F495873

General Info

Members Datasets Scaffolds Average Seq Length
1843 555 1843 205

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0190048|Ga0500651_0190048_148_918
Length 256
Sequence MNGPSKGRFHFHVRGGRDGVRLSLFRGSIVCWPDQRRRACIPAKPILCERTMTKRISAKHKIDRRLGQNIWGRPKSPVNKREYGPGQHGQRRAGKVSDFGIQLRAKQKLKGYYANINERQFKNIYKEATRLRGDTSENLIGLLECRLDAVIYRAKFVPTPFAARQFVSHGHINVNGRRVNIPSYRCRPGDLVEVREKGRGMVLVLEAVQSPERDVPDYVEADHGKMKATFVRIPQLSDVPYPVQMEPNLVVEFYSR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
158 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
159 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
160 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
161 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
162 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
165 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
168 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
169 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
245 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
246 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
247 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
248 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
250 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
256 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
257 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
258 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
259 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
260 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
261 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
269 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
270 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
274 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
275 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
276 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
283 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
284 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
285 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
287 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
293 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
294 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
295 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
296 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
297 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
298 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
299 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
300 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
301 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
302 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
308 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
313 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
314 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
316 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
317 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
318 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
319 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
320 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
321 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
322 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
323 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
324 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
325 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
326 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
327 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
328 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
329 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
330 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
331 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
332 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
333 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
334 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
335 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
336 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
337 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
338 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
339 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
340 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
341 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
342 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
343 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
344 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
345 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
346 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
347 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
348 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
349 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
350 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
351 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
352 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
355 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
356 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
357 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
358 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
359 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
360 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
361 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
362 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
363 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
364 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
365 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
366 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
367 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
368 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
369 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
370 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
382 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
383 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
384 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
385 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
386 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
387 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
392 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
393 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
400 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
401 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
402 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
403 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
408 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
409 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
410 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
413 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
414 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
415 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
416 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
417 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
418 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
419 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
420 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
421 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
422 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
423 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
424 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
425 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
426 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
427 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
428 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
431 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
432 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
465 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
466 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
470 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
471 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
472 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
473 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
474 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
475 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
476 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
477 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
478 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
479 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
482 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
483 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
484 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
485 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
486 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
487 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
488 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
491 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
492 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
493 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
494 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
495 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
496 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
497 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
498 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
499 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
500 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
501 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
502 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
503 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
504 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
505 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
506 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
507 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
508 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
509 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
510 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
511 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
512 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
513 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
514 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
515 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
516 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
517 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
518 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
519 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
520 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
521 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
522 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
523 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
524 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
525 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
526 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
527 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
528 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
529 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
530 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
531 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
532 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
533 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
534 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
554 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
555 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 2.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0.71
Rhizoplane 6.13
Rhizosphere 82.96
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C4886 2010549000 Bacteria 1877
2 JGI24740J21852_10028970 3300001979 Bacteria 1823
3 JGI24739J22299_10035650 3300001989 Bacteria 1684
4 JGI24737J22298_10009679 3300001990 Bacteria 3196
5 JGI24743J22301_10050974 3300001991 Bacteria 843
6 JGI24735J21928_10019801 3300002067 Bacteria 2066
7 JGI24745J21846_1025938 3300002073 Bacteria 698
8 JGI24738J21930_10039363 3300002075 Bacteria 961
9 JGI25156J39149_1007812 3300002705 Bacteria 2764
10 JGI25157J39369_1001188 3300002741 Bacteria 11043
11 JGI25406J46586_10002529 3300003203 Bacteria 8658
12 JGI25165J46597_1000192 3300003214 Bacteria 91136
13 JGI25165J46597_1003262 3300003214 Bacteria 4193
14 JGI25160J50197_1005746 3300003354 Bacteria 5118
15 Ga0007416J51690_1023620 3300003577 Bacteria 686
16 JGI25404J52841_10047908 3300003659 Bacteria 900
17 Ga0055542_1000612 3300003762 Bacteria 30367
18 Ga0055529_1003526 3300003763 Bacteria 2576
19 Ga0055531_10016283 3300003794 Bacteria 3217
20 Ga0065712_10370395 3300005290 Bacteria 755
21 Ga0065715_10105176 3300005293 Bacteria 2905
22 Ga0070658_10021681 3300005327 Bacteria 5149
23 Ga0070658_10021783 3300005327 Bacteria 5136
24 Ga0070658_10031935 3300005327 Bacteria 4232
25 Ga0070658_10051002 3300005327 Bacteria 3353
26 Ga0070658_10386894 3300005327 Bacteria 1200
27 Ga0070676_10014141 3300005328 Bacteria 4382
28 Ga0070683_100224613 3300005329 Bacteria 1785
29 Ga0070683_100468308 3300005329 Bacteria 1203
30 Ga0070683_100542749 3300005329 Bacteria 1112
31 Ga0070690_100010596 3300005330 Bacteria 5369
32 Ga0070670_100014234 3300005331 Bacteria 6823
33 Ga0068869_100173823 3300005334 Bacteria 1684
34 Ga0068869_100225952 3300005334 Bacteria 1486
35 Ga0070666_10019980 3300005335 Bacteria 4328
36 Ga0070666_10240332 3300005335 Bacteria 1280
37 Ga0070680_100026089 3300005336 Bacteria 4674
38 Ga0070680_100530837 3300005336 Bacteria 1008
39 Ga0070680_101022033 3300005336 Bacteria 714
40 Ga0070682_100001226 3300005337 Bacteria 14606
41 Ga0070682_100002466 3300005337 Bacteria 10225
42 Ga0070682_100002995 3300005337 Bacteria 9375
43 Ga0070682_100083887 3300005337 Bacteria 2069
44 Ga0068868_100021232 3300005338 Bacteria 4889
45 Ga0068868_100327996 3300005338 Bacteria 1306
46 Ga0070660_100022647 3300005339 Bacteria 4649
47 Ga0070660_100032440 3300005339 Bacteria 3930
48 Ga0070660_100571500 3300005339 Bacteria 944
49 Ga0070689_100005857 3300005340 Bacteria 8441
50 Ga0070689_100691753 3300005340 Bacteria 890
51 Ga0070689_100703389 3300005340 Bacteria 882
52 Ga0070691_10004158 3300005341 Bacteria 6571
53 Ga0070691_10035914 3300005341 Bacteria 2335
54 Ga0070691_10055160 3300005341 Bacteria 1903
55 Ga0070687_100001867 3300005343 Bacteria 7638
56 Ga0070687_100247855 3300005343 Bacteria 1105
57 Ga0070661_100002323 3300005344 Bacteria 13057
58 Ga0070661_100041250 3300005344 Bacteria 3368
59 Ga0070692_10004328 3300005345 Bacteria 5910
60 Ga0070668_100003026 3300005347 Bacteria 12438
61 Ga0070668_100019887 3300005347 Bacteria 5059
62 Ga0070668_100211414 3300005347 Bacteria 1596
63 Ga0070668_100212046 3300005347 Bacteria 1593
64 Ga0070668_100227611 3300005347 Bacteria 1540
65 Ga0070668_100315465 3300005347 Bacteria 1315
66 Ga0070668_100592997 3300005347 Bacteria 968
67 Ga0070668_100799715 3300005347 Bacteria 838
68 Ga0070669_100001259 3300005353 Bacteria 18386
69 Ga0070669_100056898 3300005353 Bacteria 2867
70 Ga0070675_100015132 3300005354 Bacteria 6092
71 Ga0070675_100182317 3300005354 Bacteria 1816
72 Ga0070675_100432631 3300005354 Bacteria 1178
73 Ga0070671_100001064 3300005355 Bacteria 20251
74 Ga0070674_100000541 3300005356 Bacteria 18943
75 Ga0070674_100066867 3300005356 Bacteria 2527
76 Ga0070674_100088457 3300005356 Bacteria 2229
77 Ga0070674_100163799 3300005356 Bacteria 1689
78 Ga0070674_100362019 3300005356 Bacteria 1175
79 Ga0070674_100364610 3300005356 Bacteria 1171
80 Ga0070673_100000057 3300005364 Bacteria 45789
81 Ga0070688_100001329 3300005365 Bacteria 12253
82 Ga0070659_100000930 3300005366 Bacteria 21487
83 Ga0070659_100008775 3300005366 Bacteria 7401
84 Ga0070659_100016746 3300005366 Bacteria 5506
85 Ga0070659_100550665 3300005366 Bacteria 987
86 Ga0070667_100002740 3300005367 Bacteria 15237
87 Ga0070667_100061608 3300005367 Bacteria 3177
88 Ga0070667_100210428 3300005367 Bacteria 1728
89 Ga0070667_100320517 3300005367 Bacteria 1398
90 Ga0070667_100484448 3300005367 Bacteria 1133
91 Ga0070703_10001755 3300005406 Bacteria 6422
92 Ga0070703_10028563 3300005406 Bacteria 1668
93 Ga0070703_10224050 3300005406 Bacteria 750
94 Ga0070709_10029110 3300005434 Bacteria 3300
95 Ga0070709_10244548 3300005434 Bacteria 1290
96 Ga0070709_10345783 3300005434 Bacteria 1098
97 Ga0070709_10547385 3300005434 Bacteria 885
98 Ga0070714_100037979 3300005435 Bacteria 4049
99 Ga0070714_100667227 3300005435 Bacteria 1002
100 Ga0070713_100000821 3300005436 Bacteria 19927
101 Ga0070713_100064624 3300005436 Bacteria 3071
102 Ga0070710_10070031 3300005437 Bacteria 2019
103 Ga0070710_10513903 3300005437 Bacteria 822
104 Ga0070701_10136185 3300005438 Bacteria 1400
105 Ga0070711_100058787 3300005439 Bacteria 2667
106 Ga0070711_100081834 3300005439 Bacteria 2302
107 Ga0070711_100094047 3300005439 Bacteria 2166
108 Ga0070711_100096299 3300005439 Bacteria 2144
109 Ga0070711_100109994 3300005439 Bacteria 2021
110 Ga0070711_100210304 3300005439 Bacteria 1506
111 Ga0070705_100000482 3300005440 Bacteria 23023
112 Ga0070705_100001911 3300005440 Bacteria 10701
113 Ga0070705_100037527 3300005440 Bacteria 2734
114 Ga0070705_100039606 3300005440 Bacteria 2675
115 Ga0070705_100164198 3300005440 Bacteria 1488
116 Ga0070705_100328749 3300005440 Bacteria 1107
117 Ga0070700_100037506 3300005441 Bacteria 2948
118 Ga0070700_100067062 3300005441 Bacteria 2279
119 Ga0070700_100115743 3300005441 Bacteria 1789
120 Ga0070700_100239407 3300005441 Bacteria 1296
121 Ga0070694_100001027 3300005444 Bacteria 15886
122 Ga0070694_100016532 3300005444 Bacteria 4645
123 Ga0070694_100023169 3300005444 Bacteria 3990
124 Ga0070708_100204145 3300005445 Bacteria 1851
125 Ga0070708_100601211 3300005445 Bacteria 1037
126 Ga0070663_100005184 3300005455 Bacteria 7719
127 Ga0070663_100008291 3300005455 Bacteria 6384
128 Ga0070663_100044716 3300005455 Bacteria 3124
129 Ga0070663_100061385 3300005455 Bacteria 2707
130 Ga0070663_100091503 3300005455 Bacteria 2254
131 Ga0070663_100096361 3300005455 Bacteria 2200
132 Ga0070663_100530272 3300005455 Bacteria 981
133 Ga0070663_100703660 3300005455 Bacteria 859
134 Ga0070678_100023682 3300005456 Bacteria 4097
135 Ga0070678_100136161 3300005456 Bacteria 1959
136 Ga0070678_100407401 3300005456 Bacteria 1183
137 Ga0070662_100005649 3300005457 Bacteria 8000
138 Ga0070662_100401932 3300005457 Bacteria 1131
139 Ga0070681_10009623 3300005458 Bacteria 9504
140 Ga0070681_10054520 3300005458 Bacteria 3984
141 Ga0070681_10056304 3300005458 Bacteria 3914
142 Ga0070681_10107453 3300005458 Bacteria 2731
143 Ga0070681_10119937 3300005458 Bacteria 2566
144 Ga0070681_10286454 3300005458 Bacteria 1558
145 Ga0068867_100054354 3300005459 Bacteria 2958
146 Ga0068867_100388015 3300005459 Bacteria 1175
147 Ga0068867_100840375 3300005459 Bacteria 822
148 Ga0070685_10012730 3300005466 Bacteria 4426
149 Ga0070685_10167378 3300005466 Bacteria 1406
150 Ga0070706_100694230 3300005467 Bacteria 944
151 Ga0070707_100010698 3300005468 Bacteria 8547
152 Ga0070698_100051280 3300005471 Bacteria 4203
153 Ga0070698_100785038 3300005471 Bacteria 896
154 Ga0070699_100000836 3300005518 Bacteria 28545
155 Ga0070699_100069742 3300005518 Bacteria 3055
156 Ga0070699_100094222 3300005518 Bacteria 2621
157 Ga0070699_100416437 3300005518 Bacteria 1216
158 Ga0070679_100015220 3300005530 Bacteria 7388
159 Ga0070679_100089644 3300005530 Bacteria 3063
160 Ga0070679_100097482 3300005530 Bacteria 2928
161 Ga0070684_100438273 3300005535 Bacteria 1207
162 Ga0070684_100970740 3300005535 Bacteria 797
163 Ga0070697_100001866 3300005536 Bacteria 16103
164 Ga0070697_100014888 3300005536 Bacteria 6105
165 Ga0068853_100002253 3300005539 Bacteria 14417
166 Ga0068853_100006655 3300005539 Bacteria 9203
167 Ga0068853_100025202 3300005539 Bacteria 4990
168 Ga0068853_100061886 3300005539 Bacteria 3238
169 Ga0068853_100075662 3300005539 Bacteria 2938
170 Ga0068853_100224330 3300005539 Bacteria 1717
171 Ga0070672_100161402 3300005543 Bacteria 1860
172 Ga0070672_100551467 3300005543 Bacteria 1001
173 Ga0070686_100184664 3300005544 Bacteria 1484
174 Ga0070695_100000195 3300005545 Bacteria 29584
175 Ga0070695_100000581 3300005545 Bacteria 19279
176 Ga0070695_100007007 3300005545 Bacteria 6679
177 Ga0070695_100030874 3300005545 Bacteria 3338
178 Ga0070695_100065339 3300005545 Bacteria 2369
179 Ga0070695_100167265 3300005545 Bacteria 1548
180 Ga0070695_100320465 3300005545 Bacteria 1152
181 Ga0070696_100000690 3300005546 Bacteria 21595
182 Ga0070696_100001754 3300005546 Bacteria 14229
183 Ga0070696_100018247 3300005546 Bacteria 4740
184 Ga0070696_100123840 3300005546 Bacteria 1874
185 Ga0070693_100000914 3300005547 Bacteria 13126
186 Ga0070693_100027143 3300005547 Bacteria 3099
187 Ga0070693_100035966 3300005547 Bacteria 2750
188 Ga0070693_100037340 3300005547 Bacteria 2708
189 Ga0070693_100151406 3300005547 Bacteria 1470
190 Ga0070693_100169615 3300005547 Bacteria 1397
191 Ga0070693_100247245 3300005547 Bacteria 1181
192 Ga0070693_100404663 3300005547 Bacteria 947
193 Ga0070665_100025273 3300005548 Bacteria 5984
194 Ga0070665_100043638 3300005548 Bacteria 4505
195 Ga0070665_100064156 3300005548 Bacteria 3683
196 Ga0070665_100070997 3300005548 Bacteria 3489
197 Ga0070665_100095473 3300005548 Bacteria 2978
198 Ga0070665_100128148 3300005548 Bacteria 2540
199 Ga0070665_100289108 3300005548 Bacteria 1641
200 Ga0070704_100002869 3300005549 Bacteria 9769
201 Ga0070704_100007305 3300005549 Bacteria 6573
202 Ga0070704_100029004 3300005549 Bacteria 3689
203 Ga0070704_100183282 3300005549 Bacteria 1677
204 Ga0070704_100378394 3300005549 Bacteria 1202
205 Ga0070704_100688333 3300005549 Bacteria 906
206 Ga0068855_100072247 3300005563 Bacteria 4011
207 Ga0068855_100076455 3300005563 Bacteria 3886
208 Ga0068855_100255082 3300005563 Bacteria 1955
209 Ga0070664_100003236 3300005564 Bacteria 13160
210 Ga0070664_100701164 3300005564 Bacteria 943
211 Ga0068857_100010632 3300005577 Bacteria 8003
212 Ga0068857_100013736 3300005577 Bacteria 7055
213 Ga0068857_100013738 3300005577 Bacteria 7055
214 Ga0068857_100062947 3300005577 Bacteria 3298
215 Ga0068857_100341791 3300005577 Bacteria 1385
216 Ga0068854_100004526 3300005578 Bacteria 8767
217 Ga0068854_100014363 3300005578 Bacteria 5220
218 Ga0068854_100843221 3300005578 Bacteria 802
219 Ga0068856_100001161 3300005614 Bacteria 27673
220 Ga0068856_100059501 3300005614 Bacteria 3773
221 Ga0068856_100161708 3300005614 Bacteria 2249
222 Ga0068856_100447789 3300005614 Bacteria 1312
223 Ga0068856_100846745 3300005614 Bacteria 934
224 Ga0070702_100012198 3300005615 Bacteria 4299
225 Ga0070702_100032394 3300005615 Bacteria 2868
226 Ga0070702_100082500 3300005615 Bacteria 1929
227 Ga0070702_100181582 3300005615 Bacteria 1377
228 Ga0070702_100182650 3300005615 Bacteria 1374
229 Ga0068852_100008313 3300005616 Bacteria 7637
230 Ga0068852_100018494 3300005616 Bacteria 5491
231 Ga0068852_100158335 3300005616 Bacteria 2112
232 Ga0068859_100000988 3300005617 Bacteria 29125
233 Ga0068859_100569234 3300005617 Bacteria 1227
234 Ga0068864_100026317 3300005618 Bacteria 4906
235 Ga0068864_100045147 3300005618 Bacteria 3779
236 Ga0068864_100620332 3300005618 Bacteria 1051
237 Ga0068866_10013292 3300005718 Bacteria 3609
238 Ga0068866_10209355 3300005718 Bacteria 1170
239 Ga0068866_10386259 3300005718 Bacteria 899
240 Ga0068861_100001822 3300005719 Bacteria 13732
241 Ga0068861_100017951 3300005719 Bacteria 5031
242 Ga0068863_100004888 3300005841 Bacteria 13206
243 Ga0068863_100308348 3300005841 Bacteria 1536
244 Ga0068858_100030872 3300005842 Bacteria 4977
245 Ga0068858_100083031 3300005842 Bacteria 2979
246 Ga0068860_100000926 3300005843 Bacteria 32568
247 Ga0068860_100009033 3300005843 Bacteria 9921
248 Ga0068860_100068511 3300005843 Bacteria 3371
249 Ga0068860_100120631 3300005843 Bacteria 2511
250 Ga0068860_100307635 3300005843 Bacteria 1554
251 Ga0068862_100001945 3300005844 Bacteria 18720
252 Ga0068862_100017794 3300005844 Bacteria 5916
253 Ga0068862_100018580 3300005844 Bacteria 5790
254 Ga0068862_100039031 3300005844 Bacteria 4031
255 Ga0068862_100059776 3300005844 Bacteria 3273
256 Ga0068862_100087797 3300005844 Bacteria 2705
257 Ga0068862_100307291 3300005844 Bacteria 1461
258 Ga0068862_100323811 3300005844 Bacteria 1423
259 Ga0068862_100524184 3300005844 Bacteria 1128
260 Ga0081455_10000206 3300005937 Bacteria 75450
261 Ga0081455_10002195 3300005937 Bacteria 23269
262 Ga0081455_10005107 3300005937 Bacteria 14473
263 Ga0081455_10017029 3300005937 Bacteria 6986
264 Ga0081455_10105529 3300005937 Bacteria 2251
265 Ga0081455_10134987 3300005937 Bacteria 1924
266 Ga0081455_10145278 3300005937 Bacteria 1836
267 Ga0081540_1000056 3300005983 Bacteria 122552
268 Ga0081540_1000084 3300005983 Bacteria 100067
269 Ga0081540_1001770 3300005983 Bacteria 18155
270 Ga0081540_1099107 3300005983 Bacteria 1260
271 Ga0081539_10000054 3300005985 Bacteria 259053
272 Ga0081539_10006565 3300005985 Bacteria 11078
273 Ga0081539_10165130 3300005985 Bacteria 1052
274 Ga0075365_10007267 3300006038 Bacteria 6192
275 Ga0075365_10088030 3300006038 Bacteria 2112
276 Ga0075368_10000337 3300006042 Bacteria 13784
277 Ga0075368_10004593 3300006042 Bacteria 4692
278 Ga0075368_10013623 3300006042 Bacteria 2989
279 Ga0075368_10021504 3300006042 Bacteria 2451
280 Ga0075363_100011887 3300006048 Bacteria 4182
281 Ga0075363_100014188 3300006048 Bacteria 3886
282 Ga0075363_100018851 3300006048 Bacteria 3443
283 Ga0075363_100029503 3300006048 Bacteria 2833
284 Ga0075363_100143314 3300006048 Bacteria 1346
285 Ga0075364_10002122 3300006051 Bacteria 11093
286 Ga0075364_10007755 3300006051 Bacteria 6392
287 Ga0075364_10295816 3300006051 Bacteria 1102
288 Ga0070715_10104527 3300006163 Bacteria 1326
289 Ga0070716_100008734 3300006173 Bacteria 5033
290 Ga0070716_100042581 3300006173 Bacteria 2536
291 Ga0070712_100001926 3300006175 Bacteria 12699
292 Ga0070712_100006320 3300006175 Bacteria 7346
293 Ga0075362_10003670 3300006177 Bacteria 5417
294 Ga0075362_10071447 3300006177 Bacteria 1586
295 Ga0075362_10074486 3300006177 Bacteria 1556
296 Ga0075367_10000532 3300006178 Bacteria 14389
297 Ga0075367_10017857 3300006178 Bacteria 3902
298 Ga0075367_10052250 3300006178 Bacteria 2418
299 Ga0075367_10169171 3300006178 Bacteria 1361
300 Ga0075367_10191110 3300006178 Bacteria 1277
301 Ga0075367_10194115 3300006178 Bacteria 1267
302 Ga0075367_10410518 3300006178 Bacteria 857
303 Ga0075369_10079339 3300006186 Bacteria 1454
304 Ga0075369_10095657 3300006186 Bacteria 1329
305 Ga0075366_10081004 3300006195 Bacteria 1939
306 Ga0075366_10100388 3300006195 Bacteria 1736
307 Ga0097621_100008311 3300006237 Bacteria 7468
308 Ga0097621_100031965 3300006237 Bacteria 4180
309 Ga0097621_100549461 3300006237 Bacteria 1051
310 Ga0097621_100842667 3300006237 Bacteria 851
311 Ga0075370_10076573 3300006353 Bacteria 1919
312 Ga0075370_10142857 3300006353 Bacteria 1400
313 Ga0068871_100014662 3300006358 Bacteria 5848
314 Ga0068871_100083151 3300006358 Bacteria 2655
315 Ga0075428_100050334 3300006844 Bacteria 4570
316 Ga0075428_100100614 3300006844 Bacteria 3152
317 Ga0075430_100031495 3300006846 Bacteria 4502
318 Ga0075430_100080919 3300006846 Bacteria 2721
319 Ga0075430_100265378 3300006846 Bacteria 1422
320 Ga0075430_100628550 3300006846 Bacteria 886
321 Ga0075431_100002538 3300006847 Bacteria 17614
322 Ga0075431_100094545 3300006847 Bacteria 3085
323 Ga0075431_100254902 3300006847 Bacteria 1782
324 Ga0075431_100441702 3300006847 Bacteria 1298
325 Ga0075433_10001745 3300006852 Bacteria 16240
326 Ga0075433_10005400 3300006852 Bacteria 10043
327 Ga0075433_10598806 3300006852 Bacteria 968
328 Ga0075434_100004864 3300006871 Bacteria 12170
329 Ga0075434_100028601 3300006871 Bacteria 5479
330 Ga0075434_100343182 3300006871 Bacteria 1514
331 Ga0075429_100037548 3300006880 Bacteria 4216
332 Ga0075429_100060402 3300006880 Bacteria 3302
333 Ga0075429_100131565 3300006880 Bacteria 2189
334 Ga0068865_100003035 3300006881 Bacteria 10039
335 Ga0068865_100017196 3300006881 Bacteria 4647
336 Ga0068865_100299399 3300006881 Bacteria 1287
337 Ga0075436_100014618 3300006914 Bacteria 5380
338 Ga0075436_100038092 3300006914 Bacteria 3319
339 Ga0075436_100044658 3300006914 Bacteria 3056
340 Ga0075436_100116338 3300006914 Bacteria 1868
341 Ga0097620_100000988 3300006931 Bacteria 29125
342 Ga0097620_100569165 3300006931 Bacteria 1227
343 Ga0075435_100010519 3300007076 Bacteria 6768
344 Ga0075435_100037487 3300007076 Bacteria 3860
345 Ga0075435_100052443 3300007076 Bacteria 3288
346 Ga0075435_100123380 3300007076 Bacteria 2163
347 Ga0075435_100281103 3300007076 Bacteria 1421
348 Ga0099795_10014807 3300007788 Bacteria 2427
349 Ga0105244_10144043 3300009036 Bacteria 1144
350 Ga0105244_10220680 3300009036 Bacteria 889
351 Ga0105250_10077450 3300009092 Bacteria 1346
352 Ga0105240_10073694 3300009093 Bacteria 4216
353 Ga0105240_10183491 3300009093 Bacteria 2467
354 Ga0105240_10205833 3300009093 Bacteria 2303
355 Ga0105240_10310807 3300009093 Bacteria 1800
356 Ga0105240_10482260 3300009093 Bacteria 1382
357 Ga0105240_10547464 3300009093 Bacteria 1281
358 Ga0105240_11176739 3300009093 Bacteria 813
359 Ga0111539_10012221 3300009094 Bacteria 10767
360 Ga0111539_10017956 3300009094 Bacteria 8762
361 Ga0111539_10063889 3300009094 Bacteria 4356
362 Ga0111539_10281772 3300009094 Bacteria 1934
363 Ga0111539_10711556 3300009094 Bacteria 1169
364 Ga0111539_11336403 3300009094 Bacteria 832
365 Ga0105245_10011237 3300009098 Bacteria 7795
366 Ga0105245_10132988 3300009098 Bacteria 2335
367 Ga0105245_10175078 3300009098 Bacteria 2046
368 Ga0105245_10290079 3300009098 Bacteria 1602
369 Ga0105247_10000737 3300009101 Bacteria 25281
370 Ga0105247_10001368 3300009101 Bacteria 17689
371 Ga0105247_10234964 3300009101 Bacteria 1246
372 Ga0105247_10262609 3300009101 Bacteria 1184
373 Ga0105247_10706670 3300009101 Bacteria 759
374 Ga0114129_10051143 3300009147 Bacteria 5802
375 Ga0114129_10122419 3300009147 Bacteria 3580
376 Ga0114129_10197230 3300009147 Bacteria 2729
377 Ga0114129_10242123 3300009147 Bacteria 2424
378 Ga0114129_10394526 3300009147 Bacteria 1825
379 Ga0114129_10404709 3300009147 Bacteria 1798
380 Ga0114129_10407325 3300009147 Bacteria 1791
381 Ga0105243_10029787 3300009148 Bacteria 4200
382 Ga0105243_10085833 3300009148 Bacteria 2580
383 Ga0105243_10088324 3300009148 Bacteria 2547
384 Ga0105243_10100798 3300009148 Bacteria 2397
385 Ga0105243_10682441 3300009148 Bacteria 999
386 Ga0105243_11345118 3300009148 Bacteria 733
387 Ga0105241_10002335 3300009174 Bacteria 14254
388 Ga0105241_10014047 3300009174 Bacteria 5869
389 Ga0105241_10016188 3300009174 Bacteria 5463
390 Ga0105241_10024062 3300009174 Bacteria 4522
391 Ga0105241_10041637 3300009174 Bacteria 3472
392 Ga0105241_10180978 3300009174 Bacteria 1749
393 Ga0105242_10012128 3300009176 Bacteria 6630
394 Ga0105242_10018436 3300009176 Bacteria 5456
395 Ga0105242_10638387 3300009176 Bacteria 1034
396 Ga0105242_10771680 3300009176 Bacteria 948
397 Ga0105242_11097111 3300009176 Bacteria 810
398 Ga0105242_11219632 3300009176 Bacteria 772
399 Ga0105248_10108818 3300009177 Bacteria 3125
400 Ga0105248_10442555 3300009177 Bacteria 1464
401 Ga0105248_10601915 3300009177 Bacteria 1240
402 Ga0105248_11373771 3300009177 Bacteria 799
403 Ga0105237_10003028 3300009545 Bacteria 20270
404 Ga0105237_10006900 3300009545 Bacteria 12523
405 Ga0105237_10071221 3300009545 Bacteria 3472
406 Ga0105237_10092975 3300009545 Bacteria 3005
407 Ga0105237_10380971 3300009545 Bacteria 1415
408 Ga0105237_10558912 3300009545 Bacteria 1151
409 Ga0105237_10629162 3300009545 Bacteria 1080
410 Ga0105238_10017449 3300009551 Bacteria 7295
411 Ga0105238_10026969 3300009551 Bacteria 5856
412 Ga0105238_10050679 3300009551 Bacteria 4179
413 Ga0105238_10053343 3300009551 Bacteria 4063
414 Ga0105238_10428381 3300009551 Bacteria 1318
415 Ga0105238_10900454 3300009551 Bacteria 903
416 Ga0105249_10000531 3300009553 Bacteria 35092
417 Ga0105249_10008319 3300009553 Bacteria 9032
418 Ga0105249_10070606 3300009553 Bacteria 3224
419 Ga0105249_10107309 3300009553 Bacteria 2635
420 Ga0105249_10166990 3300009553 Bacteria 2131
421 Ga0105249_10333549 3300009553 Bacteria 1531
422 Ga0105249_10370752 3300009553 Bacteria 1455
423 Ga0105249_10752003 3300009553 Bacteria 1037
424 Ga0105249_10772019 3300009553 Bacteria 1024
425 Ga0099796_10002097 3300010159 Bacteria 4273
426 Ga0105239_10010524 3300010375 Bacteria 10339
427 Ga0105239_10030053 3300010375 Bacteria 5975
428 Ga0105239_10067664 3300010375 Bacteria 3924
429 Ga0105239_10168067 3300010375 Bacteria 2452
430 Ga0105239_10937793 3300010375 Bacteria 994
431 Ga0105246_10015297 3300011119 Bacteria 4842
432 Ga0105246_10024383 3300011119 Bacteria 3930
433 Ga0105246_10095782 3300011119 Bacteria 2149
434 Ga0105246_10164786 3300011119 Bacteria 1692
435 Ga0105246_10215498 3300011119 Bacteria 1501
436 Ga0105246_10986868 3300011119 Bacteria 761
437 Ga0157373_10064010 3300013100 Bacteria 2603
438 Ga0157373_10102109 3300013100 Bacteria 2018
439 Ga0157371_10024584 3300013102 Bacteria 4396
440 Ga0157370_10019510 3300013104 Bacteria 6799
441 Ga0157370_10019637 3300013104 Bacteria 6769
442 Ga0157370_10110620 3300013104 Bacteria 2568
443 Ga0157370_10132278 3300013104 Bacteria 2327
444 Ga0157370_10395219 3300013104 Bacteria 1273
445 Ga0157370_10893728 3300013104 Bacteria 806
446 Ga0157369_10001030 3300013105 Bacteria 35205
447 Ga0157369_10093483 3300013105 Bacteria 3210
448 Ga0157369_10146006 3300013105 Bacteria 2501
449 Ga0157369_10185997 3300013105 Bacteria 2184
450 Ga0157369_10696279 3300013105 Bacteria 1046
451 Ga0157374_10175222 3300013296 Bacteria 2093
452 Ga0157374_10230288 3300013296 Bacteria 1820
453 Ga0157374_10391418 3300013296 Bacteria 1385
454 Ga0157378_10043214 3300013297 Bacteria 4001
455 Ga0157378_10231402 3300013297 Bacteria 1761
456 Ga0157378_10622154 3300013297 Bacteria 1093
457 Ga0163162_10054728 3300013306 Bacteria 4015
458 Ga0163162_10082841 3300013306 Bacteria 3280
459 Ga0163162_10117746 3300013306 Bacteria 2758
460 Ga0163162_10750552 3300013306 Bacteria 1095
461 Ga0157372_10026742 3300013307 Bacteria 6279
462 Ga0157372_10109363 3300013307 Bacteria 3165
463 Ga0157372_10135005 3300013307 Bacteria 2841
464 Ga0157372_10191024 3300013307 Bacteria 2372
465 Ga0157372_10991994 3300013307 Bacteria 973
466 Ga0157372_11213938 3300013307 Bacteria 871
467 Ga0157375_10001988 3300013308 Bacteria 17647
468 Ga0157375_10008047 3300013308 Bacteria 9226
469 Ga0157375_10143231 3300013308 Bacteria 2519
470 Ga0157375_10189394 3300013308 Bacteria 2212
471 Ga0157375_10976955 3300013308 Bacteria 987
472 Ga0163163_10097157 3300014325 Bacteria 2966
473 Ga0163163_10365068 3300014325 Bacteria 1500
474 Ga0163163_10416832 3300014325 Bacteria 1402
475 Ga0163163_10459326 3300014325 Bacteria 1334
476 Ga0163163_10646252 3300014325 Bacteria 1121
477 Ga0163163_11283878 3300014325 Bacteria 794
478 Ga0157380_10405808 3300014326 Bacteria 1294
479 Ga0157380_10504078 3300014326 Bacteria 1176
480 Ga0157380_10716256 3300014326 Bacteria 1008
481 Ga0182008_10054407 3300014497 Bacteria 1980
482 Ga0157377_10025352 3300014745 Bacteria 3162
483 Ga0157379_10000749 3300014968 Bacteria 26252
484 Ga0157379_10016989 3300014968 Bacteria 6405
485 Ga0157379_10075923 3300014968 Bacteria 3009
486 Ga0157379_10133417 3300014968 Bacteria 2236
487 Ga0157379_10290156 3300014968 Bacteria 1490
488 Ga0157379_10361360 3300014968 Bacteria 1330
489 Ga0157379_10734299 3300014968 Bacteria 929
490 Ga0157376_10003317 3300014969 Bacteria 11080
491 Ga0157376_10399975 3300014969 Bacteria 1328
492 Ga0182007_10035490 3300015262 Bacteria 1680
493 Ga0182007_10052757 3300015262 Bacteria 1340
494 Ga0182005_1092467 3300015265 Bacteria 842
495 Ga0183360_11619 3300015689 Bacteria 802
496 Ga0163161_10003533 3300017792 Bacteria 10931
497 Ga0163161_10025367 3300017792 Bacteria 4195
498 Ga0163161_10084722 3300017792 Bacteria 2338
499 Ga0163161_10264032 3300017792 Bacteria 1345
500 Ga0163161_10741409 3300017792 Bacteria 821
501 Ga0206355_1642619 3300020076 Bacteria 753
502 Ga0214544_1000020 3300021320 Bacteria 178560
503 Ga0214542_1000024 3300021321 Bacteria 191218
504 Ga0214545_1000011 3300021324 Bacteria 190550
505 Ga0214543_1000033 3300021327 Bacteria 190419
506 Ga0213872_10000436 3300021361 Bacteria 34190
507 Ga0213872_10001037 3300021361 Bacteria 19370
508 Ga0213872_10001313 3300021361 Bacteria 16489
509 Ga0213872_10026558 3300021361 Bacteria 2659
510 Ga0213872_10056877 3300021361 Bacteria 1771
511 Ga0213876_10009498 3300021384 Bacteria 5232
512 Ga0213871_10081219 3300021441 Bacteria 929
513 Ga0224712_10238004 3300022467 Bacteria 838
514 Ga0209563_101494 3300025230 Bacteria 6143
515 Ga0209646_1012674 3300025246 Bacteria 1291
516 Ga0209026_1000002 3300025250 Bacteria 1136158
517 Ga0209026_1029710 3300025250 Bacteria 813
518 Ga0209677_102419 3300025253 Bacteria 7054
519 Ga0209148_1000038 3300025254 Bacteria 493744
520 Ga0209759_1000062 3300025256 Bacteria 197996
521 Ga0209233_1000027 3300025261 Bacteria 652089
522 Ga0209233_1000421 3300025261 Bacteria 31634
523 Ga0209455_1000068 3300025272 Bacteria 310024
524 Ga0209676_1000082 3300025292 Bacteria 280400
525 Ga0209758_1000407 3300025297 Bacteria 73945
526 Ga0209758_1000648 3300025297 Bacteria 52785
527 Ga0209758_1000900 3300025297 Bacteria 40401
528 Ga0209758_1000952 3300025297 Bacteria 39040
529 Ga0209758_1005567 3300025297 Bacteria 9592
530 Ga0209758_1029931 3300025297 Bacteria 2264
531 Ga0209256_1011331 3300025299 Bacteria 3580
532 Ga0207426_1000466 3300025302 Bacteria 62533
533 Ga0207426_1049518 3300025302 Bacteria 1257
534 Ga0209257_1000453 3300025304 Bacteria 76813
535 Ga0209257_1000459 3300025304 Bacteria 75629
536 Ga0209257_1001445 3300025304 Bacteria 28079
537 Ga0207697_10063726 3300025315 Bacteria 1536
538 Ga0207697_10200825 3300025315 Bacteria 877
539 Ga0207656_10008565 3300025321 Bacteria 3769
540 Ga0207696_1074805 3300025711 Bacteria 939
541 Ga0207653_10001588 3300025885 Bacteria 7338
542 Ga0207653_10233721 3300025885 Bacteria 701
543 Ga0207692_10055751 3300025898 Bacteria 2025
544 Ga0207692_10318999 3300025898 Bacteria 950
545 Ga0207642_10029261 3300025899 Bacteria 2279
546 Ga0207642_10437371 3300025899 Bacteria 790
547 Ga0207710_10013792 3300025900 Bacteria 3402
548 Ga0207688_10273069 3300025901 Bacteria 1029
549 Ga0207680_10030082 3300025903 Bacteria 3058
550 Ga0207647_10004130 3300025904 Bacteria 10778
551 Ga0207647_10007855 3300025904 Bacteria 7674
552 Ga0207647_10026597 3300025904 Bacteria 3783
553 Ga0207647_10043340 3300025904 Bacteria 2817
554 Ga0207647_10081984 3300025904 Bacteria 1932
555 Ga0207647_10208481 3300025904 Bacteria 1129
556 Ga0207685_10007736 3300025905 Bacteria 3015
557 Ga0207685_10085006 3300025905 Bacteria 1319
558 Ga0207685_10115392 3300025905 Bacteria 1170
559 Ga0207699_10000247 3300025906 Bacteria 30409
560 Ga0207699_10006459 3300025906 Bacteria 5679
561 Ga0207699_10020990 3300025906 Bacteria 3511
562 Ga0207699_10037459 3300025906 Bacteria 2773
563 Ga0207645_10018132 3300025907 Bacteria 4638
564 Ga0207645_10046403 3300025907 Bacteria 2775
565 Ga0207645_10372579 3300025907 Bacteria 957
566 Ga0207705_10085846 3300025909 Bacteria 2299
567 Ga0207705_10108390 3300025909 Bacteria 2050
568 Ga0207705_10220589 3300025909 Bacteria 1440
569 Ga0207705_10235580 3300025909 Bacteria 1393
570 Ga0207654_10028657 3300025911 Bacteria 3037
571 Ga0207654_10032030 3300025911 Bacteria 2900
572 Ga0207707_10056300 3300025912 Bacteria 3421
573 Ga0207707_10111346 3300025912 Bacteria 2393
574 Ga0207707_10154670 3300025912 Bacteria 2006
575 Ga0207707_10171728 3300025912 Bacteria 1895
576 Ga0207707_10232803 3300025912 Bacteria 1603
577 Ga0207707_10546335 3300025912 Bacteria 984
578 Ga0207695_10080996 3300025913 Bacteria 3287
579 Ga0207695_10137937 3300025913 Bacteria 2391
580 Ga0207695_10266602 3300025913 Bacteria 1609
581 Ga0207695_10359508 3300025913 Bacteria 1342
582 Ga0207671_10001115 3300025914 Bacteria 32386
583 Ga0207671_10028628 3300025914 Bacteria 4162
584 Ga0207671_10033498 3300025914 Bacteria 3821
585 Ga0207671_10098471 3300025914 Bacteria 2212
586 Ga0207671_10116914 3300025914 Bacteria 2035
587 Ga0207671_10157615 3300025914 Bacteria 1757
588 Ga0207671_10447878 3300025914 Bacteria 1028
589 Ga0207693_10000452 3300025915 Bacteria 37613
590 Ga0207693_10010567 3300025915 Bacteria 7489
591 Ga0207693_10328403 3300025915 Bacteria 1197
592 Ga0207663_10024121 3300025916 Bacteria 3500
593 Ga0207663_10049118 3300025916 Bacteria 2615
594 Ga0207663_10070876 3300025916 Bacteria 2247
595 Ga0207660_10067495 3300025917 Bacteria 2590
596 Ga0207660_10258532 3300025917 Bacteria 1376
597 Ga0207662_10002336 3300025918 Bacteria 9507
598 Ga0207657_10000216 3300025919 Bacteria 60001
599 Ga0207657_10007456 3300025919 Bacteria 11217
600 Ga0207657_10114352 3300025919 Bacteria 2225
601 Ga0207657_10182122 3300025919 Bacteria 1698
602 Ga0207649_10000746 3300025920 Bacteria 21330
603 Ga0207649_10003062 3300025920 Bacteria 9185
604 Ga0207649_10103220 3300025920 Bacteria 1891
605 Ga0207649_10594945 3300025920 Bacteria 850
606 Ga0207652_10011743 3300025921 Bacteria 7069
607 Ga0207652_10096405 3300025921 Bacteria 2606
608 Ga0207646_10017030 3300025922 Bacteria 6812
609 Ga0207681_10008312 3300025923 Bacteria 6347
610 Ga0207681_10401768 3300025923 Bacteria 1107
611 Ga0207681_10487979 3300025923 Bacteria 1007
612 Ga0207694_10013968 3300025924 Bacteria 6055
613 Ga0207694_10053540 3300025924 Bacteria 3129
614 Ga0207694_10074985 3300025924 Bacteria 2648
615 Ga0207694_10370236 3300025924 Bacteria 1188
616 Ga0207694_10410411 3300025924 Bacteria 1127
617 Ga0207650_10029186 3300025925 Bacteria 3962
618 Ga0207650_10377393 3300025925 Bacteria 1170
619 Ga0207659_10186178 3300025926 Bacteria 1649
620 Ga0207659_10204786 3300025926 Bacteria 1578
621 Ga0207659_10304953 3300025926 Bacteria 1309
622 Ga0207659_10378426 3300025926 Bacteria 1180
623 Ga0207687_10073987 3300025927 Bacteria 2441
624 Ga0207687_10373717 3300025927 Bacteria 1166
625 Ga0207687_10585649 3300025927 Bacteria 939
626 Ga0207700_10000005 3300025928 Bacteria 394836
627 Ga0207700_10858763 3300025928 Bacteria 812
628 Ga0207664_10029550 3300025929 Bacteria 4176
629 Ga0207664_10067335 3300025929 Bacteria 2873
630 Ga0207664_10385348 3300025929 Bacteria 1245
631 Ga0207664_10659262 3300025929 Bacteria 941
632 Ga0207664_11151621 3300025929 Bacteria 692
633 Ga0207644_10048242 3300025931 Bacteria 3043
634 Ga0207644_10654242 3300025931 Bacteria 875
635 Ga0207690_10020548 3300025932 Bacteria 4082
636 Ga0207690_10044955 3300025932 Bacteria 2914
637 Ga0207706_10004343 3300025933 Bacteria 13311
638 Ga0207706_10023201 3300025933 Bacteria 5573
639 Ga0207706_10193087 3300025933 Bacteria 1787
640 Ga0207706_10326748 3300025933 Bacteria 1334
641 Ga0207686_10009840 3300025934 Bacteria 5197
642 Ga0207686_10287222 3300025934 Bacteria 1217
643 Ga0207686_10559218 3300025934 Bacteria 895
644 Ga0207709_10061448 3300025935 Bacteria 2348
645 Ga0207709_10166159 3300025935 Bacteria 1544
646 Ga0207709_10343431 3300025935 Bacteria 1124
647 Ga0207709_10764232 3300025935 Bacteria 778
648 Ga0207670_10013288 3300025936 Bacteria 4848
649 Ga0207670_10085302 3300025936 Bacteria 2219
650 Ga0207670_10984073 3300025936 Bacteria 709
651 Ga0207669_10006682 3300025937 Bacteria 5288
652 Ga0207669_10094332 3300025937 Bacteria 1958
653 Ga0207704_10002567 3300025938 Bacteria 8192
654 Ga0207704_10020922 3300025938 Bacteria 3473
655 Ga0207704_10480338 3300025938 Bacteria 998
656 Ga0207665_10000221 3300025939 Bacteria 38707
657 Ga0207665_10074793 3300025939 Bacteria 2319
658 Ga0207691_10005941 3300025940 Bacteria 11789
659 Ga0207691_10216278 3300025940 Bacteria 1663
660 Ga0207711_10064180 3300025941 Bacteria 3172
661 Ga0207689_10036092 3300025942 Bacteria 4104
662 Ga0207689_10160394 3300025942 Bacteria 1853
663 Ga0207689_10166143 3300025942 Bacteria 1818
664 Ga0207689_10394632 3300025942 Bacteria 1153
665 Ga0207679_10013396 3300025945 Bacteria 5375
666 Ga0207667_10093222 3300025949 Bacteria 3110
667 Ga0207667_10186802 3300025949 Bacteria 2127
668 Ga0207667_10200984 3300025949 Bacteria 2044
669 Ga0207667_10211185 3300025949 Bacteria 1989
670 Ga0207667_10559828 3300025949 Bacteria 1156
671 Ga0207667_10593846 3300025949 Bacteria 1117
672 Ga0207651_10002858 3300025960 Bacteria 8323
673 Ga0207712_10005342 3300025961 Bacteria 8112
674 Ga0207712_10024603 3300025961 Bacteria 3990
675 Ga0207712_10063511 3300025961 Bacteria 2629
676 Ga0207712_10108912 3300025961 Bacteria 2074
677 Ga0207712_10195529 3300025961 Bacteria 1599
678 Ga0207712_10219331 3300025961 Bacteria 1520
679 Ga0207712_10304584 3300025961 Bacteria 1309
680 Ga0207712_10773934 3300025961 Bacteria 842
681 Ga0207668_10013005 3300025972 Bacteria 5114
682 Ga0207668_10057577 3300025972 Bacteria 2712
683 Ga0207668_10082339 3300025972 Bacteria 2337
684 Ga0207668_10173086 3300025972 Bacteria 1695
685 Ga0207668_10230094 3300025972 Bacteria 1494
686 Ga0207668_10760481 3300025972 Bacteria 855
687 Ga0207640_10006200 3300025981 Bacteria 6547
688 Ga0207640_10424385 3300025981 Bacteria 1089
689 Ga0207658_10119156 3300025986 Bacteria 2101
690 Ga0207658_10246838 3300025986 Bacteria 1515
691 Ga0207658_10287354 3300025986 Bacteria 1412
692 Ga0207658_10455791 3300025986 Bacteria 1133
693 Ga0207658_10575822 3300025986 Bacteria 1009
694 Ga0207677_10100552 3300026023 Bacteria 2126
695 Ga0207677_10109511 3300026023 Bacteria 2054
696 Ga0207703_10011279 3300026035 Bacteria 6950
697 Ga0207703_10077424 3300026035 Bacteria 2761
698 Ga0207703_10084220 3300026035 Bacteria 2658
699 Ga0207703_10152980 3300026035 Bacteria 2013
700 Ga0207703_10239751 3300026035 Bacteria 1630
701 Ga0207703_10555384 3300026035 Bacteria 1083
702 Ga0207639_10002485 3300026041 Bacteria 12354
703 Ga0207639_10004167 3300026041 Bacteria 9731
704 Ga0207639_10004947 3300026041 Bacteria 8977
705 Ga0207639_10313166 3300026041 Bacteria 1391
706 Ga0207639_10341915 3300026041 Bacteria 1334
707 Ga0207639_10376317 3300026041 Bacteria 1274
708 Ga0207639_11272816 3300026041 Bacteria 690
709 Ga0207678_10000074 3300026067 Bacteria 79745
710 Ga0207678_10009216 3300026067 Bacteria 8685
711 Ga0207678_10010215 3300026067 Bacteria 8240
712 Ga0207678_10017036 3300026067 Bacteria 6380
713 Ga0207678_10104636 3300026067 Bacteria 2415
714 Ga0207678_10131972 3300026067 Bacteria 2131
715 Ga0207678_10161833 3300026067 Bacteria 1911
716 Ga0207678_10175750 3300026067 Bacteria 1828
717 Ga0207678_10694159 3300026067 Bacteria 896
718 Ga0207678_10695720 3300026067 Bacteria 894
719 Ga0207678_11032402 3300026067 Bacteria 728
720 Ga0207708_10002195 3300026075 Bacteria 14412
721 Ga0207708_10002674 3300026075 Bacteria 13095
722 Ga0207708_10144281 3300026075 Bacteria 1870
723 Ga0207708_10185551 3300026075 Bacteria 1653
724 Ga0207702_10000159 3300026078 Bacteria 79906
725 Ga0207702_10151474 3300026078 Bacteria 2110
726 Ga0207702_10235157 3300026078 Bacteria 1714
727 Ga0207702_10278184 3300026078 Bacteria 1581
728 Ga0207702_10757700 3300026078 Bacteria 958
729 Ga0207641_10033600 3300026088 Bacteria 4261
730 Ga0207641_10268125 3300026088 Bacteria 1601
731 Ga0207648_10083551 3300026089 Bacteria 2785
732 Ga0207648_10100658 3300026089 Bacteria 2532
733 Ga0207648_10115039 3300026089 Bacteria 2363
734 Ga0207648_10124445 3300026089 Bacteria 2268
735 Ga0207648_10361362 3300026089 Bacteria 1310
736 Ga0207676_10039841 3300026095 Bacteria 3597
737 Ga0207676_10149585 3300026095 Bacteria 2009
738 Ga0207674_10000335 3300026116 Bacteria 60219
739 Ga0207674_10015555 3300026116 Bacteria 8356
740 Ga0207674_10023181 3300026116 Bacteria 6653
741 Ga0207674_10120421 3300026116 Bacteria 2592
742 Ga0207674_10613208 3300026116 Bacteria 1051
743 Ga0207675_100000039 3300026118 Bacteria 91886
744 Ga0207675_100053803 3300026118 Bacteria 3755
745 Ga0207675_100274569 3300026118 Bacteria 1636
746 Ga0207683_10000595 3300026121 Bacteria 33293
747 Ga0207683_10073841 3300026121 Bacteria 3017
748 Ga0207683_10080590 3300026121 Bacteria 2888
749 Ga0207683_10169014 3300026121 Bacteria 1980
750 Ga0207698_10034219 3300026142 Bacteria 3701
751 Ga0207698_10470470 3300026142 Bacteria 1217
752 Ga0207698_11452894 3300026142 Bacteria 701
753 Ga0209389_1000011 3300027296 Bacteria 223265
754 Ga0209389_1000025 3300027296 Bacteria 149588
755 Ga0209589_1000018 3300027357 Bacteria 192614
756 Ga0209589_1000066 3300027357 Bacteria 100795
757 Ga0209489_100017 3300027361 Bacteria 223265
758 Ga0209489_100026 3300027361 Bacteria 192614
759 Ga0209489_100030 3300027361 Bacteria 185999
760 Ga0209700_100027 3300027363 Bacteria 223462
761 Ga0209700_100035 3300027363 Bacteria 192614
762 Ga0209179_1005602 3300027512 Bacteria 1977
763 Ga0209813_10000760 3300027866 Bacteria 7378
764 Ga0209813_10005375 3300027866 Bacteria 3104
765 Ga0209813_10044758 3300027866 Bacteria 1361
766 Ga0209813_10059953 3300027866 Bacteria 1213
767 Ga0209974_10087936 3300027876 Bacteria 1075
768 Ga0207428_10008033 3300027907 Bacteria 9573
769 Ga0207428_10043605 3300027907 Bacteria 3622
770 Ga0207428_10078442 3300027907 Bacteria 2584
771 Ga0207428_10172000 3300027907 Bacteria 1640
772 Ga0207428_10195403 3300027907 Bacteria 1524
773 Ga0207428_10666539 3300027907 Bacteria 746
774 Ga0268266_10000873 3300028379 Bacteria 39154
775 Ga0268266_10087621 3300028379 Bacteria 2724
776 Ga0268266_10129837 3300028379 Bacteria 2253
777 Ga0268266_10238915 3300028379 Bacteria 1676
778 Ga0268265_10001274 3300028380 Bacteria 21743
779 Ga0268265_10031136 3300028380 Bacteria 3851
780 Ga0268265_10085096 3300028380 Bacteria 2508
781 Ga0268265_10298580 3300028380 Bacteria 1449
782 Ga0268265_10363619 3300028380 Bacteria 1325
783 Ga0268265_11128615 3300028380 Bacteria 779
784 Ga0268264_10005176 3300028381 Bacteria 11051
785 Ga0268264_10021651 3300028381 Bacteria 5249
786 Ga0268264_10024677 3300028381 Bacteria 4910
787 Ga0268264_10101089 3300028381 Bacteria 2506
788 Ga0268264_10316793 3300028381 Bacteria 1473
789 Ga0268264_10607753 3300028381 Bacteria 1078
790 Ga0265318_10037477 3300028577 Bacteria 1857
791 Ga0265318_10163334 3300028577 Bacteria 816
792 Ga0307517_10175344 3300028786 Bacteria 1398
793 Ga0307515_10298722 3300028794 Bacteria 1298
794 Ga0265324_10003033 3300029957 Bacteria 8214
795 Ga0265328_10006595 3300031239 Bacteria 4887
796 Ga0265328_10022262 3300031239 Bacteria 2413
797 Ga0265320_10002231 3300031240 Bacteria 13590
798 Ga0265325_10049914 3300031241 Bacteria 2157
799 Ga0265340_10001518 3300031247 Bacteria 13312
800 Ga0265340_10075342 3300031247 Bacteria 1594
801 Ga0265340_10091620 3300031247 Bacteria 1420
802 Ga0265340_10119958 3300031247 Bacteria 1211
803 Ga0265339_10096644 3300031249 Bacteria 1541
804 Ga0265331_10000002 3300031250 Bacteria 511481
805 Ga0265331_10000017 3300031250 Bacteria 269978
806 Ga0265331_10000314 3300031250 Bacteria 52982
807 Ga0265331_10000478 3300031250 Bacteria 38316
808 Ga0265331_10009324 3300031250 Bacteria 5517
809 Ga0265331_10016612 3300031250 Bacteria 3861
810 Ga0265331_10162272 3300031250 Bacteria 1013
811 Ga0265331_10191643 3300031250 Bacteria 922
812 Ga0265327_10000033 3300031251 Bacteria 317182
813 Ga0265316_10005893 3300031344 Bacteria 11812
814 Ga0265316_10017819 3300031344 Bacteria 6124
815 Ga0265316_10143150 3300031344 Bacteria 1795
816 Ga0307513_10025773 3300031456 Bacteria 6801
817 Ga0307513_10343306 3300031456 Bacteria 1243
818 Ga0307509_10524222 3300031507 Bacteria 866
819 Ga0307408_100316171 3300031548 Bacteria 1314
820 Ga0265313_10002202 3300031595 Bacteria 17238
821 Ga0265314_10018836 3300031711 Bacteria 5363
822 Ga0265314_10039537 3300031711 Bacteria 3396
823 Ga0265314_10047684 3300031711 Bacteria 3013
824 Ga0265314_10165830 3300031711 Bacteria 1339
825 Ga0265342_10006480 3300031712 Bacteria 8717
826 Ga0307516_10059535 3300031730 Bacteria 3714
827 Ga0307413_10123279 3300031824 Bacteria 1759
828 Ga0307410_10847323 3300031852 Bacteria 780
829 Ga0307406_10000774 3300031901 Bacteria 17940
830 Ga0307406_10481156 3300031901 Bacteria 1003
831 Ga0307406_10665748 3300031901 Bacteria 866
832 Ga0307412_10003682 3300031911 Bacteria 8515
833 Ga0307412_10120408 3300031911 Bacteria 1889
834 Ga0307412_10632544 3300031911 Bacteria 910
835 Ga0307409_100122190 3300031995 Bacteria 2208
836 Ga0307409_100402903 3300031995 Bacteria 1307
837 Ga0307409_100613668 3300031995 Bacteria 1077
838 Ga0307409_100933318 3300031995 Bacteria 883
839 Ga0307416_101678955 3300032002 Bacteria 740
840 Ga0307414_10014861 3300032004 Bacteria 4684
841 Ga0307414_10136883 3300032004 Bacteria 1911
842 Ga0307414_10158594 3300032004 Bacteria 1794
843 Ga0307414_10276399 3300032004 Bacteria 1409
844 Ga0307414_10449737 3300032004 Bacteria 1129
845 Ga0307411_10187376 3300032005 Bacteria 1576
846 Ga0307411_10621267 3300032005 Bacteria 932
847 Ga0307415_101269811 3300032126 Bacteria 696
848 Ga0316583_10025586 3300032133 Bacteria 2107
849 Ga0316585_10018624 3300032137 Bacteria 2108
850 Ga0316593_10027378 3300032168 Bacteria 1829
851 Ga0316593_10197251 3300032168 Bacteria 743
852 Ga0307510_10010422 3300033180 Bacteria 11039
853 Ga0307510_10081949 3300033180 Bacteria 3124
854 Ga0307510_10190048 3300033180 Bacteria 1603
855 Ga0307510_10292534 3300033180 Bacteria 1094
856 Ga0316592_1022506 3300033524 Bacteria 1348
857 Ga0316592_1042795 3300033524 Bacteria 1004
858 Ga0316586_1006026 3300033527 Bacteria 1729
859 Ga0316588_1017308 3300033528 Bacteria 1605
860 Ga0316587_1051103 3300033529 Bacteria 757
861 Ga0316596_1027015 3300033541 Bacteria 1480
862 Ga0373928_0039814 3300035084 Bacteria 1075
863 Ga0373940_0124594 3300035088 Bacteria 802
864 Ga0373949_0003058 3300035090 Bacteria 4095
865 Ga0373949_0036948 3300035090 Bacteria 1186
866 Ga0373939_0005251 3300035114 Bacteria 3080
867 Ga0373939_0007825 3300035114 Bacteria 2604
868 Ga0373939_0084871 3300035114 Bacteria 1059
869 Ga0373941_0010797 3300035115 Bacteria 2344
870 Ga0373941_0220077 3300035115 Bacteria 729
871 Ga0373953_0120779 3300035117 Bacteria 1113
872 Ga0373954_0047670 3300035118 Bacteria 2006
873 Ga0373954_0207274 3300035118 Bacteria 963
874 Ga0373956_0023275 3300035119 Bacteria 2657
875 Ga0373957_0181984 3300035120 Bacteria 871
876 Ga0373960_0007243 3300035121 Bacteria 2624
877 Ga0373960_0013830 3300035121 Bacteria 2032
878 Ga0373960_0069484 3300035121 Bacteria 1086
879 Ga0373960_0073403 3300035121 Bacteria 1063
880 Ga0373943_0108265 3300035170 Bacteria 1462
881 Ga0373955_0038963 3300035172 Bacteria 2534
882 Ga0373942_0009911 3300035207 Bacteria 2233
883 Ga0373942_0021023 3300035207 Bacteria 1643
884 Ga0373961_0010094 3300035241 Bacteria 2323
885 Ga0373961_0066618 3300035241 Bacteria 1105
886 Ga0373961_0071723 3300035241 Bacteria 1072
887 Ga0373962_0001511 3300035242 Bacteria 5502
888 Ga0373931_0001319 3300035691 Bacteria 10621
889 Ga0373931_0004510 3300035691 Bacteria 6368
890 Ga0373931_0020752 3300035691 Bacteria 3290
891 Ga0373931_0167002 3300035691 Bacteria 1294
892 Ga0373931_0214314 3300035691 Bacteria 1156
893 Ga0373935_0001191 3300035692 Bacteria 14308
894 Ga0373935_0012370 3300035692 Bacteria 5136
895 Ga0373935_0349075 3300035692 Bacteria 1054
896 Ga0373927_0011783 3300035695 Bacteria 5823
897 Ga0373927_0197512 3300035695 Bacteria 1320
898 Ga0373927_0251341 3300035695 Bacteria 1162
899 Ga0373947_0067957 3300035725 Bacteria 2178
900 Ga0373947_0472092 3300035725 Bacteria 851
901 Ga0373937_0044626 3300036401 Bacteria 4050
902 Ga0373937_0096130 3300036401 Bacteria 2747
903 Ga0373937_0345739 3300036401 Bacteria 1408
904 Ga0316582_0232890 3300036647 Bacteria 1261
905 Ga0316584_0061029 3300036712 Bacteria 2824
906 Ga0373925_0016064 3300037068 Bacteria 5420
907 Ga0373925_0023175 3300037068 Bacteria 4530
908 Ga0395899_0000059 3300037312 Bacteria 213004
909 Ga0395899_0004247 3300037312 Bacteria 11219
910 Ga0395899_0406994 3300037312 Bacteria 899
911 Ga0395899_0506796 3300037312 Bacteria 782
912 Ga0395900_0000017 3300037418 Bacteria 369602
913 Ga0395900_0017966 3300037418 Bacteria 7220
914 Ga0395900_0043669 3300037418 Bacteria 4620
915 Ga0395900_0052008 3300037418 Bacteria 4218
916 Ga0395900_0249169 3300037418 Bacteria 1778
917 Ga0395900_0319674 3300037418 Bacteria 1533
918 Ga0395898_0000030 3300037466 Bacteria 369577
919 Ga0395898_0182998 3300037466 Bacteria 2002
920 Ga0395898_0252953 3300037466 Bacteria 1680
921 Ga0395898_0266730 3300037466 Bacteria 1633
922 Ga0395905_0000056 3300037471 Bacteria 209230
923 Ga0395905_0000155 3300037471 Bacteria 112355
924 Ga0395905_0003237 3300037471 Bacteria 17510
925 Ga0395905_0015966 3300037471 Bacteria 7137
926 Ga0395905_0259806 3300037471 Bacteria 1621
927 Ga0316581_0019637 3300037588 Bacteria 1972
928 Ga0436364_0560002 3300037853 Bacteria 93566
929 Ga0436364_1552215 3300037853 Bacteria 8392
930 Ga0395901_0000015 3300038443 Bacteria 373388
931 Ga0395901_0006827 3300038443 Bacteria 11526
932 Ga0395901_0046022 3300038443 Bacteria 4530
933 Ga0395901_0109187 3300038443 Bacteria 2905
934 Ga0395901_0250125 3300038443 Bacteria 1847
935 Ga0395901_0330958 3300038443 Bacteria 1575
936 Ga0395901_0437297 3300038443 Bacteria 1339
937 Ga0436365_0093392 3300039437 Bacteria 124820
938 Ga0436365_0226250 3300039437 Bacteria 1000
939 Ga0436365_0650967 3300039437 Bacteria 3831
940 Ga0436365_0761391 3300039437 Bacteria 1591
941 Ga0436365_1477315 3300039437 Bacteria 937
942 Ga0436360_0445476 3300039438 Bacteria 730
943 Ga0436360_0815295 3300039438 Bacteria 3113
944 Ga0436360_0912999 3300039438 Bacteria 1327
945 Ga0436360_0931197 3300039438 Bacteria 902
946 Ga0436360_1214702 3300039438 Bacteria 1191
947 Ga0436361_0112287 3300039447 Bacteria 22106
948 Ga0436361_0301054 3300039447 Bacteria 795
949 Ga0436361_0325755 3300039447 Bacteria 54753
950 Ga0436361_0578839 3300039447 Bacteria 1501
951 Ga0436361_0833838 3300039447 Bacteria 2497
952 Ga0436363_1420920 3300039450 Bacteria 873
953 Ga0436362_0171928 3300039453 Bacteria 764
954 Ga0436362_0528243 3300039453 Bacteria 1851
955 Ga0439438_063402 3300041405 Bacteria 923
956 Ga0439453_0023489 3300041408 Bacteria 1126
957 Ga0451789_0454652 3300041443 Bacteria 1425
958 Ga0451797_0027779 3300041453 Bacteria 1261
959 Ga0451807_2375559 3300041486 Bacteria 1017
960 Ga0451853_3496765 3300041512 Bacteria 1112
961 Ga0439445_0067478 3300042004 Bacteria 986
962 Ga0439448_0011064 3300042005 Bacteria 2684
963 Ga0450900_046263 3300042136 Bacteria 660
964 Ga0439459_0077406 3300042438 Bacteria 780
965 Ga0450893_0012777 3300042532 Bacteria 1395
966 Ga0450901_005797 3300042533 Bacteria 1269
967 Ga0451577_0289675 3300042876 Bacteria 1484
968 Ga0439440_0050739 3300042993 Bacteria 1036
969 Ga0466969_0000296 3300044656 Bacteria 27238
970 Ga0466972_0000261 3300044658 Bacteria 34759
971 Ga0466972_0011899 3300044658 Bacteria 4371
972 Ga0466965_0052182 3300044683 Bacteria 2030
973 Ga0466966_0000163 3300044684 Bacteria 43388
974 Ga0466961_0014752 3300044693 Bacteria 5020
975 Ga0466961_0147439 3300044693 Bacteria 1471
976 Ga0466963_0027220 3300044694 Bacteria 3659
977 Ga0466963_0387747 3300044694 Bacteria 985
978 Ga0453684_0012729 3300044712 Bacteria 13813
979 Ga0453684_0037239 3300044712 Bacteria 6680
980 Ga0453684_0076864 3300044712 Bacteria 4189
981 Ga0453684_0363809 3300044712 Bacteria 1628
982 Ga0466971_0001744 3300044719 Bacteria 9214
983 Ga0466971_0093306 3300044719 Bacteria 1379
984 Ga0466970_0005908 3300044765 Bacteria 6098
985 Ga0466957_0015256 3300044842 Bacteria 4488
986 Ga0466957_0052318 3300044842 Bacteria 2486
987 Ga0466957_0066260 3300044842 Bacteria 2226
988 Ga0466957_0384168 3300044842 Bacteria 958
989 Ga0466960_0039510 3300044901 Bacteria 2226
990 Ga0466959_0000071 3300045049 Bacteria 68513
991 Ga0466959_0025270 3300045049 Bacteria 4401
992 Ga0451576_0000040 3300045051 Bacteria 349778
993 Ga0451576_0008100 3300045051 Bacteria 12386
994 Ga0451576_0253480 3300045051 Bacteria 1839
995 Ga0451576_0804553 3300045051 Bacteria 987
996 Ga0466958_0000501 3300045836 Bacteria 16450
997 Ga0466958_0000962 3300045836 Bacteria 13039
998 Ga0466958_0444992 3300045836 Bacteria 839
999 Ga0495627_119531 3300046453 Bacteria 745
1000 Ga0495603_0000012 3300046455 Bacteria 69707
1001 Ga0495590_0036195 3300046457 Bacteria 1722
1002 Ga0495590_0189340 3300046457 Bacteria 754
1003 Ga0495629_0000204 3300046459 Bacteria 52811
1004 Ga0495629_0026771 3300046459 Bacteria 4094
1005 Ga0495629_0036745 3300046459 Bacteria 3456
1006 Ga0495638_0009691 3300046460 Bacteria 6733
1007 Ga0495638_0219694 3300046460 Bacteria 1063
1008 Ga0495638_0255997 3300046460 Bacteria 963
1009 Ga0495651_0068227 3300046462 Bacteria 2711
1010 Ga0495650_0048140 3300046471 Bacteria 1779
1011 Ga0495580_0003848 3300046472 Bacteria 12701
1012 Ga0495580_0031069 3300046472 Bacteria 3863
1013 Ga0495582_0000956 3300046473 Bacteria 16123
1014 Ga0495582_0038633 3300046473 Bacteria 2627
1015 Ga0495605_0191326 3300046474 Bacteria 895
1016 Ga0495639_0001489 3300046475 Bacteria 10436
1017 Ga0495664_0028736 3300046477 Bacteria 3248
1018 Ga0495584_0023311 3300046491 Bacteria 3139
1019 Ga0495584_0037100 3300046491 Bacteria 2462
1020 Ga0495584_0091890 3300046491 Bacteria 1531
1021 Ga0495584_0237686 3300046491 Bacteria 926
1022 Ga0495585_0196945 3300046492 Bacteria 1028
1023 Ga0495594_0000041 3300046499 Bacteria 56922
1024 Ga0495594_0309629 3300046499 Bacteria 900
1025 Ga0495607_0117284 3300046501 Bacteria 1403
1026 Ga0495606_0038000 3300046507 Bacteria 3261
1027 Ga0495608_0383695 3300046511 Bacteria 861
1028 Ga0495608_0388541 3300046511 Bacteria 855
1029 Ga0495616_0228102 3300046513 Bacteria 808
1030 Ga0495618_0013081 3300046514 Bacteria 5045
1031 Ga0495618_0333782 3300046514 Bacteria 937
1032 Ga0495618_0364554 3300046514 Bacteria 889
1033 Ga0495630_0039243 3300046517 Bacteria 3542
1034 Ga0495637_0184190 3300046520 Bacteria 773
1035 Ga0495643_0058993 3300046522 Bacteria 2040
1036 Ga0495643_0128777 3300046522 Bacteria 1272
1037 Ga0495643_0189496 3300046522 Bacteria 994
1038 Ga0495663_0068226 3300046525 Bacteria 1129
1039 Ga0495666_0220748 3300046526 Bacteria 868
1040 Ga0495652_0199035 3300046529 Bacteria 1522
1041 Ga0495665_0014774 3300046531 Bacteria 4208
1042 Ga0495640_0373425 3300046533 Bacteria 878
1043 Ga0495587_0211124 3300046536 Bacteria 1096
1044 Ga0495587_0432184 3300046536 Bacteria 730
1045 Ga0495597_0046332 3300046542 Bacteria 1927
1046 Ga0495622_0001150 3300046557 Bacteria 13782
1047 Ga0495622_0016396 3300046557 Bacteria 3449
1048 Ga0495622_0032559 3300046557 Bacteria 2434
1049 Ga0495633_0002153 3300046558 Bacteria 14119
1050 Ga0495633_0071165 3300046558 Bacteria 1623
1051 Ga0495667_0159425 3300046559 Bacteria 1451
1052 Ga0495668_0176722 3300046616 Bacteria 1170
1053 Ga0495634_0109488 3300046642 Bacteria 1777
1054 Ga0495625_0125992 3300046660 Bacteria 1739
1055 Ga0495625_0283446 3300046660 Bacteria 1065
1056 Ga0495635_0010103 3300046663 Bacteria 6600
1057 Ga0495657_0017867 3300046675 Bacteria 5144
1058 Ga0495657_0268283 3300046675 Bacteria 1024
1059 Ga0495646_0066665 3300046680 Bacteria 2129
1060 Ga0495646_0387902 3300046680 Bacteria 727
1061 Ga0495658_0003944 3300046683 Bacteria 7323
1062 Ga0495658_0271406 3300046683 Bacteria 1069
1063 Ga0495658_0328719 3300046683 Bacteria 970
1064 Ga0495658_0534842 3300046683 Bacteria 750
1065 Ga0495669_0106417 3300046684 Bacteria 1307
1066 Ga0495613_0000075 3300046689 Bacteria 97894
1067 Ga0495613_0055177 3300046689 Bacteria 2920
1068 Ga0495624_0076666 3300046690 Bacteria 2074
1069 Ga0495671_0239979 3300046692 Bacteria 876
1070 Ga0495649_0064277 3300046694 Bacteria 1971
1071 Ga0495600_0022581 3300046809 Bacteria 4041
1072 Ga0495581_0000422 3300047315 Bacteria 21439
1073 Ga0495604_0004947 3300047317 Bacteria 10564
1074 Ga0495604_0303634 3300047317 Bacteria 1071
1075 Ga0495674_0245362 3300047319 Bacteria 1475
1076 Ga0495676_0082205 3300047321 Bacteria 2438
1077 Ga0495680_0036041 3300047322 Bacteria 3977
1078 Ga0495683_0189370 3300047323 Bacteria 934
1079 Ga0495683_0204248 3300047323 Bacteria 889
1080 Ga0495687_139709 3300047443 Bacteria 844
1081 Ga0495677_0107704 3300047445 Bacteria 1058
1082 Ga0495673_0004418 3300047469 Bacteria 8798
1083 Ga0495681_0233668 3300047470 Bacteria 732
1084 Ga0495686_0086340 3300047472 Bacteria 1910
1085 Ga0495686_0121506 3300047472 Bacteria 1556
1086 Ga0495686_0164418 3300047472 Bacteria 1294
1087 Ga0495593_0002009 3300047673 Bacteria 12133
1088 Ga0495593_0120514 3300047673 Bacteria 1335
1089 Ga0495602_0036625 3300048088 Bacteria 4564
1090 Ga0495602_0255334 3300048088 Bacteria 1304
1091 Ga0495614_0021119 3300048089 Bacteria 2814
1092 Ga0495626_0099393 3300048091 Bacteria 1270
1093 Ga0495626_0250349 3300048091 Bacteria 711
1094 Ga0496100_0003333 3300048903 Bacteria 8364
1095 Ga0496100_0020476 3300048903 Bacteria 3966
1096 Ga0496100_0036049 3300048903 Bacteria 3117
1097 Ga0496100_0382342 3300048903 Bacteria 1069
1098 Ga0496101_0001105 3300048904 Bacteria 16040
1099 Ga0496101_0011382 3300048904 Bacteria 5902
1100 Ga0496101_0073681 3300048904 Bacteria 2508
1101 Ga0496101_0149709 3300048904 Bacteria 1784
1102 Ga0496101_0329000 3300048904 Bacteria 1199
1103 Ga0496102_0022644 3300048905 Bacteria 5568
1104 Ga0496102_0032247 3300048905 Bacteria 4707
1105 Ga0496102_0117953 3300048905 Bacteria 2477
1106 Ga0496102_0128264 3300048905 Bacteria 2372
1107 Ga0496102_0134898 3300048905 Bacteria 2312
1108 Ga0496102_0178287 3300048905 Bacteria 2001
1109 Ga0496102_0325718 3300048905 Bacteria 1447
1110 Ga0496102_0335632 3300048905 Bacteria 1423
1111 Ga0496102_0348090 3300048905 Bacteria 1395
1112 Ga0496102_0381317 3300048905 Bacteria 1327
1113 Ga0496102_0595519 3300048905 Bacteria 1028
1114 Ga0496103_0011964 3300048906 Bacteria 5153
1115 Ga0496103_0018424 3300048906 Bacteria 4188
1116 Ga0496103_0021663 3300048906 Bacteria 3868
1117 Ga0496103_0032188 3300048906 Bacteria 3199
1118 Ga0496103_0120418 3300048906 Bacteria 1671
1119 Ga0496103_0298409 3300048906 Bacteria 1036
1120 Ga0496104_0009311 3300048907 Bacteria 8734
1121 Ga0496104_0034308 3300048907 Bacteria 4730
1122 Ga0496104_0139330 3300048907 Bacteria 2331
1123 Ga0496104_0188509 3300048907 Bacteria 1973
1124 Ga0496104_0274479 3300048907 Bacteria 1598
1125 Ga0496104_0290614 3300048907 Bacteria 1547
1126 Ga0496104_0466730 3300048907 Bacteria 1174
1127 Ga0496105_0003160 3300048908 Bacteria 12132
1128 Ga0496105_0006016 3300048908 Bacteria 9272
1129 Ga0496105_0044255 3300048908 Bacteria 3671
1130 Ga0496105_0158207 3300048908 Bacteria 1860
1131 Ga0496105_0252930 3300048908 Bacteria 1427
1132 Ga0496105_0517783 3300048908 Bacteria 934
1133 Ga0496106_0000370 3300048909 Bacteria 31887
1134 Ga0496106_0000929 3300048909 Bacteria 21332
1135 Ga0496106_0010898 3300048909 Bacteria 6717
1136 Ga0496106_0038703 3300048909 Bacteria 3570
1137 Ga0496106_0097598 3300048909 Bacteria 2275
1138 Ga0496106_0103365 3300048909 Bacteria 2211
1139 Ga0496106_0166740 3300048909 Bacteria 1744
1140 Ga0496106_0197982 3300048909 Bacteria 1598
1141 Ga0496106_0743167 3300048909 Bacteria 780
1142 Ga0496106_0774605 3300048909 Bacteria 762
1143 Ga0496107_0000197 3300048910 Bacteria 31646
1144 Ga0496107_0002908 3300048910 Bacteria 11321
1145 Ga0496107_0003884 3300048910 Bacteria 10045
1146 Ga0496107_0030161 3300048910 Bacteria 3864
1147 Ga0496107_0038428 3300048910 Bacteria 3433
1148 Ga0496107_0071684 3300048910 Bacteria 2518
1149 Ga0496107_0082406 3300048910 Bacteria 2346
1150 Ga0496107_0265826 3300048910 Bacteria 1276
1151 Ga0496108_0022688 3300048911 Bacteria 5162
1152 Ga0496108_0133772 3300048911 Bacteria 2132
1153 Ga0496108_0195406 3300048911 Bacteria 1754
1154 Ga0496108_0304484 3300048911 Bacteria 1388
1155 Ga0496108_0307809 3300048911 Bacteria 1380
1156 Ga0496108_0315096 3300048911 Bacteria 1363
1157 Ga0496108_0334206 3300048911 Bacteria 1321
1158 Ga0496108_0441937 3300048911 Bacteria 1136
1159 Ga0496108_0522625 3300048911 Bacteria 1036
1160 Ga0496108_0731956 3300048911 Bacteria 856
1161 Ga0496109_0069376 3300048912 Bacteria 3232
1162 Ga0496109_0071965 3300048912 Bacteria 3175
1163 Ga0496109_0075773 3300048912 Bacteria 3093
1164 Ga0496109_0107861 3300048912 Bacteria 2587
1165 Ga0496109_0116895 3300048912 Bacteria 2482
1166 Ga0496109_0309120 3300048912 Bacteria 1491
1167 Ga0496109_0312969 3300048912 Bacteria 1481
1168 Ga0496109_1093015 3300048912 Bacteria 734
1169 Ga0496110_0003625 3300048913 Bacteria 11877
1170 Ga0496110_0022817 3300048913 Bacteria 5317
1171 Ga0496110_0629877 3300048913 Bacteria 972
1172 Ga0496111_0025325 3300048914 Bacteria 4186
1173 Ga0496111_0048951 3300048914 Bacteria 3047
1174 Ga0496111_0094870 3300048914 Bacteria 2188
1175 Ga0496111_0271931 3300048914 Bacteria 1257
1176 Ga0496111_0386045 3300048914 Bacteria 1035
1177 Ga0496111_0625842 3300048914 Bacteria 787
1178 Ga0496112_0008520 3300048915 Bacteria 9187
1179 Ga0496112_0012075 3300048915 Bacteria 7925
1180 Ga0496112_0092098 3300048915 Bacteria 3000
1181 Ga0496112_0108040 3300048915 Bacteria 2752
1182 Ga0496112_0135180 3300048915 Bacteria 2436
1183 Ga0496112_0831742 3300048915 Bacteria 847
1184 Ga0496113_0021889 3300048916 Bacteria 4514
1185 Ga0496113_0033853 3300048916 Bacteria 3723
1186 Ga0496113_0043296 3300048916 Bacteria 3331
1187 Ga0496113_0060307 3300048916 Bacteria 2859
1188 Ga0496113_0062903 3300048916 Bacteria 2804
1189 Ga0496113_0197816 3300048916 Bacteria 1597
1190 Ga0496113_1036651 3300048916 Bacteria 645
1191 Ga0496114_0026036 3300048917 Bacteria 4785
1192 Ga0496114_0051930 3300048917 Bacteria 3414
1193 Ga0496114_0138405 3300048917 Bacteria 2106
1194 Ga0496114_0399886 3300048917 Bacteria 1216
1195 Ga0496114_0461753 3300048917 Bacteria 1124
1196 Ga0496114_0475210 3300048917 Bacteria 1106
1197 Ga0496114_0880698 3300048917 Bacteria 776
1198 Ga0496115_0056491 3300048918 Bacteria 3155
1199 Ga0496115_0060837 3300048918 Bacteria 3043
1200 Ga0496115_0092745 3300048918 Bacteria 2469
1201 Ga0496115_0120861 3300048918 Bacteria 2155
1202 Ga0496115_0144169 3300048918 Bacteria 1965
1203 Ga0496115_0278134 3300048918 Bacteria 1374
1204 Ga0496116_0322532 3300048919 Bacteria 722
1205 Ga0496119_0026505 3300048922 Bacteria 4017
1206 Ga0496120_0006976 3300048923 Bacteria 8507
1207 Ga0496120_0012874 3300048923 Bacteria 5664
1208 Ga0496120_0060944 3300048923 Bacteria 2108
1209 Ga0496121_0004399 3300048924 Bacteria 18999
1210 Ga0496121_0117248 3300048924 Bacteria 2017
1211 Ga0496121_0195010 3300048924 Bacteria 1448
1212 Ga0496121_0283377 3300048924 Bacteria 1132
1213 Ga0496122_0003989 3300048925 Bacteria 18819
1214 Ga0496123_0000732 3300048926 Bacteria 53376
1215 Ga0496123_0004691 3300048926 Bacteria 14159
1216 Ga0496124_0126144 3300048927 Bacteria 2039
1217 Ga0496124_0278373 3300048927 Bacteria 1221
1218 Ga0496124_0672741 3300048927 Bacteria 661
1219 Ga0496125_0001673 3300048928 Bacteria 31116
1220 Ga0496125_0134295 3300048928 Bacteria 1734
1221 Ga0496125_0320766 3300048928 Bacteria 939
1222 Ga0496125_0404021 3300048928 Bacteria 797
1223 Ga0496126_0063768 3300048929 Bacteria 3302
1224 Ga0496126_0283832 3300048929 Bacteria 1371
1225 Ga0501341_03081 3300049131 Bacteria 929
1226 Ga0501341_06796 3300049131 Bacteria 708
1227 Ga0501304_013565 3300049160 Bacteria 746
1228 Ga0501307_029406 3300049162 Bacteria 755
1229 Ga0501314_014114 3300049530 Bacteria 780
1230 Ga0501317_029807 3300049533 Bacteria 786
1231 Ga0501319_005604 3300049535 Bacteria 905
1232 Ga0501320_022059 3300049536 Bacteria 744
1233 Ga0501325_016174 3300049541 Bacteria 743
1234 Ga0501031_0000018 3300049568 Bacteria 106734
1235 Ga0501031_0004819 3300049568 Bacteria 8764
1236 Ga0501031_0011795 3300049568 Bacteria 5699
1237 Ga0501031_0017396 3300049568 Bacteria 4671
1238 Ga0501031_0019004 3300049568 Bacteria 4474
1239 Ga0501031_0027610 3300049568 Bacteria 3700
1240 Ga0501031_0090635 3300049568 Bacteria 1994
1241 Ga0501031_0093230 3300049568 Bacteria 1965
1242 Ga0501031_0180474 3300049568 Bacteria 1379
1243 Ga0501031_0309154 3300049568 Bacteria 1024
1244 Ga0501031_0323768 3300049568 Bacteria 998
1245 Ga0501031_0334047 3300049568 Bacteria 981
1246 Ga0501031_0338096 3300049568 Bacteria 975
1247 Ga0501031_0358294 3300049568 Bacteria 944
1248 Ga0501031_0444789 3300049568 Bacteria 837
1249 Ga0501032_0000201 3300049569 Bacteria 49742
1250 Ga0501032_0000564 3300049569 Bacteria 30069
1251 Ga0501032_0008483 3300049569 Bacteria 7492
1252 Ga0501032_0015071 3300049569 Bacteria 5460
1253 Ga0501032_0024542 3300049569 Bacteria 4161
1254 Ga0501032_0045244 3300049569 Bacteria 2978
1255 Ga0501032_0068470 3300049569 Bacteria 2369
1256 Ga0501032_0089499 3300049569 Bacteria 2043
1257 Ga0501032_0129953 3300049569 Bacteria 1662
1258 Ga0501032_0134005 3300049569 Bacteria 1633
1259 Ga0501032_0176821 3300049569 Bacteria 1398
1260 Ga0501032_0228372 3300049569 Bacteria 1210
1261 Ga0501033_0000328 3300049570 Bacteria 45346
1262 Ga0501033_0000443 3300049570 Bacteria 39616
1263 Ga0501033_0002655 3300049570 Bacteria 15024
1264 Ga0501033_0003152 3300049570 Bacteria 13705
1265 Ga0501033_0015074 3300049570 Bacteria 5864
1266 Ga0501033_0016649 3300049570 Bacteria 5561
1267 Ga0501033_0024371 3300049570 Bacteria 4565
1268 Ga0501033_0026107 3300049570 Bacteria 4397
1269 Ga0501033_0038123 3300049570 Bacteria 3596
1270 Ga0501033_0058501 3300049570 Bacteria 2847
1271 Ga0501033_0073909 3300049570 Bacteria 2503
1272 Ga0501033_0102582 3300049570 Bacteria 2087
1273 Ga0501033_0107767 3300049570 Bacteria 2029
1274 Ga0501033_0115195 3300049570 Bacteria 1953
1275 Ga0501033_0149703 3300049570 Bacteria 1684
1276 Ga0501033_0161613 3300049570 Bacteria 1612
1277 Ga0501033_0211126 3300049570 Bacteria 1384
1278 Ga0501033_0318198 3300049570 Bacteria 1093
1279 Ga0501033_0629760 3300049570 Bacteria 734
1280 Ga0501034_0000005 3300049571 Bacteria 367512
1281 Ga0501034_0000033 3300049571 Bacteria 243508
1282 Ga0501034_0000061 3300049571 Bacteria 195178
1283 Ga0501034_0000314 3300049571 Bacteria 86025
1284 Ga0501034_0000681 3300049571 Bacteria 51656
1285 Ga0501034_0011987 3300049571 Bacteria 8957
1286 Ga0501034_0021545 3300049571 Bacteria 6567
1287 Ga0501034_0024021 3300049571 Bacteria 6202
1288 Ga0501034_0032646 3300049571 Bacteria 5286
1289 Ga0501034_0040361 3300049571 Bacteria 4724
1290 Ga0501034_0047357 3300049571 Bacteria 4341
1291 Ga0501034_0060789 3300049571 Bacteria 3795
1292 Ga0501034_0061513 3300049571 Bacteria 3770
1293 Ga0501034_0096024 3300049571 Bacteria 2960
1294 Ga0501034_0109071 3300049571 Bacteria 2759
1295 Ga0501034_0152423 3300049571 Bacteria 2287
1296 Ga0501034_0162570 3300049571 Bacteria 2203
1297 Ga0501034_0221338 3300049571 Bacteria 1845
1298 Ga0501034_0227391 3300049571 Bacteria 1816
1299 Ga0501034_0250558 3300049571 Bacteria 1715
1300 Ga0501034_0272853 3300049571 Bacteria 1632
1301 Ga0501034_0305621 3300049571 Bacteria 1526
1302 Ga0501034_0358193 3300049571 Bacteria 1386
1303 Ga0501034_0559565 3300049571 Bacteria 1052
1304 Ga0501034_1183646 3300049571 Bacteria 643
1305 Ga0501036_0000005 3300049572 Bacteria 246420
1306 Ga0501036_0000027 3300049572 Bacteria 99799
1307 Ga0501036_0005854 3300049572 Bacteria 9956
1308 Ga0501036_0008162 3300049572 Bacteria 8582
1309 Ga0501036_0017322 3300049572 Bacteria 6021
1310 Ga0501036_0037202 3300049572 Bacteria 4117
1311 Ga0501036_0048667 3300049572 Bacteria 3589
1312 Ga0501036_0112205 3300049572 Bacteria 2304
1313 Ga0501036_0177705 3300049572 Bacteria 1792
1314 Ga0501036_0186371 3300049572 Bacteria 1746
1315 Ga0501036_0254302 3300049572 Bacteria 1472
1316 Ga0501036_0313616 3300049572 Bacteria 1311
1317 Ga0501036_0375418 3300049572 Bacteria 1187
1318 Ga0501037_0000045 3300049573 Bacteria 117148
1319 Ga0501037_0000104 3300049573 Bacteria 80204
1320 Ga0501037_0000271 3300049573 Bacteria 44641
1321 Ga0501037_0001652 3300049573 Bacteria 16226
1322 Ga0501037_0002530 3300049573 Bacteria 13205
1323 Ga0501037_0009928 3300049573 Bacteria 6981
1324 Ga0501037_0031330 3300049573 Bacteria 3925
1325 Ga0501037_0049206 3300049573 Bacteria 3087
1326 Ga0501037_0049408 3300049573 Bacteria 3080
1327 Ga0501037_0138110 3300049573 Bacteria 1745
1328 Ga0501037_0198785 3300049573 Bacteria 1417
1329 Ga0501037_0292653 3300049573 Bacteria 1132
1330 Ga0501037_0349463 3300049573 Bacteria 1020
1331 Ga0501037_0404808 3300049573 Bacteria 935
1332 Ga0501037_0432744 3300049573 Bacteria 899
1333 Ga0501037_0484587 3300049573 Bacteria 840
1334 Ga0501037_0700991 3300049573 Bacteria 674
1335 Ga0501038_0000001 3300049574 Bacteria 375481
1336 Ga0501038_0000340 3300049574 Bacteria 40348
1337 Ga0501038_0005022 3300049574 Bacteria 12285
1338 Ga0501038_0022940 3300049574 Bacteria 5587
1339 Ga0501038_0024635 3300049574 Bacteria 5365
1340 Ga0501038_0035324 3300049574 Bacteria 4388
1341 Ga0501038_0042473 3300049574 Bacteria 3959
1342 Ga0501038_0054962 3300049574 Bacteria 3422
1343 Ga0501038_0070214 3300049574 Bacteria 2974
1344 Ga0501038_0122866 3300049574 Bacteria 2139
1345 Ga0501038_0161583 3300049574 Bacteria 1820
1346 Ga0501038_0239184 3300049574 Bacteria 1442
1347 Ga0501038_0286172 3300049574 Bacteria 1296
1348 Ga0501038_0310247 3300049574 Bacteria 1236
1349 Ga0501038_0346954 3300049574 Bacteria 1157
1350 Ga0501038_0395620 3300049574 Bacteria 1070
1351 Ga0501038_0522909 3300049574 Bacteria 905
1352 Ga0501039_0000003 3300049575 Bacteria 357424
1353 Ga0501039_0000007 3300049575 Bacteria 277831
1354 Ga0501039_0000802 3300049575 Bacteria 22639
1355 Ga0501039_0002360 3300049575 Bacteria 14059
1356 Ga0501039_0010241 3300049575 Bacteria 7144
1357 Ga0501039_0013631 3300049575 Bacteria 6217
1358 Ga0501039_0020878 3300049575 Bacteria 5020
1359 Ga0501039_0046660 3300049575 Bacteria 3347
1360 Ga0501039_0148950 3300049575 Bacteria 1839
1361 Ga0501039_0290120 3300049575 Bacteria 1286
1362 Ga0501039_0292636 3300049575 Bacteria 1280
1363 Ga0501039_0309843 3300049575 Bacteria 1241
1364 Ga0501039_0330799 3300049575 Bacteria 1197
1365 Ga0501039_0395949 3300049575 Bacteria 1085
1366 Ga0501039_0657967 3300049575 Bacteria 820
1367 Ga0501039_0905061 3300049575 Bacteria 687
1368 Ga0501040_0003550 3300049576 Bacteria 10081
1369 Ga0501040_0034815 3300049576 Bacteria 3412
1370 Ga0501040_0036827 3300049576 Bacteria 3322
1371 Ga0501040_0116070 3300049576 Bacteria 1875
1372 Ga0501040_0127805 3300049576 Bacteria 1786
1373 Ga0501040_0391639 3300049576 Bacteria 997
1374 Ga0501041_0010586 3300049577 Bacteria 5436
1375 Ga0501041_0024250 3300049577 Bacteria 3641
1376 Ga0501041_0066945 3300049577 Bacteria 2201
1377 Ga0501041_0270716 3300049577 Bacteria 1068
1378 Ga0501041_0410981 3300049577 Bacteria 858
1379 Ga0501042_0014332 3300049578 Bacteria 5410
1380 Ga0501042_0036971 3300049578 Bacteria 3464
1381 Ga0501042_0050539 3300049578 Bacteria 2965
1382 Ga0501042_0099243 3300049578 Bacteria 2093
1383 Ga0501042_0108557 3300049578 Bacteria 1998
1384 Ga0501042_0154488 3300049578 Bacteria 1655
1385 Ga0501043_0000096 3300049579 Bacteria 79864
1386 Ga0501043_0000248 3300049579 Bacteria 48962
1387 Ga0501043_0001636 3300049579 Bacteria 19475
1388 Ga0501043_0006416 3300049579 Bacteria 9449
1389 Ga0501043_0030108 3300049579 Bacteria 4263
1390 Ga0501043_0031597 3300049579 Bacteria 4162
1391 Ga0501043_0039968 3300049579 Bacteria 3687
1392 Ga0501043_0152562 3300049579 Bacteria 1808
1393 Ga0501043_0170588 3300049579 Bacteria 1697
1394 Ga0501043_0204152 3300049579 Bacteria 1533
1395 Ga0501043_0273882 3300049579 Bacteria 1295
1396 Ga0501043_0703974 3300049579 Bacteria 738
1397 Ga0501043_0864112 3300049579 Bacteria 651
1398 Ga0501046_0000023 3300049580 Bacteria 213965
1399 Ga0501046_0001575 3300049580 Bacteria 21813
1400 Ga0501046_0003564 3300049580 Bacteria 14270
1401 Ga0501046_0006295 3300049580 Bacteria 10524
1402 Ga0501046_0011230 3300049580 Bacteria 7668
1403 Ga0501046_0012911 3300049580 Bacteria 7101
1404 Ga0501046_0029227 3300049580 Bacteria 4483
1405 Ga0501046_0030845 3300049580 Bacteria 4350
1406 Ga0501046_0058101 3300049580 Bacteria 3033
1407 Ga0501046_0060031 3300049580 Bacteria 2977
1408 Ga0501046_0099874 3300049580 Bacteria 2227
1409 Ga0501046_0185188 3300049580 Bacteria 1555
1410 Ga0501046_0427760 3300049580 Bacteria 954
1411 Ga0501046_0527134 3300049580 Bacteria 844
1412 Ga0501047_0000122 3300049581 Bacteria 95307
1413 Ga0501047_0001023 3300049581 Bacteria 28199
1414 Ga0501047_0004600 3300049581 Bacteria 12977
1415 Ga0501047_0004914 3300049581 Bacteria 12557
1416 Ga0501047_0008466 3300049581 Bacteria 9706
1417 Ga0501047_0021450 3300049581 Bacteria 6202
1418 Ga0501047_0022728 3300049581 Bacteria 6021
1419 Ga0501047_0026581 3300049581 Bacteria 5569
1420 Ga0501047_0064620 3300049581 Bacteria 3529
1421 Ga0501047_0068795 3300049581 Bacteria 3410
1422 Ga0501047_0073145 3300049581 Bacteria 3300
1423 Ga0501047_0090627 3300049581 Bacteria 2935
1424 Ga0501047_0107883 3300049581 Bacteria 2666
1425 Ga0501047_0170509 3300049581 Bacteria 2045
1426 Ga0501047_0180906 3300049581 Bacteria 1975
1427 Ga0501047_0338964 3300049581 Bacteria 1341
1428 Ga0501047_0348117 3300049581 Bacteria 1319
1429 Ga0501047_0850694 3300049581 Bacteria 726
1430 Ga0501048_0000060 3300049582 Bacteria 54898
1431 Ga0501048_0000299 3300049582 Bacteria 33603
1432 Ga0501048_0010572 3300049582 Bacteria 6886
1433 Ga0501048_0158920 3300049582 Bacteria 1599
1434 Ga0501048_0208661 3300049582 Bacteria 1385
1435 Ga0501048_0239518 3300049582 Bacteria 1287
1436 Ga0501048_0341510 3300049582 Bacteria 1067
1437 Ga0501048_0439009 3300049582 Bacteria 934
1438 Ga0501048_0781530 3300049582 Bacteria 686
1439 Ga0501067_0000224 3300049583 Bacteria 31442
1440 Ga0501067_0002012 3300049583 Bacteria 11204
1441 Ga0501067_0008225 3300049583 Bacteria 5793
1442 Ga0501067_0048413 3300049583 Bacteria 2357
1443 Ga0501067_0052948 3300049583 Bacteria 2249
1444 Ga0501067_0054371 3300049583 Bacteria 2218
1445 Ga0501067_0102845 3300049583 Bacteria 1587
1446 Ga0501067_0357210 3300049583 Bacteria 815
1447 Ga0501067_0369388 3300049583 Bacteria 800
1448 Ga0501068_0001760 3300049584 Bacteria 11514
1449 Ga0501068_0005327 3300049584 Bacteria 7028
1450 Ga0501068_0020442 3300049584 Bacteria 3857
1451 Ga0501068_0063002 3300049584 Bacteria 2255
1452 Ga0501068_0079118 3300049584 Bacteria 2016
1453 Ga0501068_0125825 3300049584 Bacteria 1600
1454 Ga0501069_0000012 3300049585 Bacteria 148453
1455 Ga0501069_0010871 3300049585 Bacteria 4821
1456 Ga0501069_0014599 3300049585 Bacteria 4200
1457 Ga0501069_0024963 3300049585 Bacteria 3264
1458 Ga0501069_0063468 3300049585 Bacteria 2063
1459 Ga0501069_0077586 3300049585 Bacteria 1868
1460 Ga0501069_0122508 3300049585 Bacteria 1486
1461 Ga0501069_0344870 3300049585 Bacteria 877
1462 Ga0501070_0000655 3300049586 Bacteria 31899
1463 Ga0501070_0006725 3300049586 Bacteria 9790
1464 Ga0501070_0016571 3300049586 Bacteria 6189
1465 Ga0501070_0018812 3300049586 Bacteria 5794
1466 Ga0501070_0095134 3300049586 Bacteria 2465
1467 Ga0501070_0100999 3300049586 Bacteria 2386
1468 Ga0501070_0144310 3300049586 Bacteria 1965
1469 Ga0501070_0158774 3300049586 Bacteria 1864
1470 Ga0501070_0166828 3300049586 Bacteria 1814
1471 Ga0501070_0201311 3300049586 Bacteria 1635
1472 Ga0501070_0256433 3300049586 Bacteria 1430
1473 Ga0501070_0262462 3300049586 Bacteria 1411
1474 Ga0501070_0264672 3300049586 Bacteria 1405
1475 Ga0501070_0317161 3300049586 Bacteria 1268
1476 Ga0501070_0345630 3300049586 Bacteria 1208
1477 Ga0501070_0354419 3300049586 Bacteria 1191
1478 Ga0501070_0393622 3300049586 Bacteria 1121
1479 Ga0501070_0436748 3300049586 Bacteria 1056
1480 Ga0501070_0470211 3300049586 Bacteria 1012
1481 Ga0501070_0648276 3300049586 Bacteria 839
1482 Ga0501070_0852893 3300049586 Bacteria 713
1483 Ga0501071_0012761 3300049587 Bacteria 5712
1484 Ga0501071_0028792 3300049587 Bacteria 3916
1485 Ga0501071_0048177 3300049587 Bacteria 3063
1486 Ga0501071_0053351 3300049587 Bacteria 2916
1487 Ga0501071_0064234 3300049587 Bacteria 2663
1488 Ga0501071_0113545 3300049587 Bacteria 2003
1489 Ga0501071_0166399 3300049587 Bacteria 1650
1490 Ga0501071_0179667 3300049587 Bacteria 1585
1491 Ga0501071_0376487 3300049587 Bacteria 1082
1492 Ga0501071_0391157 3300049587 Bacteria 1061
1493 Ga0501072_0004865 3300049588 Bacteria 10218
1494 Ga0501072_0017931 3300049588 Bacteria 5443
1495 Ga0501072_0034155 3300049588 Bacteria 3986
1496 Ga0501072_0062830 3300049588 Bacteria 2929
1497 Ga0501072_0183311 3300049588 Bacteria 1670
1498 Ga0501072_0234011 3300049588 Bacteria 1463
1499 Ga0501072_0825671 3300049588 Bacteria 725
1500 Ga0501073_0000014 3300049589 Bacteria 159719
1501 Ga0501073_0002833 3300049589 Bacteria 12998
1502 Ga0501073_0018220 3300049589 Bacteria 5074
1503 Ga0501073_0024859 3300049589 Bacteria 4299
1504 Ga0501073_0034517 3300049589 Bacteria 3600
1505 Ga0501073_0038666 3300049589 Bacteria 3383
1506 Ga0501073_0041910 3300049589 Bacteria 3233
1507 Ga0501073_0047652 3300049589 Bacteria 3011
1508 Ga0501073_0056617 3300049589 Bacteria 2742
1509 Ga0501073_0065487 3300049589 Bacteria 2534
1510 Ga0501073_0083577 3300049589 Bacteria 2221
1511 Ga0501073_0137204 3300049589 Bacteria 1695
1512 Ga0501073_0170505 3300049589 Bacteria 1506
1513 Ga0501073_0190027 3300049589 Bacteria 1421
1514 Ga0501073_0383579 3300049589 Bacteria 971
1515 Ga0501073_0451539 3300049589 Bacteria 888
1516 Ga0501073_0645765 3300049589 Bacteria 730
1517 Ga0501074_0000018 3300049590 Bacteria 76326
1518 Ga0501074_0002711 3300049590 Bacteria 12399
1519 Ga0501074_0012897 3300049590 Bacteria 6077
1520 Ga0501074_0015276 3300049590 Bacteria 5580
1521 Ga0501074_0021326 3300049590 Bacteria 4704
1522 Ga0501074_0103606 3300049590 Bacteria 2037
1523 Ga0501074_0133838 3300049590 Bacteria 1773
1524 Ga0501074_0318524 3300049590 Bacteria 1104
1525 Ga0501074_0570773 3300049590 Bacteria 801
1526 Ga0501075_0018336 3300049591 Bacteria 5065
1527 Ga0501075_0027652 3300049591 Bacteria 4181
1528 Ga0501075_0043514 3300049591 Bacteria 3368
1529 Ga0501075_0059389 3300049591 Bacteria 2880
1530 Ga0501075_0106152 3300049591 Bacteria 2135
1531 Ga0501075_0893142 3300049591 Bacteria 676
1532 Ga0501076_0006456 3300049592 Bacteria 8510
1533 Ga0501076_0018774 3300049592 Bacteria 5276
1534 Ga0501076_0027098 3300049592 Bacteria 4445
1535 Ga0501076_0066828 3300049592 Bacteria 2870
1536 Ga0501076_0177685 3300049592 Bacteria 1735
1537 Ga0501076_0311057 3300049592 Bacteria 1292
1538 Ga0501077_0001847 3300049593 Bacteria 12803
1539 Ga0501077_0004733 3300049593 Bacteria 8270
1540 Ga0501077_0011089 3300049593 Bacteria 5622
1541 Ga0501077_0023018 3300049593 Bacteria 3951
1542 Ga0501077_0037231 3300049593 Bacteria 3100
1543 Ga0501077_0265565 3300049593 Bacteria 1092
1544 Ga0501077_0272029 3300049593 Bacteria 1078
1545 Ga0501077_0303739 3300049593 Bacteria 1017
1546 Ga0501079_0004830 3300049741 Bacteria 9983
1547 Ga0501079_0005303 3300049741 Bacteria 9591
1548 Ga0501079_0014814 3300049741 Bacteria 5944
1549 Ga0501079_0058404 3300049741 Bacteria 2976
1550 Ga0501079_0084466 3300049741 Bacteria 2456
1551 Ga0501079_0109216 3300049741 Bacteria 2148
1552 Ga0501079_0118284 3300049741 Bacteria 2060
1553 Ga0501079_0233810 3300049741 Bacteria 1436
1554 Ga0501079_0406820 3300049741 Bacteria 1067
1555 Ga0501079_0426889 3300049741 Bacteria 1041
1556 Ga0501079_0781664 3300049741 Bacteria 752
1557 Ga0501080_0000002 3300049742 Bacteria 218492
1558 Ga0501080_0002237 3300049742 Bacteria 16816
1559 Ga0501080_0004022 3300049742 Bacteria 13021
1560 Ga0501080_0010582 3300049742 Bacteria 8443
1561 Ga0501080_0013615 3300049742 Bacteria 7489
1562 Ga0501080_0013921 3300049742 Bacteria 7404
1563 Ga0501080_0035684 3300049742 Bacteria 4641
1564 Ga0501080_0052841 3300049742 Bacteria 3782
1565 Ga0501080_0078300 3300049742 Bacteria 3075
1566 Ga0501080_0094547 3300049742 Bacteria 2776
1567 Ga0501080_0142348 3300049742 Bacteria 2217
1568 Ga0501080_0385462 3300049742 Bacteria 1262
1569 Ga0501080_0518077 3300049742 Bacteria 1064
1570 Ga0501080_0529225 3300049742 Bacteria 1051
1571 Ga0501080_0683087 3300049742 Bacteria 906
1572 Ga0501080_1169928 3300049742 Bacteria 662
1573 Ga0501081_0010055 3300049743 Bacteria 6170
1574 Ga0501081_0035267 3300049743 Bacteria 3405
1575 Ga0501081_0085755 3300049743 Bacteria 2210
1576 Ga0501081_0126776 3300049743 Bacteria 1821
1577 Ga0501081_0144990 3300049743 Bacteria 1703
1578 Ga0501081_0659993 3300049743 Bacteria 784
1579 Ga0501081_0828834 3300049743 Bacteria 697
1580 Ga0501083_0003370 3300049744 Bacteria 11185
1581 Ga0501083_0024248 3300049744 Bacteria 4204
1582 Ga0501083_0063805 3300049744 Bacteria 2456
1583 Ga0501083_0087008 3300049744 Bacteria 2066
1584 Ga0501083_0163497 3300049744 Bacteria 1455
1585 Ga0501083_0240614 3300049744 Bacteria 1178
1586 Ga0501083_0267403 3300049744 Bacteria 1112
1587 Ga0501083_0306741 3300049744 Bacteria 1032
1588 Ga0501035_0000008 3300049822 Bacteria 313425
1589 Ga0501035_0000032 3300049822 Bacteria 175435
1590 Ga0501035_0000039 3300049822 Bacteria 156824
1591 Ga0501035_0000117 3300049822 Bacteria 96642
1592 Ga0501035_0002261 3300049822 Bacteria 19041
1593 Ga0501035_0004448 3300049822 Bacteria 13299
1594 Ga0501035_0005021 3300049822 Bacteria 12533
1595 Ga0501035_0008137 3300049822 Bacteria 9772
1596 Ga0501035_0017042 3300049822 Bacteria 6694
1597 Ga0501035_0026899 3300049822 Bacteria 5259
1598 Ga0501035_0029253 3300049822 Bacteria 5024
1599 Ga0501035_0045729 3300049822 Bacteria 3937
1600 Ga0501035_0071486 3300049822 Bacteria 3072
1601 Ga0501035_0094737 3300049822 Bacteria 2625
1602 Ga0501035_0099467 3300049822 Bacteria 2553
1603 Ga0501035_0106844 3300049822 Bacteria 2453
1604 Ga0501035_0172930 3300049822 Bacteria 1865
1605 Ga0501035_0173103 3300049822 Bacteria 1864
1606 Ga0501035_0181247 3300049822 Bacteria 1815
1607 Ga0501035_0198596 3300049822 Bacteria 1721
1608 Ga0501035_0256988 3300049822 Bacteria 1482
1609 Ga0501035_0325138 3300049822 Bacteria 1291
1610 Ga0501035_0433007 3300049822 Bacteria 1090
1611 Ga0501035_0484671 3300049822 Bacteria 1019
1612 Ga0501035_0750170 3300049822 Bacteria 783
1613 Ga0501044_0000001 3300049823 Bacteria 418087
1614 Ga0501044_0000019 3300049823 Bacteria 223724
1615 Ga0501044_0000047 3300049823 Bacteria 146449
1616 Ga0501044_0000703 3300049823 Bacteria 40390
1617 Ga0501044_0004317 3300049823 Bacteria 15935
1618 Ga0501044_0010978 3300049823 Bacteria 9833
1619 Ga0501044_0013911 3300049823 Bacteria 8695
1620 Ga0501044_0028245 3300049823 Bacteria 5922
1621 Ga0501044_0034875 3300049823 Bacteria 5273
1622 Ga0501044_0035914 3300049823 Bacteria 5187
1623 Ga0501044_0046510 3300049823 Bacteria 4491
1624 Ga0501044_0048777 3300049823 Bacteria 4373
1625 Ga0501044_0058195 3300049823 Bacteria 3964
1626 Ga0501044_0058823 3300049823 Bacteria 3940
1627 Ga0501044_0103289 3300049823 Bacteria 2865
1628 Ga0501044_0121136 3300049823 Bacteria 2617
1629 Ga0501044_0143513 3300049823 Bacteria 2375
1630 Ga0501044_0148141 3300049823 Bacteria 2331
1631 Ga0501044_0154920 3300049823 Bacteria 2271
1632 Ga0501044_0177509 3300049823 Bacteria 2098
1633 Ga0501044_0191453 3300049823 Bacteria 2008
1634 Ga0501044_0209608 3300049823 Bacteria 1903
1635 Ga0501044_0231424 3300049823 Bacteria 1795
1636 Ga0501044_0337127 3300049823 Bacteria 1429
1637 Ga0501044_0365035 3300049823 Bacteria 1361
1638 Ga0501044_0462847 3300049823 Bacteria 1173
1639 Ga0501044_0669613 3300049823 Bacteria 925
1640 Ga0501045_0001654 3300049824 Bacteria 14980
1641 Ga0501045_0008550 3300049824 Bacteria 7136
1642 Ga0501045_0009260 3300049824 Bacteria 6888
1643 Ga0501045_0010803 3300049824 Bacteria 6398
1644 Ga0501045_0041021 3300049824 Bacteria 3367
1645 Ga0501045_0050604 3300049824 Bacteria 3032
1646 Ga0501045_0230832 3300049824 Bacteria 1378
1647 Ga0501045_0663410 3300049824 Bacteria 770
1648 nmdc:mga03683_4036_c1 3300050489 Bacteria 4817
1649 nmdc:mga03683_58041_c1 3300050489 Bacteria 1630
1650 nmdc:mga03n38_117253_c1 3300050490 Bacteria 1304
1651 nmdc:mga03n38_132244_c1 3300050490 Bacteria 1238
1652 nmdc:mga03n38_1389_c1 3300050490 Bacteria 6885
1653 nmdc:mga03n38_143265_c1 3300050490 Bacteria 1196
1654 nmdc:mga03n38_245834_c1 3300050490 Bacteria 943
1655 nmdc:mga03n38_436972_c1 3300050490 Bacteria 726
1656 nmdc:mga00v17_130479_c1 3300050491 Bacteria 1606
1657 nmdc:mga00v17_264705_c1 3300050491 Bacteria 1115
1658 nmdc:mga00v17_26959_c1 3300050491 Bacteria 3352
1659 nmdc:mga00v17_400348_c1 3300050491 Bacteria 892
1660 nmdc:mga0yw44_129012_c1 3300050492 Bacteria 1635
1661 nmdc:mga0yw44_35872_c1 3300050492 Bacteria 2918
1662 nmdc:mga0yw44_4300_c1 3300050492 Bacteria 6501
1663 nmdc:mga0yw44_78709_c1 3300050492 Bacteria 2062
1664 nmdc:mga0k408_124121_c1 3300050493 Bacteria 1531
1665 nmdc:mga0k408_20853_c2 3300050493 Bacteria 1912
1666 nmdc:mga0k408_82957_c1 3300050493 Bacteria 1879
1667 nmdc:mga06z11_12231_c1 3300050494 Bacteria 3728
1668 nmdc:mga06z11_33762_c1 3300050494 Bacteria 2506
1669 nmdc:mga06z11_705_c1 3300050494 Bacteria 12155
1670 nmdc:mga06z11_72969_c1 3300050494 Bacteria 1821
1671 nmdc:mga04h51_23833_c1 3300050495 Bacteria 1868
1672 nmdc:mga04h51_4615_c1 3300050495 Bacteria 3443
1673 nmdc:mga04h51_694_c1 3300050495 Bacteria 7837
1674 nmdc:mga07m45_211273_c1 3300050496 Bacteria 1129
1675 nmdc:mga07m45_239053_c1 3300050496 Bacteria 1057
1676 nmdc:mga07m45_434322_c1 3300050496 Bacteria 762
1677 nmdc:mga07m45_53418_c1 3300050496 Bacteria 2283
1678 nmdc:mga05p37_182118_c1 3300050507 Bacteria 2555
1679 nmdc:mga05p37_427650_c1 3300050507 Bacteria 1539
1680 nmdc:mga05p37_51437_c1 3300050507 Bacteria 5066
1681 nmdc:mga05p37_65210_c1 3300050507 Bacteria 4482
1682 nmdc:mga05p37_98045_c1 3300050507 Bacteria 3610
1683 nmdc:mga09592_114198_c1 3300050508 Bacteria 2318
1684 nmdc:mga09592_200339_c1 3300050508 Bacteria 1729
1685 nmdc:mga09592_241494_c1 3300050508 Bacteria 1565
1686 nmdc:mga09592_524289_c1 3300050508 Bacteria 1019
1687 nmdc:mga0qj67_156075_c1 3300050509 Bacteria 1852
1688 nmdc:mga0qj67_314501_c1 3300050509 Bacteria 1268
1689 nmdc:mga0qj67_54444_c1 3300050509 Bacteria 3168
1690 nmdc:mga06r32_190094_c1 3300050510 Bacteria 2041
1691 nmdc:mga06r32_23400_c1 3300050510 Bacteria 5714
1692 nmdc:mga06r32_264088_c1 3300050510 Bacteria 1709
1693 nmdc:mga06r32_350083_c1 3300050510 Bacteria 1462
1694 nmdc:mga08y16_139567_c1 3300050511 Bacteria 2520
1695 nmdc:mga08y16_171037_c1 3300050511 Bacteria 2257
1696 nmdc:mga08y16_21413_c1 3300050511 Bacteria 6828
1697 nmdc:mga08y16_296484_c1 3300050511 Bacteria 1667
1698 nmdc:mga08y16_316692_c1 3300050511 Bacteria 1606
1699 nmdc:mga08y16_5359_c1 3300050511 Bacteria 13416
1700 nmdc:mga08y16_63289_c1 3300050511 Bacteria 3863
1701 nmdc:mga0n895_15896_c1 3300050512 Bacteria 6884
1702 nmdc:mga0n895_170676_c1 3300050512 Bacteria 2207
1703 nmdc:mga0n895_2207_c1 3300050512 Bacteria 15060
1704 nmdc:mga0n895_30612_c1 3300050512 Bacteria 5146
1705 nmdc:mga0n895_83313_c1 3300050512 Bacteria 3189
1706 nmdc:mga0rr50_121476_c1 3300050513 Bacteria 2080
1707 nmdc:mga0rr50_19863_c1 3300050513 Bacteria 4546
1708 nmdc:mga0rr50_224297_c1 3300050513 Bacteria 1553
1709 nmdc:mga0rr50_519292_c1 3300050513 Bacteria 1013
1710 nmdc:mga0rr50_60126_c1 3300050513 Bacteria 2857
1711 nmdc:mga0rr50_653383_c1 3300050513 Bacteria 897
1712 nmdc:mga08x19_156817_c1 3300050514 Bacteria 1544
1713 nmdc:mga08x19_208239_c1 3300050514 Bacteria 1342
1714 nmdc:mga08x19_21206_c1 3300050514 Bacteria 4007
1715 nmdc:mga08x19_69_c1 3300050514 Bacteria 100711
1716 nmdc:mga08x19_9966_c1 3300050514 Bacteria 5696
1717 nmdc:mga0a205_21733_c1 3300050515 Bacteria 6067
1718 nmdc:mga0a205_431202_c1 3300050515 Bacteria 1180
1719 nmdc:mga0a205_468445_c1 3300050515 Bacteria 1119
1720 nmdc:mga0sz30_1901_c1 3300050516 Bacteria 7452
1721 nmdc:mga0sz30_32122_c1 3300050516 Bacteria 2176
1722 nmdc:mga0sz30_9747_c2 3300050516 Bacteria 2319
1723 Ga0495601_0066610 3300053077 Bacteria 2293
1724 Ga0495601_0076451 3300053077 Bacteria 2144
1725 Ga0495612_0157560 3300053078 Bacteria 990
1726 Ga0495655_0000251 3300053083 Bacteria 10014
1727 Ga0495595_0028754 3300053084 Bacteria 2484
1728 Ga0495595_0032219 3300053084 Bacteria 2360
1729 Ga0495619_0004327 3300053085 Bacteria 9056
1730 Ga0495619_0196442 3300053085 Bacteria 1397
1731 Ga0495619_0454718 3300053085 Bacteria 882
1732 Ga0500643_000019 3300053087 Bacteria 294301
1733 Ga0500643_014322 3300053087 Bacteria 2763
1734 Ga0500644_0003737 3300053088 Bacteria 3781
1735 Ga0500646_0002953 3300053090 Bacteria 4366
1736 Ga0500651_0003961 3300053093 Bacteria 8216
1737 Ga0500651_0190048 3300053093 Bacteria 1216
1738 Ga0500566_0000487 3300053094 Bacteria 22108
1739 Ga0500641_0042791 3300053096 Bacteria 1836
1740 Ga0500641_0131552 3300053096 Bacteria 1080
1741 Ga0500555_011538 3300053103 Bacteria 2539
1742 Ga0500556_0000036 3300053104 Bacteria 144864
1743 Ga0500556_0001299 3300053104 Bacteria 11249
1744 Ga0500572_004255 3300053111 Bacteria 3250
1745 Ga0500595_024485 3300053119 Bacteria 2106
1746 Ga0500595_048346 3300053119 Bacteria 1329
1747 Ga0500595_065616 3300053119 Bacteria 1086
1748 Ga0500607_060523 3300053121 Bacteria 1985
1749 Ga0500621_044069 3300053126 Bacteria 1804
1750 Ga0500642_0272533 3300053130 Bacteria 771
1751 Ga0500652_048904 3300053131 Bacteria 1722
1752 Ga0500658_0098157 3300053134 Bacteria 1275
1753 Ga0500559_0039340 3300053136 Bacteria 2056
1754 Ga0500559_0047072 3300053136 Bacteria 1893
1755 Ga0500568_0000309 3300053139 Bacteria 38852
1756 Ga0500568_0031708 3300053139 Bacteria 2178
1757 Ga0500588_0003081 3300053146 Bacteria 3478
1758 Ga0500588_0028064 3300053146 Bacteria 1592
1759 Ga0500604_0001638 3300053151 Bacteria 6294
1760 Ga0500604_0006127 3300053151 Bacteria 3175
1761 Ga0500604_0022165 3300053151 Bacteria 1801
1762 Ga0500604_0030493 3300053151 Bacteria 1577
1763 Ga0500616_0002280 3300053153 Bacteria 16258
1764 Ga0500616_0009256 3300053153 Bacteria 6005
1765 Ga0500616_0019054 3300053153 Bacteria 3874
1766 Ga0500616_0024006 3300053153 Bacteria 3393
1767 Ga0500616_0032619 3300053153 Bacteria 2847
1768 Ga0500616_0056137 3300053153 Bacteria 2056
1769 Ga0500619_054403 3300053154 Bacteria 1303
1770 Ga0500620_000626 3300053155 Bacteria 6046
1771 Ga0500620_018206 3300053155 Bacteria 2041
1772 Ga0500627_0185884 3300053158 Bacteria 934
1773 Ga0500634_0000025 3300053161 Bacteria 81954
1774 Ga0500638_003723 3300053162 Bacteria 5722
1775 Ga0500636_0000194 3300053177 Bacteria 32748
1776 Ga0500637_0178773 3300053178 Bacteria 1217
1777 Ga0500645_056068 3300053730 Bacteria 1144
1778 Ga0500609_003263 3300053731 Bacteria 2288
1779 Ga0500552_011425 3300053733 Bacteria 1115
1780 Ga0501084_0006046 3300054114 Bacteria 9953
1781 Ga0501084_0009681 3300054114 Bacteria 7970
1782 Ga0501084_0023106 3300054114 Bacteria 5190
1783 Ga0501084_0049863 3300054114 Bacteria 3504
1784 Ga0501084_0068743 3300054114 Bacteria 2965
1785 Ga0501084_0124882 3300054114 Bacteria 2165
1786 Ga0501084_0149033 3300054114 Bacteria 1971
1787 Ga0501084_0250923 3300054114 Bacteria 1494
1788 Ga0501084_0553673 3300054114 Bacteria 972
1789 Ga0587077_051409 3300059493 Bacteria 864
1790 Ga0587077_080517 3300059493 Bacteria 746
1791 Ga0587082_059591 3300059504 Bacteria 749
1792 Ga0587082_059824 3300059504 Bacteria 748
1793 Ga0587091_050805 3300059511 Bacteria 850
1794 Ga0587101_027942 3300059623 Bacteria 861
1795 Ga0587101_033312 3300059623 Bacteria 815
1796 Ga0587109_069466 3300059624 Bacteria 759
1797 Ga0587113_015543 3300059625 Bacteria 756
1798 Ga0587115_051677 3300059626 Bacteria 669
1799 Ga0587130_013116 3300059631 Bacteria 835
1800 Ga0587062_006809 3300059639 Bacteria 1311
1801 Ga0587062_050607 3300059639 Bacteria 702
1802 Ga0587068_057336 3300059641 Bacteria 742
1803 Ga0587069_046331 3300059642 Bacteria 759
1804 Ga0587076_063858 3300059645 Bacteria 749
1805 Ga0587079_059224 3300059647 Bacteria 826
1806 Ga0587110_013617 3300059654 Bacteria 853
1807 Ga0587120_008602 3300059659 Bacteria 838
1808 Ga0587124_010216 3300059660 Bacteria 834
1809 Ga0587111_0066355 3300060346 Bacteria 832
1810 Ga0587111_0068265 3300060346 Bacteria 824
1811 Ga0587111_0096492 3300060346 Bacteria 730
1812 Ga0501082_0002218 3300060353 Bacteria 16990
1813 Ga0501082_0008244 3300060353 Bacteria 8984
1814 Ga0501082_0015022 3300060353 Bacteria 6673
1815 Ga0501082_0021725 3300060353 Bacteria 5532
1816 Ga0501082_0033112 3300060353 Bacteria 4457
1817 Ga0501082_0038987 3300060353 Bacteria 4098
1818 Ga0501082_0050351 3300060353 Bacteria 3592
1819 Ga0501082_0058924 3300060353 Bacteria 3309
1820 Ga0501082_0072665 3300060353 Bacteria 2963
1821 Ga0501082_0109419 3300060353 Bacteria 2392
1822 Ga0501082_0165672 3300060353 Bacteria 1920
1823 Ga0501082_0190851 3300060353 Bacteria 1782
1824 Ga0501082_0331408 3300060353 Bacteria 1326
1825 Ga0501082_0348487 3300060353 Bacteria 1291
1826 Ga0501082_0374891 3300060353 Bacteria 1241
1827 Ga0501082_0402469 3300060353 Bacteria 1195
1828 Ga0501082_0431388 3300060353 Bacteria 1151
1829 Ga0501082_0508428 3300060353 Bacteria 1053
1830 Ga0501082_0716932 3300060353 Bacteria 875
1831 Ga0501082_0752630 3300060353 Bacteria 853
1832 Ga0501082_0920630 3300060353 Bacteria 765
1833 Ga0501082_1191385 3300060353 Bacteria 666
1834 Ga0466962_0000476 3300061719 Bacteria 17393
1835 Ga0466962_0168384 3300061719 Bacteria 1066
1836 Ga0530510_0005850 3300061734 Bacteria 8520
1837 Ga0530510_0007021 3300061734 Bacteria 7843
1838 Ga0530510_0026303 3300061734 Bacteria 4164
1839 Ga0530510_0165872 3300061734 Bacteria 1635
1840 Ga0530510_0203259 3300061734 Bacteria 1472
1841 Ga0530510_0298869 3300061734 Bacteria 1204
1842 Ga0530510_0395637 3300061734 Bacteria 1041
1843 Ga0530510_0710982 3300061734 Bacteria 766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0828834 Ga0501081_0828834_19_636 189
2 3300049824 Ga0501045_0663410 Ga0501045_0663410_41_727 189
3 3300060353 Ga0501082_1191385 Ga0501082_1191385_15_590 191
4 3300060353 Ga0501082_0402469 Ga0501082_0402469_391_1104 198
5 3300003577 Ga0007416J51690_1023620 Ga0007416J51690_10236201 204
6 3300005547 Ga0070693_100169615 Ga0070693_1001696152 204
7 3300005844 Ga0068862_100018580 Ga0068862_1000185803 204
8 3300005937 Ga0081455_10134987 Ga0081455_101349872 204
9 3300006846 Ga0075430_100080919 Ga0075430_1000809192 204
10 3300009177 Ga0105248_10601915 Ga0105248_106019152 204
11 3300009545 Ga0105237_10558912 Ga0105237_105589122 204
12 3300021361 Ga0213872_10000436 Ga0213872_1000043613 204
13 3300021361 Ga0213872_10001037 Ga0213872_1000103715 204
14 3300021361 Ga0213872_10001313 Ga0213872_100013132 204
15 3300021361 Ga0213872_10026558 Ga0213872_100265583 204
16 3300021361 Ga0213872_10056877 Ga0213872_100568771 204
17 3300025297 Ga0209758_1000648 Ga0209758_100064843 204
18 3300025297 Ga0209758_1029931 Ga0209758_10299313 204
19 3300025302 Ga0207426_1049518 Ga0207426_10495182 204
20 3300025304 Ga0209257_1000453 Ga0209257_100045364 204
21 3300025914 Ga0207671_10447878 Ga0207671_104478781 204
22 3300025935 Ga0207709_10764232 Ga0207709_107642321 204
23 3300028380 Ga0268265_10085096 Ga0268265_100850962 204
24 3300029957 Ga0265324_10003033 Ga0265324_100030337 204
25 3300031239 Ga0265328_10022262 Ga0265328_100222622 204
26 3300031240 Ga0265320_10002231 Ga0265320_100022318 204
27 3300031250 Ga0265331_10000314 Ga0265331_1000031419 204
28 3300031250 Ga0265331_10009324 Ga0265331_100093246 204
29 3300031456 Ga0307513_10343306 Ga0307513_103433062 204
30 3300031507 Ga0307509_10524222 Ga0307509_105242222 204
31 3300032002 Ga0307416_101678955 Ga0307416_1016789551 204
32 3300033180 Ga0307510_10190048 Ga0307510_101900482 204
33 3300037853 Ga0436364_0560002 Ga0436364_0560002_25243_25944 204
34 3300039438 Ga0436360_0931197 Ga0436360_0931197_91_708 204
35 3300039438 Ga0436360_1214702 Ga0436360_1214702_177_794 204
36 3300039447 Ga0436361_0112287 Ga0436361_0112287_2307_2924 204
37 3300039447 Ga0436361_0325755 Ga0436361_0325755_15664_16281 204
38 3300039447 Ga0436361_0578839 Ga0436361_0578839_333_950 204
39 3300039447 Ga0436361_0833838 Ga0436361_0833838_205_822 204
40 3300042876 Ga0451577_0289675 Ga0451577_0289675_555_1172 204
41 3300044694 Ga0466963_0387747 Ga0466963_0387747_261_878 204
42 3300044712 Ga0453684_0012729 Ga0453684_0012729_10853_11470 204
43 3300044712 Ga0453684_0037239 Ga0453684_0037239_3797_4414 204
44 3300044712 Ga0453684_0076864 Ga0453684_0076864_923_1540 204
45 3300044712 Ga0453684_0363809 Ga0453684_0363809_694_1311 204
46 3300044719 Ga0466971_0093306 Ga0466971_0093306_677_1294 204
47 3300044842 Ga0466957_0015256 Ga0466957_0015256_1931_2548 204
48 3300044842 Ga0466957_0384168 Ga0466957_0384168_311_925 204
49 3300045051 Ga0451576_0000040 Ga0451576_0000040_27630_28247 204
50 3300045051 Ga0451576_0008100 Ga0451576_0008100_8411_9028 204
51 3300045051 Ga0451576_0253480 Ga0451576_0253480_1023_1640 204
52 3300045836 Ga0466958_0000962 Ga0466958_0000962_2644_3261 204
53 3300046513 Ga0495616_0228102 Ga0495616_0228102_102_722 204
54 3300046660 Ga0495625_0283446 Ga0495625_0283446_45_665 204
55 3300049533 Ga0501317_029807 Ga0501317_029807_127_741 204
56 3300049572 Ga0501036_0186371 Ga0501036_0186371_604_1224 204
57 3300049575 Ga0501039_0292636 Ga0501039_0292636_641_1261 204
58 3300049575 Ga0501039_0395949 Ga0501039_0395949_314_928 204
59 3300049579 Ga0501043_0031597 Ga0501043_0031597_614_1234 204
60 3300049580 Ga0501046_0099874 Ga0501046_0099874_160_780 204
61 3300049581 Ga0501047_0022728 Ga0501047_0022728_1382_2002 204
62 3300049584 Ga0501068_0125825 Ga0501068_0125825_815_1435 204
63 3300049586 Ga0501070_0144310 Ga0501070_0144310_505_1125 204
64 3300049589 Ga0501073_0170505 Ga0501073_0170505_350_970 204
65 3300049589 Ga0501073_0645765 Ga0501073_0645765_49_669 204
66 3300049741 Ga0501079_0118284 Ga0501079_0118284_1223_1843 204
67 3300049742 Ga0501080_0010582 Ga0501080_0010582_1659_2279 204
68 3300049742 Ga0501080_0385462 Ga0501080_0385462_455_1075 204
69 3300049744 Ga0501083_0063805 Ga0501083_0063805_1150_1770 204
70 3300049822 Ga0501035_0750170 Ga0501035_0750170_146_766 204
71 3300049823 Ga0501044_0004317 Ga0501044_0004317_11855_12475 204
72 3300049823 Ga0501044_0058823 Ga0501044_0058823_1614_2234 204
73 3300050493 nmdc:mga0k408_20853_c2 nmdc:mga0k408_20853_c2_1068_1688 204
74 3300050509 nmdc:mga0qj67_314501_c1 nmdc:mga0qj67_314501_c1_162_776 204
75 3300053087 Ga0500643_014322 Ga0500643_014322_1142_1762 204
76 3300053090 Ga0500646_0002953 Ga0500646_0002953_392_1012 204
77 3300053096 Ga0500641_0042791 Ga0500641_0042791_930_1550 204
78 3300053134 Ga0500658_0098157 Ga0500658_0098157_543_1163 204
79 3300053139 Ga0500568_0031708 Ga0500568_0031708_29_649 204
80 3300053146 Ga0500588_0003081 Ga0500588_0003081_1227_1847 204
81 3300053146 Ga0500588_0028064 Ga0500588_0028064_228_848 204
82 3300053151 Ga0500604_0001638 Ga0500604_0001638_5036_5656 204
83 3300053153 Ga0500616_0002280 Ga0500616_0002280_4902_5522 204
84 3300053731 Ga0500609_003263 Ga0500609_003263_1118_1738 204
85 3300054114 Ga0501084_0250923 Ga0501084_0250923_457_1077 204
86 3300060346 Ga0587111_0066355 Ga0587111_0066355_88_708 204
87 3300060353 Ga0501082_0165672 Ga0501082_0165672_833_1453 204
88 3300001979 JGI24740J21852_10028970 JGI24740J21852_100289702 205
89 3300001989 JGI24739J22299_10035650 JGI24739J22299_100356503 205
90 3300001990 JGI24737J22298_10009679 JGI24737J22298_100096794 205
91 3300001991 JGI24743J22301_10050974 JGI24743J22301_100509742 205
92 3300002067 JGI24735J21928_10019801 JGI24735J21928_100198012 205
93 3300002073 JGI24745J21846_1025938 JGI24745J21846_10259381 205
94 3300002075 JGI24738J21930_10039363 JGI24738J21930_100393632 205
95 3300002705 JGI25156J39149_1007812 JGI25156J39149_10078125 205
96 3300002741 JGI25157J39369_1001188 JGI25157J39369_10011886 205
97 3300003203 JGI25406J46586_10002529 JGI25406J46586_100025298 205
98 3300003214 JGI25165J46597_1000192 JGI25165J46597_100019235 205
99 3300003214 JGI25165J46597_1003262 JGI25165J46597_10032624 205
100 3300003354 JGI25160J50197_1005746 JGI25160J50197_10057463 205
101 3300003659 JGI25404J52841_10047908 JGI25404J52841_100479081 205
102 3300003762 Ga0055542_1000612 Ga0055542_100061224 205
103 3300003763 Ga0055529_1003526 Ga0055529_10035264 205
104 3300003794 Ga0055531_10016283 Ga0055531_100162832 205
105 3300005290 Ga0065712_10370395 Ga0065712_103703951 205
106 3300005327 Ga0070658_10021681 Ga0070658_100216814 205
107 3300005327 Ga0070658_10021783 Ga0070658_100217832 205
108 3300005327 Ga0070658_10031935 Ga0070658_100319351 205
109 3300005327 Ga0070658_10051002 Ga0070658_100510024 205
110 3300005327 Ga0070658_10386894 Ga0070658_103868942 205
111 3300005328 Ga0070676_10014141 Ga0070676_100141414 205
112 3300005329 Ga0070683_100224613 Ga0070683_1002246132 205
113 3300005329 Ga0070683_100468308 Ga0070683_1004683082 205
114 3300005329 Ga0070683_100542749 Ga0070683_1005427493 205
115 3300005330 Ga0070690_100010596 Ga0070690_1000105964 205
116 3300005331 Ga0070670_100014234 Ga0070670_1000142347 205
117 3300005334 Ga0068869_100173823 Ga0068869_1001738231 205
118 3300005334 Ga0068869_100225952 Ga0068869_1002259522 205
119 3300005335 Ga0070666_10019980 Ga0070666_100199804 205
120 3300005335 Ga0070666_10240332 Ga0070666_102403321 205
121 3300005336 Ga0070680_100026089 Ga0070680_1000260893 205
122 3300005336 Ga0070680_100530837 Ga0070680_1005308371 205
123 3300005336 Ga0070680_101022033 Ga0070680_1010220331 205
124 3300005337 Ga0070682_100001226 Ga0070682_1000012265 205
125 3300005337 Ga0070682_100002466 Ga0070682_1000024663 205
126 3300005337 Ga0070682_100002995 Ga0070682_1000029954 205
127 3300005337 Ga0070682_100083887 Ga0070682_1000838872 205
128 3300005338 Ga0068868_100021232 Ga0068868_1000212321 205
129 3300005338 Ga0068868_100327996 Ga0068868_1003279961 205
130 3300005339 Ga0070660_100022647 Ga0070660_1000226472 205
131 3300005339 Ga0070660_100032440 Ga0070660_1000324403 205
132 3300005339 Ga0070660_100571500 Ga0070660_1005715002 205
133 3300005340 Ga0070689_100005857 Ga0070689_1000058576 205
134 3300005340 Ga0070689_100691753 Ga0070689_1006917531 205
135 3300005340 Ga0070689_100703389 Ga0070689_1007033891 205
136 3300005341 Ga0070691_10004158 Ga0070691_100041585 205
137 3300005341 Ga0070691_10035914 Ga0070691_100359143 205
138 3300005341 Ga0070691_10055160 Ga0070691_100551601 205
139 3300005343 Ga0070687_100001867 Ga0070687_1000018677 205
140 3300005343 Ga0070687_100247855 Ga0070687_1002478551 205
141 3300005344 Ga0070661_100002323 Ga0070661_10000232317 205
142 3300005344 Ga0070661_100041250 Ga0070661_1000412503 205
143 3300005345 Ga0070692_10004328 Ga0070692_100043282 205
144 3300005347 Ga0070668_100003026 Ga0070668_1000030263 205
145 3300005347 Ga0070668_100019887 Ga0070668_1000198874 205
146 3300005347 Ga0070668_100211414 Ga0070668_1002114141 205
147 3300005347 Ga0070668_100212046 Ga0070668_1002120461 205
148 3300005347 Ga0070668_100227611 Ga0070668_1002276112 205
149 3300005347 Ga0070668_100315465 Ga0070668_1003154652 205
150 3300005347 Ga0070668_100592997 Ga0070668_1005929972 205
151 3300005347 Ga0070668_100799715 Ga0070668_1007997151 205
152 3300005353 Ga0070669_100001259 Ga0070669_10000125916 205
153 3300005353 Ga0070669_100056898 Ga0070669_1000568983 205
154 3300005354 Ga0070675_100015132 Ga0070675_1000151327 205
155 3300005354 Ga0070675_100182317 Ga0070675_1001823172 205
156 3300005354 Ga0070675_100432631 Ga0070675_1004326312 205
157 3300005355 Ga0070671_100001064 Ga0070671_1000010647 205
158 3300005356 Ga0070674_100000541 Ga0070674_10000054113 205
159 3300005356 Ga0070674_100066867 Ga0070674_1000668672 205
160 3300005356 Ga0070674_100088457 Ga0070674_1000884574 205
161 3300005356 Ga0070674_100163799 Ga0070674_1001637992 205
162 3300005356 Ga0070674_100362019 Ga0070674_1003620191 205
163 3300005356 Ga0070674_100364610 Ga0070674_1003646102 205
164 3300005364 Ga0070673_100000057 Ga0070673_10000005731 205
165 3300005365 Ga0070688_100001329 Ga0070688_1000013297 205
166 3300005366 Ga0070659_100000930 Ga0070659_1000009303 205
167 3300005366 Ga0070659_100008775 Ga0070659_1000087754 205
168 3300005366 Ga0070659_100016746 Ga0070659_1000167464 205
169 3300005366 Ga0070659_100550665 Ga0070659_1005506652 205
170 3300005367 Ga0070667_100002740 Ga0070667_10000274010 205
171 3300005367 Ga0070667_100061608 Ga0070667_1000616085 205
172 3300005367 Ga0070667_100210428 Ga0070667_1002104282 205
173 3300005367 Ga0070667_100320517 Ga0070667_1003205171 205
174 3300005367 Ga0070667_100484448 Ga0070667_1004844481 205
175 3300005406 Ga0070703_10001755 Ga0070703_100017554 205
176 3300005406 Ga0070703_10028563 Ga0070703_100285631 205
177 3300005406 Ga0070703_10224050 Ga0070703_102240501 205
178 3300005434 Ga0070709_10029110 Ga0070709_100291104 205
179 3300005434 Ga0070709_10244548 Ga0070709_102445481 205
180 3300005434 Ga0070709_10345783 Ga0070709_103457831 205
181 3300005434 Ga0070709_10547385 Ga0070709_105473852 205
182 3300005435 Ga0070714_100037979 Ga0070714_1000379794 205
183 3300005435 Ga0070714_100667227 Ga0070714_1006672272 205
184 3300005436 Ga0070713_100000821 Ga0070713_10000082112 205
185 3300005436 Ga0070713_100064624 Ga0070713_1000646243 205
186 3300005437 Ga0070710_10070031 Ga0070710_100700312 205
187 3300005437 Ga0070710_10513903 Ga0070710_105139031 205
188 3300005438 Ga0070701_10136185 Ga0070701_101361852 205
189 3300005439 Ga0070711_100058787 Ga0070711_1000587873 205
190 3300005439 Ga0070711_100081834 Ga0070711_1000818344 205
191 3300005439 Ga0070711_100094047 Ga0070711_1000940473 205
192 3300005439 Ga0070711_100096299 Ga0070711_1000962992 205
193 3300005439 Ga0070711_100109994 Ga0070711_1001099942 205
194 3300005439 Ga0070711_100210304 Ga0070711_1002103041 205
195 3300005440 Ga0070705_100000482 Ga0070705_1000004822 205
196 3300005440 Ga0070705_100001911 Ga0070705_1000019113 205
197 3300005440 Ga0070705_100037527 Ga0070705_1000375271 205
198 3300005440 Ga0070705_100039606 Ga0070705_1000396062 205
199 3300005440 Ga0070705_100164198 Ga0070705_1001641981 205
200 3300005440 Ga0070705_100328749 Ga0070705_1003287492 205
201 3300005441 Ga0070700_100037506 Ga0070700_1000375062 205
202 3300005441 Ga0070700_100067062 Ga0070700_1000670623 205
203 3300005441 Ga0070700_100115743 Ga0070700_1001157431 205
204 3300005441 Ga0070700_100239407 Ga0070700_1002394072 205
205 3300005444 Ga0070694_100001027 Ga0070694_10000102712 205
206 3300005444 Ga0070694_100016532 Ga0070694_1000165322 205
207 3300005444 Ga0070694_100023169 Ga0070694_1000231695 205
208 3300005445 Ga0070708_100204145 Ga0070708_1002041452 205
209 3300005445 Ga0070708_100601211 Ga0070708_1006012111 205
210 3300005455 Ga0070663_100005184 Ga0070663_1000051847 205
211 3300005455 Ga0070663_100008291 Ga0070663_1000082916 205
212 3300005455 Ga0070663_100044716 Ga0070663_1000447164 205
213 3300005455 Ga0070663_100061385 Ga0070663_1000613853 205
214 3300005455 Ga0070663_100091503 Ga0070663_1000915032 205
215 3300005455 Ga0070663_100096361 Ga0070663_1000963612 205
216 3300005455 Ga0070663_100530272 Ga0070663_1005302721 205
217 3300005455 Ga0070663_100703660 Ga0070663_1007036601 205
218 3300005456 Ga0070678_100023682 Ga0070678_1000236824 205
219 3300005456 Ga0070678_100136161 Ga0070678_1001361613 205
220 3300005456 Ga0070678_100407401 Ga0070678_1004074012 205
221 3300005457 Ga0070662_100005649 Ga0070662_1000056494 205
222 3300005457 Ga0070662_100401932 Ga0070662_1004019321 205
223 3300005458 Ga0070681_10009623 Ga0070681_100096234 205
224 3300005458 Ga0070681_10054520 Ga0070681_100545201 205
225 3300005458 Ga0070681_10056304 Ga0070681_100563044 205
226 3300005458 Ga0070681_10107453 Ga0070681_101074532 205
227 3300005458 Ga0070681_10119937 Ga0070681_101199375 205
228 3300005458 Ga0070681_10286454 Ga0070681_102864541 205
229 3300005459 Ga0068867_100054354 Ga0068867_1000543542 205
230 3300005459 Ga0068867_100388015 Ga0068867_1003880152 205
231 3300005459 Ga0068867_100840375 Ga0068867_1008403752 205
232 3300005466 Ga0070685_10012730 Ga0070685_100127302 205
233 3300005466 Ga0070685_10167378 Ga0070685_101673782 205
234 3300005467 Ga0070706_100694230 Ga0070706_1006942302 205
235 3300005468 Ga0070707_100010698 Ga0070707_1000106985 205
236 3300005471 Ga0070698_100051280 Ga0070698_1000512806 205
237 3300005471 Ga0070698_100785038 Ga0070698_1007850381 205
238 3300005518 Ga0070699_100000836 Ga0070699_1000008363 205
239 3300005518 Ga0070699_100069742 Ga0070699_1000697422 205
240 3300005518 Ga0070699_100094222 Ga0070699_1000942226 205
241 3300005518 Ga0070699_100416437 Ga0070699_1004164373 205
242 3300005530 Ga0070679_100015220 Ga0070679_1000152204 205
243 3300005530 Ga0070679_100089644 Ga0070679_1000896441 205
244 3300005530 Ga0070679_100097482 Ga0070679_1000974825 205
245 3300005535 Ga0070684_100438273 Ga0070684_1004382732 205
246 3300005535 Ga0070684_100970740 Ga0070684_1009707401 205
247 3300005536 Ga0070697_100001866 Ga0070697_10000186612 205
248 3300005536 Ga0070697_100014888 Ga0070697_1000148885 205
249 3300005539 Ga0068853_100002253 Ga0068853_10000225310 205
250 3300005539 Ga0068853_100006655 Ga0068853_1000066557 205
251 3300005539 Ga0068853_100025202 Ga0068853_1000252027 205
252 3300005539 Ga0068853_100061886 Ga0068853_1000618862 205
253 3300005539 Ga0068853_100075662 Ga0068853_1000756624 205
254 3300005539 Ga0068853_100224330 Ga0068853_1002243302 205
255 3300005543 Ga0070672_100161402 Ga0070672_1001614023 205
256 3300005543 Ga0070672_100551467 Ga0070672_1005514672 205
257 3300005544 Ga0070686_100184664 Ga0070686_1001846641 205
258 3300005545 Ga0070695_100000195 Ga0070695_10000019516 205
259 3300005545 Ga0070695_100000581 Ga0070695_1000005812 205
260 3300005545 Ga0070695_100007007 Ga0070695_1000070072 205
261 3300005545 Ga0070695_100030874 Ga0070695_1000308745 205
262 3300005545 Ga0070695_100065339 Ga0070695_1000653392 205
263 3300005545 Ga0070695_100167265 Ga0070695_1001672652 205
264 3300005546 Ga0070696_100000690 Ga0070696_10000069014 205
265 3300005546 Ga0070696_100001754 Ga0070696_10000175415 205
266 3300005546 Ga0070696_100018247 Ga0070696_1000182474 205
267 3300005546 Ga0070696_100123840 Ga0070696_1001238402 205
268 3300005547 Ga0070693_100000914 Ga0070693_1000009143 205
269 3300005547 Ga0070693_100027143 Ga0070693_1000271434 205
270 3300005547 Ga0070693_100035966 Ga0070693_1000359662 205
271 3300005547 Ga0070693_100037340 Ga0070693_1000373403 205
272 3300005547 Ga0070693_100151406 Ga0070693_1001514062 205
273 3300005547 Ga0070693_100247245 Ga0070693_1002472452 205
274 3300005547 Ga0070693_100404663 Ga0070693_1004046631 205
275 3300005548 Ga0070665_100025273 Ga0070665_1000252733 205
276 3300005548 Ga0070665_100043638 Ga0070665_1000436384 205
277 3300005548 Ga0070665_100064156 Ga0070665_1000641562 205
278 3300005548 Ga0070665_100070997 Ga0070665_1000709973 205
279 3300005548 Ga0070665_100095473 Ga0070665_1000954734 205
280 3300005548 Ga0070665_100128148 Ga0070665_1001281484 205
281 3300005548 Ga0070665_100289108 Ga0070665_1002891082 205
282 3300005549 Ga0070704_100002869 Ga0070704_1000028698 205
283 3300005549 Ga0070704_100007305 Ga0070704_1000073056 205
284 3300005549 Ga0070704_100029004 Ga0070704_1000290043 205
285 3300005549 Ga0070704_100183282 Ga0070704_1001832823 205
286 3300005549 Ga0070704_100688333 Ga0070704_1006883331 205
287 3300005563 Ga0068855_100072247 Ga0068855_1000722473 205
288 3300005563 Ga0068855_100076455 Ga0068855_1000764553 205
289 3300005563 Ga0068855_100255082 Ga0068855_1002550821 205
290 3300005564 Ga0070664_100003236 Ga0070664_10000323612 205
291 3300005564 Ga0070664_100701164 Ga0070664_1007011642 205
292 3300005577 Ga0068857_100010632 Ga0068857_1000106323 205
293 3300005577 Ga0068857_100013736 Ga0068857_1000137364 205
294 3300005577 Ga0068857_100013738 Ga0068857_1000137386 205
295 3300005577 Ga0068857_100062947 Ga0068857_1000629473 205
296 3300005577 Ga0068857_100341791 Ga0068857_1003417913 205
297 3300005578 Ga0068854_100004526 Ga0068854_1000045267 205
298 3300005578 Ga0068854_100014363 Ga0068854_1000143635 205
299 3300005578 Ga0068854_100843221 Ga0068854_1008432211 205
300 3300005614 Ga0068856_100001161 Ga0068856_10000116113 205
301 3300005614 Ga0068856_100059501 Ga0068856_1000595019 205
302 3300005614 Ga0068856_100161708 Ga0068856_1001617083 205
303 3300005614 Ga0068856_100447789 Ga0068856_1004477892 205
304 3300005614 Ga0068856_100846745 Ga0068856_1008467451 205
305 3300005615 Ga0070702_100012198 Ga0070702_1000121983 205
306 3300005615 Ga0070702_100032394 Ga0070702_1000323943 205
307 3300005615 Ga0070702_100082500 Ga0070702_1000825001 205
308 3300005615 Ga0070702_100181582 Ga0070702_1001815821 205
309 3300005615 Ga0070702_100182650 Ga0070702_1001826502 205
310 3300005616 Ga0068852_100008313 Ga0068852_10000831310 205
311 3300005616 Ga0068852_100018494 Ga0068852_1000184946 205
312 3300005616 Ga0068852_100158335 Ga0068852_1001583354 205
313 3300005617 Ga0068859_100000988 Ga0068859_1000009885 205
314 3300005617 Ga0068859_100569234 Ga0068859_1005692342 205
315 3300005618 Ga0068864_100026317 Ga0068864_1000263175 205
316 3300005618 Ga0068864_100045147 Ga0068864_1000451473 205
317 3300005618 Ga0068864_100620332 Ga0068864_1006203322 205
318 3300005718 Ga0068866_10013292 Ga0068866_100132923 205
319 3300005718 Ga0068866_10209355 Ga0068866_102093551 205
320 3300005718 Ga0068866_10386259 Ga0068866_103862592 205
321 3300005719 Ga0068861_100001822 Ga0068861_1000018222 205
322 3300005719 Ga0068861_100017951 Ga0068861_1000179514 205
323 3300005841 Ga0068863_100004888 Ga0068863_1000048887 205
324 3300005841 Ga0068863_100308348 Ga0068863_1003083482 205
325 3300005842 Ga0068858_100030872 Ga0068858_1000308724 205
326 3300005842 Ga0068858_100083031 Ga0068858_1000830313 205
327 3300005843 Ga0068860_100000926 Ga0068860_10000092631 205
328 3300005843 Ga0068860_100009033 Ga0068860_1000090338 205
329 3300005843 Ga0068860_100068511 Ga0068860_1000685114 205
330 3300005843 Ga0068860_100120631 Ga0068860_1001206312 205
331 3300005843 Ga0068860_100307635 Ga0068860_1003076354 205
332 3300005844 Ga0068862_100001945 Ga0068862_10000194511 205
333 3300005844 Ga0068862_100017794 Ga0068862_1000177943 205
334 3300005844 Ga0068862_100039031 Ga0068862_1000390312 205
335 3300005844 Ga0068862_100059776 Ga0068862_1000597763 205
336 3300005844 Ga0068862_100087797 Ga0068862_1000877973 205
337 3300005844 Ga0068862_100307291 Ga0068862_1003072911 205
338 3300005844 Ga0068862_100323811 Ga0068862_1003238112 205
339 3300005844 Ga0068862_100524184 Ga0068862_1005241841 205
340 3300005937 Ga0081455_10000206 Ga0081455_1000020648 205
341 3300005937 Ga0081455_10002195 Ga0081455_1000219523 205
342 3300005937 Ga0081455_10005107 Ga0081455_100051077 205
343 3300005937 Ga0081455_10017029 Ga0081455_100170299 205
344 3300005937 Ga0081455_10105529 Ga0081455_101055295 205
345 3300005937 Ga0081455_10145278 Ga0081455_101452783 205
346 3300005983 Ga0081540_1000056 Ga0081540_10000569 205
347 3300005983 Ga0081540_1000084 Ga0081540_100008418 205
348 3300005983 Ga0081540_1001770 Ga0081540_10017709 205
349 3300005983 Ga0081540_1099107 Ga0081540_10991072 205
350 3300005985 Ga0081539_10000054 Ga0081539_1000005417 205
351 3300005985 Ga0081539_10006565 Ga0081539_100065658 205
352 3300005985 Ga0081539_10165130 Ga0081539_101651301 205
353 3300006038 Ga0075365_10007267 Ga0075365_100072676 205
354 3300006038 Ga0075365_10088030 Ga0075365_100880302 205
355 3300006042 Ga0075368_10000337 Ga0075368_100003378 205
356 3300006042 Ga0075368_10004593 Ga0075368_100045932 205
357 3300006042 Ga0075368_10013623 Ga0075368_100136232 205
358 3300006042 Ga0075368_10021504 Ga0075368_100215042 205
359 3300006048 Ga0075363_100011887 Ga0075363_1000118874 205
360 3300006048 Ga0075363_100014188 Ga0075363_1000141882 205
361 3300006048 Ga0075363_100018851 Ga0075363_1000188513 205
362 3300006048 Ga0075363_100029503 Ga0075363_1000295032 205
363 3300006048 Ga0075363_100143314 Ga0075363_1001433142 205
364 3300006051 Ga0075364_10002122 Ga0075364_1000212211 205
365 3300006051 Ga0075364_10007755 Ga0075364_100077559 205
366 3300006051 Ga0075364_10295816 Ga0075364_102958162 205
367 3300006163 Ga0070715_10104527 Ga0070715_101045272 205
368 3300006173 Ga0070716_100008734 Ga0070716_1000087343 205
369 3300006173 Ga0070716_100042581 Ga0070716_1000425813 205
370 3300006175 Ga0070712_100001926 Ga0070712_10000192611 205
371 3300006175 Ga0070712_100006320 Ga0070712_1000063205 205
372 3300006177 Ga0075362_10003670 Ga0075362_100036704 205
373 3300006177 Ga0075362_10071447 Ga0075362_100714472 205
374 3300006177 Ga0075362_10074486 Ga0075362_100744862 205
375 3300006178 Ga0075367_10000532 Ga0075367_100005322 205
376 3300006178 Ga0075367_10017857 Ga0075367_100178573 205
377 3300006178 Ga0075367_10052250 Ga0075367_100522503 205
378 3300006178 Ga0075367_10169171 Ga0075367_101691712 205
379 3300006178 Ga0075367_10191110 Ga0075367_101911101 205
380 3300006178 Ga0075367_10194115 Ga0075367_101941152 205
381 3300006178 Ga0075367_10410518 Ga0075367_104105182 205
382 3300006186 Ga0075369_10079339 Ga0075369_100793391 205
383 3300006186 Ga0075369_10095657 Ga0075369_100956572 205
384 3300006195 Ga0075366_10081004 Ga0075366_100810041 205
385 3300006195 Ga0075366_10100388 Ga0075366_101003883 205
386 3300006237 Ga0097621_100008311 Ga0097621_1000083115 205
387 3300006237 Ga0097621_100031965 Ga0097621_1000319653 205
388 3300006237 Ga0097621_100549461 Ga0097621_1005494612 205
389 3300006237 Ga0097621_100842667 Ga0097621_1008426671 205
390 3300006353 Ga0075370_10076573 Ga0075370_100765734 205
391 3300006353 Ga0075370_10142857 Ga0075370_101428572 205
392 3300006358 Ga0068871_100014662 Ga0068871_1000146626 205
393 3300006358 Ga0068871_100083151 Ga0068871_1000831512 205
394 3300006844 Ga0075428_100050334 Ga0075428_1000503344 205
395 3300006844 Ga0075428_100100614 Ga0075428_1001006143 205
396 3300006846 Ga0075430_100031495 Ga0075430_1000314953 205
397 3300006846 Ga0075430_100265378 Ga0075430_1002653782 205
398 3300006846 Ga0075430_100628550 Ga0075430_1006285502 205
399 3300006847 Ga0075431_100002538 Ga0075431_10000253818 205
400 3300006847 Ga0075431_100094545 Ga0075431_1000945453 205
401 3300006847 Ga0075431_100254902 Ga0075431_1002549023 205
402 3300006847 Ga0075431_100441702 Ga0075431_1004417021 205
403 3300006852 Ga0075433_10001745 Ga0075433_1000174512 205
404 3300006852 Ga0075433_10005400 Ga0075433_100054006 205
405 3300006871 Ga0075434_100004864 Ga0075434_10000486410 205
406 3300006871 Ga0075434_100028601 Ga0075434_1000286013 205
407 3300006871 Ga0075434_100343182 Ga0075434_1003431822 205
408 3300006880 Ga0075429_100037548 Ga0075429_1000375484 205
409 3300006880 Ga0075429_100060402 Ga0075429_1000604022 205
410 3300006880 Ga0075429_100131565 Ga0075429_1001315651 205
411 3300006881 Ga0068865_100003035 Ga0068865_1000030353 205
412 3300006881 Ga0068865_100017196 Ga0068865_1000171965 205
413 3300006881 Ga0068865_100299399 Ga0068865_1002993992 205
414 3300006914 Ga0075436_100014618 Ga0075436_1000146185 205
415 3300006914 Ga0075436_100038092 Ga0075436_1000380925 205
416 3300006914 Ga0075436_100044658 Ga0075436_1000446583 205
417 3300006914 Ga0075436_100116338 Ga0075436_1001163382 205
418 3300006931 Ga0097620_100000988 Ga0097620_10000098830 205
419 3300006931 Ga0097620_100569165 Ga0097620_1005691652 205
420 3300007076 Ga0075435_100010519 Ga0075435_1000105193 205
421 3300007076 Ga0075435_100037487 Ga0075435_1000374875 205
422 3300007076 Ga0075435_100052443 Ga0075435_1000524433 205
423 3300007076 Ga0075435_100123380 Ga0075435_1001233802 205
424 3300007076 Ga0075435_100281103 Ga0075435_1002811032 205
425 3300007788 Ga0099795_10014807 Ga0099795_100148073 205
426 3300009036 Ga0105244_10144043 Ga0105244_101440431 205
427 3300009036 Ga0105244_10220680 Ga0105244_102206802 205
428 3300009092 Ga0105250_10077450 Ga0105250_100774502 205
429 3300009093 Ga0105240_10073694 Ga0105240_100736944 205
430 3300009093 Ga0105240_10183491 Ga0105240_101834912 205
431 3300009093 Ga0105240_10205833 Ga0105240_102058332 205
432 3300009093 Ga0105240_10310807 Ga0105240_103108072 205
433 3300009093 Ga0105240_10482260 Ga0105240_104822602 205
434 3300009093 Ga0105240_10547464 Ga0105240_105474642 205
435 3300009093 Ga0105240_11176739 Ga0105240_111767391 205
436 3300009094 Ga0111539_10012221 Ga0111539_100122216 205
437 3300009094 Ga0111539_10017956 Ga0111539_1001795610 205
438 3300009094 Ga0111539_10063889 Ga0111539_100638894 205
439 3300009094 Ga0111539_10281772 Ga0111539_102817722 205
440 3300009094 Ga0111539_10711556 Ga0111539_107115561 205
441 3300009094 Ga0111539_11336403 Ga0111539_113364031 205
442 3300009098 Ga0105245_10011237 Ga0105245_100112373 205
443 3300009098 Ga0105245_10132988 Ga0105245_101329882 205
444 3300009098 Ga0105245_10175078 Ga0105245_101750782 205
445 3300009098 Ga0105245_10290079 Ga0105245_102900792 205
446 3300009101 Ga0105247_10000737 Ga0105247_1000073716 205
447 3300009101 Ga0105247_10001368 Ga0105247_100013683 205
448 3300009101 Ga0105247_10234964 Ga0105247_102349642 205
449 3300009101 Ga0105247_10262609 Ga0105247_102626092 205
450 3300009101 Ga0105247_10706670 Ga0105247_107066701 205
451 3300009147 Ga0114129_10051143 Ga0114129_100511433 205
452 3300009147 Ga0114129_10122419 Ga0114129_101224193 205
453 3300009147 Ga0114129_10197230 Ga0114129_101972302 205
454 3300009147 Ga0114129_10242123 Ga0114129_102421234 205
455 3300009147 Ga0114129_10394526 Ga0114129_103945262 205
456 3300009147 Ga0114129_10407325 Ga0114129_104073252 205
457 3300009148 Ga0105243_10029787 Ga0105243_100297874 205
458 3300009148 Ga0105243_10085833 Ga0105243_100858332 205
459 3300009148 Ga0105243_10088324 Ga0105243_100883241 205
460 3300009148 Ga0105243_10100798 Ga0105243_101007983 205
461 3300009148 Ga0105243_10682441 Ga0105243_106824411 205
462 3300009148 Ga0105243_11345118 Ga0105243_113451181 205
463 3300009174 Ga0105241_10002335 Ga0105241_1000233514 205
464 3300009174 Ga0105241_10014047 Ga0105241_100140472 205
465 3300009174 Ga0105241_10016188 Ga0105241_100161889 205
466 3300009174 Ga0105241_10024062 Ga0105241_100240623 205
467 3300009174 Ga0105241_10041637 Ga0105241_100416374 205
468 3300009174 Ga0105241_10180978 Ga0105241_101809782 205
469 3300009176 Ga0105242_10012128 Ga0105242_100121283 205
470 3300009176 Ga0105242_10018436 Ga0105242_100184363 205
471 3300009176 Ga0105242_10638387 Ga0105242_106383872 205
472 3300009176 Ga0105242_10771680 Ga0105242_107716801 205
473 3300009176 Ga0105242_11097111 Ga0105242_110971111 205
474 3300009176 Ga0105242_11219632 Ga0105242_112196321 205
475 3300009177 Ga0105248_10108818 Ga0105248_101088183 205
476 3300009177 Ga0105248_10442555 Ga0105248_104425551 205
477 3300009177 Ga0105248_11373771 Ga0105248_113737711 205
478 3300009545 Ga0105237_10003028 Ga0105237_100030289 205
479 3300009545 Ga0105237_10006900 Ga0105237_100069002 205
480 3300009545 Ga0105237_10071221 Ga0105237_100712213 205
481 3300009545 Ga0105237_10092975 Ga0105237_100929754 205
482 3300009545 Ga0105237_10380971 Ga0105237_103809712 205
483 3300009545 Ga0105237_10629162 Ga0105237_106291622 205
484 3300009551 Ga0105238_10017449 Ga0105238_100174494 205
485 3300009551 Ga0105238_10026969 Ga0105238_100269697 205
486 3300009551 Ga0105238_10050679 Ga0105238_100506793 205
487 3300009551 Ga0105238_10053343 Ga0105238_100533433 205
488 3300009551 Ga0105238_10428381 Ga0105238_104283812 205
489 3300009551 Ga0105238_10900454 Ga0105238_109004541 205
490 3300009553 Ga0105249_10000531 Ga0105249_100005313 205
491 3300009553 Ga0105249_10008319 Ga0105249_100083194 205
492 3300009553 Ga0105249_10070606 Ga0105249_100706063 205
493 3300009553 Ga0105249_10107309 Ga0105249_101073092 205
494 3300009553 Ga0105249_10166990 Ga0105249_101669902 205
495 3300009553 Ga0105249_10333549 Ga0105249_103335492 205
496 3300009553 Ga0105249_10370752 Ga0105249_103707522 205
497 3300009553 Ga0105249_10752003 Ga0105249_107520031 205
498 3300009553 Ga0105249_10772019 Ga0105249_107720191 205
499 3300010159 Ga0099796_10002097 Ga0099796_100020974 205
500 3300010375 Ga0105239_10010524 Ga0105239_100105242 205
501 3300010375 Ga0105239_10030053 Ga0105239_100300536 205
502 3300010375 Ga0105239_10067664 Ga0105239_100676644 205
503 3300010375 Ga0105239_10168067 Ga0105239_101680674 205
504 3300010375 Ga0105239_10937793 Ga0105239_109377931 205
505 3300011119 Ga0105246_10015297 Ga0105246_100152974 205
506 3300011119 Ga0105246_10024383 Ga0105246_100243833 205
507 3300011119 Ga0105246_10095782 Ga0105246_100957822 205
508 3300011119 Ga0105246_10164786 Ga0105246_101647863 205
509 3300011119 Ga0105246_10215498 Ga0105246_102154981 205
510 3300011119 Ga0105246_10986868 Ga0105246_109868681 205
511 3300013100 Ga0157373_10064010 Ga0157373_100640104 205
512 3300013100 Ga0157373_10102109 Ga0157373_101021093 205
513 3300013102 Ga0157371_10024584 Ga0157371_100245844 205
514 3300013104 Ga0157370_10019510 Ga0157370_1001951011 205
515 3300013104 Ga0157370_10019637 Ga0157370_100196375 205
516 3300013104 Ga0157370_10110620 Ga0157370_101106202 205
517 3300013104 Ga0157370_10132278 Ga0157370_101322783 205
518 3300013104 Ga0157370_10395219 Ga0157370_103952193 205
519 3300013104 Ga0157370_10893728 Ga0157370_108937281 205
520 3300013105 Ga0157369_10001030 Ga0157369_1000103014 205
521 3300013105 Ga0157369_10093483 Ga0157369_100934833 205
522 3300013105 Ga0157369_10146006 Ga0157369_101460062 205
523 3300013105 Ga0157369_10185997 Ga0157369_101859975 205
524 3300013105 Ga0157369_10696279 Ga0157369_106962791 205
525 3300013296 Ga0157374_10175222 Ga0157374_101752223 205
526 3300013296 Ga0157374_10230288 Ga0157374_102302881 205
527 3300013296 Ga0157374_10391418 Ga0157374_103914181 205
528 3300013297 Ga0157378_10043214 Ga0157378_100432146 205
529 3300013297 Ga0157378_10231402 Ga0157378_102314022 205
530 3300013297 Ga0157378_10622154 Ga0157378_106221541 205
531 3300013306 Ga0163162_10054728 Ga0163162_100547286 205
532 3300013306 Ga0163162_10082841 Ga0163162_100828413 205
533 3300013306 Ga0163162_10117746 Ga0163162_101177462 205
534 3300013306 Ga0163162_10750552 Ga0163162_107505522 205
535 3300013307 Ga0157372_10026742 Ga0157372_100267426 205
536 3300013307 Ga0157372_10109363 Ga0157372_101093633 205
537 3300013307 Ga0157372_10135005 Ga0157372_101350052 205
538 3300013307 Ga0157372_10191024 Ga0157372_101910244 205
539 3300013307 Ga0157372_10991994 Ga0157372_109919942 205
540 3300013307 Ga0157372_11213938 Ga0157372_112139381 205
541 3300013308 Ga0157375_10001988 Ga0157375_1000198816 205
542 3300013308 Ga0157375_10008047 Ga0157375_100080473 205
543 3300013308 Ga0157375_10143231 Ga0157375_101432314 205
544 3300013308 Ga0157375_10189394 Ga0157375_101893942 205
545 3300013308 Ga0157375_10976955 Ga0157375_109769551 205
546 3300014325 Ga0163163_10097157 Ga0163163_100971572 205
547 3300014325 Ga0163163_10365068 Ga0163163_103650682 205
548 3300014325 Ga0163163_10416832 Ga0163163_104168322 205
549 3300014325 Ga0163163_10459326 Ga0163163_104593261 205
550 3300014325 Ga0163163_10646252 Ga0163163_106462522 205
551 3300014325 Ga0163163_11283878 Ga0163163_112838781 205
552 3300014326 Ga0157380_10405808 Ga0157380_104058082 205
553 3300014326 Ga0157380_10504078 Ga0157380_105040782 205
554 3300014326 Ga0157380_10716256 Ga0157380_107162562 205
555 3300014497 Ga0182008_10054407 Ga0182008_100544071 205
556 3300014745 Ga0157377_10025352 Ga0157377_100253524 205
557 3300014968 Ga0157379_10000749 Ga0157379_1000074911 205
558 3300014968 Ga0157379_10016989 Ga0157379_1001698910 205
559 3300014968 Ga0157379_10075923 Ga0157379_100759233 205
560 3300014968 Ga0157379_10133417 Ga0157379_101334172 205
561 3300014968 Ga0157379_10290156 Ga0157379_102901561 205
562 3300014968 Ga0157379_10361360 Ga0157379_103613602 205
563 3300014968 Ga0157379_10734299 Ga0157379_107342991 205
564 3300014969 Ga0157376_10003317 Ga0157376_100033175 205
565 3300014969 Ga0157376_10399975 Ga0157376_103999751 205
566 3300015262 Ga0182007_10035490 Ga0182007_100354902 205
567 3300015262 Ga0182007_10052757 Ga0182007_100527572 205
568 3300015265 Ga0182005_1092467 Ga0182005_10924671 205
569 3300015689 Ga0183360_11619 Ga0183360_116191 205
570 3300017792 Ga0163161_10003533 Ga0163161_100035333 205
571 3300017792 Ga0163161_10025367 Ga0163161_100253673 205
572 3300017792 Ga0163161_10084722 Ga0163161_100847223 205
573 3300017792 Ga0163161_10264032 Ga0163161_102640322 205
574 3300017792 Ga0163161_10741409 Ga0163161_107414091 205
575 3300020076 Ga0206355_1642619 Ga0206355_16426192 205
576 3300021320 Ga0214544_1000020 Ga0214544_1000020115 205
577 3300021321 Ga0214542_1000024 Ga0214542_1000024126 205
578 3300021324 Ga0214545_1000011 Ga0214545_1000011126 205
579 3300021327 Ga0214543_1000033 Ga0214543_100003378 205
580 3300021384 Ga0213876_10009498 Ga0213876_100094986 205
581 3300021441 Ga0213871_10081219 Ga0213871_100812191 205
582 3300022467 Ga0224712_10238004 Ga0224712_102380041 205
583 3300025230 Ga0209563_101494 Ga0209563_1014948 205
584 3300025246 Ga0209646_1012674 Ga0209646_10126742 205
585 3300025250 Ga0209026_1000002 Ga0209026_1000002202 205
586 3300025250 Ga0209026_1029710 Ga0209026_10297101 205
587 3300025253 Ga0209677_102419 Ga0209677_1024194 205
588 3300025254 Ga0209148_1000038 Ga0209148_1000038311 205
589 3300025256 Ga0209759_1000062 Ga0209759_1000062115 205
590 3300025261 Ga0209233_1000027 Ga0209233_1000027206 205
591 3300025261 Ga0209233_1000421 Ga0209233_100042121 205
592 3300025272 Ga0209455_1000068 Ga0209455_1000068115 205
593 3300025292 Ga0209676_1000082 Ga0209676_100008268 205
594 3300025297 Ga0209758_1000407 Ga0209758_100040735 205
595 3300025297 Ga0209758_1000900 Ga0209758_100090031 205
596 3300025297 Ga0209758_1000952 Ga0209758_10009528 205
597 3300025297 Ga0209758_1005567 Ga0209758_10055679 205
598 3300025299 Ga0209256_1011331 Ga0209256_10113311 205
599 3300025302 Ga0207426_1000466 Ga0207426_100046646 205
600 3300025304 Ga0209257_1000459 Ga0209257_100045945 205
601 3300025304 Ga0209257_1001445 Ga0209257_100144514 205
602 3300025315 Ga0207697_10063726 Ga0207697_100637261 205
603 3300025315 Ga0207697_10200825 Ga0207697_102008252 205
604 3300025321 Ga0207656_10008565 Ga0207656_100085653 205
605 3300025711 Ga0207696_1074805 Ga0207696_10748051 205
606 3300025885 Ga0207653_10001588 Ga0207653_100015884 205
607 3300025885 Ga0207653_10233721 Ga0207653_102337211 205
608 3300025898 Ga0207692_10055751 Ga0207692_100557513 205
609 3300025898 Ga0207692_10318999 Ga0207692_103189991 205
610 3300025899 Ga0207642_10029261 Ga0207642_100292612 205
611 3300025899 Ga0207642_10437371 Ga0207642_104373711 205
612 3300025900 Ga0207710_10013792 Ga0207710_100137924 205
613 3300025901 Ga0207688_10273069 Ga0207688_102730691 205
614 3300025903 Ga0207680_10030082 Ga0207680_100300821 205
615 3300025904 Ga0207647_10004130 Ga0207647_1000413011 205
616 3300025904 Ga0207647_10007855 Ga0207647_100078558 205
617 3300025904 Ga0207647_10026597 Ga0207647_100265973 205
618 3300025904 Ga0207647_10043340 Ga0207647_100433402 205
619 3300025904 Ga0207647_10081984 Ga0207647_100819841 205
620 3300025904 Ga0207647_10208481 Ga0207647_102084812 205
621 3300025905 Ga0207685_10007736 Ga0207685_100077361 205
622 3300025905 Ga0207685_10085006 Ga0207685_100850061 205
623 3300025905 Ga0207685_10115392 Ga0207685_101153921 205
624 3300025906 Ga0207699_10000247 Ga0207699_100002471 205
625 3300025906 Ga0207699_10006459 Ga0207699_100064595 205
626 3300025906 Ga0207699_10020990 Ga0207699_100209904 205
627 3300025906 Ga0207699_10037459 Ga0207699_100374592 205
628 3300025907 Ga0207645_10018132 Ga0207645_100181324 205
629 3300025907 Ga0207645_10046403 Ga0207645_100464032 205
630 3300025907 Ga0207645_10372579 Ga0207645_103725791 205
631 3300025909 Ga0207705_10085846 Ga0207705_100858462 205
632 3300025909 Ga0207705_10108390 Ga0207705_101083903 205
633 3300025909 Ga0207705_10220589 Ga0207705_102205892 205
634 3300025909 Ga0207705_10235580 Ga0207705_102355801 205
635 3300025911 Ga0207654_10028657 Ga0207654_100286574 205
636 3300025911 Ga0207654_10032030 Ga0207654_100320301 205
637 3300025912 Ga0207707_10056300 Ga0207707_100563003 205
638 3300025912 Ga0207707_10111346 Ga0207707_101113462 205
639 3300025912 Ga0207707_10154670 Ga0207707_101546701 205
640 3300025912 Ga0207707_10171728 Ga0207707_101717282 205
641 3300025912 Ga0207707_10232803 Ga0207707_102328033 205
642 3300025912 Ga0207707_10546335 Ga0207707_105463351 205
643 3300025913 Ga0207695_10080996 Ga0207695_100809963 205
644 3300025913 Ga0207695_10137937 Ga0207695_101379374 205
645 3300025913 Ga0207695_10266602 Ga0207695_102666023 205
646 3300025913 Ga0207695_10359508 Ga0207695_103595082 205
647 3300025914 Ga0207671_10001115 Ga0207671_100011159 205
648 3300025914 Ga0207671_10028628 Ga0207671_100286283 205
649 3300025914 Ga0207671_10033498 Ga0207671_100334983 205
650 3300025914 Ga0207671_10098471 Ga0207671_100984711 205
651 3300025914 Ga0207671_10116914 Ga0207671_101169141 205
652 3300025914 Ga0207671_10157615 Ga0207671_101576152 205
653 3300025915 Ga0207693_10000452 Ga0207693_1000045228 205
654 3300025915 Ga0207693_10010567 Ga0207693_100105674 205
655 3300025915 Ga0207693_10328403 Ga0207693_103284031 205
656 3300025916 Ga0207663_10024121 Ga0207663_100241213 205
657 3300025916 Ga0207663_10049118 Ga0207663_100491183 205
658 3300025916 Ga0207663_10070876 Ga0207663_100708763 205
659 3300025917 Ga0207660_10067495 Ga0207660_100674953 205
660 3300025917 Ga0207660_10258532 Ga0207660_102585321 205
661 3300025918 Ga0207662_10002336 Ga0207662_100023369 205
662 3300025919 Ga0207657_10000216 Ga0207657_1000021652 205
663 3300025919 Ga0207657_10007456 Ga0207657_100074565 205
664 3300025919 Ga0207657_10114352 Ga0207657_101143522 205
665 3300025919 Ga0207657_10182122 Ga0207657_101821223 205
666 3300025920 Ga0207649_10000746 Ga0207649_1000074610 205
667 3300025920 Ga0207649_10003062 Ga0207649_100030622 205
668 3300025920 Ga0207649_10103220 Ga0207649_101032202 205
669 3300025920 Ga0207649_10594945 Ga0207649_105949451 205
670 3300025921 Ga0207652_10011743 Ga0207652_100117431 205
671 3300025921 Ga0207652_10096405 Ga0207652_100964053 205
672 3300025922 Ga0207646_10017030 Ga0207646_1001703010 205
673 3300025923 Ga0207681_10008312 Ga0207681_100083125 205
674 3300025923 Ga0207681_10401768 Ga0207681_104017681 205
675 3300025923 Ga0207681_10487979 Ga0207681_104879792 205
676 3300025924 Ga0207694_10013968 Ga0207694_100139682 205
677 3300025924 Ga0207694_10053540 Ga0207694_100535402 205
678 3300025924 Ga0207694_10074985 Ga0207694_100749853 205
679 3300025924 Ga0207694_10370236 Ga0207694_103702361 205
680 3300025924 Ga0207694_10410411 Ga0207694_104104111 205
681 3300025925 Ga0207650_10029186 Ga0207650_100291864 205
682 3300025925 Ga0207650_10377393 Ga0207650_103773933 205
683 3300025926 Ga0207659_10186178 Ga0207659_101861782 205
684 3300025926 Ga0207659_10204786 Ga0207659_102047864 205
685 3300025926 Ga0207659_10304953 Ga0207659_103049531 205
686 3300025926 Ga0207659_10378426 Ga0207659_103784262 205
687 3300025927 Ga0207687_10073987 Ga0207687_100739873 205
688 3300025927 Ga0207687_10373717 Ga0207687_103737172 205
689 3300025927 Ga0207687_10585649 Ga0207687_105856491 205
690 3300025928 Ga0207700_10000005 Ga0207700_10000005130 205
691 3300025928 Ga0207700_10858763 Ga0207700_108587631 205
692 3300025929 Ga0207664_10029550 Ga0207664_100295505 205
693 3300025929 Ga0207664_10067335 Ga0207664_100673354 205
694 3300025929 Ga0207664_10385348 Ga0207664_103853482 205
695 3300025929 Ga0207664_10659262 Ga0207664_106592621 205
696 3300025929 Ga0207664_11151621 Ga0207664_111516211 205
697 3300025931 Ga0207644_10048242 Ga0207644_100482423 205
698 3300025931 Ga0207644_10654242 Ga0207644_106542421 205
699 3300025932 Ga0207690_10020548 Ga0207690_100205482 205
700 3300025932 Ga0207690_10044955 Ga0207690_100449553 205
701 3300025933 Ga0207706_10004343 Ga0207706_100043433 205
702 3300025933 Ga0207706_10023201 Ga0207706_100232014 205
703 3300025933 Ga0207706_10193087 Ga0207706_101930872 205
704 3300025933 Ga0207706_10326748 Ga0207706_103267481 205
705 3300025934 Ga0207686_10009840 Ga0207686_100098405 205
706 3300025934 Ga0207686_10287222 Ga0207686_102872222 205
707 3300025934 Ga0207686_10559218 Ga0207686_105592181 205
708 3300025935 Ga0207709_10061448 Ga0207709_100614483 205
709 3300025935 Ga0207709_10166159 Ga0207709_101661592 205
710 3300025935 Ga0207709_10343431 Ga0207709_103434312 205
711 3300025936 Ga0207670_10013288 Ga0207670_100132881 205
712 3300025936 Ga0207670_10085302 Ga0207670_100853022 205
713 3300025936 Ga0207670_10984073 Ga0207670_109840731 205
714 3300025937 Ga0207669_10006682 Ga0207669_100066823 205
715 3300025937 Ga0207669_10094332 Ga0207669_100943321 205
716 3300025938 Ga0207704_10002567 Ga0207704_100025672 205
717 3300025938 Ga0207704_10020922 Ga0207704_100209223 205
718 3300025938 Ga0207704_10480338 Ga0207704_104803381 205
719 3300025939 Ga0207665_10000221 Ga0207665_100002215 205
720 3300025939 Ga0207665_10074793 Ga0207665_100747932 205
721 3300025940 Ga0207691_10005941 Ga0207691_1000594111 205
722 3300025940 Ga0207691_10216278 Ga0207691_102162782 205
723 3300025941 Ga0207711_10064180 Ga0207711_100641803 205
724 3300025942 Ga0207689_10036092 Ga0207689_100360924 205
725 3300025942 Ga0207689_10160394 Ga0207689_101603943 205
726 3300025942 Ga0207689_10166143 Ga0207689_101661432 205
727 3300025942 Ga0207689_10394632 Ga0207689_103946322 205
728 3300025945 Ga0207679_10013396 Ga0207679_100133963 205
729 3300025949 Ga0207667_10093222 Ga0207667_100932222 205
730 3300025949 Ga0207667_10186802 Ga0207667_101868022 205
731 3300025949 Ga0207667_10200984 Ga0207667_102009843 205
732 3300025949 Ga0207667_10211185 Ga0207667_102111852 205
733 3300025949 Ga0207667_10559828 Ga0207667_105598281 205
734 3300025949 Ga0207667_10593846 Ga0207667_105938462 205
735 3300025960 Ga0207651_10002858 Ga0207651_1000285810 205
736 3300025961 Ga0207712_10005342 Ga0207712_100053422 205
737 3300025961 Ga0207712_10024603 Ga0207712_100246034 205
738 3300025961 Ga0207712_10063511 Ga0207712_100635111 205
739 3300025961 Ga0207712_10108912 Ga0207712_101089124 205
740 3300025961 Ga0207712_10195529 Ga0207712_101955292 205
741 3300025961 Ga0207712_10219331 Ga0207712_102193311 205
742 3300025961 Ga0207712_10304584 Ga0207712_103045842 205
743 3300025961 Ga0207712_10773934 Ga0207712_107739341 205
744 3300025972 Ga0207668_10013005 Ga0207668_100130053 205
745 3300025972 Ga0207668_10057577 Ga0207668_100575771 205
746 3300025972 Ga0207668_10082339 Ga0207668_100823392 205
747 3300025972 Ga0207668_10173086 Ga0207668_101730862 205
748 3300025972 Ga0207668_10230094 Ga0207668_102300942 205
749 3300025972 Ga0207668_10760481 Ga0207668_107604811 205
750 3300025981 Ga0207640_10006200 Ga0207640_100062002 205
751 3300025981 Ga0207640_10424385 Ga0207640_104243851 205
752 3300025986 Ga0207658_10119156 Ga0207658_101191565 205
753 3300025986 Ga0207658_10246838 Ga0207658_102468382 205
754 3300025986 Ga0207658_10287354 Ga0207658_102873543 205
755 3300025986 Ga0207658_10455791 Ga0207658_104557911 205
756 3300025986 Ga0207658_10575822 Ga0207658_105758222 205
757 3300026023 Ga0207677_10100552 Ga0207677_101005523 205
758 3300026023 Ga0207677_10109511 Ga0207677_101095114 205
759 3300026035 Ga0207703_10011279 Ga0207703_100112792 205
760 3300026035 Ga0207703_10077424 Ga0207703_100774242 205
761 3300026035 Ga0207703_10084220 Ga0207703_100842201 205
762 3300026035 Ga0207703_10152980 Ga0207703_101529802 205
763 3300026035 Ga0207703_10239751 Ga0207703_102397512 205
764 3300026035 Ga0207703_10555384 Ga0207703_105553842 205
765 3300026041 Ga0207639_10002485 Ga0207639_1000248510 205
766 3300026041 Ga0207639_10004167 Ga0207639_1000416710 205
767 3300026041 Ga0207639_10004947 Ga0207639_100049476 205
768 3300026041 Ga0207639_10313166 Ga0207639_103131662 205
769 3300026041 Ga0207639_10341915 Ga0207639_103419152 205
770 3300026041 Ga0207639_10376317 Ga0207639_103763171 205
771 3300026041 Ga0207639_11272816 Ga0207639_112728161 205
772 3300026067 Ga0207678_10000074 Ga0207678_1000007444 205
773 3300026067 Ga0207678_10009216 Ga0207678_100092163 205
774 3300026067 Ga0207678_10010215 Ga0207678_100102153 205
775 3300026067 Ga0207678_10017036 Ga0207678_100170362 205
776 3300026067 Ga0207678_10104636 Ga0207678_101046361 205
777 3300026067 Ga0207678_10131972 Ga0207678_101319722 205
778 3300026067 Ga0207678_10161833 Ga0207678_101618333 205
779 3300026067 Ga0207678_10175750 Ga0207678_101757502 205
780 3300026067 Ga0207678_10694159 Ga0207678_106941591 205
781 3300026067 Ga0207678_10695720 Ga0207678_106957201 205
782 3300026067 Ga0207678_11032402 Ga0207678_110324021 205
783 3300026075 Ga0207708_10002195 Ga0207708_1000219512 205
784 3300026075 Ga0207708_10002674 Ga0207708_1000267414 205
785 3300026075 Ga0207708_10144281 Ga0207708_101442813 205
786 3300026075 Ga0207708_10185551 Ga0207708_101855512 205
787 3300026078 Ga0207702_10000159 Ga0207702_1000015914 205
788 3300026078 Ga0207702_10151474 Ga0207702_101514741 205
789 3300026078 Ga0207702_10235157 Ga0207702_102351572 205
790 3300026078 Ga0207702_10278184 Ga0207702_102781841 205
791 3300026078 Ga0207702_10757700 Ga0207702_107577001 205
792 3300026088 Ga0207641_10033600 Ga0207641_100336007 205
793 3300026088 Ga0207641_10268125 Ga0207641_102681252 205
794 3300026089 Ga0207648_10083551 Ga0207648_100835513 205
795 3300026089 Ga0207648_10100658 Ga0207648_101006582 205
796 3300026089 Ga0207648_10115039 Ga0207648_101150391 205
797 3300026089 Ga0207648_10124445 Ga0207648_101244452 205
798 3300026089 Ga0207648_10361362 Ga0207648_103613621 205
799 3300026095 Ga0207676_10039841 Ga0207676_100398414 205
800 3300026095 Ga0207676_10149585 Ga0207676_101495851 205
801 3300026116 Ga0207674_10000335 Ga0207674_1000033553 205
802 3300026116 Ga0207674_10015555 Ga0207674_100155558 205
803 3300026116 Ga0207674_10023181 Ga0207674_100231815 205
804 3300026116 Ga0207674_10120421 Ga0207674_101204212 205
805 3300026116 Ga0207674_10613208 Ga0207674_106132081 205
806 3300026118 Ga0207675_100000039 Ga0207675_10000003948 205
807 3300026118 Ga0207675_100053803 Ga0207675_1000538034 205
808 3300026118 Ga0207675_100274569 Ga0207675_1002745692 205
809 3300026121 Ga0207683_10000595 Ga0207683_1000059527 205
810 3300026121 Ga0207683_10073841 Ga0207683_100738412 205
811 3300026121 Ga0207683_10080590 Ga0207683_100805904 205
812 3300026121 Ga0207683_10169014 Ga0207683_101690142 205
813 3300026142 Ga0207698_10034219 Ga0207698_100342192 205
814 3300026142 Ga0207698_10470470 Ga0207698_104704702 205
815 3300026142 Ga0207698_11452894 Ga0207698_114528941 205
816 3300027296 Ga0209389_1000011 Ga0209389_100001190 205
817 3300027296 Ga0209389_1000025 Ga0209389_1000025150 205
818 3300027357 Ga0209589_1000018 Ga0209589_100001862 205
819 3300027357 Ga0209589_1000066 Ga0209589_100006699 205
820 3300027361 Ga0209489_100017 Ga0209489_100017144 205
821 3300027361 Ga0209489_100026 Ga0209489_10002662 205
822 3300027361 Ga0209489_100030 Ga0209489_10003014 205
823 3300027363 Ga0209700_100027 Ga0209700_10002790 205
824 3300027363 Ga0209700_100035 Ga0209700_10003562 205
825 3300027512 Ga0209179_1005602 Ga0209179_10056022 205
826 3300027866 Ga0209813_10000760 Ga0209813_100007605 205
827 3300027866 Ga0209813_10005375 Ga0209813_100053752 205
828 3300027866 Ga0209813_10044758 Ga0209813_100447581 205
829 3300027866 Ga0209813_10059953 Ga0209813_100599531 205
830 3300027876 Ga0209974_10087936 Ga0209974_100879361 205
831 3300027907 Ga0207428_10008033 Ga0207428_100080336 205
832 3300027907 Ga0207428_10043605 Ga0207428_100436053 205
833 3300027907 Ga0207428_10078442 Ga0207428_100784421 205
834 3300027907 Ga0207428_10172000 Ga0207428_101720002 205
835 3300027907 Ga0207428_10195403 Ga0207428_101954032 205
836 3300027907 Ga0207428_10666539 Ga0207428_106665391 205
837 3300028379 Ga0268266_10000873 Ga0268266_1000087336 205
838 3300028379 Ga0268266_10087621 Ga0268266_100876212 205
839 3300028379 Ga0268266_10129837 Ga0268266_101298372 205
840 3300028379 Ga0268266_10238915 Ga0268266_102389151 205
841 3300028380 Ga0268265_10001274 Ga0268265_1000127423 205
842 3300028380 Ga0268265_10031136 Ga0268265_100311363 205
843 3300028380 Ga0268265_10298580 Ga0268265_102985802 205
844 3300028380 Ga0268265_10363619 Ga0268265_103636193 205
845 3300028380 Ga0268265_11128615 Ga0268265_111286151 205
846 3300028381 Ga0268264_10005176 Ga0268264_100051762 205
847 3300028381 Ga0268264_10021651 Ga0268264_100216512 205
848 3300028381 Ga0268264_10024677 Ga0268264_100246772 205
849 3300028381 Ga0268264_10101089 Ga0268264_101010892 205
850 3300028381 Ga0268264_10316793 Ga0268264_103167932 205
851 3300028381 Ga0268264_10607753 Ga0268264_106077532 205
852 3300028577 Ga0265318_10037477 Ga0265318_100374772 205
853 3300028577 Ga0265318_10163334 Ga0265318_101633341 205
854 3300028786 Ga0307517_10175344 Ga0307517_101753441 205
855 3300028794 Ga0307515_10298722 Ga0307515_102987222 205
856 3300031239 Ga0265328_10006595 Ga0265328_100065953 205
857 3300031241 Ga0265325_10049914 Ga0265325_100499142 205
858 3300031247 Ga0265340_10001518 Ga0265340_1000151813 205
859 3300031247 Ga0265340_10075342 Ga0265340_100753422 205
860 3300031247 Ga0265340_10091620 Ga0265340_100916202 205
861 3300031247 Ga0265340_10119958 Ga0265340_101199582 205
862 3300031249 Ga0265339_10096644 Ga0265339_100966443 205
863 3300031250 Ga0265331_10000002 Ga0265331_10000002259 205
864 3300031250 Ga0265331_10000017 Ga0265331_1000001745 205
865 3300031250 Ga0265331_10000478 Ga0265331_1000047814 205
866 3300031250 Ga0265331_10016612 Ga0265331_100166122 205
867 3300031250 Ga0265331_10162272 Ga0265331_101622722 205
868 3300031250 Ga0265331_10191643 Ga0265331_101916431 205
869 3300031251 Ga0265327_10000033 Ga0265327_10000033245 205
870 3300031344 Ga0265316_10005893 Ga0265316_100058934 205
871 3300031344 Ga0265316_10017819 Ga0265316_100178192 205
872 3300031344 Ga0265316_10143150 Ga0265316_101431502 205
873 3300031456 Ga0307513_10025773 Ga0307513_100257736 205
874 3300031548 Ga0307408_100316171 Ga0307408_1003161712 205
875 3300031595 Ga0265313_10002202 Ga0265313_1000220210 205
876 3300031711 Ga0265314_10018836 Ga0265314_100188363 205
877 3300031711 Ga0265314_10039537 Ga0265314_100395372 205
878 3300031711 Ga0265314_10047684 Ga0265314_100476844 205
879 3300031711 Ga0265314_10165830 Ga0265314_101658302 205
880 3300031712 Ga0265342_10006480 Ga0265342_100064806 205
881 3300031730 Ga0307516_10059535 Ga0307516_100595354 205
882 3300031824 Ga0307413_10123279 Ga0307413_101232792 205
883 3300031852 Ga0307410_10847323 Ga0307410_108473231 205
884 3300031901 Ga0307406_10000774 Ga0307406_100007748 205
885 3300031901 Ga0307406_10481156 Ga0307406_104811561 205
886 3300031901 Ga0307406_10665748 Ga0307406_106657481 205
887 3300031911 Ga0307412_10003682 Ga0307412_100036825 205
888 3300031911 Ga0307412_10120408 Ga0307412_101204082 205
889 3300031911 Ga0307412_10632544 Ga0307412_106325441 205
890 3300031995 Ga0307409_100122190 Ga0307409_1001221902 205
891 3300031995 Ga0307409_100402903 Ga0307409_1004029031 205
892 3300031995 Ga0307409_100613668 Ga0307409_1006136682 205
893 3300031995 Ga0307409_100933318 Ga0307409_1009333181 205
894 3300032004 Ga0307414_10014861 Ga0307414_100148614 205
895 3300032004 Ga0307414_10136883 Ga0307414_101368833 205
896 3300032004 Ga0307414_10158594 Ga0307414_101585942 205
897 3300032004 Ga0307414_10276399 Ga0307414_102763992 205
898 3300032004 Ga0307414_10449737 Ga0307414_104497372 205
899 3300032005 Ga0307411_10187376 Ga0307411_101873762 205
900 3300032005 Ga0307411_10621267 Ga0307411_106212671 205
901 3300032126 Ga0307415_101269811 Ga0307415_1012698111 205
902 3300032133 Ga0316583_10025586 Ga0316583_100255862 205
903 3300032137 Ga0316585_10018624 Ga0316585_100186242 205
904 3300032168 Ga0316593_10027378 Ga0316593_100273782 205
905 3300032168 Ga0316593_10197251 Ga0316593_101972511 205
906 3300033180 Ga0307510_10010422 Ga0307510_100104221 205
907 3300033180 Ga0307510_10081949 Ga0307510_100819494 205
908 3300033180 Ga0307510_10292534 Ga0307510_102925341 205
909 3300033524 Ga0316592_1022506 Ga0316592_10225062 205
910 3300033524 Ga0316592_1042795 Ga0316592_10427951 205
911 3300033527 Ga0316586_1006026 Ga0316586_10060262 205
912 3300033528 Ga0316588_1017308 Ga0316588_10173081 205
913 3300033529 Ga0316587_1051103 Ga0316587_10511031 205
914 3300033541 Ga0316596_1027015 Ga0316596_10270152 205
915 3300035084 Ga0373928_0039814 Ga0373928_0039814_421_1038 205
916 3300035088 Ga0373940_0124594 Ga0373940_0124594_108_725 205
917 3300035090 Ga0373949_0003058 Ga0373949_0003058_3031_3648 205
918 3300035090 Ga0373949_0036948 Ga0373949_0036948_407_1024 205
919 3300035114 Ga0373939_0005251 Ga0373939_0005251_29_646 205
920 3300035114 Ga0373939_0007825 Ga0373939_0007825_1940_2557 205
921 3300035114 Ga0373939_0084871 Ga0373939_0084871_162_779 205
922 3300035115 Ga0373941_0010797 Ga0373941_0010797_1332_1949 205
923 3300035115 Ga0373941_0220077 Ga0373941_0220077_81_698 205
924 3300035117 Ga0373953_0120779 Ga0373953_0120779_310_927 205
925 3300035118 Ga0373954_0047670 Ga0373954_0047670_597_1214 205
926 3300035118 Ga0373954_0207274 Ga0373954_0207274_262_879 205
927 3300035119 Ga0373956_0023275 Ga0373956_0023275_1601_2218 205
928 3300035120 Ga0373957_0181984 Ga0373957_0181984_161_778 205
929 3300035121 Ga0373960_0007243 Ga0373960_0007243_1092_1709 205
930 3300035121 Ga0373960_0013830 Ga0373960_0013830_1161_1778 205
931 3300035121 Ga0373960_0069484 Ga0373960_0069484_332_949 205
932 3300035121 Ga0373960_0073403 Ga0373960_0073403_92_709 205
933 3300035170 Ga0373943_0108265 Ga0373943_0108265_460_1077 205
934 3300035172 Ga0373955_0038963 Ga0373955_0038963_984_1601 205
935 3300035207 Ga0373942_0009911 Ga0373942_0009911_222_839 205
936 3300035207 Ga0373942_0021023 Ga0373942_0021023_657_1274 205
937 3300035241 Ga0373961_0010094 Ga0373961_0010094_743_1360 205
938 3300035241 Ga0373961_0066618 Ga0373961_0066618_191_808 205
939 3300035241 Ga0373961_0071723 Ga0373961_0071723_371_988 205
940 3300035242 Ga0373962_0001511 Ga0373962_0001511_4523_5140 205
941 3300035691 Ga0373931_0001319 Ga0373931_0001319_9592_10209 205
942 3300035691 Ga0373931_0004510 Ga0373931_0004510_2331_2948 205
943 3300035691 Ga0373931_0020752 Ga0373931_0020752_770_1387 205
944 3300035691 Ga0373931_0167002 Ga0373931_0167002_363_980 205
945 3300035691 Ga0373931_0214314 Ga0373931_0214314_61_678 205
946 3300035692 Ga0373935_0001191 Ga0373935_0001191_8006_8623 205
947 3300035692 Ga0373935_0012370 Ga0373935_0012370_535_1152 205
948 3300035692 Ga0373935_0349075 Ga0373935_0349075_400_1017 205
949 3300035695 Ga0373927_0011783 Ga0373927_0011783_2981_3598 205
950 3300035695 Ga0373927_0197512 Ga0373927_0197512_107_724 205
951 3300035695 Ga0373927_0251341 Ga0373927_0251341_101_718 205
952 3300035725 Ga0373947_0067957 Ga0373947_0067957_733_1350 205
953 3300035725 Ga0373947_0472092 Ga0373947_0472092_187_804 205
954 3300036401 Ga0373937_0044626 Ga0373937_0044626_1230_1847 205
955 3300036401 Ga0373937_0096130 Ga0373937_0096130_1583_2200 205
956 3300036401 Ga0373937_0345739 Ga0373937_0345739_233_850 205
957 3300036647 Ga0316582_0232890 Ga0316582_0232890_328_945 205
958 3300036712 Ga0316584_0061029 Ga0316584_0061029_1749_2366 205
959 3300037068 Ga0373925_0016064 Ga0373925_0016064_4230_4847 205
960 3300037068 Ga0373925_0023175 Ga0373925_0023175_3731_4348 205
961 3300037312 Ga0395899_0000059 Ga0395899_0000059_86693_87337 205
962 3300037312 Ga0395899_0004247 Ga0395899_0004247_1764_2396 205
963 3300037312 Ga0395899_0406994 Ga0395899_0406994_59_676 205
964 3300037312 Ga0395899_0506796 Ga0395899_0506796_15_632 205
965 3300037418 Ga0395900_0000017 Ga0395900_0000017_86693_87337 205
966 3300037418 Ga0395900_0017966 Ga0395900_0017966_323_940 205
967 3300037418 Ga0395900_0043669 Ga0395900_0043669_507_1124 205
968 3300037418 Ga0395900_0052008 Ga0395900_0052008_1303_1935 205
969 3300037418 Ga0395900_0249169 Ga0395900_0249169_202_819 205
970 3300037418 Ga0395900_0319674 Ga0395900_0319674_549_1166 205
971 3300037466 Ga0395898_0000030 Ga0395898_0000030_86668_87312 205
972 3300037466 Ga0395898_0182998 Ga0395898_0182998_268_900 205
973 3300037466 Ga0395898_0252953 Ga0395898_0252953_235_852 205
974 3300037466 Ga0395898_0266730 Ga0395898_0266730_136_753 205
975 3300037471 Ga0395905_0000056 Ga0395905_0000056_121894_122538 205
976 3300037471 Ga0395905_0000155 Ga0395905_0000155_2916_3533 205
977 3300037471 Ga0395905_0003237 Ga0395905_0003237_9157_9774 205
978 3300037471 Ga0395905_0015966 Ga0395905_0015966_4901_5518 205
979 3300037471 Ga0395905_0259806 Ga0395905_0259806_56_673 205
980 3300037588 Ga0316581_0019637 Ga0316581_0019637_1280_1897 205
981 3300037853 Ga0436364_1552215 Ga0436364_1552215_5236_5853 205
982 3300038443 Ga0395901_0000015 Ga0395901_0000015_282266_282910 205
983 3300038443 Ga0395901_0006827 Ga0395901_0006827_1596_2213 205
984 3300038443 Ga0395901_0046022 Ga0395901_0046022_2626_3258 205
985 3300038443 Ga0395901_0109187 Ga0395901_0109187_1232_1849 205
986 3300038443 Ga0395901_0250125 Ga0395901_0250125_13_630 205
987 3300038443 Ga0395901_0330958 Ga0395901_0330958_718_1335 205
988 3300038443 Ga0395901_0437297 Ga0395901_0437297_446_1063 205
989 3300039437 Ga0436365_0093392 Ga0436365_0093392_86514_87131 205
990 3300039437 Ga0436365_0226250 Ga0436365_0226250_104_721 205
991 3300039437 Ga0436365_0650967 Ga0436365_0650967_2633_3250 205
992 3300039437 Ga0436365_0761391 Ga0436365_0761391_96_713 205
993 3300039437 Ga0436365_1477315 Ga0436365_1477315_37_654 205
994 3300039438 Ga0436360_0445476 Ga0436360_0445476_12_629 205
995 3300039438 Ga0436360_0815295 Ga0436360_0815295_332_949 205
996 3300039438 Ga0436360_0912999 Ga0436360_0912999_459_1076 205
997 3300039447 Ga0436361_0301054 Ga0436361_0301054_53_670 205
998 3300039450 Ga0436363_1420920 Ga0436363_1420920_235_852 205
999 3300039453 Ga0436362_0171928 Ga0436362_0171928_32_649 205
1000 3300039453 Ga0436362_0528243 Ga0436362_0528243_1049_1666 205
1001 3300041405 Ga0439438_063402 Ga0439438_063402_286_903 205
1002 3300041408 Ga0439453_0023489 Ga0439453_0023489_445_1062 205
1003 3300041443 Ga0451789_0454652 Ga0451789_0454652_140_757 205
1004 3300041453 Ga0451797_0027779 Ga0451797_0027779_416_1033 205
1005 3300041486 Ga0451807_2375559 Ga0451807_2375559_387_1004 205
1006 3300041512 Ga0451853_3496765 Ga0451853_3496765_416_1033 205
1007 3300042004 Ga0439445_0067478 Ga0439445_0067478_282_899 205
1008 3300042005 Ga0439448_0011064 Ga0439448_0011064_1526_2143 205
1009 3300042136 Ga0450900_046263 Ga0450900_046263_14_631 205
1010 3300042438 Ga0439459_0077406 Ga0439459_0077406_64_681 205
1011 3300042532 Ga0450893_0012777 Ga0450893_0012777_497_1114 205
1012 3300042533 Ga0450901_005797 Ga0450901_005797_562_1179 205
1013 3300042993 Ga0439440_0050739 Ga0439440_0050739_209_826 205
1014 3300044656 Ga0466969_0000296 Ga0466969_0000296_20163_20780 205
1015 3300044658 Ga0466972_0000261 Ga0466972_0000261_32463_33080 205
1016 3300044658 Ga0466972_0011899 Ga0466972_0011899_56_673 205
1017 3300044683 Ga0466965_0052182 Ga0466965_0052182_361_978 205
1018 3300044684 Ga0466966_0000163 Ga0466966_0000163_2022_2639 205
1019 3300044693 Ga0466961_0014752 Ga0466961_0014752_585_1202 205
1020 3300044693 Ga0466961_0147439 Ga0466961_0147439_19_636 205
1021 3300044694 Ga0466963_0027220 Ga0466963_0027220_151_768 205
1022 3300044719 Ga0466971_0001744 Ga0466971_0001744_2067_2684 205
1023 3300044765 Ga0466970_0005908 Ga0466970_0005908_2736_3353 205
1024 3300044842 Ga0466957_0052318 Ga0466957_0052318_1561_2178 205
1025 3300044842 Ga0466957_0066260 Ga0466957_0066260_114_731 205
1026 3300044901 Ga0466960_0039510 Ga0466960_0039510_266_883 205
1027 3300045049 Ga0466959_0000071 Ga0466959_0000071_32414_33031 205
1028 3300045049 Ga0466959_0025270 Ga0466959_0025270_3014_3631 205
1029 3300045051 Ga0451576_0804553 Ga0451576_0804553_87_704 205
1030 3300045836 Ga0466958_0000501 Ga0466958_0000501_6442_7059 205
1031 3300045836 Ga0466958_0444992 Ga0466958_0444992_125_742 205
1032 3300046453 Ga0495627_119531 Ga0495627_119531_83_700 205
1033 3300046455 Ga0495603_0000012 Ga0495603_0000012_65222_65839 205
1034 3300046457 Ga0495590_0036195 Ga0495590_0036195_318_935 205
1035 3300046457 Ga0495590_0189340 Ga0495590_0189340_94_711 205
1036 3300046459 Ga0495629_0000204 Ga0495629_0000204_9904_10521 205
1037 3300046459 Ga0495629_0026771 Ga0495629_0026771_2186_2803 205
1038 3300046459 Ga0495629_0036745 Ga0495629_0036745_1384_2001 205
1039 3300046460 Ga0495638_0009691 Ga0495638_0009691_1060_1677 205
1040 3300046460 Ga0495638_0219694 Ga0495638_0219694_393_1010 205
1041 3300046460 Ga0495638_0255997 Ga0495638_0255997_231_848 205
1042 3300046462 Ga0495651_0068227 Ga0495651_0068227_1874_2491 205
1043 3300046471 Ga0495650_0048140 Ga0495650_0048140_47_664 205
1044 3300046472 Ga0495580_0003848 Ga0495580_0003848_7296_7913 205
1045 3300046472 Ga0495580_0031069 Ga0495580_0031069_3063_3680 205
1046 3300046473 Ga0495582_0000956 Ga0495582_0000956_452_1069 205
1047 3300046473 Ga0495582_0038633 Ga0495582_0038633_779_1396 205
1048 3300046474 Ga0495605_0191326 Ga0495605_0191326_222_839 205
1049 3300046475 Ga0495639_0001489 Ga0495639_0001489_6948_7565 205
1050 3300046477 Ga0495664_0028736 Ga0495664_0028736_1046_1663 205
1051 3300046491 Ga0495584_0023311 Ga0495584_0023311_1997_2614 205
1052 3300046491 Ga0495584_0037100 Ga0495584_0037100_217_834 205
1053 3300046491 Ga0495584_0091890 Ga0495584_0091890_131_748 205
1054 3300046491 Ga0495584_0237686 Ga0495584_0237686_293_910 205
1055 3300046492 Ga0495585_0196945 Ga0495585_0196945_217_834 205
1056 3300046499 Ga0495594_0000041 Ga0495594_0000041_23583_24200 205
1057 3300046499 Ga0495594_0309629 Ga0495594_0309629_263_880 205
1058 3300046501 Ga0495607_0117284 Ga0495607_0117284_167_784 205
1059 3300046507 Ga0495606_0038000 Ga0495606_0038000_2020_2637 205
1060 3300046511 Ga0495608_0383695 Ga0495608_0383695_44_661 205
1061 3300046511 Ga0495608_0388541 Ga0495608_0388541_60_677 205
1062 3300046514 Ga0495618_0013081 Ga0495618_0013081_406_1023 205
1063 3300046514 Ga0495618_0333782 Ga0495618_0333782_237_854 205
1064 3300046514 Ga0495618_0364554 Ga0495618_0364554_118_735 205
1065 3300046517 Ga0495630_0039243 Ga0495630_0039243_1812_2429 205
1066 3300046520 Ga0495637_0184190 Ga0495637_0184190_110_727 205
1067 3300046522 Ga0495643_0058993 Ga0495643_0058993_72_689 205
1068 3300046522 Ga0495643_0128777 Ga0495643_0128777_394_1011 205
1069 3300046522 Ga0495643_0189496 Ga0495643_0189496_114_731 205
1070 3300046525 Ga0495663_0068226 Ga0495663_0068226_454_1071 205
1071 3300046526 Ga0495666_0220748 Ga0495666_0220748_165_782 205
1072 3300046529 Ga0495652_0199035 Ga0495652_0199035_374_991 205
1073 3300046531 Ga0495665_0014774 Ga0495665_0014774_1979_2596 205
1074 3300046533 Ga0495640_0373425 Ga0495640_0373425_204_821 205
1075 3300046536 Ga0495587_0211124 Ga0495587_0211124_75_692 205
1076 3300046536 Ga0495587_0432184 Ga0495587_0432184_96_713 205
1077 3300046542 Ga0495597_0046332 Ga0495597_0046332_903_1520 205
1078 3300046557 Ga0495622_0001150 Ga0495622_0001150_1078_1695 205
1079 3300046557 Ga0495622_0016396 Ga0495622_0016396_1415_2032 205
1080 3300046557 Ga0495622_0032559 Ga0495622_0032559_1216_1833 205
1081 3300046558 Ga0495633_0002153 Ga0495633_0002153_5221_5838 205
1082 3300046558 Ga0495633_0071165 Ga0495633_0071165_309_926 205
1083 3300046559 Ga0495667_0159425 Ga0495667_0159425_605_1222 205
1084 3300046616 Ga0495668_0176722 Ga0495668_0176722_281_898 205
1085 3300046642 Ga0495634_0109488 Ga0495634_0109488_539_1156 205
1086 3300046660 Ga0495625_0125992 Ga0495625_0125992_1073_1690 205
1087 3300046663 Ga0495635_0010103 Ga0495635_0010103_3536_4153 205
1088 3300046675 Ga0495657_0017867 Ga0495657_0017867_4168_4785 205
1089 3300046675 Ga0495657_0268283 Ga0495657_0268283_78_695 205
1090 3300046680 Ga0495646_0066665 Ga0495646_0066665_896_1513 205
1091 3300046680 Ga0495646_0387902 Ga0495646_0387902_77_694 205
1092 3300046683 Ga0495658_0003944 Ga0495658_0003944_5839_6456 205
1093 3300046683 Ga0495658_0271406 Ga0495658_0271406_257_874 205
1094 3300046683 Ga0495658_0328719 Ga0495658_0328719_266_883 205
1095 3300046683 Ga0495658_0534842 Ga0495658_0534842_49_666 205
1096 3300046684 Ga0495669_0106417 Ga0495669_0106417_275_892 205
1097 3300046689 Ga0495613_0000075 Ga0495613_0000075_92006_92623 205
1098 3300046689 Ga0495613_0055177 Ga0495613_0055177_1053_1670 205
1099 3300046690 Ga0495624_0076666 Ga0495624_0076666_453_1070 205
1100 3300046692 Ga0495671_0239979 Ga0495671_0239979_221_838 205
1101 3300046694 Ga0495649_0064277 Ga0495649_0064277_603_1220 205
1102 3300046809 Ga0495600_0022581 Ga0495600_0022581_1737_2354 205
1103 3300047315 Ga0495581_0000422 Ga0495581_0000422_2981_3598 205
1104 3300047317 Ga0495604_0004947 Ga0495604_0004947_7944_8561 205
1105 3300047317 Ga0495604_0303634 Ga0495604_0303634_380_997 205
1106 3300047319 Ga0495674_0245362 Ga0495674_0245362_541_1158 205
1107 3300047321 Ga0495676_0082205 Ga0495676_0082205_572_1189 205
1108 3300047322 Ga0495680_0036041 Ga0495680_0036041_1177_1794 205
1109 3300047323 Ga0495683_0189370 Ga0495683_0189370_196_813 205
1110 3300047323 Ga0495683_0204248 Ga0495683_0204248_44_661 205
1111 3300047443 Ga0495687_139709 Ga0495687_139709_160_777 205
1112 3300047445 Ga0495677_0107704 Ga0495677_0107704_382_999 205
1113 3300047469 Ga0495673_0004418 Ga0495673_0004418_6630_7247 205
1114 3300047470 Ga0495681_0233668 Ga0495681_0233668_42_659 205
1115 3300047472 Ga0495686_0086340 Ga0495686_0086340_1230_1847 205
1116 3300047472 Ga0495686_0121506 Ga0495686_0121506_514_1131 205
1117 3300047472 Ga0495686_0164418 Ga0495686_0164418_417_1034 205
1118 3300047673 Ga0495593_0002009 Ga0495593_0002009_11136_11753 205
1119 3300047673 Ga0495593_0120514 Ga0495593_0120514_189_806 205
1120 3300048088 Ga0495602_0036625 Ga0495602_0036625_638_1255 205
1121 3300048088 Ga0495602_0255334 Ga0495602_0255334_299_916 205
1122 3300048089 Ga0495614_0021119 Ga0495614_0021119_1217_1834 205
1123 3300048091 Ga0495626_0099393 Ga0495626_0099393_600_1217 205
1124 3300048091 Ga0495626_0250349 Ga0495626_0250349_14_631 205
1125 3300048903 Ga0496100_0003333 Ga0496100_0003333_492_1109 205
1126 3300048903 Ga0496100_0020476 Ga0496100_0020476_3172_3789 205
1127 3300048903 Ga0496100_0036049 Ga0496100_0036049_158_775 205
1128 3300048903 Ga0496100_0382342 Ga0496100_0382342_399_1016 205
1129 3300048904 Ga0496101_0001105 Ga0496101_0001105_573_1190 205
1130 3300048904 Ga0496101_0011382 Ga0496101_0011382_3146_3763 205
1131 3300048904 Ga0496101_0073681 Ga0496101_0073681_1850_2467 205
1132 3300048904 Ga0496101_0149709 Ga0496101_0149709_1132_1749 205
1133 3300048904 Ga0496101_0329000 Ga0496101_0329000_273_890 205
1134 3300048905 Ga0496102_0022644 Ga0496102_0022644_4838_5455 205
1135 3300048905 Ga0496102_0032247 Ga0496102_0032247_2119_2736 205
1136 3300048905 Ga0496102_0117953 Ga0496102_0117953_1209_1826 205
1137 3300048905 Ga0496102_0128264 Ga0496102_0128264_216_833 205
1138 3300048905 Ga0496102_0134898 Ga0496102_0134898_170_787 205
1139 3300048905 Ga0496102_0178287 Ga0496102_0178287_1222_1839 205
1140 3300048905 Ga0496102_0325718 Ga0496102_0325718_356_973 205
1141 3300048905 Ga0496102_0335632 Ga0496102_0335632_103_750 205
1142 3300048905 Ga0496102_0348090 Ga0496102_0348090_104_721 205
1143 3300048905 Ga0496102_0381317 Ga0496102_0381317_410_1027 205
1144 3300048905 Ga0496102_0595519 Ga0496102_0595519_23_640 205
1145 3300048906 Ga0496103_0011964 Ga0496103_0011964_529_1146 205
1146 3300048906 Ga0496103_0018424 Ga0496103_0018424_1446_2063 205
1147 3300048906 Ga0496103_0021663 Ga0496103_0021663_348_965 205
1148 3300048906 Ga0496103_0032188 Ga0496103_0032188_639_1256 205
1149 3300048906 Ga0496103_0120418 Ga0496103_0120418_568_1185 205
1150 3300048906 Ga0496103_0298409 Ga0496103_0298409_204_821 205
1151 3300048907 Ga0496104_0009311 Ga0496104_0009311_7330_7947 205
1152 3300048907 Ga0496104_0034308 Ga0496104_0034308_302_919 205
1153 3300048907 Ga0496104_0139330 Ga0496104_0139330_1040_1657 205
1154 3300048907 Ga0496104_0188509 Ga0496104_0188509_1053_1670 205
1155 3300048907 Ga0496104_0274479 Ga0496104_0274479_42_659 205
1156 3300048907 Ga0496104_0290614 Ga0496104_0290614_380_997 205
1157 3300048907 Ga0496104_0466730 Ga0496104_0466730_410_1027 205
1158 3300048908 Ga0496105_0003160 Ga0496105_0003160_11178_11795 205
1159 3300048908 Ga0496105_0006016 Ga0496105_0006016_5172_5789 205
1160 3300048908 Ga0496105_0044255 Ga0496105_0044255_778_1395 205
1161 3300048908 Ga0496105_0158207 Ga0496105_0158207_1190_1807 205
1162 3300048908 Ga0496105_0252930 Ga0496105_0252930_543_1160 205
1163 3300048908 Ga0496105_0517783 Ga0496105_0517783_42_659 205
1164 3300048909 Ga0496106_0000370 Ga0496106_0000370_24263_24880 205
1165 3300048909 Ga0496106_0000929 Ga0496106_0000929_2139_2756 205
1166 3300048909 Ga0496106_0010898 Ga0496106_0010898_2591_3208 205
1167 3300048909 Ga0496106_0038703 Ga0496106_0038703_2492_3109 205
1168 3300048909 Ga0496106_0097598 Ga0496106_0097598_1429_2046 205
1169 3300048909 Ga0496106_0103365 Ga0496106_0103365_1352_1969 205
1170 3300048909 Ga0496106_0166740 Ga0496106_0166740_966_1583 205
1171 3300048909 Ga0496106_0197982 Ga0496106_0197982_940_1557 205
1172 3300048909 Ga0496106_0743167 Ga0496106_0743167_118_735 205
1173 3300048909 Ga0496106_0774605 Ga0496106_0774605_108_725 205
1174 3300048910 Ga0496107_0000197 Ga0496107_0000197_5797_6414 205
1175 3300048910 Ga0496107_0002908 Ga0496107_0002908_8017_8634 205
1176 3300048910 Ga0496107_0003884 Ga0496107_0003884_2439_3056 205
1177 3300048910 Ga0496107_0030161 Ga0496107_0030161_3052_3669 205
1178 3300048910 Ga0496107_0038428 Ga0496107_0038428_1045_1662 205
1179 3300048910 Ga0496107_0071684 Ga0496107_0071684_1050_1667 205
1180 3300048910 Ga0496107_0082406 Ga0496107_0082406_386_1003 205
1181 3300048910 Ga0496107_0265826 Ga0496107_0265826_304_921 205
1182 3300048911 Ga0496108_0022688 Ga0496108_0022688_4241_4858 205
1183 3300048911 Ga0496108_0133772 Ga0496108_0133772_53_670 205
1184 3300048911 Ga0496108_0195406 Ga0496108_0195406_894_1511 205
1185 3300048911 Ga0496108_0304484 Ga0496108_0304484_288_905 205
1186 3300048911 Ga0496108_0307809 Ga0496108_0307809_592_1209 205
1187 3300048911 Ga0496108_0315096 Ga0496108_0315096_639_1256 205
1188 3300048911 Ga0496108_0334206 Ga0496108_0334206_423_1040 205
1189 3300048911 Ga0496108_0441937 Ga0496108_0441937_361_978 205
1190 3300048911 Ga0496108_0522625 Ga0496108_0522625_394_1011 205
1191 3300048911 Ga0496108_0731956 Ga0496108_0731956_16_633 205
1192 3300048912 Ga0496109_0069376 Ga0496109_0069376_178_795 205
1193 3300048912 Ga0496109_0071965 Ga0496109_0071965_2241_2858 205
1194 3300048912 Ga0496109_0075773 Ga0496109_0075773_362_979 205
1195 3300048912 Ga0496109_0107861 Ga0496109_0107861_234_851 205
1196 3300048912 Ga0496109_0116895 Ga0496109_0116895_1067_1684 205
1197 3300048912 Ga0496109_0312969 Ga0496109_0312969_800_1417 205
1198 3300048912 Ga0496109_1093015 Ga0496109_1093015_107_724 205
1199 3300048913 Ga0496110_0003625 Ga0496110_0003625_10979_11596 205
1200 3300048913 Ga0496110_0022817 Ga0496110_0022817_2399_3016 205
1201 3300048913 Ga0496110_0629877 Ga0496110_0629877_334_951 205
1202 3300048914 Ga0496111_0025325 Ga0496111_0025325_426_1043 205
1203 3300048914 Ga0496111_0048951 Ga0496111_0048951_125_742 205
1204 3300048914 Ga0496111_0094870 Ga0496111_0094870_1222_1839 205
1205 3300048914 Ga0496111_0271931 Ga0496111_0271931_199_816 205
1206 3300048914 Ga0496111_0386045 Ga0496111_0386045_377_994 205
1207 3300048914 Ga0496111_0625842 Ga0496111_0625842_47_664 205
1208 3300048915 Ga0496112_0008520 Ga0496112_0008520_3069_3686 205
1209 3300048915 Ga0496112_0012075 Ga0496112_0012075_2616_3233 205
1210 3300048915 Ga0496112_0092098 Ga0496112_0092098_113_730 205
1211 3300048915 Ga0496112_0108040 Ga0496112_0108040_413_1030 205
1212 3300048915 Ga0496112_0135180 Ga0496112_0135180_1038_1655 205
1213 3300048915 Ga0496112_0831742 Ga0496112_0831742_136_753 205
1214 3300048916 Ga0496113_0021889 Ga0496113_0021889_1777_2394 205
1215 3300048916 Ga0496113_0033853 Ga0496113_0033853_1958_2575 205
1216 3300048916 Ga0496113_0043296 Ga0496113_0043296_958_1575 205
1217 3300048916 Ga0496113_0060307 Ga0496113_0060307_983_1600 205
1218 3300048916 Ga0496113_0062903 Ga0496113_0062903_56_673 205
1219 3300048916 Ga0496113_1036651 Ga0496113_1036651_13_630 205
1220 3300048917 Ga0496114_0026036 Ga0496114_0026036_248_865 205
1221 3300048917 Ga0496114_0051930 Ga0496114_0051930_2353_2970 205
1222 3300048917 Ga0496114_0138405 Ga0496114_0138405_270_887 205
1223 3300048917 Ga0496114_0399886 Ga0496114_0399886_135_752 205
1224 3300048917 Ga0496114_0461753 Ga0496114_0461753_432_1049 205
1225 3300048917 Ga0496114_0475210 Ga0496114_0475210_411_1028 205
1226 3300048917 Ga0496114_0880698 Ga0496114_0880698_73_690 205
1227 3300048918 Ga0496115_0056491 Ga0496115_0056491_1552_2169 205
1228 3300048918 Ga0496115_0060837 Ga0496115_0060837_650_1267 205
1229 3300048918 Ga0496115_0092745 Ga0496115_0092745_655_1272 205
1230 3300048918 Ga0496115_0120861 Ga0496115_0120861_1370_1987 205
1231 3300048918 Ga0496115_0144169 Ga0496115_0144169_969_1586 205
1232 3300048918 Ga0496115_0278134 Ga0496115_0278134_157_774 205
1233 3300048919 Ga0496116_0322532 Ga0496116_0322532_67_684 205
1234 3300048922 Ga0496119_0026505 Ga0496119_0026505_2385_3002 205
1235 3300048923 Ga0496120_0006976 Ga0496120_0006976_5543_6160 205
1236 3300048923 Ga0496120_0012874 Ga0496120_0012874_3387_4004 205
1237 3300048923 Ga0496120_0060944 Ga0496120_0060944_169_786 205
1238 3300048924 Ga0496121_0004399 Ga0496121_0004399_3410_4027 205
1239 3300048924 Ga0496121_0117248 Ga0496121_0117248_1032_1649 205
1240 3300048924 Ga0496121_0195010 Ga0496121_0195010_734_1351 205
1241 3300048924 Ga0496121_0283377 Ga0496121_0283377_94_711 205
1242 3300048925 Ga0496122_0003989 Ga0496122_0003989_11794_12411 205
1243 3300048926 Ga0496123_0000732 Ga0496123_0000732_52435_53052 205
1244 3300048926 Ga0496123_0004691 Ga0496123_0004691_1432_2049 205
1245 3300048927 Ga0496124_0126144 Ga0496124_0126144_385_1002 205
1246 3300048927 Ga0496124_0278373 Ga0496124_0278373_235_852 205
1247 3300048927 Ga0496124_0672741 Ga0496124_0672741_13_630 205
1248 3300048928 Ga0496125_0001673 Ga0496125_0001673_4515_5132 205
1249 3300048928 Ga0496125_0134295 Ga0496125_0134295_728_1345 205
1250 3300048928 Ga0496125_0320766 Ga0496125_0320766_162_779 205
1251 3300048928 Ga0496125_0404021 Ga0496125_0404021_123_740 205
1252 3300048929 Ga0496126_0063768 Ga0496126_0063768_149_766 205
1253 3300048929 Ga0496126_0283832 Ga0496126_0283832_595_1212 205
1254 3300049131 Ga0501341_03081 Ga0501341_03081_165_782 205
1255 3300049131 Ga0501341_06796 Ga0501341_06796_47_664 205
1256 3300049160 Ga0501304_013565 Ga0501304_013565_18_635 205
1257 3300049162 Ga0501307_029406 Ga0501307_029406_13_630 205
1258 3300049530 Ga0501314_014114 Ga0501314_014114_133_750 205
1259 3300049535 Ga0501319_005604 Ga0501319_005604_29_646 205
1260 3300049536 Ga0501320_022059 Ga0501320_022059_113_730 205
1261 3300049541 Ga0501325_016174 Ga0501325_016174_111_728 205
1262 3300049568 Ga0501031_0000018 Ga0501031_0000018_100597_101214 205
1263 3300049568 Ga0501031_0004819 Ga0501031_0004819_2522_3139 205
1264 3300049568 Ga0501031_0011795 Ga0501031_0011795_1253_1870 205
1265 3300049568 Ga0501031_0017396 Ga0501031_0017396_1031_1648 205
1266 3300049568 Ga0501031_0019004 Ga0501031_0019004_2248_2865 205
1267 3300049568 Ga0501031_0027610 Ga0501031_0027610_2113_2730 205
1268 3300049568 Ga0501031_0090635 Ga0501031_0090635_608_1225 205
1269 3300049568 Ga0501031_0093230 Ga0501031_0093230_634_1251 205
1270 3300049568 Ga0501031_0180474 Ga0501031_0180474_748_1365 205
1271 3300049568 Ga0501031_0309154 Ga0501031_0309154_357_974 205
1272 3300049568 Ga0501031_0323768 Ga0501031_0323768_235_852 205
1273 3300049568 Ga0501031_0334047 Ga0501031_0334047_137_754 205
1274 3300049568 Ga0501031_0338096 Ga0501031_0338096_156_773 205
1275 3300049568 Ga0501031_0358294 Ga0501031_0358294_101_718 205
1276 3300049568 Ga0501031_0444789 Ga0501031_0444789_192_809 205
1277 3300049569 Ga0501032_0000201 Ga0501032_0000201_5442_6059 205
1278 3300049569 Ga0501032_0000564 Ga0501032_0000564_6628_7245 205
1279 3300049569 Ga0501032_0008483 Ga0501032_0008483_2813_3430 205
1280 3300049569 Ga0501032_0015071 Ga0501032_0015071_3753_4370 205
1281 3300049569 Ga0501032_0024542 Ga0501032_0024542_229_846 205
1282 3300049569 Ga0501032_0045244 Ga0501032_0045244_2098_2715 205
1283 3300049569 Ga0501032_0068470 Ga0501032_0068470_1587_2204 205
1284 3300049569 Ga0501032_0089499 Ga0501032_0089499_985_1602 205
1285 3300049569 Ga0501032_0129953 Ga0501032_0129953_303_920 205
1286 3300049569 Ga0501032_0134005 Ga0501032_0134005_303_920 205
1287 3300049569 Ga0501032_0176821 Ga0501032_0176821_253_870 205
1288 3300049569 Ga0501032_0228372 Ga0501032_0228372_375_992 205
1289 3300049570 Ga0501033_0000328 Ga0501033_0000328_39095_39712 205
1290 3300049570 Ga0501033_0000443 Ga0501033_0000443_34262_34879 205
1291 3300049570 Ga0501033_0002655 Ga0501033_0002655_11325_11942 205
1292 3300049570 Ga0501033_0003152 Ga0501033_0003152_5997_6614 205
1293 3300049570 Ga0501033_0015074 Ga0501033_0015074_1901_2518 205
1294 3300049570 Ga0501033_0016649 Ga0501033_0016649_4872_5489 205
1295 3300049570 Ga0501033_0024371 Ga0501033_0024371_1387_2004 205
1296 3300049570 Ga0501033_0026107 Ga0501033_0026107_295_912 205
1297 3300049570 Ga0501033_0038123 Ga0501033_0038123_1427_2044 205
1298 3300049570 Ga0501033_0058501 Ga0501033_0058501_1913_2530 205
1299 3300049570 Ga0501033_0073909 Ga0501033_0073909_871_1503 205
1300 3300049570 Ga0501033_0102582 Ga0501033_0102582_67_684 205
1301 3300049570 Ga0501033_0107767 Ga0501033_0107767_47_664 205
1302 3300049570 Ga0501033_0115195 Ga0501033_0115195_632_1249 205
1303 3300049570 Ga0501033_0149703 Ga0501033_0149703_624_1241 205
1304 3300049570 Ga0501033_0161613 Ga0501033_0161613_222_839 205
1305 3300049570 Ga0501033_0211126 Ga0501033_0211126_666_1283 205
1306 3300049570 Ga0501033_0318198 Ga0501033_0318198_250_867 205
1307 3300049570 Ga0501033_0629760 Ga0501033_0629760_47_664 205
1308 3300049571 Ga0501034_0000005 Ga0501034_0000005_361257_361874 205
1309 3300049571 Ga0501034_0000033 Ga0501034_0000033_109786_110403 205
1310 3300049571 Ga0501034_0000061 Ga0501034_0000061_10971_11588 205
1311 3300049571 Ga0501034_0000314 Ga0501034_0000314_50706_51323 205
1312 3300049571 Ga0501034_0000681 Ga0501034_0000681_22333_22950 205
1313 3300049571 Ga0501034_0011987 Ga0501034_0011987_5045_5662 205
1314 3300049571 Ga0501034_0021545 Ga0501034_0021545_1194_1811 205
1315 3300049571 Ga0501034_0024021 Ga0501034_0024021_2773_3390 205
1316 3300049571 Ga0501034_0032646 Ga0501034_0032646_3570_4187 205
1317 3300049571 Ga0501034_0040361 Ga0501034_0040361_77_694 205
1318 3300049571 Ga0501034_0047357 Ga0501034_0047357_3292_3909 205
1319 3300049571 Ga0501034_0060789 Ga0501034_0060789_2888_3505 205
1320 3300049571 Ga0501034_0061513 Ga0501034_0061513_1059_1676 205
1321 3300049571 Ga0501034_0096024 Ga0501034_0096024_723_1340 205
1322 3300049571 Ga0501034_0109071 Ga0501034_0109071_1457_2074 205
1323 3300049571 Ga0501034_0152423 Ga0501034_0152423_146_763 205
1324 3300049571 Ga0501034_0162570 Ga0501034_0162570_383_1000 205
1325 3300049571 Ga0501034_0221338 Ga0501034_0221338_458_1075 205
1326 3300049571 Ga0501034_0227391 Ga0501034_0227391_581_1198 205
1327 3300049571 Ga0501034_0250558 Ga0501034_0250558_246_863 205
1328 3300049571 Ga0501034_0272853 Ga0501034_0272853_154_771 205
1329 3300049571 Ga0501034_0305621 Ga0501034_0305621_287_904 205
1330 3300049571 Ga0501034_0358193 Ga0501034_0358193_328_945 205
1331 3300049571 Ga0501034_0559565 Ga0501034_0559565_48_665 205
1332 3300049571 Ga0501034_1183646 Ga0501034_1183646_10_627 205
1333 3300049572 Ga0501036_0000005 Ga0501036_0000005_240125_240742 205
1334 3300049572 Ga0501036_0000027 Ga0501036_0000027_84183_84800 205
1335 3300049572 Ga0501036_0005854 Ga0501036_0005854_6767_7384 205
1336 3300049572 Ga0501036_0008162 Ga0501036_0008162_4752_5369 205
1337 3300049572 Ga0501036_0017322 Ga0501036_0017322_4579_5196 205
1338 3300049572 Ga0501036_0037202 Ga0501036_0037202_2372_2989 205
1339 3300049572 Ga0501036_0048667 Ga0501036_0048667_2020_2637 205
1340 3300049572 Ga0501036_0112205 Ga0501036_0112205_802_1419 205
1341 3300049572 Ga0501036_0177705 Ga0501036_0177705_178_795 205
1342 3300049572 Ga0501036_0254302 Ga0501036_0254302_437_1054 205
1343 3300049572 Ga0501036_0313616 Ga0501036_0313616_227_844 205
1344 3300049572 Ga0501036_0375418 Ga0501036_0375418_153_770 205
1345 3300049573 Ga0501037_0000045 Ga0501037_0000045_111004_111621 205
1346 3300049573 Ga0501037_0000104 Ga0501037_0000104_33628_34245 205
1347 3300049573 Ga0501037_0000271 Ga0501037_0000271_5672_6289 205
1348 3300049573 Ga0501037_0001652 Ga0501037_0001652_11626_12243 205
1349 3300049573 Ga0501037_0002530 Ga0501037_0002530_6873_7490 205
1350 3300049573 Ga0501037_0009928 Ga0501037_0009928_5111_5728 205
1351 3300049573 Ga0501037_0031330 Ga0501037_0031330_1196_1813 205
1352 3300049573 Ga0501037_0049206 Ga0501037_0049206_207_824 205
1353 3300049573 Ga0501037_0049408 Ga0501037_0049408_1439_2056 205
1354 3300049573 Ga0501037_0138110 Ga0501037_0138110_628_1245 205
1355 3300049573 Ga0501037_0198785 Ga0501037_0198785_684_1301 205
1356 3300049573 Ga0501037_0292653 Ga0501037_0292653_223_840 205
1357 3300049573 Ga0501037_0349463 Ga0501037_0349463_385_1002 205
1358 3300049573 Ga0501037_0404808 Ga0501037_0404808_258_875 205
1359 3300049573 Ga0501037_0432744 Ga0501037_0432744_86_703 205
1360 3300049573 Ga0501037_0484587 Ga0501037_0484587_211_828 205
1361 3300049573 Ga0501037_0700991 Ga0501037_0700991_34_651 205
1362 3300049574 Ga0501038_0000001 Ga0501038_0000001_361257_361874 205
1363 3300049574 Ga0501038_0000340 Ga0501038_0000340_14616_15233 205
1364 3300049574 Ga0501038_0005022 Ga0501038_0005022_8748_9365 205
1365 3300049574 Ga0501038_0022940 Ga0501038_0022940_1400_2104 205
1366 3300049574 Ga0501038_0024635 Ga0501038_0024635_1350_1967 205
1367 3300049574 Ga0501038_0035324 Ga0501038_0035324_931_1563 205
1368 3300049574 Ga0501038_0042473 Ga0501038_0042473_971_1588 205
1369 3300049574 Ga0501038_0054962 Ga0501038_0054962_2781_3398 205
1370 3300049574 Ga0501038_0070214 Ga0501038_0070214_486_1103 205
1371 3300049574 Ga0501038_0122866 Ga0501038_0122866_1356_1973 205
1372 3300049574 Ga0501038_0161583 Ga0501038_0161583_350_967 205
1373 3300049574 Ga0501038_0239184 Ga0501038_0239184_587_1204 205
1374 3300049574 Ga0501038_0286172 Ga0501038_0286172_53_670 205
1375 3300049574 Ga0501038_0310247 Ga0501038_0310247_305_922 205
1376 3300049574 Ga0501038_0346954 Ga0501038_0346954_276_893 205
1377 3300049574 Ga0501038_0395620 Ga0501038_0395620_269_886 205
1378 3300049574 Ga0501038_0522909 Ga0501038_0522909_264_881 205
1379 3300049575 Ga0501039_0000003 Ga0501039_0000003_237438_238055 205
1380 3300049575 Ga0501039_0000007 Ga0501039_0000007_135301_135918 205
1381 3300049575 Ga0501039_0000802 Ga0501039_0000802_12109_12726 205
1382 3300049575 Ga0501039_0002360 Ga0501039_0002360_12927_13544 205
1383 3300049575 Ga0501039_0010241 Ga0501039_0010241_3766_4383 205
1384 3300049575 Ga0501039_0013631 Ga0501039_0013631_883_1500 205
1385 3300049575 Ga0501039_0020878 Ga0501039_0020878_1591_2208 205
1386 3300049575 Ga0501039_0046660 Ga0501039_0046660_2185_2802 205
1387 3300049575 Ga0501039_0148950 Ga0501039_0148950_607_1224 205
1388 3300049575 Ga0501039_0290120 Ga0501039_0290120_615_1232 205
1389 3300049575 Ga0501039_0309843 Ga0501039_0309843_174_791 205
1390 3300049575 Ga0501039_0330799 Ga0501039_0330799_405_1022 205
1391 3300049575 Ga0501039_0657967 Ga0501039_0657967_152_769 205
1392 3300049575 Ga0501039_0905061 Ga0501039_0905061_24_641 205
1393 3300049576 Ga0501040_0003550 Ga0501040_0003550_4974_5591 205
1394 3300049576 Ga0501040_0034815 Ga0501040_0034815_1794_2411 205
1395 3300049576 Ga0501040_0036827 Ga0501040_0036827_1801_2418 205
1396 3300049576 Ga0501040_0116070 Ga0501040_0116070_288_905 205
1397 3300049576 Ga0501040_0127805 Ga0501040_0127805_1157_1774 205
1398 3300049576 Ga0501040_0391639 Ga0501040_0391639_347_964 205
1399 3300049577 Ga0501041_0010586 Ga0501041_0010586_82_699 205
1400 3300049577 Ga0501041_0024250 Ga0501041_0024250_2396_3013 205
1401 3300049577 Ga0501041_0066945 Ga0501041_0066945_744_1361 205
1402 3300049577 Ga0501041_0270716 Ga0501041_0270716_42_659 205
1403 3300049577 Ga0501041_0410981 Ga0501041_0410981_97_714 205
1404 3300049578 Ga0501042_0014332 Ga0501042_0014332_3004_3621 205
1405 3300049578 Ga0501042_0036971 Ga0501042_0036971_2188_2805 205
1406 3300049578 Ga0501042_0050539 Ga0501042_0050539_1151_1855 205
1407 3300049578 Ga0501042_0099243 Ga0501042_0099243_730_1347 205
1408 3300049578 Ga0501042_0108557 Ga0501042_0108557_376_993 205
1409 3300049578 Ga0501042_0154488 Ga0501042_0154488_931_1548 205
1410 3300049579 Ga0501043_0000096 Ga0501043_0000096_38690_39307 205
1411 3300049579 Ga0501043_0000248 Ga0501043_0000248_4325_4942 205
1412 3300049579 Ga0501043_0001636 Ga0501043_0001636_10901_11518 205
1413 3300049579 Ga0501043_0006416 Ga0501043_0006416_6047_6664 205
1414 3300049579 Ga0501043_0030108 Ga0501043_0030108_1129_1746 205
1415 3300049579 Ga0501043_0039968 Ga0501043_0039968_1777_2394 205
1416 3300049579 Ga0501043_0152562 Ga0501043_0152562_861_1478 205
1417 3300049579 Ga0501043_0170588 Ga0501043_0170588_896_1513 205
1418 3300049579 Ga0501043_0204152 Ga0501043_0204152_764_1381 205
1419 3300049579 Ga0501043_0273882 Ga0501043_0273882_211_828 205
1420 3300049579 Ga0501043_0703974 Ga0501043_0703974_16_633 205
1421 3300049579 Ga0501043_0864112 Ga0501043_0864112_22_639 205
1422 3300049580 Ga0501046_0000023 Ga0501046_0000023_18308_18925 205
1423 3300049580 Ga0501046_0001575 Ga0501046_0001575_10916_11533 205
1424 3300049580 Ga0501046_0003564 Ga0501046_0003564_9900_10517 205
1425 3300049580 Ga0501046_0006295 Ga0501046_0006295_5368_5985 205
1426 3300049580 Ga0501046_0011230 Ga0501046_0011230_2000_2617 205
1427 3300049580 Ga0501046_0012911 Ga0501046_0012911_5632_6249 205
1428 3300049580 Ga0501046_0029227 Ga0501046_0029227_627_1244 205
1429 3300049580 Ga0501046_0030845 Ga0501046_0030845_3658_4275 205
1430 3300049580 Ga0501046_0058101 Ga0501046_0058101_1427_2044 205
1431 3300049580 Ga0501046_0060031 Ga0501046_0060031_1548_2165 205
1432 3300049580 Ga0501046_0185188 Ga0501046_0185188_846_1463 205
1433 3300049580 Ga0501046_0427760 Ga0501046_0427760_294_911 205
1434 3300049580 Ga0501046_0527134 Ga0501046_0527134_12_629 205
1435 3300049581 Ga0501047_0000122 Ga0501047_0000122_4738_5355 205
1436 3300049581 Ga0501047_0001023 Ga0501047_0001023_12218_12835 205
1437 3300049581 Ga0501047_0004600 Ga0501047_0004600_8506_9123 205
1438 3300049581 Ga0501047_0004914 Ga0501047_0004914_5499_6116 205
1439 3300049581 Ga0501047_0008466 Ga0501047_0008466_146_763 205
1440 3300049581 Ga0501047_0021450 Ga0501047_0021450_2773_3390 205
1441 3300049581 Ga0501047_0026581 Ga0501047_0026581_2825_3442 205
1442 3300049581 Ga0501047_0064620 Ga0501047_0064620_1903_2535 205
1443 3300049581 Ga0501047_0068795 Ga0501047_0068795_2567_3184 205
1444 3300049581 Ga0501047_0073145 Ga0501047_0073145_184_801 205
1445 3300049581 Ga0501047_0090627 Ga0501047_0090627_2301_2918 205
1446 3300049581 Ga0501047_0107883 Ga0501047_0107883_1898_2515 205
1447 3300049581 Ga0501047_0170509 Ga0501047_0170509_839_1456 205
1448 3300049581 Ga0501047_0180906 Ga0501047_0180906_508_1125 205
1449 3300049581 Ga0501047_0338964 Ga0501047_0338964_555_1172 205
1450 3300049581 Ga0501047_0348117 Ga0501047_0348117_443_1060 205
1451 3300049581 Ga0501047_0850694 Ga0501047_0850694_31_648 205
1452 3300049582 Ga0501048_0000060 Ga0501048_0000060_23589_24206 205
1453 3300049582 Ga0501048_0000299 Ga0501048_0000299_4110_4727 205
1454 3300049582 Ga0501048_0010572 Ga0501048_0010572_2363_2980 205
1455 3300049582 Ga0501048_0158920 Ga0501048_0158920_949_1566 205
1456 3300049582 Ga0501048_0208661 Ga0501048_0208661_541_1158 205
1457 3300049582 Ga0501048_0239518 Ga0501048_0239518_646_1263 205
1458 3300049582 Ga0501048_0341510 Ga0501048_0341510_16_633 205
1459 3300049582 Ga0501048_0439009 Ga0501048_0439009_44_661 205
1460 3300049582 Ga0501048_0781530 Ga0501048_0781530_41_658 205
1461 3300049583 Ga0501067_0000224 Ga0501067_0000224_3087_3704 205
1462 3300049583 Ga0501067_0002012 Ga0501067_0002012_5503_6120 205
1463 3300049583 Ga0501067_0008225 Ga0501067_0008225_4150_4767 205
1464 3300049583 Ga0501067_0048413 Ga0501067_0048413_319_936 205
1465 3300049583 Ga0501067_0052948 Ga0501067_0052948_1593_2210 205
1466 3300049583 Ga0501067_0054371 Ga0501067_0054371_886_1503 205
1467 3300049583 Ga0501067_0102845 Ga0501067_0102845_530_1147 205
1468 3300049583 Ga0501067_0357210 Ga0501067_0357210_86_703 205
1469 3300049583 Ga0501067_0369388 Ga0501067_0369388_21_638 205
1470 3300049584 Ga0501068_0001760 Ga0501068_0001760_10332_10949 205
1471 3300049584 Ga0501068_0005327 Ga0501068_0005327_1972_2589 205
1472 3300049584 Ga0501068_0020442 Ga0501068_0020442_2815_3432 205
1473 3300049584 Ga0501068_0063002 Ga0501068_0063002_694_1311 205
1474 3300049584 Ga0501068_0079118 Ga0501068_0079118_1311_1928 205
1475 3300049585 Ga0501069_0000012 Ga0501069_0000012_40558_41175 205
1476 3300049585 Ga0501069_0010871 Ga0501069_0010871_2056_2673 205
1477 3300049585 Ga0501069_0014599 Ga0501069_0014599_1567_2184 205
1478 3300049585 Ga0501069_0024963 Ga0501069_0024963_449_1066 205
1479 3300049585 Ga0501069_0063468 Ga0501069_0063468_199_816 205
1480 3300049585 Ga0501069_0077586 Ga0501069_0077586_551_1168 205
1481 3300049585 Ga0501069_0122508 Ga0501069_0122508_177_794 205
1482 3300049585 Ga0501069_0344870 Ga0501069_0344870_198_815 205
1483 3300049586 Ga0501070_0000655 Ga0501070_0000655_12900_13517 205
1484 3300049586 Ga0501070_0006725 Ga0501070_0006725_6017_6634 205
1485 3300049586 Ga0501070_0016571 Ga0501070_0016571_3852_4469 205
1486 3300049586 Ga0501070_0018812 Ga0501070_0018812_2081_2698 205
1487 3300049586 Ga0501070_0095134 Ga0501070_0095134_1001_1618 205
1488 3300049586 Ga0501070_0100999 Ga0501070_0100999_628_1245 205
1489 3300049586 Ga0501070_0158774 Ga0501070_0158774_775_1392 205
1490 3300049586 Ga0501070_0166828 Ga0501070_0166828_986_1603 205
1491 3300049586 Ga0501070_0201311 Ga0501070_0201311_980_1597 205
1492 3300049586 Ga0501070_0256433 Ga0501070_0256433_536_1153 205
1493 3300049586 Ga0501070_0262462 Ga0501070_0262462_552_1169 205
1494 3300049586 Ga0501070_0264672 Ga0501070_0264672_569_1186 205
1495 3300049586 Ga0501070_0317161 Ga0501070_0317161_33_650 205
1496 3300049586 Ga0501070_0345630 Ga0501070_0345630_19_636 205
1497 3300049586 Ga0501070_0354419 Ga0501070_0354419_551_1168 205
1498 3300049586 Ga0501070_0393622 Ga0501070_0393622_128_745 205
1499 3300049586 Ga0501070_0436748 Ga0501070_0436748_49_666 205
1500 3300049586 Ga0501070_0470211 Ga0501070_0470211_40_657 205
1501 3300049586 Ga0501070_0648276 Ga0501070_0648276_208_825 205
1502 3300049586 Ga0501070_0852893 Ga0501070_0852893_69_686 205
1503 3300049587 Ga0501071_0012761 Ga0501071_0012761_4001_4618 205
1504 3300049587 Ga0501071_0028792 Ga0501071_0028792_3120_3737 205
1505 3300049587 Ga0501071_0048177 Ga0501071_0048177_1961_2578 205
1506 3300049587 Ga0501071_0053351 Ga0501071_0053351_271_888 205
1507 3300049587 Ga0501071_0064234 Ga0501071_0064234_1953_2570 205
1508 3300049587 Ga0501071_0113545 Ga0501071_0113545_1141_1758 205
1509 3300049587 Ga0501071_0166399 Ga0501071_0166399_255_872 205
1510 3300049587 Ga0501071_0179667 Ga0501071_0179667_502_1119 205
1511 3300049587 Ga0501071_0376487 Ga0501071_0376487_375_992 205
1512 3300049587 Ga0501071_0391157 Ga0501071_0391157_421_1038 205
1513 3300049588 Ga0501072_0004865 Ga0501072_0004865_9409_10026 205
1514 3300049588 Ga0501072_0017931 Ga0501072_0017931_1319_1936 205
1515 3300049588 Ga0501072_0034155 Ga0501072_0034155_147_764 205
1516 3300049588 Ga0501072_0062830 Ga0501072_0062830_1430_2047 205
1517 3300049588 Ga0501072_0183311 Ga0501072_0183311_554_1171 205
1518 3300049588 Ga0501072_0234011 Ga0501072_0234011_674_1291 205
1519 3300049588 Ga0501072_0825671 Ga0501072_0825671_15_704 205
1520 3300049589 Ga0501073_0000014 Ga0501073_0000014_33966_34583 205
1521 3300049589 Ga0501073_0002833 Ga0501073_0002833_9008_9625 205
1522 3300049589 Ga0501073_0018220 Ga0501073_0018220_3135_3752 205
1523 3300049589 Ga0501073_0024859 Ga0501073_0024859_1060_1677 205
1524 3300049589 Ga0501073_0034517 Ga0501073_0034517_2143_2760 205
1525 3300049589 Ga0501073_0038666 Ga0501073_0038666_1505_2122 205
1526 3300049589 Ga0501073_0041910 Ga0501073_0041910_1894_2511 205
1527 3300049589 Ga0501073_0047652 Ga0501073_0047652_2108_2725 205
1528 3300049589 Ga0501073_0056617 Ga0501073_0056617_1191_1808 205
1529 3300049589 Ga0501073_0065487 Ga0501073_0065487_557_1174 205
1530 3300049589 Ga0501073_0083577 Ga0501073_0083577_641_1258 205
1531 3300049589 Ga0501073_0137204 Ga0501073_0137204_875_1492 205
1532 3300049589 Ga0501073_0190027 Ga0501073_0190027_281_898 205
1533 3300049589 Ga0501073_0383579 Ga0501073_0383579_254_871 205
1534 3300049589 Ga0501073_0451539 Ga0501073_0451539_245_862 205
1535 3300049590 Ga0501074_0000018 Ga0501074_0000018_40559_41176 205
1536 3300049590 Ga0501074_0002711 Ga0501074_0002711_10832_11449 205
1537 3300049590 Ga0501074_0012897 Ga0501074_0012897_1638_2255 205
1538 3300049590 Ga0501074_0015276 Ga0501074_0015276_3573_4190 205
1539 3300049590 Ga0501074_0021326 Ga0501074_0021326_2716_3333 205
1540 3300049590 Ga0501074_0103606 Ga0501074_0103606_573_1190 205
1541 3300049590 Ga0501074_0133838 Ga0501074_0133838_923_1540 205
1542 3300049590 Ga0501074_0318524 Ga0501074_0318524_270_887 205
1543 3300049590 Ga0501074_0570773 Ga0501074_0570773_160_777 205
1544 3300049591 Ga0501075_0018336 Ga0501075_0018336_1335_1952 205
1545 3300049591 Ga0501075_0027652 Ga0501075_0027652_775_1392 205
1546 3300049591 Ga0501075_0043514 Ga0501075_0043514_27_644 205
1547 3300049591 Ga0501075_0059389 Ga0501075_0059389_683_1300 205
1548 3300049591 Ga0501075_0106152 Ga0501075_0106152_1255_1872 205
1549 3300049591 Ga0501075_0893142 Ga0501075_0893142_41_658 205
1550 3300049592 Ga0501076_0006456 Ga0501076_0006456_3483_4100 205
1551 3300049592 Ga0501076_0018774 Ga0501076_0018774_853_1470 205
1552 3300049592 Ga0501076_0027098 Ga0501076_0027098_186_803 205
1553 3300049592 Ga0501076_0066828 Ga0501076_0066828_2199_2816 205
1554 3300049592 Ga0501076_0177685 Ga0501076_0177685_86_703 205
1555 3300049592 Ga0501076_0311057 Ga0501076_0311057_295_912 205
1556 3300049593 Ga0501077_0001847 Ga0501077_0001847_4721_5464 205
1557 3300049593 Ga0501077_0004733 Ga0501077_0004733_6933_7550 205
1558 3300049593 Ga0501077_0011089 Ga0501077_0011089_1397_2014 205
1559 3300049593 Ga0501077_0023018 Ga0501077_0023018_1595_2212 205
1560 3300049593 Ga0501077_0037231 Ga0501077_0037231_1872_2489 205
1561 3300049593 Ga0501077_0265565 Ga0501077_0265565_259_876 205
1562 3300049593 Ga0501077_0272029 Ga0501077_0272029_18_635 205
1563 3300049593 Ga0501077_0303739 Ga0501077_0303739_247_864 205
1564 3300049741 Ga0501079_0004830 Ga0501079_0004830_1504_2121 205
1565 3300049741 Ga0501079_0005303 Ga0501079_0005303_7086_7829 205
1566 3300049741 Ga0501079_0014814 Ga0501079_0014814_2619_3236 205
1567 3300049741 Ga0501079_0058404 Ga0501079_0058404_527_1144 205
1568 3300049741 Ga0501079_0084466 Ga0501079_0084466_371_988 205
1569 3300049741 Ga0501079_0109216 Ga0501079_0109216_675_1292 205
1570 3300049741 Ga0501079_0233810 Ga0501079_0233810_330_947 205
1571 3300049741 Ga0501079_0406820 Ga0501079_0406820_219_836 205
1572 3300049741 Ga0501079_0426889 Ga0501079_0426889_107_724 205
1573 3300049741 Ga0501079_0781664 Ga0501079_0781664_79_696 205
1574 3300049742 Ga0501080_0000002 Ga0501080_0000002_201316_201933 205
1575 3300049742 Ga0501080_0002237 Ga0501080_0002237_13346_13963 205
1576 3300049742 Ga0501080_0004022 Ga0501080_0004022_9237_9854 205
1577 3300049742 Ga0501080_0013615 Ga0501080_0013615_3930_4547 205
1578 3300049742 Ga0501080_0013921 Ga0501080_0013921_3775_4392 205
1579 3300049742 Ga0501080_0035684 Ga0501080_0035684_3158_3775 205
1580 3300049742 Ga0501080_0052841 Ga0501080_0052841_1663_2280 205
1581 3300049742 Ga0501080_0078300 Ga0501080_0078300_2370_2987 205
1582 3300049742 Ga0501080_0094547 Ga0501080_0094547_825_1442 205
1583 3300049742 Ga0501080_0142348 Ga0501080_0142348_1392_2009 205
1584 3300049742 Ga0501080_0518077 Ga0501080_0518077_196_813 205
1585 3300049742 Ga0501080_0529225 Ga0501080_0529225_112_729 205
1586 3300049742 Ga0501080_0683087 Ga0501080_0683087_52_669 205
1587 3300049742 Ga0501080_1169928 Ga0501080_1169928_30_647 205
1588 3300049743 Ga0501081_0010055 Ga0501081_0010055_2851_3594 205
1589 3300049743 Ga0501081_0035267 Ga0501081_0035267_2510_3127 205
1590 3300049743 Ga0501081_0085755 Ga0501081_0085755_1314_1931 205
1591 3300049743 Ga0501081_0126776 Ga0501081_0126776_1177_1794 205
1592 3300049743 Ga0501081_0144990 Ga0501081_0144990_483_1100 205
1593 3300049743 Ga0501081_0659993 Ga0501081_0659993_28_645 205
1594 3300049744 Ga0501083_0003370 Ga0501083_0003370_9603_10220 205
1595 3300049744 Ga0501083_0024248 Ga0501083_0024248_3469_4086 205
1596 3300049744 Ga0501083_0087008 Ga0501083_0087008_153_770 205
1597 3300049744 Ga0501083_0163497 Ga0501083_0163497_251_868 205
1598 3300049744 Ga0501083_0240614 Ga0501083_0240614_531_1148 205
1599 3300049744 Ga0501083_0267403 Ga0501083_0267403_479_1096 205
1600 3300049744 Ga0501083_0306741 Ga0501083_0306741_66_683 205
1601 3300049822 Ga0501035_0000008 Ga0501035_0000008_307136_307753 205
1602 3300049822 Ga0501035_0000032 Ga0501035_0000032_119132_119749 205
1603 3300049822 Ga0501035_0000039 Ga0501035_0000039_115566_116183 205
1604 3300049822 Ga0501035_0000117 Ga0501035_0000117_53841_54458 205
1605 3300049822 Ga0501035_0002261 Ga0501035_0002261_11829_12446 205
1606 3300049822 Ga0501035_0004448 Ga0501035_0004448_6194_6811 205
1607 3300049822 Ga0501035_0005021 Ga0501035_0005021_7204_7821 205
1608 3300049822 Ga0501035_0008137 Ga0501035_0008137_1762_2379 205
1609 3300049822 Ga0501035_0017042 Ga0501035_0017042_1127_1744 205
1610 3300049822 Ga0501035_0026899 Ga0501035_0026899_4342_4959 205
1611 3300049822 Ga0501035_0029253 Ga0501035_0029253_83_700 205
1612 3300049822 Ga0501035_0045729 Ga0501035_0045729_452_1069 205
1613 3300049822 Ga0501035_0071486 Ga0501035_0071486_826_1443 205
1614 3300049822 Ga0501035_0094737 Ga0501035_0094737_738_1355 205
1615 3300049822 Ga0501035_0099467 Ga0501035_0099467_1724_2341 205
1616 3300049822 Ga0501035_0106844 Ga0501035_0106844_246_863 205
1617 3300049822 Ga0501035_0172930 Ga0501035_0172930_201_818 205
1618 3300049822 Ga0501035_0173103 Ga0501035_0173103_1168_1785 205
1619 3300049822 Ga0501035_0181247 Ga0501035_0181247_1175_1792 205
1620 3300049822 Ga0501035_0198596 Ga0501035_0198596_80_697 205
1621 3300049822 Ga0501035_0256988 Ga0501035_0256988_324_941 205
1622 3300049822 Ga0501035_0325138 Ga0501035_0325138_514_1131 205
1623 3300049822 Ga0501035_0433007 Ga0501035_0433007_225_842 205
1624 3300049822 Ga0501035_0484671 Ga0501035_0484671_374_991 205
1625 3300049823 Ga0501044_0000001 Ga0501044_0000001_56214_56831 205
1626 3300049823 Ga0501044_0000019 Ga0501044_0000019_109781_110398 205
1627 3300049823 Ga0501044_0000047 Ga0501044_0000047_40721_41338 205
1628 3300049823 Ga0501044_0000703 Ga0501044_0000703_10281_10898 205
1629 3300049823 Ga0501044_0010978 Ga0501044_0010978_648_1265 205
1630 3300049823 Ga0501044_0013911 Ga0501044_0013911_1461_2078 205
1631 3300049823 Ga0501044_0028245 Ga0501044_0028245_2712_3329 205
1632 3300049823 Ga0501044_0034875 Ga0501044_0034875_3810_4427 205
1633 3300049823 Ga0501044_0035914 Ga0501044_0035914_1779_2396 205
1634 3300049823 Ga0501044_0046510 Ga0501044_0046510_1102_1719 205
1635 3300049823 Ga0501044_0048777 Ga0501044_0048777_2001_2618 205
1636 3300049823 Ga0501044_0058195 Ga0501044_0058195_2439_3056 205
1637 3300049823 Ga0501044_0103289 Ga0501044_0103289_2029_2646 205
1638 3300049823 Ga0501044_0121136 Ga0501044_0121136_45_662 205
1639 3300049823 Ga0501044_0143513 Ga0501044_0143513_1731_2348 205
1640 3300049823 Ga0501044_0148141 Ga0501044_0148141_254_871 205
1641 3300049823 Ga0501044_0154920 Ga0501044_0154920_510_1127 205
1642 3300049823 Ga0501044_0177509 Ga0501044_0177509_353_970 205
1643 3300049823 Ga0501044_0191453 Ga0501044_0191453_118_735 205
1644 3300049823 Ga0501044_0209608 Ga0501044_0209608_732_1349 205
1645 3300049823 Ga0501044_0231424 Ga0501044_0231424_27_644 205
1646 3300049823 Ga0501044_0337127 Ga0501044_0337127_383_1000 205
1647 3300049823 Ga0501044_0365035 Ga0501044_0365035_586_1203 205
1648 3300049823 Ga0501044_0462847 Ga0501044_0462847_250_867 205
1649 3300049823 Ga0501044_0669613 Ga0501044_0669613_216_833 205
1650 3300049824 Ga0501045_0001654 Ga0501045_0001654_10502_11119 205
1651 3300049824 Ga0501045_0008550 Ga0501045_0008550_3724_4341 205
1652 3300049824 Ga0501045_0009260 Ga0501045_0009260_2979_3596 205
1653 3300049824 Ga0501045_0010803 Ga0501045_0010803_4312_4929 205
1654 3300049824 Ga0501045_0041021 Ga0501045_0041021_2166_2783 205
1655 3300049824 Ga0501045_0050604 Ga0501045_0050604_409_1026 205
1656 3300049824 Ga0501045_0230832 Ga0501045_0230832_405_1022 205
1657 3300050489 nmdc:mga03683_4036_c1 nmdc:mga03683_4036_c1_174_791 205
1658 3300050489 nmdc:mga03683_58041_c1 nmdc:mga03683_58041_c1_537_1154 205
1659 3300050490 nmdc:mga03n38_117253_c1 nmdc:mga03n38_117253_c1_619_1236 205
1660 3300050490 nmdc:mga03n38_132244_c1 nmdc:mga03n38_132244_c1_359_976 205
1661 3300050490 nmdc:mga03n38_1389_c1 nmdc:mga03n38_1389_c1_4583_5200 205
1662 3300050490 nmdc:mga03n38_143265_c1 nmdc:mga03n38_143265_c1_153_770 205
1663 3300050490 nmdc:mga03n38_245834_c1 nmdc:mga03n38_245834_c1_18_635 205
1664 3300050490 nmdc:mga03n38_436972_c1 nmdc:mga03n38_436972_c1_93_710 205
1665 3300050491 nmdc:mga00v17_130479_c1 nmdc:mga00v17_130479_c1_119_736 205
1666 3300050491 nmdc:mga00v17_264705_c1 nmdc:mga00v17_264705_c1_137_754 205
1667 3300050491 nmdc:mga00v17_26959_c1 nmdc:mga00v17_26959_c1_31_648 205
1668 3300050491 nmdc:mga00v17_400348_c1 nmdc:mga00v17_400348_c1_115_732 205
1669 3300050492 nmdc:mga0yw44_129012_c1 nmdc:mga0yw44_129012_c1_859_1476 205
1670 3300050492 nmdc:mga0yw44_35872_c1 nmdc:mga0yw44_35872_c1_177_794 205
1671 3300050492 nmdc:mga0yw44_4300_c1 nmdc:mga0yw44_4300_c1_3356_3973 205
1672 3300050492 nmdc:mga0yw44_78709_c1 nmdc:mga0yw44_78709_c1_957_1574 205
1673 3300050493 nmdc:mga0k408_124121_c1 nmdc:mga0k408_124121_c1_711_1328 205
1674 3300050493 nmdc:mga0k408_82957_c1 nmdc:mga0k408_82957_c1_1193_1810 205
1675 3300050494 nmdc:mga06z11_12231_c1 nmdc:mga06z11_12231_c1_1942_2559 205
1676 3300050494 nmdc:mga06z11_33762_c1 nmdc:mga06z11_33762_c1_953_1570 205
1677 3300050494 nmdc:mga06z11_705_c1 nmdc:mga06z11_705_c1_3708_4325 205
1678 3300050494 nmdc:mga06z11_72969_c1 nmdc:mga06z11_72969_c1_189_806 205
1679 3300050495 nmdc:mga04h51_23833_c1 nmdc:mga04h51_23833_c1_892_1509 205
1680 3300050495 nmdc:mga04h51_4615_c1 nmdc:mga04h51_4615_c1_510_1127 205
1681 3300050495 nmdc:mga04h51_694_c1 nmdc:mga04h51_694_c1_3880_4497 205
1682 3300050496 nmdc:mga07m45_211273_c1 nmdc:mga07m45_211273_c1_35_652 205
1683 3300050496 nmdc:mga07m45_239053_c1 nmdc:mga07m45_239053_c1_220_837 205
1684 3300050496 nmdc:mga07m45_434322_c1 nmdc:mga07m45_434322_c1_94_711 205
1685 3300050496 nmdc:mga07m45_53418_c1 nmdc:mga07m45_53418_c1_1463_2080 205
1686 3300050507 nmdc:mga05p37_182118_c1 nmdc:mga05p37_182118_c1_1577_2194 205
1687 3300050507 nmdc:mga05p37_427650_c1 nmdc:mga05p37_427650_c1_113_841 205
1688 3300050507 nmdc:mga05p37_51437_c1 nmdc:mga05p37_51437_c1_3182_3799 205
1689 3300050507 nmdc:mga05p37_65210_c1 nmdc:mga05p37_65210_c1_2009_2626 205
1690 3300050507 nmdc:mga05p37_98045_c1 nmdc:mga05p37_98045_c1_26_643 205
1691 3300050508 nmdc:mga09592_114198_c1 nmdc:mga09592_114198_c1_368_1096 205
1692 3300050508 nmdc:mga09592_200339_c1 nmdc:mga09592_200339_c1_707_1324 205
1693 3300050508 nmdc:mga09592_241494_c1 nmdc:mga09592_241494_c1_621_1238 205
1694 3300050508 nmdc:mga09592_524289_c1 nmdc:mga09592_524289_c1_182_799 205
1695 3300050509 nmdc:mga0qj67_156075_c1 nmdc:mga0qj67_156075_c1_795_1412 205
1696 3300050509 nmdc:mga0qj67_54444_c1 nmdc:mga0qj67_54444_c1_791_1408 205
1697 3300050510 nmdc:mga06r32_190094_c1 nmdc:mga06r32_190094_c1_1116_1733 205
1698 3300050510 nmdc:mga06r32_23400_c1 nmdc:mga06r32_23400_c1_1164_1892 205
1699 3300050510 nmdc:mga06r32_264088_c1 nmdc:mga06r32_264088_c1_962_1579 205
1700 3300050510 nmdc:mga06r32_350083_c1 nmdc:mga06r32_350083_c1_28_645 205
1701 3300050511 nmdc:mga08y16_139567_c1 nmdc:mga08y16_139567_c1_738_1355 205
1702 3300050511 nmdc:mga08y16_171037_c1 nmdc:mga08y16_171037_c1_811_1428 205
1703 3300050511 nmdc:mga08y16_21413_c1 nmdc:mga08y16_21413_c1_3810_4427 205
1704 3300050511 nmdc:mga08y16_296484_c1 nmdc:mga08y16_296484_c1_16_633 205
1705 3300050511 nmdc:mga08y16_316692_c1 nmdc:mga08y16_316692_c1_439_1056 205
1706 3300050511 nmdc:mga08y16_5359_c1 nmdc:mga08y16_5359_c1_9479_10096 205
1707 3300050511 nmdc:mga08y16_63289_c1 nmdc:mga08y16_63289_c1_2907_3524 205
1708 3300050512 nmdc:mga0n895_15896_c1 nmdc:mga0n895_15896_c1_4287_4904 205
1709 3300050512 nmdc:mga0n895_170676_c1 nmdc:mga0n895_170676_c1_1272_1889 205
1710 3300050512 nmdc:mga0n895_2207_c1 nmdc:mga0n895_2207_c1_14217_14834 205
1711 3300050512 nmdc:mga0n895_30612_c1 nmdc:mga0n895_30612_c1_2184_2801 205
1712 3300050512 nmdc:mga0n895_83313_c1 nmdc:mga0n895_83313_c1_822_1439 205
1713 3300050513 nmdc:mga0rr50_121476_c1 nmdc:mga0rr50_121476_c1_1320_1937 205
1714 3300050513 nmdc:mga0rr50_19863_c1 nmdc:mga0rr50_19863_c1_1951_2568 205
1715 3300050513 nmdc:mga0rr50_224297_c1 nmdc:mga0rr50_224297_c1_926_1543 205
1716 3300050513 nmdc:mga0rr50_519292_c1 nmdc:mga0rr50_519292_c1_98_715 205
1717 3300050513 nmdc:mga0rr50_60126_c1 nmdc:mga0rr50_60126_c1_742_1359 205
1718 3300050513 nmdc:mga0rr50_653383_c1 nmdc:mga0rr50_653383_c1_254_871 205
1719 3300050514 nmdc:mga08x19_156817_c1 nmdc:mga08x19_156817_c1_872_1489 205
1720 3300050514 nmdc:mga08x19_208239_c1 nmdc:mga08x19_208239_c1_32_649 205
1721 3300050514 nmdc:mga08x19_21206_c1 nmdc:mga08x19_21206_c1_266_883 205
1722 3300050514 nmdc:mga08x19_69_c1 nmdc:mga08x19_69_c1_89628_90245 205
1723 3300050514 nmdc:mga08x19_9966_c1 nmdc:mga08x19_9966_c1_2102_2719 205
1724 3300050515 nmdc:mga0a205_21733_c1 nmdc:mga0a205_21733_c1_3861_4478 205
1725 3300050515 nmdc:mga0a205_431202_c1 nmdc:mga0a205_431202_c1_515_1132 205
1726 3300050516 nmdc:mga0sz30_1901_c1 nmdc:mga0sz30_1901_c1_2215_2832 205
1727 3300050516 nmdc:mga0sz30_32122_c1 nmdc:mga0sz30_32122_c1_902_1519 205
1728 3300050516 nmdc:mga0sz30_9747_c2 nmdc:mga0sz30_9747_c2_211_828 205
1729 3300053077 Ga0495601_0066610 Ga0495601_0066610_461_1078 205
1730 3300053077 Ga0495601_0076451 Ga0495601_0076451_96_713 205
1731 3300053078 Ga0495612_0157560 Ga0495612_0157560_195_812 205
1732 3300053083 Ga0495655_0000251 Ga0495655_0000251_6578_7195 205
1733 3300053084 Ga0495595_0028754 Ga0495595_0028754_1658_2275 205
1734 3300053084 Ga0495595_0032219 Ga0495595_0032219_911_1528 205
1735 3300053085 Ga0495619_0004327 Ga0495619_0004327_1118_1735 205
1736 3300053085 Ga0495619_0196442 Ga0495619_0196442_762_1379 205
1737 3300053085 Ga0495619_0454718 Ga0495619_0454718_113_730 205
1738 3300053087 Ga0500643_000019 Ga0500643_000019_139067_139684 205
1739 3300053088 Ga0500644_0003737 Ga0500644_0003737_1453_2070 205
1740 3300053093 Ga0500651_0003961 Ga0500651_0003961_1546_2163 205
1741 3300053093 Ga0500651_0190048 Ga0500651_0190048_148_918 205
1742 3300053094 Ga0500566_0000487 Ga0500566_0000487_20453_21070 205
1743 3300053096 Ga0500641_0131552 Ga0500641_0131552_362_979 205
1744 3300053103 Ga0500555_011538 Ga0500555_011538_1314_1931 205
1745 3300053104 Ga0500556_0000036 Ga0500556_0000036_102950_103567 205
1746 3300053104 Ga0500556_0001299 Ga0500556_0001299_150_767 205
1747 3300053111 Ga0500572_004255 Ga0500572_004255_41_658 205
1748 3300053119 Ga0500595_024485 Ga0500595_024485_1191_1808 205
1749 3300053119 Ga0500595_048346 Ga0500595_048346_331_948 205
1750 3300053119 Ga0500595_065616 Ga0500595_065616_214_831 205
1751 3300053121 Ga0500607_060523 Ga0500607_060523_139_756 205
1752 3300053126 Ga0500621_044069 Ga0500621_044069_390_1007 205
1753 3300053130 Ga0500642_0272533 Ga0500642_0272533_100_717 205
1754 3300053131 Ga0500652_048904 Ga0500652_048904_1026_1643 205
1755 3300053136 Ga0500559_0039340 Ga0500559_0039340_510_1127 205
1756 3300053136 Ga0500559_0047072 Ga0500559_0047072_49_666 205
1757 3300053139 Ga0500568_0000309 Ga0500568_0000309_2078_2731 205
1758 3300053151 Ga0500604_0006127 Ga0500604_0006127_381_998 205
1759 3300053151 Ga0500604_0022165 Ga0500604_0022165_886_1503 205
1760 3300053151 Ga0500604_0030493 Ga0500604_0030493_191_808 205
1761 3300053153 Ga0500616_0009256 Ga0500616_0009256_4558_5175 205
1762 3300053153 Ga0500616_0019054 Ga0500616_0019054_1747_2364 205
1763 3300053153 Ga0500616_0024006 Ga0500616_0024006_1431_2048 205
1764 3300053153 Ga0500616_0032619 Ga0500616_0032619_158_775 205
1765 3300053153 Ga0500616_0056137 Ga0500616_0056137_629_1246 205
1766 3300053154 Ga0500619_054403 Ga0500619_054403_235_852 205
1767 3300053155 Ga0500620_000626 Ga0500620_000626_4296_4913 205
1768 3300053155 Ga0500620_018206 Ga0500620_018206_703_1320 205
1769 3300053158 Ga0500627_0185884 Ga0500627_0185884_77_694 205
1770 3300053161 Ga0500634_0000025 Ga0500634_0000025_60065_60682 205
1771 3300053162 Ga0500638_003723 Ga0500638_003723_4958_5575 205
1772 3300053177 Ga0500636_0000194 Ga0500636_0000194_18085_18702 205
1773 3300053178 Ga0500637_0178773 Ga0500637_0178773_362_979 205
1774 3300053730 Ga0500645_056068 Ga0500645_056068_129_746 205
1775 3300053733 Ga0500552_011425 Ga0500552_011425_304_921 205
1776 3300054114 Ga0501084_0006046 Ga0501084_0006046_4315_5058 205
1777 3300054114 Ga0501084_0009681 Ga0501084_0009681_3252_3869 205
1778 3300054114 Ga0501084_0023106 Ga0501084_0023106_116_733 205
1779 3300054114 Ga0501084_0049863 Ga0501084_0049863_1269_1886 205
1780 3300054114 Ga0501084_0068743 Ga0501084_0068743_2243_2860 205
1781 3300054114 Ga0501084_0124882 Ga0501084_0124882_594_1211 205
1782 3300054114 Ga0501084_0149033 Ga0501084_0149033_362_979 205
1783 3300054114 Ga0501084_0553673 Ga0501084_0553673_320_937 205
1784 3300059493 Ga0587077_051409 Ga0587077_051409_117_734 205
1785 3300059493 Ga0587077_080517 Ga0587077_080517_116_733 205
1786 3300059504 Ga0587082_059591 Ga0587082_059591_114_731 205
1787 3300059504 Ga0587082_059824 Ga0587082_059824_117_734 205
1788 3300059511 Ga0587091_050805 Ga0587091_050805_30_647 205
1789 3300059623 Ga0587101_027942 Ga0587101_027942_13_630 205
1790 3300059623 Ga0587101_033312 Ga0587101_033312_84_701 205
1791 3300059624 Ga0587109_069466 Ga0587109_069466_117_734 205
1792 3300059625 Ga0587113_015543 Ga0587113_015543_18_635 205
1793 3300059626 Ga0587115_051677 Ga0587115_051677_42_659 205
1794 3300059631 Ga0587130_013116 Ga0587130_013116_95_712 205
1795 3300059639 Ga0587062_006809 Ga0587062_006809_15_632 205
1796 3300059639 Ga0587062_050607 Ga0587062_050607_66_683 205
1797 3300059641 Ga0587068_057336 Ga0587068_057336_107_724 205
1798 3300059642 Ga0587069_046331 Ga0587069_046331_117_734 205
1799 3300059645 Ga0587076_063858 Ga0587076_063858_15_632 205
1800 3300059647 Ga0587079_059224 Ga0587079_059224_110_727 205
1801 3300059654 Ga0587110_013617 Ga0587110_013617_185_802 205
1802 3300059659 Ga0587120_008602 Ga0587120_008602_202_819 205
1803 3300059660 Ga0587124_010216 Ga0587124_010216_201_818 205
1804 3300060346 Ga0587111_0068265 Ga0587111_0068265_27_644 205
1805 3300060346 Ga0587111_0096492 Ga0587111_0096492_84_701 205
1806 3300060353 Ga0501082_0002218 Ga0501082_0002218_11471_12088 205
1807 3300060353 Ga0501082_0008244 Ga0501082_0008244_5614_6231 205
1808 3300060353 Ga0501082_0015022 Ga0501082_0015022_986_1603 205
1809 3300060353 Ga0501082_0021725 Ga0501082_0021725_4279_4896 205
1810 3300060353 Ga0501082_0033112 Ga0501082_0033112_1891_2508 205
1811 3300060353 Ga0501082_0038987 Ga0501082_0038987_3262_3879 205
1812 3300060353 Ga0501082_0050351 Ga0501082_0050351_999_1616 205
1813 3300060353 Ga0501082_0058924 Ga0501082_0058924_1068_1685 205
1814 3300060353 Ga0501082_0072665 Ga0501082_0072665_1057_1674 205
1815 3300060353 Ga0501082_0109419 Ga0501082_0109419_847_1464 205
1816 3300060353 Ga0501082_0190851 Ga0501082_0190851_990_1607 205
1817 3300060353 Ga0501082_0331408 Ga0501082_0331408_85_702 205
1818 3300060353 Ga0501082_0348487 Ga0501082_0348487_198_815 205
1819 3300060353 Ga0501082_0374891 Ga0501082_0374891_415_1032 205
1820 3300060353 Ga0501082_0431388 Ga0501082_0431388_442_1059 205
1821 3300060353 Ga0501082_0508428 Ga0501082_0508428_383_1000 205
1822 3300060353 Ga0501082_0716932 Ga0501082_0716932_224_841 205
1823 3300060353 Ga0501082_0752630 Ga0501082_0752630_20_637 205
1824 3300060353 Ga0501082_0920630 Ga0501082_0920630_37_654 205
1825 3300061719 Ga0466962_0000476 Ga0466962_0000476_6852_7469 205
1826 3300061719 Ga0466962_0168384 Ga0466962_0168384_296_913 205
1827 3300061734 Ga0530510_0005850 Ga0530510_0005850_7618_8235 205
1828 3300061734 Ga0530510_0007021 Ga0530510_0007021_4481_5098 205
1829 3300061734 Ga0530510_0026303 Ga0530510_0026303_1415_2032 205
1830 3300061734 Ga0530510_0165872 Ga0530510_0165872_294_911 205
1831 3300061734 Ga0530510_0203259 Ga0530510_0203259_602_1219 205
1832 3300061734 Ga0530510_0298869 Ga0530510_0298869_360_977 205
1833 3300061734 Ga0530510_0395637 Ga0530510_0395637_83_826 205
1834 3300061734 Ga0530510_0710982 Ga0530510_0710982_123_740 205
1835 3300005293 Ga0065715_10105176 Ga0065715_101051762 206
1836 3300005545 Ga0070695_100320465 Ga0070695_1003204651 206
1837 3300005549 Ga0070704_100378394 Ga0070704_1003783942 206
1838 3300006852 Ga0075433_10598806 Ga0075433_105988061 206
1839 3300009147 Ga0114129_10404709 Ga0114129_104047093 206
1840 3300048912 Ga0496109_0309120 Ga0496109_0309120_319_939 206
1841 3300048916 Ga0496113_0197816 Ga0496113_0197816_429_1049 206
1842 3300050515 nmdc:mga0a205_468445_c1 nmdc:mga0a205_468445_c1_267_887 206
1843 2010549000 RicEn_C4886 RicEn_87190 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

145

192

0.98

PF00163

Ribosomal_S4

Ribosomal protein S4/S9 N-terminal domain

54

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cqj-assembly1.cif.gz_A solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog 0.9308 94 136
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9272 48 148
1ksv-assembly1.cif.gz_A structure of rsua 0.9249 94 143
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.8932 48 148
3dh3-assembly4.cif.gz_D crystal structure of rluf in complex with a 22 nucleotide rna substrate 0.8913 95 143
ID Description Score Start End Superfamily
af_A0A0P0Y445_123_179_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9846 94 137 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9769 93 142 3.10.290.10
af_Q4DSJ7_105_180_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9737 93 137 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.97 94 136 3.10.290.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9609 94 136 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A3G7CER1-F1-model_v4 Small ribosomal subunit protein uS4c 0.9767 61 145 GO:0003735
GO:0009507
GO:0015935
GO:0019843
GO:0042274
AF-I1E303-F1-model_v4 Small subunit ribosomal protein S4 0.9688 80 185 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-A0A327K132-F1-model_v4 Small ribosomal subunit protein uS4 0.9653 53 139 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-A0A7K0F5T4-F1-model_v4 deleted 0.9584 55 156
AF-T1A5M6-F1-model_v4 30S ribosomal protein S4 0.9542 92 161 GO:0003735
GO:0015935
GO:0019843
GO:0042274

Feature Viewer

pLDDT pTM Quality
71.96 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map