0014039_340_1245 301
1315 3300035695 Ga0373927_0049781 Ga0373927_0049781_205_1110 301
1316 3300035724 Ga0373933_0036074 Ga0373933_0036074_1477_2382 301
1317 3300036401 Ga0373937_0032052 Ga0373937_0032052_2722_3627 301
1318 3300037068 Ga0373925_0023355 Ga0373925_0023355_2758_3663 301
1319 3300046454 Ga0495592_0008094 Ga0495592_0008094_6006_6911 301
1320 3300046462 Ga0495651_0090115 Ga0495651_0090115_339_1244 301
1321 3300046516 Ga0495628_0011769 Ga0495628_0011769_954_1859 301
1322 3300046529 Ga0495652_0010453 Ga0495652_0010453_2936_3841 301
1323 3300046536 Ga0495587_0087729 Ga0495587_0087729_445_1350 301
1324 3300046543 Ga0495645_0003334 Ga0495645_0003334_1808_2713 301
1325 3300046559 Ga0495667_0001880 Ga0495667_0001880_9395_10300 301
1326 3300046663 Ga0495635_0114367 Ga0495635_0114367_904_1809 301
1327 3300046675 Ga0495657_0174238 Ga0495657_0174238_350_1255 301
1328 3300046678 Ga0495599_0006442 Ga0495599_0006442_856_1761 301
1329 3300046679 Ga0495623_0028685 Ga0495623_0028685_1609_2514 301
1330 3300046809 Ga0495600_0086189 Ga0495600_0086189_1089_1994 301
1331 3300047317 Ga0495604_0003605 Ga0495604_0003605_6704_7609 301
1332 3300047322 Ga0495680_0002772 Ga0495680_0002772_14259_15164 301
1333 3300047444 Ga0495675_0087197 Ga0495675_0087197_897_1802 301
1334 3300048088 Ga0495602_0031862 Ga0495602_0031862_1748_2653 301
1335 3300048907 Ga0496104_0000065 Ga0496104_0000065_57535_58440 301
1336 3300048907 Ga0496104_0144029 Ga0496104_0144029_590_1534 301
1337 3300048908 Ga0496105_0000338 Ga0496105_0000338_7289_8194 301
1338 3300048912 Ga0496109_0213887 Ga0496109_0213887_64_1008 301
1339 3300048918 Ga0496115_0329554 Ga0496115_0329554_190_1095 301
1340 3300053077 Ga0495601_0000111 Ga0495601_0000111_2793_3698 301
1341 3300053078 Ga0495612_0001438 Ga0495612_0001438_1872_2777 301
1342 3300053084 Ga0495595_0000587 Ga0495595_0000587_3609_4514 301
1343 3300053085 Ga0495619_0000296 Ga0495619_0000296_8433_9338 301
1344 3300005434 Ga0070709_10002761 Ga0070709_100027613 302
1345 3300005435 Ga0070714_100008916 Ga0070714_1000089161 302
1346 3300005436 Ga0070713_100000399 Ga0070713_10000039916 302
1347 3300005436 Ga0070713_100193756 Ga0070713_1001937562 302
1348 3300005437 Ga0070710_10039926 Ga0070710_100399263 302
1349 3300005439 Ga0070711_100056042 Ga0070711_1000560423 302
1350 3300006163 Ga0070715_10001341 Ga0070715_100013413 302
1351 3300006175 Ga0070712_100014542 Ga0070712_1000145423 302
1352 3300009147 Ga0114129_10344682 Ga0114129_103446822 302
1353 3300025905 Ga0207685_10021771 Ga0207685_100217713 302
1354 3300025906 Ga0207699_10008397 Ga0207699_100083973 302
1355 3300025915 Ga0207693_10052221 Ga0207693_100522213 302
1356 3300025916 Ga0207663_10000486 Ga0207663_100004863 302
1357 3300025928 Ga0207700_10002081 Ga0207700_100020817 302
1358 3300025929 Ga0207664_10012679 Ga0207664_100126796 302
1359 3300025929 Ga0207664_10496495 Ga0207664_104964952 302
1360 3300025939 Ga0207665_10016785 Ga0207665_100167853 302
1361 3300034818 Ga0373950_0002852 Ga0373950_0002852_1354_2262 302
1362 3300035695 Ga0373927_0272536 Ga0373927_0272536_48_1061 302
1363 3300035725 Ga0373947_0011238 Ga0373947_0011238_3949_4869 302
1364 3300037068 Ga0373925_0352427 Ga0373925_0352427_93_1106 302
1365 3300039437 Ga0436365_0291314 Ga0436365_0291314_2509_3453 302
1366 3300039437 Ga0436365_0759284 Ga0436365_0759284_549_1496 302
1367 3300046462 Ga0495651_0079310 Ga0495651_0079310_1486_2409 302
1368 3300046499 Ga0495594_0247000 Ga0495594_0247000_47_967 302
1369 3300046514 Ga0495618_0185643 Ga0495618_0185643_192_1139 302
1370 3300046526 Ga0495666_0081772 Ga0495666_0081772_388_1308 302
1371 3300046536 Ga0495587_0241562 Ga0495587_0241562_42_989 302
1372 3300046642 Ga0495634_0129721 Ga0495634_0129721_25_945 302
1373 3300046689 Ga0495613_0187711 Ga0495613_0187711_120_1040 302
1374 3300046690 Ga0495624_0065072 Ga0495624_0065072_665_1585 302
1375 3300047319 Ga0495674_0008197 Ga0495674_0008197_1998_2918 302
1376 3300047322 Ga0495680_0154704 Ga0495680_0154704_24_971 302
1377 3300048910 Ga0496107_0099528 Ga0496107_0099528_758_1723 302
1378 3300048913 Ga0496110_0257349 Ga0496110_0257349_176_1123 302
1379 3300048915 Ga0496112_0596501 Ga0496112_0596501_61_1008 302
1380 3300048918 Ga0496115_0215397 Ga0496115_0215397_511_1500 302
1381 3300049571 Ga0501034_0000295 Ga0501034_0000295_84714_85658 302
1382 3300049571 Ga0501034_0000772 Ga0501034_0000772_15949_16893 302
1383 3300049571 Ga0501034_0040486 Ga0501034_0040486_3534_4478 302
1384 3300049571 Ga0501034_0049417 Ga0501034_0049417_2726_3670 302
1385 3300049572 Ga0501036_0000331 Ga0501036_0000331_6105_7049 302
1386 3300049572 Ga0501036_0030837 Ga0501036_0030837_370_1314 302
1387 3300049573 Ga0501037_0023340 Ga0501037_0023340_1389_2333 302
1388 3300049573 Ga0501037_0043750 Ga0501037_0043750_1596_2540 302
1389 3300049573 Ga0501037_0064326 Ga0501037_0064326_1614_2558 302
1390 3300049573 Ga0501037_0067329 Ga0501037_0067329_1551_2459 302
1391 3300049575 Ga0501039_0123188 Ga0501039_0123188_334_1278 302
1392 3300049578 Ga0501042_0372384 Ga0501042_0372384_78_1022 302
1393 3300049579 Ga0501043_0003336 Ga0501043_0003336_10106_11050 302
1394 3300049579 Ga0501043_0008689 Ga0501043_0008689_3854_4798 302
1395 3300049579 Ga0501043_0026869 Ga0501043_0026869_679_1623 302
1396 3300049580 Ga0501046_0124288 Ga0501046_0124288_799_1743 302
1397 3300049581 Ga0501047_0024878 Ga0501047_0024878_4195_5139 302
1398 3300049581 Ga0501047_0060399 Ga0501047_0060399_879_1823 302
1399 3300049581 Ga0501047_0390827 Ga0501047_0390827_154_1062 302
1400 3300049581 Ga0501047_0420749 Ga0501047_0420749_16_960 302
1401 3300049582 Ga0501048_0002157 Ga0501048_0002157_12867_13811 302
1402 3300049582 Ga0501048_0168602 Ga0501048_0168602_495_1478 302
1403 3300049584 Ga0501068_0056457 Ga0501068_0056457_589_1533 302
1404 3300049586 Ga0501070_0014900 Ga0501070_0014900_3415_4359 302
1405 3300049586 Ga0501070_0336501 Ga0501070_0336501_117_1061 302
1406 3300049589 Ga0501073_0018625 Ga0501073_0018625_2672_3616 302
1407 3300049589 Ga0501073_0022099 Ga0501073_0022099_3575_4546 302
1408 3300049590 Ga0501074_0047785 Ga0501074_0047785_553_1497 302
1409 3300049590 Ga0501074_0048678 Ga0501074_0048678_998_1942 302
1410 3300049593 Ga0501077_0156248 Ga0501077_0156248_148_1092 302
1411 3300049742 Ga0501080_0030702 Ga0501080_0030702_4021_4965 302
1412 3300049742 Ga0501080_0053747 Ga0501080_0053747_572_1516 302
1413 3300049742 Ga0501080_0133442 Ga0501080_0133442_104_1048 302
1414 3300049742 Ga0501080_0186440 Ga0501080_0186440_914_1897 302
1415 3300049744 Ga0501083_0031513 Ga0501083_0031513_1554_2498 302
1416 3300049744 Ga0501083_0072454 Ga0501083_0072454_534_1517 302
1417 3300049744 Ga0501083_0190012 Ga0501083_0190012_198_1142 302
1418 3300049822 Ga0501035_0083899 Ga0501035_0083899_117_1100 302
1419 3300049822 Ga0501035_0364180 Ga0501035_0364180_189_1097 302
1420 3300049823 Ga0501044_0017342 Ga0501044_0017342_6207_7151 302
1421 3300049823 Ga0501044_0271456 Ga0501044_0271456_572_1555 302
1422 3300050515 nmdc:mga0a205_398835_c1 nmdc:mga0a205_398835_c1_53_1018 302
1423 3300053077 Ga0495601_0004646 Ga0495601_0004646_4473_5393 302
1424 3300053078 Ga0495612_0065498 Ga0495612_0065498_535_1482 302
1425 3300053084 Ga0495595_0043394 Ga0495595_0043394_586_1533 302
1426 3300053093 Ga0500651_0007251 Ga0500651_0007251_4620_5540 302
1427 3300053119 Ga0500595_000003 Ga0500595_000003_281041_281949 302
1428 3300053153 Ga0500616_0000002 Ga0500616_0000002_1472464_1473444 302
1429 3300053730 Ga0500645_000675 Ga0500645_000675_14487_15407 302
1430 3300060353 Ga0501082_0235527 Ga0501082_0235527_133_1041 302
1431 2209111006 2214775796 2213796913 303
1432 3300000041 ARcpr5oldR_c000014 ARcpr5oldR_00001413 303
1433 3300000042 ARSoilYngRDRAFT_c00094 ARSoilYngRDRAFT_0009410 303
1434 3300000043 ARcpr5yngRDRAFT_c000058 ARcpr5yngRDRAFT_0000584 303
1435 3300000044 ARSoilOldRDRAFT_c000007 ARSoilOldRDRAFT_00000737 303
1436 3300000045 ARCol0oldRDRAFT_c00221 ARCol0oldRDRAFT_002213 303
1437 3300000652 ARCol0yngRDRAFT_1000009 ARCol0yngRDRAFT_100000920 303
1438 3300001430 JGI24032J14994_100677 JGI24032J14994_1006772 303
1439 3300001915 JGI24741J21665_1011668 JGI24741J21665_10116682 303
1440 3300001976 JGI24752J21851_1002204 JGI24752J21851_10022042 303
1441 3300001978 JGI24747J21853_1001137 JGI24747J21853_10011372 303
1442 3300001989 JGI24739J22299_10010412 JGI24739J22299_100104122 303
1443 3300001990 JGI24737J22298_10021581 JGI24737J22298_100215812 303
1444 3300002070 JGI24750J21931_1000699 JGI24750J21931_10006992 303
1445 3300002073 JGI24745J21846_1000166 JGI24745J21846_10001662 303
1446 3300002075 JGI24738J21930_10001608 JGI24738J21930_100016084 303
1447 3300002076 JGI24749J21850_1005910 JGI24749J21850_10059102 303
1448 3300002077 JGI24744J21845_10011953 JGI24744J21845_100119532 303
1449 3300002126 JGI24035J26624_1002415 JGI24035J26624_10024152 303
1450 3300002155 JGI24033J26618_1000651 JGI24033J26618_10006512 303
1451 3300002239 JGI24034J26672_10004455 JGI24034J26672_100044552 303
1452 3300002244 JGI24742J22300_10006743 JGI24742J22300_100067432 303
1453 3300002459 JGI24751J29686_10019326 JGI24751J29686_100193261 303
1454 3300005276 Ga0065717_1003292 Ga0065717_10032921 303
1455 3300005288 Ga0065714_10115997 Ga0065714_101159971 303
1456 3300005289 Ga0065704_10019537 Ga0065704_100195372 303
1457 3300005290 Ga0065712_10001073 Ga0065712_100010733 303
1458 3300005290 Ga0065712_10136646 Ga0065712_101366462 303
1459 3300005293 Ga0065715_10005375 Ga0065715_100053752 303
1460 3300005293 Ga0065715_10108905 Ga0065715_101089052 303
1461 3300005295 Ga0065707_10162208 Ga0065707_101622081 303
1462 3300005327 Ga0070658_10029096 Ga0070658_100290962 303
1463 3300005328 Ga0070676_10010461 Ga0070676_100104612 303
1464 3300005330 Ga0070690_100011006 Ga0070690_1000110063 303
1465 3300005331 Ga0070670_100012145 Ga0070670_1000121456 303
1466 3300005331 Ga0070670_100135211 Ga0070670_1001352111 303
1467 3300005333 Ga0070677_10000731 Ga0070677_1000073111 303
1468 3300005334 Ga0068869_100015435 Ga0068869_1000154352 303
1469 3300005335 Ga0070666_10024658 Ga0070666_100246582 303
1470 3300005335 Ga0070666_10128387 Ga0070666_101283871 303
1471 3300005336 Ga0070680_100019249 Ga0070680_1000192492 303
1472 3300005336 Ga0070680_100165630 Ga0070680_1001656302 303
1473 3300005337 Ga0070682_100013849 Ga0070682_1000138492 303
1474 3300005338 Ga0068868_100056620 Ga0068868_1000566202 303
1475 3300005339 Ga0070660_100001770 Ga0070660_1000017702 303
1476 3300005340 Ga0070689_100031509 Ga0070689_1000315095 303
1477 3300005340 Ga0070689_100122632 Ga0070689_1001226322 303
1478 3300005341 Ga0070691_10004889 Ga0070691_100048893 303
1479 3300005343 Ga0070687_100005741 Ga0070687_1000057412 303
1480 3300005344 Ga0070661_100025157 Ga0070661_1000251572 303
1481 3300005345 Ga0070692_10006550 Ga0070692_100065502 303
1482 3300005347 Ga0070668_100001862 Ga0070668_1000018629 303
1483 3300005353 Ga0070669_100002311 Ga0070669_10000231114 303
1484 3300005354 Ga0070675_100026314 Ga0070675_1000263142 303
1485 3300005355 Ga0070671_100027221 Ga0070671_1000272212 303
1486 3300005355 Ga0070671_100029720 Ga0070671_1000297202 303
1487 3300005356 Ga0070674_100062573 Ga0070674_1000625733 303
1488 3300005364 Ga0070673_100012367 Ga0070673_1000123674 303
1489 3300005366 Ga0070659_100002966 Ga0070659_10000296611 303
1490 3300005435 Ga0070714_100048021 Ga0070714_1000480213 303
1491 3300005435 Ga0070714_100093694 Ga0070714_1000936942 303
1492 3300005435 Ga0070714_100102386 Ga0070714_1001023862 303
1493 3300005436 Ga0070713_100002808 Ga0070713_1000028082 303
1494 3300005436 Ga0070713_100073833 Ga0070713_1000738331 303
1495 3300005437 Ga0070710_10036514 Ga0070710_100365142 303
1496 3300005439 Ga0070711_100006842 Ga0070711_1000068427 303
1497 3300005439 Ga0070711_100009346 Ga0070711_1000093463 303
1498 3300005439 Ga0070711_100145021 Ga0070711_1001450211 303
1499 3300005440 Ga0070705_100007363 Ga0070705_1000073632 303
1500 3300005441 Ga0070700_100012996 Ga0070700_1000129962 303
1501 3300005455 Ga0070663_100123894 Ga0070663_1001238942 303
1502 3300005456 Ga0070678_100014938 Ga0070678_1000149382 303
1503 3300005456 Ga0070678_100017054 Ga0070678_1000170542 303
1504 3300005458 Ga0070681_10006388 Ga0070681_1000638810 303
1505 3300005458 Ga0070681_10249245 Ga0070681_102492452 303
1506 3300005459 Ga0068867_100016521 Ga0068867_1000165212 303
1507 3300005530 Ga0070679_100033931 Ga0070679_1000339312 303
1508 3300005535 Ga0070684_100029086 Ga0070684_1000290862 303
1509 3300005536 Ga0070697_100177098 Ga0070697_1001770982 303
1510 3300005539 Ga0068853_100030191 Ga0068853_1000301912 303
1511 3300005543 Ga0070672_100002208 Ga0070672_10000220811 303
1512 3300005544 Ga0070686_100129660 Ga0070686_1001296602 303
1513 3300005545 Ga0070695_100000800 Ga0070695_1000008003 303
1514 3300005546 Ga0070696_100026211 Ga0070696_1000262112 303
1515 3300005546 Ga0070696_100063701 Ga0070696_1000637013 303
1516 3300005547 Ga0070693_100010396 Ga0070693_1000103962 303
1517 3300005548 Ga0070665_100059233 Ga0070665_1000592332 303
1518 3300005563 Ga0068855_100054636 Ga0068855_1000546362 303
1519 3300005563 Ga0068855_100599507 Ga0068855_1005995071 303
1520 3300005564 Ga0070664_100018373 Ga0070664_1000183734 303
1521 3300005564 Ga0070664_100066777 Ga0070664_1000667773 303
1522 3300005564 Ga0070664_100102414 Ga0070664_1001024142 303
1523 3300005577 Ga0068857_100000616 Ga0068857_10000061628 303
1524 3300005578 Ga0068854_100043694 Ga0068854_1000436943 303
1525 3300005578 Ga0068854_100185442 Ga0068854_1001854422 303
1526 3300005614 Ga0068856_100002724 Ga0068856_1000027242 303
1527 3300005614 Ga0068856_100511607 Ga0068856_1005116072 303
1528 3300005615 Ga0070702_100010977 Ga0070702_1000109772 303
1529 3300005616 Ga0068852_100011772 Ga0068852_1000117723 303
1530 3300005617 Ga0068859_100065834 Ga0068859_1000658343 303
1531 3300005617 Ga0068859_100243352 Ga0068859_1002433522 303
1532 3300005617 Ga0068859_100678183 Ga0068859_1006781832 303
1533 3300005618 Ga0068864_100022002 Ga0068864_1000220025 303
1534 3300005618 Ga0068864_100024791 Ga0068864_1000247912 303
1535 3300005840 Ga0068870_10008285 Ga0068870_100082852 303
1536 3300005841 Ga0068863_100001280 Ga0068863_1000012802 303
1537 3300005841 Ga0068863_100206995 Ga0068863_1002069952 303
1538 3300005842 Ga0068858_100025278 Ga0068858_1000252782 303
1539 3300005842 Ga0068858_100052822 Ga0068858_1000528224 303
1540 3300005843 Ga0068860_100026148 Ga0068860_1000261483 303
1541 3300005844 Ga0068862_100003249 Ga0068862_1000032492 303
1542 3300005844 Ga0068862_100080069 Ga0068862_1000800692 303
1543 3300005937 Ga0081455_10008343 Ga0081455_100083433 303
1544 3300006028 Ga0070717_10000998 Ga0070717_1000099810 303
1545 3300006058 Ga0075432_10000490 Ga0075432_100004905 303
1546 3300006163 Ga0070715_10015189 Ga0070715_100151892 303
1547 3300006173 Ga0070716_100010682 Ga0070716_1000106822 303
1548 3300006175 Ga0070712_100112939 Ga0070712_1001129392 303
1549 3300006178 Ga0075367_10017648 Ga0075367_100176482 303
1550 3300006194 Ga0075427_10000547 Ga0075427_100005474 303
1551 3300006237 Ga0097621_100013700 Ga0097621_1000137003 303
1552 3300006237 Ga0097621_100050975 Ga0097621_1000509752 303
1553 3300006358 Ga0068871_100002047 Ga0068871_1000020472 303
1554 3300006358 Ga0068871_100009147 Ga0068871_1000091476 303
1555 3300006844 Ga0075428_100003603 Ga0075428_1000036039 303
1556 3300006846 Ga0075430_100003714 Ga0075430_1000037149 303
1557 3300006847 Ga0075431_100003725 Ga0075431_1000037254 303
1558 3300006852 Ga0075433_10000029 Ga0075433_1000002955 303
1559 3300006852 Ga0075433_10068698 Ga0075433_100686983 303
1560 3300006871 Ga0075434_100002137 Ga0075434_1000021373 303
1561 3300006871 Ga0075434_100002244 Ga0075434_1000022449 303
1562 3300006871 Ga0075434_100038251 Ga0075434_1000382514 303
1563 3300006871 Ga0075434_100056362 Ga0075434_1000563622 303
1564 3300006871 Ga0075434_100568777 Ga0075434_1005687772 303
1565 3300006880 Ga0075429_100002021 Ga0075429_1000020216 303
1566 3300006881 Ga0068865_100017000 Ga0068865_1000170002 303
1567 3300006914 Ga0075436_100221423 Ga0075436_1002214232 303
1568 3300006931 Ga0097620_100065832 Ga0097620_1000658323 303
1569 3300006931 Ga0097620_100243334 Ga0097620_1002433342 303
1570 3300006931 Ga0097620_100678273 Ga0097620_1006782732 303
1571 3300007076 Ga0075435_100001612 Ga0075435_1000016122 303
1572 3300007076 Ga0075435_100052635 Ga0075435_1000526352 303
1573 3300007076 Ga0075435_100086197 Ga0075435_1000861972 303
1574 3300007076 Ga0075435_100107854 Ga0075435_1001078543 303
1575 3300009011 Ga0105251_10064341 Ga0105251_100643412 303
1576 3300009036 Ga0105244_10069538 Ga0105244_100695382 303
1577 3300009093 Ga0105240_10284374 Ga0105240_102843742 303
1578 3300009094 Ga0111539_10000345 Ga0111539_1000034557 303
1579 3300009094 Ga0111539_10001931 Ga0111539_100019313 303
1580 3300009094 Ga0111539_10002122 Ga0111539_100021223 303
1581 3300009094 Ga0111539_10060686 Ga0111539_100606862 303
1582 3300009098 Ga0105245_10251474 Ga0105245_102514742 303
1583 3300009098 Ga0105245_10270738 Ga0105245_102707382 303
1584 3300009101 Ga0105247_10002880 Ga0105247_100028807 303
1585 3300009147 Ga0114129_10037724 Ga0114129_100377243 303
1586 3300009147 Ga0114129_10054577 Ga0114129_100545773 303
1587 3300009174 Ga0105241_10017075 Ga0105241_100170752 303
1588 3300009174 Ga0105241_10060338 Ga0105241_100603382 303
1589 3300009176 Ga0105242_10007716 Ga0105242_100077162 303
1590 3300009177 Ga0105248_10051698 Ga0105248_100516984 303
1591 3300009177 Ga0105248_10084972 Ga0105248_100849722 303
1592 3300009177 Ga0105248_10098149 Ga0105248_100981494 303
1593 3300009551 Ga0105238_10031282 Ga0105238_100312822 303
1594 3300009553 Ga0105249_10016757 Ga0105249_100167573 303
1595 3300009553 Ga0105249_10017803 Ga0105249_100178035 303
1596 3300009553 Ga0105249_10089982 Ga0105249_100899823 303
1597 3300010375 Ga0105239_10041141 Ga0105239_100411413 303
1598 3300010375 Ga0105239_10057236 Ga0105239_100572362 303
1599 3300010375 Ga0105239_10369100 Ga0105239_103691002 303
1600 3300011119 Ga0105246_10009048 Ga0105246_100090482 303
1601 3300011119 Ga0105246_10242021 Ga0105246_102420211 303
1602 3300011119 Ga0105246_10538887 Ga0105246_105388871 303
1603 3300012503 Ga0157313_1000825 Ga0157313_10008251 303
1604 3300013100 Ga0157373_10188271 Ga0157373_101882712 303
1605 3300013102 Ga0157371_10026432 Ga0157371_100264322 303
1606 3300013102 Ga0157371_10103174 Ga0157371_101031742 303
1607 3300013104 Ga0157370_10083427 Ga0157370_100834272 303
1608 3300013297 Ga0157378_10015501 Ga0157378_100155012 303
1609 3300013297 Ga0157378_10111506 Ga0157378_101115062 303
1610 3300013297 Ga0157378_10332038 Ga0157378_103320382 303
1611 3300013306 Ga0163162_10004233 Ga0163162_100042332 303
1612 3300013306 Ga0163162_10346785 Ga0163162_103467851 303
1613 3300013307 Ga0157372_10023476 Ga0157372_100234762 303
1614 3300013308 Ga0157375_10004079 Ga0157375_100040792 303
1615 3300013308 Ga0157375_10266806 Ga0157375_102668061 303
1616 3300014325 Ga0163163_10038355 Ga0163163_100383553 303
1617 3300014325 Ga0163163_10063499 Ga0163163_100634992 303
1618 3300014325 Ga0163163_10214532 Ga0163163_102145322 303
1619 3300014745 Ga0157377_10005595 Ga0157377_100055952 303
1620 3300014968 Ga0157379_10019419 Ga0157379_100194193 303
1621 3300014968 Ga0157379_10047425 Ga0157379_100474252 303
1622 3300014968 Ga0157379_10344951 Ga0157379_103449512 303
1623 3300014969 Ga0157376_10045995 Ga0157376_100459952 303
1624 3300017792 Ga0163161_10003992 Ga0163161_100039922 303
1625 3300017792 Ga0163161_10129022 Ga0163161_101290222 303
1626 3300017792 Ga0163161_10174870 Ga0163161_101748702 303
1627 3300020070 Ga0206356_11266266 Ga0206356_112662666 303
1628 3300025290 Ga0207673_1000001 Ga0207673_100000131 303
1629 3300025893 Ga0207682_10000254 Ga0207682_100002546 303
1630 3300025898 Ga0207692_10070524 Ga0207692_100705242 303
1631 3300025900 Ga0207710_10010813 Ga0207710_100108133 303
1632 3300025900 Ga0207710_10014720 Ga0207710_100147202 303
1633 3300025900 Ga0207710_10057463 Ga0207710_100574632 303
1634 3300025901 Ga0207688_10000518 Ga0207688_100005183 303
1635 3300025903 Ga0207680_10088009 Ga0207680_100880092 303
1636 3300025904 Ga0207647_10012374 Ga0207647_100123742 303
1637 3300025907 Ga0207645_10000249 Ga0207645_1000024945 303
1638 3300025908 Ga0207643_10000978 Ga0207643_1000097814 303
1639 3300025911 Ga0207654_10017523 Ga0207654_100175232 303
1640 3300025912 Ga0207707_10016918 Ga0207707_100169183 303
1641 3300025912 Ga0207707_10036558 Ga0207707_100365582 303
1642 3300025912 Ga0207707_10110818 Ga0207707_101108182 303
1643 3300025912 Ga0207707_10286287 Ga0207707_102862871 303
1644 3300025913 Ga0207695_10200231 Ga0207695_102002312 303
1645 3300025914 Ga0207671_10205156 Ga0207671_102051562 303
1646 3300025915 Ga0207693_10001489 Ga0207693_100014898 303
1647 3300025915 Ga0207693_10042947 Ga0207693_100429473 303
1648 3300025916 Ga0207663_10012940 Ga0207663_100129404 303
1649 3300025916 Ga0207663_10152537 Ga0207663_101525372 303
1650 3300025917 Ga0207660_10001490 Ga0207660_1000149016 303
1651 3300025918 Ga0207662_10076038 Ga0207662_100760383 303
1652 3300025919 Ga0207657_10217252 Ga0207657_102172522 303
1653 3300025920 Ga0207649_10006897 Ga0207649_100068972 303
1654 3300025921 Ga0207652_10045557 Ga0207652_100455572 303
1655 3300025921 Ga0207652_10226959 Ga0207652_102269592 303
1656 3300025923 Ga0207681_10000956 Ga0207681_100009563 303
1657 3300025925 Ga0207650_10030055 Ga0207650_100300554 303
1658 3300025925 Ga0207650_10074218 Ga0207650_100742182 303
1659 3300025926 Ga0207659_10006156 Ga0207659_100061566 303
1660 3300025927 Ga0207687_10017120 Ga0207687_100171202 303
1661 3300025927 Ga0207687_10230891 Ga0207687_102308912 303
1662 3300025927 Ga0207687_10403339 Ga0207687_104033392 303
1663 3300025929 Ga0207664_10037810 Ga0207664_100378103 303
1664 3300025929 Ga0207664_10048501 Ga0207664_100485012 303
1665 3300025931 Ga0207644_10015163 Ga0207644_100151632 303
1666 3300025931 Ga0207644_10018487 Ga0207644_100184872 303
1667 3300025931 Ga0207644_10033779 Ga0207644_100337792 303
1668 3300025932 Ga0207690_10000546 Ga0207690_1000054624 303
1669 3300025932 Ga0207690_10165952 Ga0207690_101659522 303
1670 3300025932 Ga0207690_10493916 Ga0207690_104939161 303
1671 3300025933 Ga0207706_10020138 Ga0207706_100201385 303
1672 3300025933 Ga0207706_10126312 Ga0207706_101263122 303
1673 3300025934 Ga0207686_10007493 Ga0207686_100074933 303
1674 3300025935 Ga0207709_10005105 Ga0207709_100051055 303
1675 3300025936 Ga0207670_10002637 Ga0207670_100026373 303
1676 3300025936 Ga0207670_10056573 Ga0207670_100565732 303
1677 3300025936 Ga0207670_10084579 Ga0207670_100845792 303
1678 3300025937 Ga0207669_10002362 Ga0207669_100023622 303
1679 3300025938 Ga0207704_10000964 Ga0207704_1000096410 303
1680 3300025938 Ga0207704_10098483 Ga0207704_100984832 303
1681 3300025939 Ga0207665_10002530 Ga0207665_100025308 303
1682 3300025940 Ga0207691_10001481 Ga0207691_1000148110 303
1683 3300025941 Ga0207711_10023845 Ga0207711_100238452 303
1684 3300025941 Ga0207711_10094808 Ga0207711_100948082 303
1685 3300025942 Ga0207689_10000424 Ga0207689_1000042415 303
1686 3300025942 Ga0207689_10087700 Ga0207689_100877002 303
1687 3300025944 Ga0207661_10001905 Ga0207661_100019055 303
1688 3300025944 Ga0207661_10028196 Ga0207661_100281962 303
1689 3300025945 Ga0207679_10000595 Ga0207679_1000059516 303
1690 3300025949 Ga0207667_10058089 Ga0207667_100580894 303
1691 3300025949 Ga0207667_10064756 Ga0207667_100647562 303
1692 3300025960 Ga0207651_10020112 Ga0207651_100201122 303
1693 3300025961 Ga0207712_10018492 Ga0207712_100184922 303
1694 3300025961 Ga0207712_10023939 Ga0207712_100239392 303
1695 3300025961 Ga0207712_10121382 Ga0207712_101213822 303
1696 3300025972 Ga0207668_10006840 Ga0207668_100068403 303
1697 3300025981 Ga0207640_10007609 Ga0207640_100076092 303
1698 3300025981 Ga0207640_10023862 Ga0207640_100238622 303
1699 3300025986 Ga0207658_10020702 Ga0207658_100207022 303
1700 3300025986 Ga0207658_10067626 Ga0207658_100676262 303
1701 3300026023 Ga0207677_10032859 Ga0207677_100328592 303
1702 3300026035 Ga0207703_10035107 Ga0207703_100351072 303
1703 3300026041 Ga0207639_10006156 Ga0207639_100061562 303
1704 3300026067 Ga0207678_10059424 Ga0207678_100594242 303
1705 3300026078 Ga0207702_10043737 Ga0207702_100437372 303
1706 3300026088 Ga0207641_10024879 Ga0207641_100248792 303
1707 3300026089 Ga0207648_10001553 Ga0207648_1000155315 303
1708 3300026095 Ga0207676_10013306 Ga0207676_100133062 303
1709 3300026121 Ga0207683_10011960 Ga0207683_100119603 303
1710 3300026121 Ga0207683_10016218 Ga0207683_100162182 303
1711 3300026121 Ga0207683_10030540 Ga0207683_100305402 303
1712 3300026142 Ga0207698_10001038 Ga0207698_1000103811 303
1713 3300027364 Ga0209967_1007987 Ga0209967_10079872 303
1714 3300027526 Ga0209968_1006106 Ga0209968_10061063 303
1715 3300027552 Ga0209982_1004320 Ga0209982_10043202 303
1716 3300027614 Ga0209970_1005990 Ga0209970_10059902 303
1717 3300027695 Ga0209966_1003959 Ga0209966_10039592 303
1718 3300027717 Ga0209998_10002627 Ga0209998_100026272 303
1719 3300027876 Ga0209974_10006301 Ga0209974_100063012 303
1720 3300027907 Ga0207428_10000150 Ga0207428_1000015065 303
1721 3300027907 Ga0207428_10000360 Ga0207428_1000036057 303
1722 3300027907 Ga0207428_10001312 Ga0207428_1000131226 303
1723 3300027907 Ga0207428_10036448 Ga0207428_100364485 303
1724 3300028379 Ga0268266_10011617 Ga0268266_100116177 303
1725 3300028380 Ga0268265_10011427 Ga0268265_100114272 303
1726 3300028381 Ga0268264_10004770 Ga0268264_100047703 303
1727 3300028800 Ga0265338_10085973 Ga0265338_100859732 303
1728 3300031235 Ga0265330_10025682 Ga0265330_100256822 303
1729 3300031247 Ga0265340_10144623 Ga0265340_101446231 303
1730 3300031712 Ga0265342_10046678 Ga0265342_100466782 303
1731 3300034816 Ga0373930_0001257 Ga0373930_0001257_2275_3186 303
1732 3300034817 Ga0373948_0000908 Ga0373948_0000908_1043_1954 303
1733 3300034819 Ga0373958_0000355 Ga0373958_0000355_1382_2293 303
1734 3300034820 Ga0373959_0000802 Ga0373959_0000802_65_976 303
1735 3300034957 Ga0373938_0000819 Ga0373938_0000819_244_1155 303
1736 3300034957 Ga0373938_0004439 Ga0373938_0004439_1384_2295 303
1737 3300035083 Ga0373926_0014919 Ga0373926_0014919_1659_2585 303
1738 3300035084 Ga0373928_0004165 Ga0373928_0004165_1781_2692 303
1739 3300035085 Ga0373929_0000724 Ga0373929_0000724_4226_5137 303
1740 3300035085 Ga0373929_0001327 Ga0373929_0001327_3403_4314 303
1741 3300035085 Ga0373929_0008227 Ga0373929_0008227_956_1888 303
1742 3300035088 Ga0373940_0000119 Ga0373940_0000119_5562_6473 303
1743 3300035089 Ga0373944_0030301 Ga0373944_0030301_115_1047 303
1744 3300035090 Ga0373949_0001280 Ga0373949_0001280_5046_5957 303
1745 3300035090 Ga0373949_0013053 Ga0373949_0013053_882_1814 303
1746 3300035091 Ga0373951_0002117 Ga0373951_0002117_1453_2364 303
1747 3300035091 Ga0373951_0007708 Ga0373951_0007708_1229_2140 303
1748 3300035091 Ga0373951_0034361 Ga0373951_0034361_189_1115 303
1749 3300035092 Ga0373952_0000988 Ga0373952_0000988_3379_4290 303
1750 3300035092 Ga0373952_0003629 Ga0373952_0003629_771_1703 303
1751 3300035111 Ga0373923_0002058 Ga0373923_0002058_375_1307 303
1752 3300035111 Ga0373923_0073674 Ga0373923_0073674_322_1248 303
1753 3300035112 Ga0373932_0002403 Ga0373932_0002403_724_1635 303
1754 3300035112 Ga0373932_0008557 Ga0373932_0008557_1366_2277 303
1755 3300035113 Ga0373936_0003648 Ga0373936_0003648_104_1036 303
1756 3300035113 Ga0373936_0083421 Ga0373936_0083421_15_941 303
1757 3300035114 Ga0373939_0001166 Ga0373939_0001166_4286_5197 303
1758 3300035114 Ga0373939_0034470 Ga0373939_0034470_291_1223 303
1759 3300035115 Ga0373941_0009208 Ga0373941_0009208_1395_2327 303
1760 3300035115 Ga0373941_0011011 Ga0373941_0011011_178_1089 303
1761 3300035117 Ga0373953_0005593 Ga0373953_0005593_3055_3981 303
1762 3300035118 Ga0373954_0003012 Ga0373954_0003012_2162_3088 303
1763 3300035118 Ga0373954_0005688 Ga0373954_0005688_1274_2206 303
1764 3300035121 Ga0373960_0022622 Ga0373960_0022622_91_1002 303
1765 3300035121 Ga0373960_0025006 Ga0373960_0025006_661_1593 303
1766 3300035170 Ga0373943_0001786 Ga0373943_0001786_1993_2925 303
1767 3300035170 Ga0373943_0113383 Ga0373943_0113383_286_1218 303
1768 3300035171 Ga0373946_0013746 Ga0373946_0013746_1993_2925 303
1769 3300035171 Ga0373946_0023480 Ga0373946_0023480_99_1025 303
1770 3300035172 Ga0373955_0002129 Ga0373955_0002129_456_1382 303
1771 3300035172 Ga0373955_0048106 Ga0373955_0048106_342_1274 303
1772 3300035207 Ga0373942_0003873 Ga0373942_0003873_240_1151 303
1773 3300035207 Ga0373942_0020819 Ga0373942_0020819_408_1340 303
1774 3300035241 Ga0373961_0001933 Ga0373961_0001933_2002_2934 303
1775 3300035241 Ga0373961_0002392 Ga0373961_0002392_484_1395 303
1776 3300035242 Ga0373962_0001833 Ga0373962_0001833_2167_3078 303
1777 3300035242 Ga0373962_0024304 Ga0373962_0024304_264_1196 303
1778 3300035242 Ga0373962_0071171 Ga0373962_0071171_51_962 303
1779 3300035410 Ga0373924_0012594 Ga0373924_0012594_804_1730 303
1780 3300035691 Ga0373931_0003840 Ga0373931_0003840_1182_2114 303
1781 3300035691 Ga0373931_0011514 Ga0373931_0011514_1057_1968 303
1782 3300035691 Ga0373931_0079578 Ga0373931_0079578_257_1168 303
1783 3300035691 Ga0373931_0245685 Ga0373931_0245685_141_1067 303
1784 3300035692 Ga0373935_0002000 Ga0373935_0002000_2421_3353 303
1785 3300035692 Ga0373935_0034724 Ga0373935_0034724_582_1508 303
1786 3300035695 Ga0373927_0015381 Ga0373927_0015381_2276_3208 303
1787 3300035724 Ga0373933_0013540 Ga0373933_0013540_254_1186 303
1788 3300035724 Ga0373933_0016394 Ga0373933_0016394_1307_2233 303
1789 3300035725 Ga0373947_0019083 Ga0373947_0019083_2540_3472 303
1790 3300035725 Ga0373947_0265768 Ga0373947_0265768_170_1096 303
1791 3300036401 Ga0373937_0020562 Ga0373937_0020562_3263_4189 303
1792 3300037068 Ga0373925_0006016 Ga0373925_0006016_190_1101 303
1793 3300037068 Ga0373925_0071715 Ga0373925_0071715_687_1613 303
1794 3300038996 Ga0242420_005885 Ga0242420_005885_211_1122 303
1795 3300042016 Ga0439463_020241 Ga0439463_020241_347_1258 303
1796 3300044694 Ga0466963_0079443 Ga0466963_0079443_341_1255 303
1797 3300044842 Ga0466957_0024689 Ga0466957_0024689_1888_2802 303
1798 3300046452 Ga0495617_020125 Ga0495617_020125_255_1187 303
1799 3300046454 Ga0495592_0033791 Ga0495592_0033791_2491_3417 303
1800 3300046454 Ga0495592_0047131 Ga0495592_0047131_1993_2925 303
1801 3300046455 Ga0495603_0015820 Ga0495603_0015820_1293_2219 303
1802 3300046455 Ga0495603_0090677 Ga0495603_0090677_208_1140 303
1803 3300046458 Ga0495591_036395 Ga0495591_036395_196_1128 303
1804 3300046459 Ga0495629_0000026 Ga0495629_0000026_87435_88367 303
1805 3300046461 Ga0495641_0004773 Ga0495641_0004773_8250_9182 303
1806 3300046461 Ga0495641_0023447 Ga0495641_0023447_1996_2922 303
1807 3300046462 Ga0495651_0000808 Ga0495651_0000808_3849_4775 303
1808 3300046462 Ga0495651_0026176 Ga0495651_0026176_2115_3047 303
1809 3300046463 Ga0495653_0010076 Ga0495653_0010076_5205_6131 303
1810 3300046472 Ga0495580_0005369 Ga0495580_0005369_9360_10292 303
1811 3300046472 Ga0495580_0097515 Ga0495580_0097515_10_936 303
1812 3300046473 Ga0495582_0003391 Ga0495582_0003391_472_1404 303
1813 3300046473 Ga0495582_0005700 Ga0495582_0005700_206_1138 303
1814 3300046475 Ga0495639_0009129 Ga0495639_0009129_1197_2129 303
1815 3300046476 Ga0495662_0010232 Ga0495662_0010232_1993_2925 303
1816 3300046477 Ga0495664_0002195 Ga0495664_0002195_9066_9998 303
1817 3300046477 Ga0495664_0020709 Ga0495664_0020709_2302_3228 303
1818 3300046491 Ga0495584_0024184 Ga0495584_0024184_277_1188 303
1819 3300046491 Ga0495584_0127502 Ga0495584_0127502_301_1212 303
1820 3300046492 Ga0495585_0005952 Ga0495585_0005952_2082_3014 303
1821 3300046501 Ga0495607_0022960 Ga0495607_0022960_938_1870 303
1822 3300046506 Ga0495583_0094855 Ga0495583_0094855_245_1177 303
1823 3300046511 Ga0495608_0004227 Ga0495608_0004227_2506_3438 303
1824 3300046511 Ga0495608_0045151 Ga0495608_0045151_739_1665 303
1825 3300046514 Ga0495618_0012417 Ga0495618_0012417_4146_5072 303
1826 3300046514 Ga0495618_0022928 Ga0495618_0022928_2563_3495 303
1827 3300046516 Ga0495628_0024473 Ga0495628_0024473_2234_3160 303
1828 3300046517 Ga0495630_0067195 Ga0495630_0067195_236_1162 303
1829 3300046520 Ga0495637_0017430 Ga0495637_0017430_891_1823 303
1830 3300046523 Ga0495644_0000215 Ga0495644_0000215_14690_15622 303
1831 3300046531 Ga0495665_0005110 Ga0495665_0005110_5451_6383 303
1832 3300046531 Ga0495665_0037705 Ga0495665_0037705_502_1428 303
1833 3300046533 Ga0495640_0029993 Ga0495640_0029993_368_1294 303
1834 3300046535 Ga0495586_0019590 Ga0495586_0019590_2053_2979 303
1835 3300046535 Ga0495586_0030611 Ga0495586_0030611_808_1740 303
1836 3300046536 Ga0495587_0003557 Ga0495587_0003557_3853_4779 303
1837 3300046536 Ga0495587_0021420 Ga0495587_0021420_148_1080 303
1838 3300046543 Ga0495645_0124722 Ga0495645_0124722_370_1302 303
1839 3300046557 Ga0495622_0074657 Ga0495622_0074657_406_1338 303
1840 3300046558 Ga0495633_0001472 Ga0495633_0001472_4702_5634 303
1841 3300046559 Ga0495667_0001178 Ga0495667_0001178_15391_16317 303
1842 3300046559 Ga0495667_0003467 Ga0495667_0003467_5454_6386 303
1843 3300046615 Ga0495656_0000808 Ga0495656_0000808_4104_5036 303
1844 3300046642 Ga0495634_0115284 Ga0495634_0115284_477_1403 303
1845 3300046642 Ga0495634_0261542 Ga0495634_0261542_118_1044 303
1846 3300046648 Ga0495611_0056620 Ga0495611_0056620_474_1406 303
1847 3300046663 Ga0495635_0062342 Ga0495635_0062342_1211_2143 303
1848 3300046664 Ga0495659_0009514 Ga0495659_0009514_1852_2784 303
1849 3300046665 Ga0495661_0021971 Ga0495661_0021971_2181_3113 303
1850 3300046674 Ga0495588_0092873 Ga0495588_0092873_180_1112 303
1851 3300046675 Ga0495657_0008887 Ga0495657_0008887_2026_2952 303
1852 3300046678 Ga0495599_0035010 Ga0495599_0035010_316_1242 303
1853 3300046678 Ga0495599_0130701 Ga0495599_0130701_342_1274 303
1854 3300046679 Ga0495623_0005999 Ga0495623_0005999_3717_4643 303
1855 3300046680 Ga0495646_0000395 Ga0495646_0000395_18095_19021 303
1856 3300046680 Ga0495646_0008527 Ga0495646_0008527_2563_3495 303
1857 3300046681 Ga0495647_0050904 Ga0495647_0050904_250_1182 303
1858 3300046683 Ga0495658_0001322 Ga0495658_0001322_10231_11163 303
1859 3300046683 Ga0495658_0107060 Ga0495658_0107060_602_1534 303
1860 3300046684 Ga0495669_0083495 Ga0495669_0083495_502_1413 303
1861 3300046689 Ga0495613_0012017 Ga0495613_0012017_4887_5819 303
1862 3300046689 Ga0495613_0053959 Ga0495613_0053959_95_1021 303
1863 3300046690 Ga0495624_0078421 Ga0495624_0078421_124_1056 303
1864 3300046691 Ga0495670_0005172 Ga0495670_0005172_1665_2597 303
1865 3300046809 Ga0495600_0002559 Ga0495600_0002559_6298_7224 303
1866 3300046809 Ga0495600_0012284 Ga0495600_0012284_370_1302 303
1867 3300047317 Ga0495604_0105349 Ga0495604_0105349_207_1139 303
1868 3300047319 Ga0495674_0014605 Ga0495674_0014605_5737_6663 303
1869 3300047319 Ga0495674_0201991 Ga0495674_0201991_343_1275 303
1870 3300047321 Ga0495676_0040035 Ga0495676_0040035_378_1310 303
1871 3300047322 Ga0495680_0000825 Ga0495680_0000825_27638_28564 303
1872 3300047322 Ga0495680_0019969 Ga0495680_0019969_2595_3527 303
1873 3300047446 Ga0495679_019573 Ga0495679_019573_327_1259 303
1874 3300047673 Ga0495593_0009453 Ga0495593_0009453_1439_2371 303
1875 3300047673 Ga0495593_0009518 Ga0495593_0009518_192_1124 303
1876 3300047673 Ga0495593_0041048 Ga0495593_0041048_1045_1971 303
1877 3300047673 Ga0495593_0057475 Ga0495593_0057475_436_1362 303
1878 3300048089 Ga0495614_0025736 Ga0495614_0025736_576_1508 303
1879 3300048903 Ga0496100_0025723 Ga0496100_0025723_785_1696 303
1880 3300048904 Ga0496101_0003853 Ga0496101_0003853_3744_4655 303
1881 3300048904 Ga0496101_0023337 Ga0496101_0023337_1864_2790 303
1882 3300048905 Ga0496102_0045197 Ga0496102_0045197_2970_3881 303
1883 3300048905 Ga0496102_0208063 Ga0496102_0208063_576_1508 303
1884 3300048906 Ga0496103_0008374 Ga0496103_0008374_3093_4025 303
1885 3300048906 Ga0496103_0027759 Ga0496103_0027759_2405_3316 303
1886 3300048906 Ga0496103_0053736 Ga0496103_0053736_110_1021 303
1887 3300048907 Ga0496104_0079488 Ga0496104_0079488_507_1439 303
1888 3300048907 Ga0496104_0168221 Ga0496104_0168221_292_1218 303
1889 3300048907 Ga0496104_0184407 Ga0496104_0184407_401_1333 303
1890 3300048908 Ga0496105_0007095 Ga0496105_0007095_4705_5652 303
1891 3300048908 Ga0496105_0030697 Ga0496105_0030697_1737_2648 303
1892 3300048909 Ga0496106_0003403 Ga0496106_0003403_6062_6973 303
1893 3300048909 Ga0496106_0012418 Ga0496106_0012418_1339_2250 303
1894 3300048909 Ga0496106_0168052 Ga0496106_0168052_390_1301 303
1895 3300048910 Ga0496107_0020448 Ga0496107_0020448_2896_3828 303
1896 3300048910 Ga0496107_0035807 Ga0496107_0035807_514_1425 303
1897 3300048910 Ga0496107_0052763 Ga0496107_0052763_117_1028 303
1898 3300048911 Ga0496108_0004356 Ga0496108_0004356_6464_7375 303
1899 3300048911 Ga0496108_0074602 Ga0496108_0074602_818_1729 303
1900 3300048912 Ga0496109_0003207 Ga0496109_0003207_5299_6210 303
1901 3300048912 Ga0496109_0014486 Ga0496109_0014486_4336_5247 303
1902 3300048912 Ga0496109_0068598 Ga0496109_0068598_2275_3201 303
1903 3300048913 Ga0496110_0026611 Ga0496110_0026611_111_1043 303
1904 3300048913 Ga0496110_0029454 Ga0496110_0029454_3200_4111 303
1905 3300048914 Ga0496111_0016724 Ga0496111_0016724_1419_2330 303
1906 3300048914 Ga0496111_0249161 Ga0496111_0249161_50_961 303
1907 3300048915 Ga0496112_0005532 Ga0496112_0005532_7079_7990 303
1908 3300048915 Ga0496112_0015369 Ga0496112_0015369_2209_3141 303
1909 3300048915 Ga0496112_0175826 Ga0496112_0175826_277_1188 303
1910 3300048916 Ga0496113_0003527 Ga0496113_0003527_4426_5337 303
1911 3300048916 Ga0496113_0047943 Ga0496113_0047943_1309_2220 303
1912 3300048916 Ga0496113_0055955 Ga0496113_0055955_861_1772 303
1913 3300048917 Ga0496114_0012027 Ga0496114_0012027_3093_4025 303
1914 3300048917 Ga0496114_0021000 Ga0496114_0021000_3763_4674 303
1915 3300048917 Ga0496114_0523529 Ga0496114_0523529_77_1003 303
1916 3300048918 Ga0496115_0003483 Ga0496115_0003483_8236_9147 303
1917 3300049590 Ga0501074_0215398 Ga0501074_0215398_270_1181 303
1918 3300049592 Ga0501076_0043461 Ga0501076_0043461_786_1697 303
1919 3300049593 Ga0501077_0087268 Ga0501077_0087268_634_1545 303
1920 3300050494 nmdc:mga06z11_19780_c1 nmdc:mga06z11_19780_c1_1759_2670 303
1921 3300050507 nmdc:mga05p37_25974_c1 nmdc:mga05p37_25974_c1_2011_2958 303
1922 3300050507 nmdc:mga05p37_2764_c1 nmdc:mga05p37_2764_c1_11738_12685 303
1923 3300050508 nmdc:mga09592_524_c1 nmdc:mga09592_524_c1_3413_4360 303
1924 3300050509 nmdc:mga0qj67_34036_c1 nmdc:mga0qj67_34036_c1_1036_1983 303
1925 3300050510 nmdc:mga06r32_121_c1 nmdc:mga06r32_121_c1_47239_48186 303
1926 3300050511 nmdc:mga08y16_1115_c1 nmdc:mga08y16_1115_c1_24210_25121 303
1927 3300050511 nmdc:mga08y16_5266_c1 nmdc:mga08y16_5266_c1_4655_5602 303
1928 3300050511 nmdc:mga08y16_56605_c1 nmdc:mga08y16_56605_c1_2918_3829 303
1929 3300050511 nmdc:mga08y16_940_c1 nmdc:mga08y16_940_c1_26033_26944 303
1930 3300050512 nmdc:mga0n895_12320_c1 nmdc:mga0n895_12320_c1_4659_5606 303
1931 3300050512 nmdc:mga0n895_2636_c1 nmdc:mga0n895_2636_c1_2732_3679 303
1932 3300050512 nmdc:mga0n895_34687_c1 nmdc:mga0n895_34687_c1_1639_2571 303
1933 3300050512 nmdc:mga0n895_471786_c1 nmdc:mga0n895_471786_c1_143_1069 303
1934 3300050512 nmdc:mga0n895_534_c1 nmdc:mga0n895_534_c1_16423_17334 303
1935 3300050513 nmdc:mga0rr50_20867_c1 nmdc:mga0rr50_20867_c1_1105_2052 303
1936 3300050513 nmdc:mga0rr50_31337_c1 nmdc:mga0rr50_31337_c1_805_1716 303
1937 3300050513 nmdc:mga0rr50_3849_c1 nmdc:mga0rr50_3849_c1_3342_4289 303
1938 3300050513 nmdc:mga0rr50_38987_c1 nmdc:mga0rr50_38987_c1_2259_3191 303
1939 3300050513 nmdc:mga0rr50_6636_c1 nmdc:mga0rr50_6636_c1_3082_4014 303
1940 3300050514 nmdc:mga08x19_106448_c1 nmdc:mga08x19_106448_c1_488_1435 303
1941 3300050514 nmdc:mga08x19_143622_c1 nmdc:mga08x19_143622_c1_154_1086 303
1942 3300050515 nmdc:mga0a205_145005_c1 nmdc:mga0a205_145005_c1_1178_2110 303
1943 3300050515 nmdc:mga0a205_213_c1 nmdc:mga0a205_213_c1_31432_32343 303
1944 3300050515 nmdc:mga0a205_549_c1 nmdc:mga0a205_549_c1_20955_21902 303
1945 3300050515 nmdc:mga0a205_61189_c1 nmdc:mga0a205_61189_c1_817_1764 303
1946 3300053077 Ga0495601_0069781 Ga0495601_0069781_836_1768 303
1947 3300053077 Ga0495601_0123720 Ga0495601_0123720_188_1114 303
1948 3300053078 Ga0495612_0004407 Ga0495612_0004407_106_1038 303
1949 3300053084 Ga0495595_0000735 Ga0495595_0000735_6192_7124 303
1950 3300053084 Ga0495595_0001611 Ga0495595_0001611_7192_8118 303
1951 3300053085 Ga0495619_0000672 Ga0495619_0000672_4895_5827 303
1952 3300053085 Ga0495619_0007396 Ga0495619_0007396_3999_4931 303
1953 3300053085 Ga0495619_0008615 Ga0495619_0008615_1902_2828 303
1954 3300053094 Ga0500566_0103886 Ga0500566_0103886_576_1508 303
1955 3300054114 Ga0501084_0169083 Ga0501084_0169083_199_1110 303
1956 3300060353 Ga0501082_0100493 Ga0501082_0100493_322_1311 303
1957 3300061734 Ga0530510_0213573 Ga0530510_0213573_112_1101 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

69

353

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zp4-assembly1.cif.gz_B glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate 0.9798 17 297
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9795 17 297
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9758 17 297
3fst-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9756 17 297
3fsu-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase double mutant phe223leuglu28gln complexed with methyltetrahydrofolate 0.9756 17 297
ID Description Score Start End Superfamily
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9602 6 297 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9288 9 298 3.20.20.220
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9283 89 293 3.20.20.220
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9247 6 297 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9171 5 295 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A3M1PXK4-F1-model_v4 Methylenetetrahydrofolate reductase 0.9863 125 300 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A2J4RD57-F1-model_v4 Methylenetetrahydrofolate reductase 0.9829 134 298 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A258CT94-F1-model_v4 Methylenetetrahydrofolate reductase (EC 1.5.1.54) 0.9824 45 300 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A6P5UD17-F1-model_v4 deleted 0.9815 33 246
AF-A0A0F5FME8-F1-model_v4 Methylenetetrahydrofolate reductase (EC 1.5.1.54) 0.9811 17 297 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Feature Viewer

pLDDT pTM Quality
89.08 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map