F495766

General Info

Members Datasets Scaffolds Average Seq Length
1811 609 1714 184

Family's Representative Sequence

Representative Sequence 3300050516|nmdc:mga0sz30_15560_c1|nmdc:mga0sz30_15560_c1_1950_2501
Length 183
Sequence VIEETLFDAEEKMEKAVSVARDDLSSIRTGRANPGMFSRVNMDYYGSPTPITQLSSINVPEPRLVVIKPYESNQLRNIEDAIRNSDLGVNPSNDGNVIRVSIPQLTEERRRDLVKQSKGEDARVSVRNIRRKAMEELHRIKKDGEAGEDEVSRAEKDLDKVTHTYTNQIDELVKHKEGELLEV

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
8 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
9 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
10 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
11 2643221613 Oerskovia sp. Root22 Isolate Unclassified
12 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
13 2643221692 Nocardia sp. Root136 Isolate Unclassified
14 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
15 2643221721 Oerskovia sp. Root918 Isolate Unclassified
16 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
17 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
18 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
19 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
20 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
21 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
22 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
23 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
24 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
25 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
26 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
27 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
28 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
29 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
30 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
31 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
32 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
33 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
34 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
35 2855683550 Micromonospora sp. RP3T Isolate Unclassified
36 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
37 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
38 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
39 2858868258 Micromonospora sp. MH33 Isolate Unclassified
40 2858882152 Micromonospora noduli MED15 Isolate Nodule
41 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
42 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
43 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
44 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
45 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
46 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
47 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
48 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
49 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
50 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
51 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
52 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
53 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
54 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
55 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
56 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
57 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
58 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
59 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
60 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
61 2902582711 Micromonospora sp. AP08 Isolate Unclassified
62 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
63 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
64 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
65 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
66 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
67 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
68 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
69 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
70 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
71 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
72 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
73 2922554459 Rhodococcus sp. 66b Isolate Unclassified
74 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
75 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
76 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
77 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
78 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
79 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
80 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
81 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
82 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
83 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
84 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
85 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
86 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
87 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
88 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
89 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
90 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
91 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
92 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
94 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
98 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
99 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
100 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
101 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
109 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
110 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
111 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
112 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
116 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
117 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
118 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
119 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
120 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
127 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
128 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
129 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
130 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
131 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
132 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
133 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
134 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
135 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
136 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
137 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
138 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
139 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
140 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
141 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
142 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
143 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
144 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
145 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
146 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
147 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
150 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
151 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
152 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
153 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
154 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
155 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
156 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
157 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
158 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
159 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
160 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
161 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
162 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
163 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
164 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
165 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
166 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
167 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
168 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
169 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
170 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
171 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
172 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
173 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
174 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
175 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
176 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
177 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
178 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
179 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
180 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
181 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
182 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
183 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
184 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
185 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
186 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
187 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
188 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
189 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
190 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
191 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
192 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
193 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
194 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
196 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
197 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
198 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
199 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
200 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
201 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
204 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
205 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
206 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
210 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
211 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
212 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
213 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
214 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
215 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
216 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
217 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
219 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
220 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
221 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
222 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
223 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
224 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
225 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
226 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
227 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
228 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
229 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
230 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
231 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
232 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
233 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
234 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
235 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
236 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
238 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
239 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
242 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
243 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
244 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
245 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
246 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
316 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
320 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
321 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
322 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
323 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
324 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
325 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
326 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
327 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
328 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
329 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
330 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
331 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
332 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
333 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
334 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
335 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
336 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
337 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
338 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
339 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
340 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
341 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
342 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
343 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
345 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
346 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
347 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
348 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
349 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
350 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
351 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
352 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
353 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
354 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
355 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
356 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
357 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
358 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
359 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
360 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
361 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
362 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
363 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
364 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
365 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
366 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
367 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
368 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
369 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
370 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
371 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
372 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
373 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
374 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
375 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
376 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
377 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
378 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
379 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
380 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
381 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
382 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
383 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
384 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
385 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
386 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
387 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
388 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
389 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
390 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
391 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
392 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
393 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
394 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
395 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
396 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
397 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
398 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
399 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
400 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
401 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
402 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
403 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
404 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
405 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
406 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
407 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
408 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
409 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
410 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
411 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
412 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
413 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
414 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
415 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
416 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
417 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
418 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
419 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
420 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
421 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
422 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
423 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
424 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
425 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
426 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
427 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
428 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
429 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
430 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
431 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
432 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
433 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
434 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
435 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
436 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
437 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
438 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
439 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
440 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
441 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
442 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
443 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
444 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
445 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
446 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
447 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
448 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
449 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
450 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
451 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
452 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
453 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
454 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
455 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
456 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
457 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
458 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
459 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
460 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
461 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
462 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
463 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
464 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
465 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
466 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
467 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
468 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
469 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
470 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
471 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
472 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
473 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
474 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
475 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
476 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
477 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
478 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
479 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
480 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
481 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
482 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
483 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
484 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
485 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
486 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
487 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
488 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
489 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
490 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
491 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
492 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
493 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
494 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
495 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
496 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
497 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
498 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
499 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
500 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
501 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
502 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
503 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
504 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
505 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
506 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
507 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
508 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
509 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
510 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
511 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
512 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
513 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
514 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
515 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
516 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
517 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
518 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
519 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
535 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
536 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
537 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
538 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
539 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
540 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
543 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
544 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
545 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
546 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
547 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
548 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
549 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
550 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
551 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
552 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
553 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
554 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
555 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
556 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
557 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
558 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
559 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
560 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
561 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
562 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
563 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
564 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
565 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
566 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
567 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
568 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
569 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
570 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
571 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
572 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
573 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
574 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
575 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
576 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
577 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
578 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
579 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
580 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
581 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
582 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
583 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
584 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
585 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
586 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
587 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
588 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
598 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
599 649633069 Micromonospora sp. L5 Isolate Unclassified
600 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
601 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
602 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
603 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
604 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
605 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
606 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
607 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
608 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
609 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.66
Metatranscriptomes 1.99
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 7.56
Nodule 0.39
Rhizoplane 7.45
Rhizosphere 76.48
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001335 3300001977 Bacteria 3930
2 JGI24750J21931_1004234 3300002070 Bacteria 1733
3 JGI24745J21846_1001041 3300002073 Bacteria 2607
4 JGI24745J21846_1007889 3300002073 Bacteria 1195
5 JGI24745J21846_1013857 3300002073 Bacteria 931
6 JGI24745J21846_1015920 3300002073 Bacteria 871
7 JGI24738J21930_10020624 3300002075 Bacteria 1370
8 JGI24744J21845_10002828 3300002077 Bacteria 3548
9 JGI24744J21845_10024014 3300002077 Bacteria 1193
10 JGI24742J22300_10000835 3300002244 Bacteria 4713
11 JGI25406J46586_10009063 3300003203 Bacteria 4468
12 rootH2_10060816 3300003320 Bacteria 1471
13 rootH2_10238385 3300003320 Bacteria 1365
14 JGI25405J52794_10010510 3300003911 Bacteria 1761
15 Ga0058861_11731922 3300004800 Bacteria 634
16 Ga0065704_10429919 3300005289 Bacteria 718
17 Ga0070658_10021225 3300005327 Bacteria 5203
18 Ga0070658_10230628 3300005327 Bacteria 1567
19 Ga0070676_10093106 3300005328 Bacteria 1850
20 Ga0070676_10123619 3300005328 Bacteria 1627
21 Ga0070676_10275103 3300005328 Bacteria 1132
22 Ga0070683_100042830 3300005329 Bacteria 4170
23 Ga0070683_100058791 3300005329 Bacteria 3571
24 Ga0070683_100092055 3300005329 Bacteria 2848
25 Ga0070683_100542962 3300005329 Bacteria 1111
26 Ga0070690_100011924 3300005330 Bacteria 5103
27 Ga0070690_100842325 3300005330 Bacteria 714
28 Ga0070690_100915004 3300005330 Bacteria 687
29 Ga0070670_100068856 3300005331 Bacteria 3038
30 Ga0070670_100291345 3300005331 Bacteria 1426
31 Ga0068869_100007122 3300005334 Bacteria 7124
32 Ga0068869_100030609 3300005334 Bacteria 3780
33 Ga0068869_100082170 3300005334 Bacteria 2407
34 Ga0068869_100112786 3300005334 Bacteria 2070
35 Ga0068869_100145016 3300005334 Bacteria 1837
36 Ga0068869_100356960 3300005334 Bacteria 1193
37 Ga0070666_10057426 3300005335 Bacteria 2629
38 Ga0070666_10488588 3300005335 Bacteria 892
39 Ga0070680_100108753 3300005336 Bacteria 2307
40 Ga0070682_100048620 3300005337 Bacteria 2641
41 Ga0070682_100050343 3300005337 Bacteria 2600
42 Ga0070682_100053136 3300005337 Bacteria 2538
43 Ga0070682_100085974 3300005337 Bacteria 2047
44 Ga0070682_100191149 3300005337 Bacteria 1437
45 Ga0070682_100196975 3300005337 Bacteria 1418
46 Ga0070682_100249368 3300005337 Bacteria 1279
47 Ga0070682_100417346 3300005337 Bacteria 1019
48 Ga0070682_100581041 3300005337 Bacteria 881
49 Ga0070682_101094494 3300005337 Bacteria 667
50 Ga0068868_100001250 3300005338 Bacteria 17460
51 Ga0068868_100030399 3300005338 Bacteria 4142
52 Ga0068868_100089130 3300005338 Bacteria 2483
53 Ga0068868_100125414 3300005338 Bacteria 2097
54 Ga0068868_100187225 3300005338 Bacteria 1720
55 Ga0068868_100193001 3300005338 Bacteria 1694
56 Ga0068868_100813910 3300005338 Bacteria 844
57 Ga0068868_101195791 3300005338 Bacteria 703
58 Ga0070660_100043371 3300005339 Bacteria 3437
59 Ga0070660_100214062 3300005339 Bacteria 1565
60 Ga0070660_100332716 3300005339 Bacteria 1249
61 Ga0070689_100016994 3300005340 Bacteria 5335
62 Ga0070689_100048266 3300005340 Bacteria 3283
63 Ga0070689_100376551 3300005340 Bacteria 1195
64 Ga0070689_100476787 3300005340 Bacteria 1065
65 Ga0070689_100578827 3300005340 Bacteria 970
66 Ga0070691_10040048 3300005341 Bacteria 2214
67 Ga0070691_10177565 3300005341 Bacteria 1107
68 Ga0070687_100051219 3300005343 Bacteria 2136
69 Ga0070687_100258358 3300005343 Bacteria 1086
70 Ga0070687_100742026 3300005343 Bacteria 690
71 Ga0070661_100071344 3300005344 Bacteria 2556
72 Ga0070661_100112490 3300005344 Bacteria 2034
73 Ga0070661_100146238 3300005344 Bacteria 1784
74 Ga0070661_100308906 3300005344 Bacteria 1232
75 Ga0070661_100486662 3300005344 Bacteria 986
76 Ga0070661_100538570 3300005344 Bacteria 938
77 Ga0070692_10030223 3300005345 Bacteria 2707
78 Ga0070692_10053955 3300005345 Bacteria 2097
79 Ga0070692_10093348 3300005345 Bacteria 1638
80 Ga0070692_10587960 3300005345 Bacteria 735
81 Ga0070668_100003037 3300005347 Bacteria 12419
82 Ga0070668_100049426 3300005347 Bacteria 3236
83 Ga0070668_100227273 3300005347 Bacteria 1541
84 Ga0070668_100407522 3300005347 Bacteria 1162
85 Ga0070668_100423477 3300005347 Bacteria 1140
86 Ga0070669_100008356 3300005353 Bacteria 7385
87 Ga0070669_100023215 3300005353 Bacteria 4442
88 Ga0070669_100198835 3300005353 Bacteria 1576
89 Ga0070669_100387977 3300005353 Bacteria 1140
90 Ga0070669_101144366 3300005353 Bacteria 671
91 Ga0070675_100002212 3300005354 Bacteria 14431
92 Ga0070675_100057136 3300005354 Bacteria 3216
93 Ga0070675_100131944 3300005354 Bacteria 2129
94 Ga0070675_100163558 3300005354 Bacteria 1915
95 Ga0070671_100034479 3300005355 Bacteria 4189
96 Ga0070671_100047862 3300005355 Bacteria 3554
97 Ga0070671_100157849 3300005355 Bacteria 1917
98 Ga0070671_100537995 3300005355 Bacteria 1007
99 Ga0070674_100000850 3300005356 Bacteria 15839
100 Ga0070674_100028726 3300005356 Bacteria 3654
101 Ga0070674_100064174 3300005356 Bacteria 2572
102 Ga0070673_100025346 3300005364 Bacteria 4364
103 Ga0070673_100038494 3300005364 Bacteria 3652
104 Ga0070673_100067119 3300005364 Bacteria 2867
105 Ga0070688_100063129 3300005365 Bacteria 2347
106 Ga0070688_100157550 3300005365 Bacteria 1558
107 Ga0070688_100329039 3300005365 Bacteria 1112
108 Ga0070659_100018903 3300005366 Bacteria 5206
109 Ga0070659_100046757 3300005366 Bacteria 3392
110 Ga0070659_100059912 3300005366 Bacteria 3006
111 Ga0070659_100085000 3300005366 Bacteria 2530
112 Ga0070659_100086906 3300005366 Bacteria 2503
113 Ga0070659_100242023 3300005366 Bacteria 1493
114 Ga0070667_100000391 3300005367 Bacteria 47388
115 Ga0070667_100008372 3300005367 Bacteria 8576
116 Ga0070667_100077191 3300005367 Bacteria 2844
117 Ga0070667_100266579 3300005367 Bacteria 1535
118 Ga0070667_101516628 3300005367 Bacteria 629
119 Ga0070709_10008373 3300005434 Bacteria 5680
120 Ga0070709_10061101 3300005434 Bacteria 2397
121 Ga0070709_10185081 3300005434 Bacteria 1465
122 Ga0070714_100000056 3300005435 Bacteria 103178
123 Ga0070714_100037899 3300005435 Bacteria 4053
124 Ga0070714_100102891 3300005435 Bacteria 2519
125 Ga0070714_100128268 3300005435 Bacteria 2264
126 Ga0070714_100301431 3300005435 Bacteria 1494
127 Ga0070714_100348342 3300005435 Bacteria 1391
128 Ga0070713_100020391 3300005436 Bacteria 5082
129 Ga0070710_10003475 3300005437 Bacteria 7462
130 Ga0070710_10007995 3300005437 Bacteria 5141
131 Ga0070710_10029829 3300005437 Bacteria 2929
132 Ga0070710_10036582 3300005437 Bacteria 2684
133 Ga0070710_10092930 3300005437 Bacteria 1783
134 Ga0070710_10807900 3300005437 Bacteria 670
135 Ga0070701_10002527 3300005438 Bacteria 7069
136 Ga0070701_10031045 3300005438 Bacteria 2649
137 Ga0070711_100000595 3300005439 Bacteria 18865
138 Ga0070711_100009414 3300005439 Bacteria 6017
139 Ga0070711_100012021 3300005439 Bacteria 5394
140 Ga0070711_100181378 3300005439 Bacteria 1612
141 Ga0070705_100024538 3300005440 Bacteria 3256
142 Ga0070705_100025127 3300005440 Bacteria 3225
143 Ga0070705_100038628 3300005440 Bacteria 2702
144 Ga0070700_100001993 3300005441 Bacteria 10367
145 Ga0070700_100070284 3300005441 Bacteria 2232
146 Ga0070694_100025849 3300005444 Bacteria 3801
147 Ga0070694_100027673 3300005444 Bacteria 3684
148 Ga0070694_100097444 3300005444 Bacteria 2074
149 Ga0070708_100161942 3300005445 Bacteria 2085
150 Ga0070708_100275757 3300005445 Bacteria 1582
151 Ga0070663_100005834 3300005455 Bacteria 7356
152 Ga0070663_100039879 3300005455 Bacteria 3285
153 Ga0070663_100157788 3300005455 Bacteria 1744
154 Ga0070663_100404418 3300005455 Bacteria 1117
155 Ga0070678_100000276 3300005456 Bacteria 23812
156 Ga0070678_100072316 3300005456 Bacteria 2584
157 Ga0070678_100092341 3300005456 Bacteria 2325
158 Ga0070678_100153378 3300005456 Bacteria 1858
159 Ga0070678_100374796 3300005456 Bacteria 1230
160 Ga0070678_100478293 3300005456 Bacteria 1096
161 Ga0070662_100005451 3300005457 Bacteria 8127
162 Ga0070662_100055537 3300005457 Bacteria 2873
163 Ga0070662_100075255 3300005457 Bacteria 2500
164 Ga0070662_100087738 3300005457 Bacteria 2330
165 Ga0070681_10179082 3300005458 Bacteria 2041
166 Ga0070681_10441761 3300005458 Bacteria 1213
167 Ga0070681_10677359 3300005458 Bacteria 947
168 Ga0068867_100000320 3300005459 Bacteria 31732
169 Ga0068867_100110924 3300005459 Bacteria 2108
170 Ga0068867_100147340 3300005459 Bacteria 1846
171 Ga0070685_10215364 3300005466 Bacteria 1256
172 Ga0070706_100416819 3300005467 Bacteria 1250
173 Ga0070706_100611089 3300005467 Bacteria 1013
174 Ga0070698_100657706 3300005471 Bacteria 989
175 Ga0070679_100027588 3300005530 Bacteria 5590
176 Ga0070679_100057418 3300005530 Bacteria 3880
177 Ga0070679_100309092 3300005530 Bacteria 1531
178 Ga0070679_100519563 3300005530 Bacteria 1134
179 Ga0070679_100547304 3300005530 Bacteria 1101
180 Ga0070684_100013677 3300005535 Bacteria 6549
181 Ga0070684_100038916 3300005535 Bacteria 4088
182 Ga0070684_100183584 3300005535 Bacteria 1902
183 Ga0070684_100340572 3300005535 Bacteria 1379
184 Ga0070684_100452781 3300005535 Bacteria 1186
185 Ga0070684_100653962 3300005535 Bacteria 978
186 Ga0070684_100738755 3300005535 Bacteria 918
187 Ga0070684_100750483 3300005535 Bacteria 911
188 Ga0068853_100001607 3300005539 Bacteria 16476
189 Ga0068853_100004868 3300005539 Bacteria 10440
190 Ga0068853_100020996 3300005539 Bacteria 5436
191 Ga0068853_100051961 3300005539 Bacteria 3529
192 Ga0068853_100056739 3300005539 Bacteria 3378
193 Ga0068853_100124594 3300005539 Bacteria 2301
194 Ga0070672_100126500 3300005543 Bacteria 2096
195 Ga0070672_100200148 3300005543 Bacteria 1670
196 Ga0070686_100013174 3300005544 Bacteria 4725
197 Ga0070695_100071349 3300005545 Bacteria 2274
198 Ga0070695_100087038 3300005545 Bacteria 2077
199 Ga0070695_100282316 3300005545 Bacteria 1220
200 Ga0070696_100003931 3300005546 Bacteria 9913
201 Ga0070696_100008598 3300005546 Bacteria 6830
202 Ga0070696_100129665 3300005546 Bacteria 1834
203 Ga0070696_100617101 3300005546 Bacteria 876
204 Ga0070693_100007579 3300005547 Bacteria 5310
205 Ga0070693_100094068 3300005547 Bacteria 1812
206 Ga0070693_100309565 3300005547 Bacteria 1067
207 Ga0070693_100331306 3300005547 Bacteria 1036
208 Ga0070665_100020646 3300005548 Bacteria 6618
209 Ga0070665_100165102 3300005548 Bacteria 2216
210 Ga0070665_100196213 3300005548 Bacteria 2020
211 Ga0070665_100196986 3300005548 Bacteria 2015
212 Ga0070665_100552961 3300005548 Bacteria 1163
213 Ga0070704_100000184 3300005549 Bacteria 25337
214 Ga0070704_100047627 3300005549 Bacteria 2997
215 Ga0070704_100383031 3300005549 Bacteria 1195
216 Ga0068855_100108544 3300005563 Bacteria 3187
217 Ga0068855_100121623 3300005563 Bacteria 2987
218 Ga0068855_100199355 3300005563 Bacteria 2254
219 Ga0068855_100221382 3300005563 Bacteria 2122
220 Ga0068855_100538998 3300005563 Bacteria 1264
221 Ga0070664_100003229 3300005564 Bacteria 13186
222 Ga0070664_100106454 3300005564 Bacteria 2443
223 Ga0070664_101079957 3300005564 Bacteria 755
224 Ga0068857_100132853 3300005577 Bacteria 2246
225 Ga0068857_100138500 3300005577 Bacteria 2199
226 Ga0068857_100158665 3300005577 Bacteria 2052
227 Ga0068857_100266717 3300005577 Bacteria 1573
228 Ga0068857_100346305 3300005577 Bacteria 1375
229 Ga0068857_100628384 3300005577 Bacteria 1016
230 Ga0068854_100001413 3300005578 Bacteria 14507
231 Ga0068854_100063636 3300005578 Bacteria 2678
232 Ga0068854_100225333 3300005578 Bacteria 1485
233 Ga0068854_100229775 3300005578 Bacteria 1472
234 Ga0068854_100285756 3300005578 Bacteria 1330
235 Ga0068854_100316415 3300005578 Bacteria 1267
236 Ga0068856_100154004 3300005614 Bacteria 2308
237 Ga0068856_100170942 3300005614 Bacteria 2185
238 Ga0068856_100512350 3300005614 Bacteria 1221
239 Ga0070702_100010452 3300005615 Bacteria 4572
240 Ga0070702_100015026 3300005615 Bacteria 3942
241 Ga0070702_100032468 3300005615 Bacteria 2865
242 Ga0070702_100148365 3300005615 Bacteria 1502
243 Ga0070702_100471760 3300005615 Bacteria 915
244 Ga0068852_100066923 3300005616 Bacteria 3139
245 Ga0068852_100085842 3300005616 Bacteria 2804
246 Ga0068852_100109092 3300005616 Bacteria 2513
247 Ga0068852_100158257 3300005616 Bacteria 2112
248 Ga0068852_100290312 3300005616 Bacteria 1580
249 Ga0068852_100334689 3300005616 Bacteria 1474
250 Ga0068852_100362186 3300005616 Bacteria 1418
251 Ga0068852_100381863 3300005616 Bacteria 1382
252 Ga0068859_100012772 3300005617 Bacteria 8439
253 Ga0068859_100026035 3300005617 Bacteria 5869
254 Ga0068859_100054216 3300005617 Bacteria 4031
255 Ga0068859_100118004 3300005617 Bacteria 2719
256 Ga0068859_100197682 3300005617 Bacteria 2095
257 Ga0068859_100295277 3300005617 Bacteria 1714
258 Ga0068864_100006670 3300005618 Bacteria 9450
259 Ga0068864_100033308 3300005618 Bacteria 4380
260 Ga0068864_100036395 3300005618 Bacteria 4195
261 Ga0068864_100179316 3300005618 Bacteria 1936
262 Ga0068864_100210587 3300005618 Bacteria 1790
263 Ga0068864_100281335 3300005618 Bacteria 1553
264 Ga0068864_100349542 3300005618 Bacteria 1394
265 Ga0068864_101649673 3300005618 Bacteria 645
266 Ga0068866_10000526 3300005718 Bacteria 17625
267 Ga0068866_10005191 3300005718 Bacteria 5365
268 Ga0068866_10046634 3300005718 Bacteria 2181
269 Ga0068866_10297188 3300005718 Bacteria 1007
270 Ga0068861_100001788 3300005719 Bacteria 13839
271 Ga0068861_100047564 3300005719 Bacteria 3239
272 Ga0068861_100077274 3300005719 Bacteria 2596
273 Ga0068861_100084706 3300005719 Bacteria 2489
274 Ga0068861_100294004 3300005719 Bacteria 1404
275 Ga0068861_100391724 3300005719 Bacteria 1230
276 Ga0068851_10071493 3300005834 Bacteria 1795
277 Ga0068851_10235629 3300005834 Bacteria 1033
278 Ga0068870_10075535 3300005840 Bacteria 1848
279 Ga0068870_10226249 3300005840 Bacteria 1148
280 Ga0068870_10493554 3300005840 Bacteria 815
281 Ga0068863_100000992 3300005841 Bacteria 28496
282 Ga0068863_100022881 3300005841 Bacteria 5972
283 Ga0068863_100023167 3300005841 Bacteria 5933
284 Ga0068863_100044586 3300005841 Bacteria 4209
285 Ga0068863_100082944 3300005841 Bacteria 3037
286 Ga0068863_100151212 3300005841 Bacteria 2221
287 Ga0068863_100158361 3300005841 Bacteria 2168
288 Ga0068863_100209541 3300005841 Bacteria 1877
289 Ga0068863_100687152 3300005841 Bacteria 1017
290 Ga0068863_101044289 3300005841 Bacteria 821
291 Ga0068858_100000750 3300005842 Bacteria 33972
292 Ga0068858_100003214 3300005842 Bacteria 16314
293 Ga0068858_100006333 3300005842 Bacteria 11524
294 Ga0068858_100103526 3300005842 Bacteria 2655
295 Ga0068858_100206484 3300005842 Bacteria 1858
296 Ga0068858_100544221 3300005842 Bacteria 1124
297 Ga0068858_100588892 3300005842 Bacteria 1078
298 Ga0068858_101755331 3300005842 Bacteria 613
299 Ga0068860_100000065 3300005843 Bacteria 186634
300 Ga0068860_100016486 3300005843 Bacteria 7206
301 Ga0068860_100074449 3300005843 Bacteria 3229
302 Ga0068860_100136722 3300005843 Bacteria 2353
303 Ga0068860_100217306 3300005843 Bacteria 1855
304 Ga0068860_100316612 3300005843 Bacteria 1531
305 Ga0068860_100567767 3300005843 Bacteria 1138
306 Ga0068860_100734919 3300005843 Bacteria 998
307 Ga0068862_100000028 3300005844 Bacteria 184197
308 Ga0068862_100000110 3300005844 Bacteria 97889
309 Ga0068862_100006896 3300005844 Bacteria 9420
310 Ga0068862_100084719 3300005844 Bacteria 2754
311 Ga0068862_100095526 3300005844 Bacteria 2593
312 Ga0068862_100528140 3300005844 Bacteria 1124
313 Ga0081455_10000011 3300005937 Bacteria 203132
314 Ga0081455_10035096 3300005937 Bacteria 4486
315 Ga0081455_10467276 3300005937 Bacteria 857
316 Ga0081538_10112439 3300005981 Bacteria 1333
317 Ga0081540_1004419 3300005983 Bacteria 10727
318 Ga0081540_1014293 3300005983 Bacteria 5095
319 Ga0081540_1041855 3300005983 Bacteria 2370
320 Ga0081540_1090796 3300005983 Bacteria 1344
321 Ga0081539_10000357 3300005985 Bacteria 100714
322 Ga0081539_10000420 3300005985 Bacteria 90166
323 Ga0081539_10000680 3300005985 Bacteria 68157
324 Ga0081539_10001106 3300005985 Bacteria 48943
325 Ga0081539_10003644 3300005985 Bacteria 18550
326 Ga0081539_10004121 3300005985 Bacteria 16553
327 Ga0081539_10005819 3300005985 Bacteria 12249
328 Ga0081539_10202618 3300005985 Bacteria 915
329 Ga0070717_10043437 3300006028 Bacteria 3668
330 Ga0070717_10084531 3300006028 Bacteria 2669
331 Ga0070717_10134693 3300006028 Bacteria 2126
332 Ga0070717_10545693 3300006028 Bacteria 1049
333 Ga0075365_10016206 3300006038 Bacteria 4526
334 Ga0075365_10103485 3300006038 Bacteria 1951
335 Ga0075365_10118048 3300006038 Bacteria 1828
336 Ga0075365_10376878 3300006038 Bacteria 1001
337 Ga0075365_10408943 3300006038 Bacteria 958
338 Ga0075365_10475967 3300006038 Bacteria 882
339 Ga0075363_100000092 3300006048 Bacteria 19660
340 Ga0075363_100001236 3300006048 Bacteria 9482
341 Ga0075363_100010691 3300006048 Bacteria 4370
342 Ga0075363_100021509 3300006048 Bacteria 3250
343 Ga0075363_100148358 3300006048 Bacteria 1323
344 Ga0075363_100159758 3300006048 Bacteria 1275
345 Ga0075363_100172142 3300006048 Bacteria 1229
346 Ga0075363_100261173 3300006048 Bacteria 999
347 Ga0075363_100351874 3300006048 Bacteria 860
348 Ga0075364_10006183 3300006051 Bacteria 7015
349 Ga0075364_10007880 3300006051 Bacteria 6342
350 Ga0075364_10055165 3300006051 Bacteria 2600
351 Ga0075364_10081873 3300006051 Bacteria 2135
352 Ga0075364_10164699 3300006051 Bacteria 1497
353 Ga0075364_10164862 3300006051 Bacteria 1497
354 Ga0075364_10423002 3300006051 Bacteria 909
355 Ga0075432_10015091 3300006058 Bacteria 2633
356 Ga0070715_10004796 3300006163 Bacteria 4475
357 Ga0070715_10008061 3300006163 Bacteria 3655
358 Ga0070715_10180699 3300006163 Bacteria 1058
359 Ga0070715_10202316 3300006163 Bacteria 1010
360 Ga0070716_100091011 3300006173 Bacteria 1846
361 Ga0070716_100134195 3300006173 Bacteria 1569
362 Ga0070716_100305270 3300006173 Bacteria 1109
363 Ga0070716_100619009 3300006173 Bacteria 817
364 Ga0070712_100013395 3300006175 Bacteria 5241
365 Ga0070712_100019203 3300006175 Bacteria 4454
366 Ga0070712_100298843 3300006175 Bacteria 1302
367 Ga0070712_100614789 3300006175 Bacteria 921
368 Ga0075362_10004621 3300006177 Bacteria 4962
369 Ga0075362_10019656 3300006177 Bacteria 2812
370 Ga0075362_10042906 3300006177 Bacteria 2001
371 Ga0075362_10059871 3300006177 Bacteria 1720
372 Ga0075362_10102641 3300006177 Bacteria 1339
373 Ga0075362_10106025 3300006177 Bacteria 1319
374 Ga0075367_10008208 3300006178 Bacteria 5397
375 Ga0075367_10106436 3300006178 Bacteria 1718
376 Ga0075367_10124665 3300006178 Bacteria 1589
377 Ga0075369_10002792 3300006186 Bacteria 6277
378 Ga0075369_10008639 3300006186 Bacteria 3928
379 Ga0075369_10013391 3300006186 Bacteria 3256
380 Ga0075369_10017409 3300006186 Bacteria 2912
381 Ga0075369_10018806 3300006186 Bacteria 2816
382 Ga0075369_10044231 3300006186 Bacteria 1913
383 Ga0075369_10080164 3300006186 Bacteria 1447
384 Ga0075369_10135910 3300006186 Bacteria 1119
385 Ga0075366_10064827 3300006195 Bacteria 2173
386 Ga0097621_100009195 3300006237 Bacteria 7165
387 Ga0097621_100170681 3300006237 Bacteria 1874
388 Ga0097621_100240410 3300006237 Bacteria 1583
389 Ga0097621_100293640 3300006237 Bacteria 1434
390 Ga0075370_10002790 3300006353 Bacteria 8189
391 Ga0075370_10015604 3300006353 Bacteria 4070
392 Ga0075370_10027827 3300006353 Bacteria 3140
393 Ga0075370_10033031 3300006353 Bacteria 2895
394 Ga0075370_10046266 3300006353 Bacteria 2462
395 Ga0075370_10143710 3300006353 Bacteria 1395
396 Ga0075370_10153453 3300006353 Bacteria 1350
397 Ga0075370_10271115 3300006353 Bacteria 1007
398 Ga0068871_100038545 3300006358 Bacteria 3818
399 Ga0068871_100087983 3300006358 Bacteria 2584
400 Ga0068871_101086503 3300006358 Bacteria 748
401 Ga0075428_100002313 3300006844 Bacteria 20641
402 Ga0075428_100003267 3300006844 Bacteria 17744
403 Ga0075428_100313185 3300006844 Bacteria 1687
404 Ga0075428_100511938 3300006844 Bacteria 1284
405 Ga0075430_100026976 3300006846 Bacteria 4885
406 Ga0075430_100085218 3300006846 Bacteria 2646
407 Ga0075430_100319826 3300006846 Bacteria 1283
408 Ga0075430_100364668 3300006846 Bacteria 1193
409 Ga0075431_100080055 3300006847 Bacteria 3373
410 Ga0075431_100344471 3300006847 Bacteria 1499
411 Ga0075431_100466461 3300006847 Bacteria 1257
412 Ga0075433_10122705 3300006852 Bacteria 2307
413 Ga0075434_100006814 3300006871 Bacteria 10509
414 Ga0075434_100279263 3300006871 Bacteria 1690
415 Ga0075429_100025079 3300006880 Bacteria 5176
416 Ga0075429_100367337 3300006880 Bacteria 1260
417 Ga0075429_100380344 3300006880 Bacteria 1236
418 Ga0075429_100476280 3300006880 Bacteria 1094
419 Ga0068865_100001938 3300006881 Bacteria 12186
420 Ga0068865_100018082 3300006881 Bacteria 4543
421 Ga0068865_100173594 3300006881 Bacteria 1654
422 Ga0068865_100601684 3300006881 Bacteria 929
423 Ga0075436_100312156 3300006914 Bacteria 1128
424 Ga0097620_100000322 3300006931 Bacteria 47705
425 Ga0097620_100012772 3300006931 Bacteria 8439
426 Ga0097620_100026034 3300006931 Bacteria 5869
427 Ga0097620_100054218 3300006931 Bacteria 4031
428 Ga0097620_100117994 3300006931 Bacteria 2719
429 Ga0097620_100197673 3300006931 Bacteria 2095
430 Ga0097620_100295268 3300006931 Bacteria 1714
431 Ga0075435_100035449 3300007076 Bacteria 3960
432 Ga0075435_100158270 3300007076 Bacteria 1907
433 Ga0075435_100563921 3300007076 Bacteria 987
434 Ga0105251_10092208 3300009011 Bacteria 1391
435 Ga0105251_10151879 3300009011 Bacteria 1046
436 Ga0105251_10261121 3300009011 Bacteria 781
437 Ga0105250_10041633 3300009092 Bacteria 1841
438 Ga0105250_10093203 3300009092 Bacteria 1226
439 Ga0105240_10040558 3300009093 Bacteria 5953
440 Ga0105240_10251183 3300009093 Bacteria 2045
441 Ga0105240_10859993 3300009093 Bacteria 978
442 Ga0111539_10002971 3300009094 Bacteria 22494
443 Ga0111539_10070908 3300009094 Bacteria 4113
444 Ga0111539_10113639 3300009094 Bacteria 3176
445 Ga0111539_10521576 3300009094 Bacteria 1384
446 Ga0105245_10001497 3300009098 Bacteria 21134
447 Ga0105245_10048809 3300009098 Bacteria 3788
448 Ga0105245_10121552 3300009098 Bacteria 2440
449 Ga0105245_10144613 3300009098 Bacteria 2243
450 Ga0105245_10235375 3300009098 Bacteria 1773
451 Ga0105245_10382883 3300009098 Bacteria 1401
452 Ga0105245_10516402 3300009098 Bacteria 1212
453 Ga0105245_10529904 3300009098 Bacteria 1197
454 Ga0105245_10648670 3300009098 Bacteria 1086
455 Ga0105247_10000232 3300009101 Bacteria 53113
456 Ga0105247_10000754 3300009101 Bacteria 25001
457 Ga0105247_10002255 3300009101 Bacteria 13260
458 Ga0105247_10023618 3300009101 Bacteria 3705
459 Ga0105247_10074245 3300009101 Bacteria 2132
460 Ga0105247_10142034 3300009101 Bacteria 1574
461 Ga0105247_10214382 3300009101 Bacteria 1300
462 Ga0105247_10232005 3300009101 Bacteria 1254
463 Ga0105247_10381038 3300009101 Bacteria 1000
464 Ga0105247_10469860 3300009101 Bacteria 911
465 Ga0114129_10000007 3300009147 Bacteria 156645
466 Ga0114129_10015755 3300009147 Bacteria 10747
467 Ga0114129_10058537 3300009147 Bacteria 5389
468 Ga0114129_10140232 3300009147 Bacteria 3314
469 Ga0114129_10399851 3300009147 Bacteria 1810
470 Ga0114129_10595628 3300009147 Bacteria 1433
471 Ga0114129_11508375 3300009147 Bacteria 826
472 Ga0105243_10008326 3300009148 Bacteria 7965
473 Ga0105243_10011814 3300009148 Bacteria 6604
474 Ga0105243_10084722 3300009148 Bacteria 2596
475 Ga0105243_10213194 3300009148 Bacteria 1702
476 Ga0105243_10719281 3300009148 Bacteria 975
477 Ga0105241_10067727 3300009174 Bacteria 2764
478 Ga0105241_10137038 3300009174 Bacteria 1989
479 Ga0105241_10153526 3300009174 Bacteria 1886
480 Ga0105241_10173812 3300009174 Bacteria 1781
481 Ga0105241_10253361 3300009174 Bacteria 1493
482 Ga0105242_10000231 3300009176 Bacteria 43931
483 Ga0105242_10035233 3300009176 Bacteria 4014
484 Ga0105242_10162856 3300009176 Bacteria 1954
485 Ga0105242_10743525 3300009176 Bacteria 965
486 Ga0105248_10000074 3300009177 Bacteria 114554
487 Ga0105248_10001522 3300009177 Bacteria 25802
488 Ga0105248_10026214 3300009177 Bacteria 6486
489 Ga0105248_10031011 3300009177 Bacteria 5974
490 Ga0105248_10138265 3300009177 Bacteria 2748
491 Ga0105248_10142666 3300009177 Bacteria 2702
492 Ga0105248_10226065 3300009177 Bacteria 2106
493 Ga0105248_10613528 3300009177 Bacteria 1227
494 Ga0105237_10000346 3300009545 Bacteria 65318
495 Ga0105237_10029171 3300009545 Bacteria 5612
496 Ga0105237_10037080 3300009545 Bacteria 4929
497 Ga0105237_10158544 3300009545 Bacteria 2260
498 Ga0105237_10443456 3300009545 Bacteria 1304
499 Ga0105237_10517556 3300009545 Bacteria 1200
500 Ga0105237_10967305 3300009545 Bacteria 858
501 Ga0105238_10020202 3300009551 Bacteria 6779
502 Ga0105238_10070194 3300009551 Bacteria 3503
503 Ga0105238_10316347 3300009551 Bacteria 1546
504 Ga0105238_10372256 3300009551 Bacteria 1419
505 Ga0105238_10420448 3300009551 Bacteria 1331
506 Ga0105238_10636139 3300009551 Bacteria 1076
507 Ga0105238_10759295 3300009551 Bacteria 984
508 Ga0105238_10916429 3300009551 Bacteria 895
509 Ga0105238_11367468 3300009551 Bacteria 735
510 Ga0105249_10000011 3300009553 Bacteria 292812
511 Ga0105249_10004109 3300009553 Bacteria 12567
512 Ga0105249_10010083 3300009553 Bacteria 8293
513 Ga0105249_10119493 3300009553 Bacteria 2503
514 Ga0105249_10242691 3300009553 Bacteria 1782
515 Ga0105249_10246958 3300009553 Bacteria 1767
516 Ga0105249_10368138 3300009553 Bacteria 1460
517 Ga0105249_10487925 3300009553 Bacteria 1276
518 Ga0105249_10948645 3300009553 Bacteria 928
519 Ga0105032_105112 3300009979 Bacteria 1106
520 Ga0105029_100136 3300009984 Bacteria 3653
521 Ga0105035_101949 3300009988 Bacteria 1483
522 Ga0105239_10003686 3300010375 Bacteria 18677
523 Ga0105239_10018741 3300010375 Bacteria 7645
524 Ga0105239_10084332 3300010375 Bacteria 3499
525 Ga0105239_10221791 3300010375 Bacteria 2120
526 Ga0105239_10256025 3300010375 Bacteria 1966
527 Ga0105239_10276407 3300010375 Bacteria 1890
528 Ga0105239_10342119 3300010375 Bacteria 1688
529 Ga0105239_10525655 3300010375 Bacteria 1346
530 Ga0105239_10882243 3300010375 Bacteria 1026
531 Ga0105239_10914610 3300010375 Bacteria 1007
532 Ga0105246_10005154 3300011119 Bacteria 7938
533 Ga0105246_10014706 3300011119 Bacteria 4927
534 Ga0105246_10104010 3300011119 Bacteria 2073
535 Ga0105246_10294995 3300011119 Bacteria 1306
536 Ga0105246_10488445 3300011119 Bacteria 1043
537 Ga0157323_1004315 3300012495 Bacteria 903
538 Ga0157347_1005832 3300012502 Bacteria 1187
539 Ga0154012_138397 3300013059 Bacteria 725
540 Ga0157373_10364109 3300013100 Bacteria 1032
541 Ga0157371_10034818 3300013102 Bacteria 3610
542 Ga0157371_10312917 3300013102 Bacteria 1138
543 Ga0157370_10020884 3300013104 Bacteria 6533
544 Ga0157370_10053602 3300013104 Bacteria 3845
545 Ga0157370_10069658 3300013104 Bacteria 3321
546 Ga0157370_10247308 3300013104 Bacteria 1650
547 Ga0157370_10556027 3300013104 Bacteria 1052
548 Ga0157370_10948379 3300013104 Bacteria 780
549 Ga0157369_10008553 3300013105 Bacteria 11737
550 Ga0157369_10074745 3300013105 Bacteria 3634
551 Ga0157369_10340893 3300013105 Bacteria 1557
552 Ga0157369_10618412 3300013105 Bacteria 1118
553 Ga0157369_11239925 3300013105 Bacteria 761
554 Ga0157374_10013939 3300013296 Bacteria 7025
555 Ga0157374_10100419 3300013296 Bacteria 2774
556 Ga0157374_10182704 3300013296 Bacteria 2049
557 Ga0157374_10295119 3300013296 Bacteria 1603
558 Ga0157374_10419078 3300013296 Bacteria 1337
559 Ga0157374_10512663 3300013296 Bacteria 1205
560 Ga0157374_10717581 3300013296 Bacteria 1013
561 Ga0157374_10812090 3300013296 Bacteria 951
562 Ga0157374_10979151 3300013296 Bacteria 865
563 Ga0157378_10001759 3300013297 Bacteria 19439
564 Ga0157378_10273058 3300013297 Bacteria 1627
565 Ga0157378_10752387 3300013297 Bacteria 997
566 Ga0157378_11011475 3300013297 Bacteria 866
567 Ga0163162_10001663 3300013306 Bacteria 20846
568 Ga0163162_10063442 3300013306 Bacteria 3737
569 Ga0163162_10106362 3300013306 Bacteria 2901
570 Ga0163162_10203582 3300013306 Bacteria 2108
571 Ga0163162_10293884 3300013306 Bacteria 1756
572 Ga0163162_10448195 3300013306 Bacteria 1423
573 Ga0163162_11332066 3300013306 Bacteria 816
574 Ga0157372_10003438 3300013307 Bacteria 17085
575 Ga0157372_10114864 3300013307 Bacteria 3086
576 Ga0157372_10240053 3300013307 Bacteria 2103
577 Ga0157372_10325276 3300013307 Bacteria 1790
578 Ga0157372_10815225 3300013307 Bacteria 1084
579 Ga0157372_11370791 3300013307 Bacteria 815
580 Ga0157375_10000224 3300013308 Bacteria 53395
581 Ga0157375_10075779 3300013308 Bacteria 3389
582 Ga0157375_10101666 3300013308 Bacteria 2958
583 Ga0157375_10196752 3300013308 Bacteria 2171
584 Ga0157375_10206687 3300013308 Bacteria 2120
585 Ga0157375_10231543 3300013308 Bacteria 2007
586 Ga0157375_11962545 3300013308 Bacteria 695
587 Ga0157515_159099 3300013875 Bacteria 1474
588 Ga0163163_10006085 3300014325 Bacteria 10502
589 Ga0163163_10034724 3300014325 Bacteria 4886
590 Ga0163163_10051315 3300014325 Bacteria 4067
591 Ga0163163_10063624 3300014325 Bacteria 3658
592 Ga0163163_10079214 3300014325 Bacteria 3284
593 Ga0163163_10086811 3300014325 Bacteria 3138
594 Ga0163163_10215661 3300014325 Bacteria 1968
595 Ga0163163_10253264 3300014325 Bacteria 1811
596 Ga0163163_10263408 3300014325 Bacteria 1775
597 Ga0157380_10000982 3300014326 Bacteria 18112
598 Ga0157380_10072752 3300014326 Bacteria 2785
599 Ga0157380_10274460 3300014326 Bacteria 1539
600 Ga0157380_10373791 3300014326 Bacteria 1342
601 Ga0157380_11194639 3300014326 Bacteria 804
602 Ga0182008_10109855 3300014497 Bacteria 1366
603 Ga0182008_10197311 3300014497 Bacteria 1023
604 Ga0157377_10029831 3300014745 Bacteria 2949
605 Ga0157377_10094235 3300014745 Bacteria 1773
606 Ga0157377_10223554 3300014745 Bacteria 1207
607 Ga0157379_10018243 3300014968 Bacteria 6184
608 Ga0157379_10019041 3300014968 Bacteria 6060
609 Ga0157379_10022891 3300014968 Bacteria 5539
610 Ga0157379_10043277 3300014968 Bacteria 4020
611 Ga0157379_10058626 3300014968 Bacteria 3443
612 Ga0157379_10133902 3300014968 Bacteria 2232
613 Ga0157379_10152763 3300014968 Bacteria 2083
614 Ga0157376_10019006 3300014969 Bacteria 5285
615 Ga0157376_10066089 3300014969 Bacteria 3056
616 Ga0157376_10129112 3300014969 Bacteria 2252
617 Ga0157376_10760586 3300014969 Bacteria 979
618 Ga0157376_11008650 3300014969 Bacteria 855
619 Ga0163161_10001626 3300017792 Bacteria 16525
620 Ga0163161_10027585 3300017792 Bacteria 4030
621 Ga0163161_10293028 3300017792 Bacteria 1279
622 Ga0163161_10324724 3300017792 Bacteria 1217
623 Ga0163161_10490299 3300017792 Bacteria 999
624 Ga0163161_10571994 3300017792 Bacteria 928
625 Ga0206356_10320805 3300020070 Bacteria 831
626 Ga0206356_10609702 3300020070 Bacteria 648
627 Ga0206356_11194379 3300020070 Bacteria 800
628 Ga0206356_11324533 3300020070 Bacteria 2338
629 Ga0206349_1101175 3300020075 Bacteria 3666
630 Ga0206349_1679340 3300020075 Bacteria 790
631 Ga0206355_1552033 3300020076 Bacteria 930
632 Ga0206351_10158893 3300020077 Bacteria 771
633 Ga0206351_10874777 3300020077 Bacteria 2539
634 Ga0206350_10331501 3300020080 Bacteria 829
635 Ga0206350_11237489 3300020080 Bacteria 1090
636 Ga0206354_10283692 3300020081 Bacteria 1498
637 Ga0206354_10311176 3300020081 Bacteria 930
638 Ga0206354_10683940 3300020081 Bacteria 899
639 Ga0206354_11633010 3300020081 Bacteria 834
640 Ga0206353_10505886 3300020082 Bacteria 1787
641 Ga0206353_11472539 3300020082 Bacteria 1144
642 Ga0206353_11490980 3300020082 Bacteria 824
643 Ga0213874_10134824 3300021377 Bacteria 851
644 Ga0213876_10006113 3300021384 Bacteria 6578
645 Ga0213876_10026227 3300021384 Bacteria 3074
646 Ga0213876_10073349 3300021384 Bacteria 1807
647 Ga0213875_10034968 3300021388 Bacteria 2371
648 Ga0213875_10048694 3300021388 Bacteria 1988
649 Ga0224712_10003696 3300022467 Bacteria 4017
650 Ga0224712_10006549 3300022467 Bacteria 3332
651 Ga0224712_10013485 3300022467 Bacteria 2604
652 Ga0224712_10184953 3300022467 Bacteria 941
653 Ga0209673_1023554 3300025273 Bacteria 2092
654 Ga0209051_1000374 3300025303 Bacteria 64311
655 Ga0209051_1001965 3300025303 Bacteria 15801
656 Ga0209051_1013246 3300025303 Bacteria 3936
657 Ga0207697_10111758 3300025315 Bacteria 1170
658 Ga0207656_10044127 3300025321 Bacteria 1903
659 Ga0207656_10143703 3300025321 Bacteria 1126
660 Ga0207713_1083306 3300025735 Bacteria 1144
661 Ga0207653_10030127 3300025885 Bacteria 1750
662 Ga0207692_10032636 3300025898 Bacteria 2504
663 Ga0207692_10103380 3300025898 Bacteria 1568
664 Ga0207692_10143161 3300025898 Bacteria 1362
665 Ga0207692_10484039 3300025898 Bacteria 783
666 Ga0207642_10000155 3300025899 Bacteria 19520
667 Ga0207642_10009846 3300025899 Bacteria 3342
668 Ga0207642_10160828 3300025899 Bacteria 1205
669 Ga0207642_10231778 3300025899 Bacteria 1038
670 Ga0207642_10309104 3300025899 Bacteria 919
671 Ga0207710_10000020 3300025900 Bacteria 338425
672 Ga0207710_10000022 3300025900 Bacteria 335632
673 Ga0207710_10003009 3300025900 Bacteria 7593
674 Ga0207710_10011357 3300025900 Bacteria 3750
675 Ga0207710_10100678 3300025900 Bacteria 1362
676 Ga0207710_10158017 3300025900 Bacteria 1103
677 Ga0207688_10000095 3300025901 Bacteria 34618
678 Ga0207688_10006812 3300025901 Bacteria 6218
679 Ga0207688_10009895 3300025901 Bacteria 5191
680 Ga0207688_10010258 3300025901 Bacteria 5099
681 Ga0207688_10091161 3300025901 Bacteria 1751
682 Ga0207688_10157693 3300025901 Bacteria 1344
683 Ga0207688_10213715 3300025901 Bacteria 1160
684 Ga0207688_10403576 3300025901 Bacteria 848
685 Ga0207688_10550655 3300025901 Bacteria 725
686 Ga0207680_10026861 3300025903 Bacteria 3196
687 Ga0207680_10071602 3300025903 Bacteria 2150
688 Ga0207647_10033517 3300025904 Bacteria 3288
689 Ga0207647_10039238 3300025904 Bacteria 2989
690 Ga0207647_10143987 3300025904 Bacteria 1396
691 Ga0207685_10000516 3300025905 Bacteria 6604
692 Ga0207685_10033102 3300025905 Bacteria 1866
693 Ga0207685_10034708 3300025905 Bacteria 1835
694 Ga0207685_10257978 3300025905 Bacteria 846
695 Ga0207699_10028451 3300025906 Bacteria 3106
696 Ga0207699_10470143 3300025906 Bacteria 904
697 Ga0207699_10549992 3300025906 Bacteria 837
698 Ga0207645_10019743 3300025907 Bacteria 4415
699 Ga0207645_10030865 3300025907 Bacteria 3453
700 Ga0207645_10268193 3300025907 Bacteria 1132
701 Ga0207643_10043313 3300025908 Bacteria 2540
702 Ga0207643_10252020 3300025908 Bacteria 1088
703 Ga0207705_10235709 3300025909 Bacteria 1393
704 Ga0207684_10770789 3300025910 Bacteria 814
705 Ga0207654_10345848 3300025911 Bacteria 1023
706 Ga0207707_10311867 3300025912 Bacteria 1359
707 Ga0207707_10340241 3300025912 Bacteria 1294
708 Ga0207695_10146181 3300025913 Bacteria 2308
709 Ga0207695_10313744 3300025913 Bacteria 1458
710 Ga0207671_10111365 3300025914 Bacteria 2083
711 Ga0207671_10162404 3300025914 Bacteria 1731
712 Ga0207671_10210733 3300025914 Bacteria 1520
713 Ga0207671_10366451 3300025914 Bacteria 1144
714 Ga0207671_10836998 3300025914 Bacteria 729
715 Ga0207693_10001452 3300025915 Bacteria 20987
716 Ga0207693_10004541 3300025915 Bacteria 11721
717 Ga0207693_10030184 3300025915 Bacteria 4281
718 Ga0207693_10111744 3300025915 Bacteria 2143
719 Ga0207693_10154825 3300025915 Bacteria 1803
720 Ga0207693_10179438 3300025915 Bacteria 1666
721 Ga0207693_10948713 3300025915 Bacteria 658
722 Ga0207663_10004097 3300025916 Bacteria 7228
723 Ga0207663_10007436 3300025916 Bacteria 5679
724 Ga0207663_10054188 3300025916 Bacteria 2510
725 Ga0207663_10095605 3300025916 Bacteria 1982
726 Ga0207660_10437931 3300025917 Bacteria 1056
727 Ga0207660_10471114 3300025917 Bacteria 1017
728 Ga0207660_10965274 3300025917 Bacteria 695
729 Ga0207662_10025029 3300025918 Bacteria 3437
730 Ga0207662_10224846 3300025918 Bacteria 1223
731 Ga0207662_10237631 3300025918 Bacteria 1192
732 Ga0207657_10064733 3300025919 Bacteria 3120
733 Ga0207657_10087284 3300025919 Bacteria 2610
734 Ga0207657_10144460 3300025919 Bacteria 1942
735 Ga0207657_10374611 3300025919 Bacteria 1121
736 Ga0207657_10492695 3300025919 Bacteria 960
737 Ga0207649_10046561 3300025920 Bacteria 2665
738 Ga0207649_10307160 3300025920 Bacteria 1161
739 Ga0207652_10378499 3300025921 Bacteria 1278
740 Ga0207652_10600323 3300025921 Bacteria 987
741 Ga0207681_10002378 3300025923 Bacteria 11963
742 Ga0207681_10013715 3300025923 Bacteria 5019
743 Ga0207681_10068786 3300025923 Bacteria 2461
744 Ga0207681_10124062 3300025923 Bacteria 1899
745 Ga0207681_10375108 3300025923 Bacteria 1144
746 Ga0207681_10473438 3300025923 Bacteria 1022
747 Ga0207694_10052539 3300025924 Bacteria 3159
748 Ga0207694_10236226 3300025924 Bacteria 1493
749 Ga0207694_10295833 3300025924 Bacteria 1332
750 Ga0207694_10746927 3300025924 Bacteria 826
751 Ga0207694_10792707 3300025924 Bacteria 800
752 Ga0207650_10499409 3300025925 Bacteria 1016
753 Ga0207650_11125963 3300025925 Bacteria 668
754 Ga0207659_10019575 3300025926 Bacteria 4459
755 Ga0207659_10067037 3300025926 Bacteria 2607
756 Ga0207659_10558253 3300025926 Bacteria 974
757 Ga0207687_10001864 3300025927 Bacteria 14520
758 Ga0207687_10042684 3300025927 Bacteria 3122
759 Ga0207687_10074366 3300025927 Bacteria 2435
760 Ga0207687_10119978 3300025927 Bacteria 1965
761 Ga0207687_10207944 3300025927 Bacteria 1534
762 Ga0207687_10357049 3300025927 Bacteria 1192
763 Ga0207687_10502793 3300025927 Bacteria 1012
764 Ga0207687_10800352 3300025927 Bacteria 804
765 Ga0207700_10107389 3300025928 Bacteria 2240
766 Ga0207700_10129377 3300025928 Bacteria 2059
767 Ga0207700_10186884 3300025928 Bacteria 1739
768 Ga0207700_10348725 3300025928 Bacteria 1289
769 Ga0207664_10000074 3300025929 Bacteria 102862
770 Ga0207664_10031253 3300025929 Bacteria 4072
771 Ga0207664_10144357 3300025929 Bacteria 2017
772 Ga0207664_10156219 3300025929 Bacteria 1942
773 Ga0207664_10372009 3300025929 Bacteria 1267
774 Ga0207664_10409549 3300025929 Bacteria 1207
775 Ga0207644_10066402 3300025931 Bacteria 2627
776 Ga0207644_10082211 3300025931 Bacteria 2382
777 Ga0207644_10327493 3300025931 Bacteria 1240
778 Ga0207644_10356175 3300025931 Bacteria 1189
779 Ga0207644_10401845 3300025931 Bacteria 1120
780 Ga0207644_10615829 3300025931 Bacteria 902
781 Ga0207690_10030138 3300025932 Bacteria 3457
782 Ga0207690_10050180 3300025932 Bacteria 2785
783 Ga0207690_10107286 3300025932 Bacteria 2005
784 Ga0207690_10180512 3300025932 Bacteria 1589
785 Ga0207690_10774498 3300025932 Bacteria 792
786 Ga0207706_10003964 3300025933 Bacteria 14024
787 Ga0207706_10016395 3300025933 Bacteria 6690
788 Ga0207706_10035096 3300025933 Bacteria 4461
789 Ga0207706_10187871 3300025933 Bacteria 1814
790 Ga0207706_10287298 3300025933 Bacteria 1434
791 Ga0207686_10001659 3300025934 Bacteria 12400
792 Ga0207686_10039896 3300025934 Bacteria 2851
793 Ga0207686_10239222 3300025934 Bacteria 1320
794 Ga0207686_10886648 3300025934 Bacteria 719
795 Ga0207709_10004864 3300025935 Bacteria 7686
796 Ga0207709_10014569 3300025935 Bacteria 4344
797 Ga0207709_10082435 3300025935 Bacteria 2077
798 Ga0207709_10340538 3300025935 Bacteria 1129
799 Ga0207670_10087172 3300025936 Bacteria 2199
800 Ga0207670_10343258 3300025936 Bacteria 1180
801 Ga0207670_10379305 3300025936 Bacteria 1126
802 Ga0207670_10422275 3300025936 Bacteria 1070
803 Ga0207669_10000776 3300025937 Bacteria 13681
804 Ga0207669_10103731 3300025937 Bacteria 1887
805 Ga0207704_10000975 3300025938 Bacteria 12683
806 Ga0207704_10116158 3300025938 Bacteria 1820
807 Ga0207704_10499569 3300025938 Bacteria 980
808 Ga0207704_10601388 3300025938 Bacteria 900
809 Ga0207704_10729964 3300025938 Bacteria 822
810 Ga0207665_10001259 3300025939 Bacteria 17081
811 Ga0207665_10002831 3300025939 Bacteria 11639
812 Ga0207665_10027039 3300025939 Bacteria 3790
813 Ga0207665_10043459 3300025939 Bacteria 3004
814 Ga0207665_10229741 3300025939 Bacteria 1363
815 Ga0207691_10024110 3300025940 Bacteria 5722
816 Ga0207691_10156345 3300025940 Bacteria 2002
817 Ga0207691_10412377 3300025940 Bacteria 1151
818 Ga0207711_10001226 3300025941 Bacteria 24313
819 Ga0207711_10005726 3300025941 Bacteria 10485
820 Ga0207711_10016831 3300025941 Bacteria 6071
821 Ga0207711_10030901 3300025941 Bacteria 4518
822 Ga0207711_10170341 3300025941 Bacteria 1975
823 Ga0207711_10292285 3300025941 Bacteria 1502
824 Ga0207711_10344703 3300025941 Bacteria 1379
825 Ga0207689_10007467 3300025942 Bacteria 9583
826 Ga0207689_10010648 3300025942 Bacteria 7915
827 Ga0207689_10021484 3300025942 Bacteria 5426
828 Ga0207689_10032301 3300025942 Bacteria 4355
829 Ga0207689_10038813 3300025942 Bacteria 3943
830 Ga0207689_10147339 3300025942 Bacteria 1939
831 Ga0207689_10154308 3300025942 Bacteria 1893
832 Ga0207689_10400778 3300025942 Bacteria 1144
833 Ga0207689_10593394 3300025942 Bacteria 932
834 Ga0207661_10041824 3300025944 Bacteria 3610
835 Ga0207661_10072243 3300025944 Bacteria 2822
836 Ga0207661_10194886 3300025944 Bacteria 1778
837 Ga0207661_10298493 3300025944 Bacteria 1444
838 Ga0207661_10793320 3300025944 Bacteria 872
839 Ga0207679_10029260 3300025945 Bacteria 3834
840 Ga0207679_10147745 3300025945 Bacteria 1909
841 Ga0207667_10048853 3300025949 Bacteria 4472
842 Ga0207667_10127042 3300025949 Bacteria 2626
843 Ga0207667_10277181 3300025949 Bacteria 1714
844 Ga0207667_10292669 3300025949 Bacteria 1664
845 Ga0207667_10566676 3300025949 Bacteria 1148
846 Ga0207651_10266346 3300025960 Bacteria 1409
847 Ga0207651_10319122 3300025960 Bacteria 1298
848 Ga0207712_10000020 3300025961 Bacteria 292796
849 Ga0207712_10011015 3300025961 Bacteria 5758
850 Ga0207712_10032064 3300025961 Bacteria 3544
851 Ga0207712_10100044 3300025961 Bacteria 2154
852 Ga0207712_10209839 3300025961 Bacteria 1550
853 Ga0207712_10228263 3300025961 Bacteria 1493
854 Ga0207712_10244011 3300025961 Bacteria 1448
855 Ga0207668_10003428 3300025972 Bacteria 9299
856 Ga0207668_10012870 3300025972 Bacteria 5134
857 Ga0207668_10051507 3300025972 Bacteria 2844
858 Ga0207668_10177251 3300025972 Bacteria 1678
859 Ga0207668_10382204 3300025972 Bacteria 1185
860 Ga0207668_11041429 3300025972 Bacteria 732
861 Ga0207640_10027752 3300025981 Bacteria 3453
862 Ga0207640_10082918 3300025981 Bacteria 2197
863 Ga0207640_10096021 3300025981 Bacteria 2065
864 Ga0207640_10169577 3300025981 Bacteria 1625
865 Ga0207640_10187332 3300025981 Bacteria 1557
866 Ga0207640_10192597 3300025981 Bacteria 1538
867 Ga0207640_10507895 3300025981 Bacteria 1005
868 Ga0207658_10000284 3300025986 Bacteria 53042
869 Ga0207658_10010717 3300025986 Bacteria 6232
870 Ga0207658_10035394 3300025986 Bacteria 3576
871 Ga0207658_10039649 3300025986 Bacteria 3399
872 Ga0207658_10083706 3300025986 Bacteria 2453
873 Ga0207658_10098142 3300025986 Bacteria 2288
874 Ga0207658_10247903 3300025986 Bacteria 1512
875 Ga0207658_10319633 3300025986 Bacteria 1343
876 Ga0207677_10006064 3300026023 Bacteria 6593
877 Ga0207677_10039091 3300026023 Bacteria 3116
878 Ga0207677_10054785 3300026023 Bacteria 2723
879 Ga0207677_10083344 3300026023 Bacteria 2301
880 Ga0207677_10187276 3300026023 Bacteria 1634
881 Ga0207677_10215975 3300026023 Bacteria 1535
882 Ga0207703_10000006 3300026035 Bacteria 502351
883 Ga0207703_10010248 3300026035 Bacteria 7344
884 Ga0207703_10022654 3300026035 Bacteria 4931
885 Ga0207703_10024649 3300026035 Bacteria 4733
886 Ga0207703_10425002 3300026035 Bacteria 1237
887 Ga0207703_10482228 3300026035 Bacteria 1162
888 Ga0207703_10602143 3300026035 Bacteria 1039
889 Ga0207639_10007554 3300026041 Bacteria 7414
890 Ga0207639_10025966 3300026041 Bacteria 4252
891 Ga0207639_10027838 3300026041 Bacteria 4121
892 Ga0207639_10131120 3300026041 Bacteria 2075
893 Ga0207639_10911047 3300026041 Bacteria 822
894 Ga0207678_10003538 3300026067 Bacteria 14057
895 Ga0207678_10007863 3300026067 Bacteria 9410
896 Ga0207678_10027419 3300026067 Bacteria 4968
897 Ga0207678_10038475 3300026067 Bacteria 4156
898 Ga0207678_10162454 3300026067 Bacteria 1907
899 Ga0207678_10332701 3300026067 Bacteria 1308
900 Ga0207678_10385380 3300026067 Bacteria 1212
901 Ga0207678_10408279 3300026067 Bacteria 1177
902 Ga0207708_10004788 3300026075 Bacteria 9967
903 Ga0207708_10011878 3300026075 Bacteria 6487
904 Ga0207708_10017706 3300026075 Bacteria 5362
905 Ga0207708_10069802 3300026075 Bacteria 2690
906 Ga0207708_10078273 3300026075 Bacteria 2538
907 Ga0207702_10147966 3300026078 Bacteria 2133
908 Ga0207702_11016675 3300026078 Bacteria 822
909 Ga0207702_11045753 3300026078 Bacteria 810
910 Ga0207702_11403425 3300026078 Bacteria 692
911 Ga0207641_10003733 3300026088 Bacteria 13389
912 Ga0207641_10004747 3300026088 Bacteria 11717
913 Ga0207641_10047120 3300026088 Bacteria 3634
914 Ga0207641_10066764 3300026088 Bacteria 3079
915 Ga0207641_10114345 3300026088 Bacteria 2398
916 Ga0207641_10150664 3300026088 Bacteria 2106
917 Ga0207641_10421622 3300026088 Bacteria 1285
918 Ga0207641_10735255 3300026088 Bacteria 973
919 Ga0207641_10755041 3300026088 Bacteria 960
920 Ga0207641_11157933 3300026088 Bacteria 772
921 Ga0207648_10000501 3300026089 Bacteria 43662
922 Ga0207648_10017364 3300026089 Bacteria 6551
923 Ga0207648_10613103 3300026089 Bacteria 1004
924 Ga0207648_10998676 3300026089 Bacteria 784
925 Ga0207676_10032131 3300026095 Bacteria 3953
926 Ga0207676_10045115 3300026095 Bacteria 3404
927 Ga0207676_10120092 3300026095 Bacteria 2215
928 Ga0207676_10158335 3300026095 Bacteria 1959
929 Ga0207676_10201067 3300026095 Bacteria 1761
930 Ga0207676_10218318 3300026095 Bacteria 1696
931 Ga0207676_10223543 3300026095 Bacteria 1678
932 Ga0207676_10322566 3300026095 Bacteria 1418
933 Ga0207676_10528570 3300026095 Bacteria 1124
934 Ga0207674_10003917 3300026116 Bacteria 18111
935 Ga0207674_10033808 3300026116 Bacteria 5350
936 Ga0207674_10036524 3300026116 Bacteria 5117
937 Ga0207674_10098826 3300026116 Bacteria 2902
938 Ga0207674_10099507 3300026116 Bacteria 2890
939 Ga0207674_10109735 3300026116 Bacteria 2735
940 Ga0207674_10115673 3300026116 Bacteria 2654
941 Ga0207674_10168463 3300026116 Bacteria 2144
942 Ga0207674_10173618 3300026116 Bacteria 2108
943 Ga0207674_10443368 3300026116 Bacteria 1255
944 Ga0207675_100009125 3300026118 Bacteria 9305
945 Ga0207675_100020710 3300026118 Bacteria 6131
946 Ga0207675_100063512 3300026118 Bacteria 3450
947 Ga0207675_100411934 3300026118 Bacteria 1334
948 Ga0207675_100421020 3300026118 Bacteria 1319
949 Ga0207675_100628611 3300026118 Bacteria 1079
950 Ga0207683_10000161 3300026121 Bacteria 56865
951 Ga0207683_10021923 3300026121 Bacteria 5480
952 Ga0207683_10039876 3300026121 Bacteria 4097
953 Ga0207683_10092671 3300026121 Bacteria 2692
954 Ga0207683_10273809 3300026121 Bacteria 1542
955 Ga0207683_10715202 3300026121 Bacteria 929
956 Ga0207698_10035735 3300026142 Bacteria 3639
957 Ga0207698_10190210 3300026142 Bacteria 1827
958 Ga0207698_10251834 3300026142 Bacteria 1616
959 Ga0207698_10288884 3300026142 Bacteria 1521
960 Ga0207698_10460334 3300026142 Bacteria 1230
961 Ga0207698_10504066 3300026142 Bacteria 1178
962 Ga0207698_10687342 3300026142 Bacteria 1017
963 Ga0207428_10033341 3300027907 Bacteria 4230
964 Ga0268266_10014275 3300028379 Bacteria 6831
965 Ga0268266_10544809 3300028379 Bacteria 1111
966 Ga0268266_10988059 3300028379 Bacteria 814
967 Ga0268265_10000004 3300028380 Bacteria 648376
968 Ga0268265_10000019 3300028380 Bacteria 285487
969 Ga0268265_10003934 3300028380 Bacteria 10466
970 Ga0268265_10085121 3300028380 Bacteria 2508
971 Ga0268265_10106101 3300028380 Bacteria 2281
972 Ga0268265_10317703 3300028380 Bacteria 1409
973 Ga0268265_10369387 3300028380 Bacteria 1316
974 Ga0268265_10673944 3300028380 Bacteria 996
975 Ga0268265_11518236 3300028380 Bacteria 674
976 Ga0268264_10000024 3300028381 Bacteria 470081
977 Ga0268264_10001207 3300028381 Bacteria 24883
978 Ga0268264_10008659 3300028381 Bacteria 8453
979 Ga0268264_10084728 3300028381 Bacteria 2718
980 Ga0268264_10149039 3300028381 Bacteria 2096
981 Ga0268264_10550757 3300028381 Bacteria 1131
982 Ga0268264_10636906 3300028381 Bacteria 1054
983 Ga0268264_11163093 3300028381 Bacteria 781
984 Ga0307517_10124059 3300028786 Bacteria 1894
985 Ga0307515_10000045 3300028794 Bacteria 301029
986 Ga0307515_10011360 3300028794 Bacteria 16902
987 Ga0307515_10036083 3300028794 Bacteria 8014
988 Ga0307515_10172678 3300028794 Bacteria 2147
989 Ga0307515_10175778 3300028794 Bacteria 2113
990 Ga0307515_10202474 3300028794 Bacteria 1856
991 Ga0307515_10271514 3300028794 Bacteria 1416
992 Ga0307515_10428718 3300028794 Bacteria 941
993 Ga0265338_10208813 3300028800 Bacteria 1467
994 Ga0307512_10005147 3300030522 Bacteria 13817
995 Ga0307512_10029915 3300030522 Bacteria 4746
996 Ga0307512_10048863 3300030522 Bacteria 3419
997 Ga0307512_10103148 3300030522 Bacteria 1921
998 Ga0314311_1113337 3300030733 Bacteria 1099
999 Ga0316182_1195261 3300030745 Bacteria 1340
1000 Ga0265328_10015430 3300031239 Bacteria 2992
1001 Ga0307513_10000001 3300031456 Bacteria 1660464
1002 Ga0307513_10010865 3300031456 Bacteria 11372
1003 Ga0307513_10129993 3300031456 Bacteria 2466
1004 Ga0307513_10195918 3300031456 Bacteria 1866
1005 Ga0307509_10020244 3300031507 Bacteria 7555
1006 Ga0307509_10402196 3300031507 Bacteria 1076
1007 Ga0307408_100187190 3300031548 Bacteria 1665
1008 Ga0307408_100288348 3300031548 Bacteria 1370
1009 Ga0307408_100412233 3300031548 Bacteria 1163
1010 Ga0307508_10001514 3300031616 Bacteria 25941
1011 Ga0307508_10004695 3300031616 Bacteria 13238
1012 Ga0307508_10072499 3300031616 Bacteria 3019
1013 Ga0307516_10002608 3300031730 Bacteria 23942
1014 Ga0307516_10008621 3300031730 Bacteria 11503
1015 Ga0307516_10047355 3300031730 Bacteria 4236
1016 Ga0307516_10276451 3300031730 Bacteria 1363
1017 Ga0307516_10345340 3300031730 Bacteria 1154
1018 Ga0307405_10048752 3300031731 Bacteria 2614
1019 Ga0307405_10192186 3300031731 Bacteria 1475
1020 Ga0307405_10244687 3300031731 Bacteria 1331
1021 Ga0307405_10352243 3300031731 Bacteria 1136
1022 Ga0307413_10017913 3300031824 Bacteria 3702
1023 Ga0307413_10106691 3300031824 Bacteria 1865
1024 Ga0307413_10348922 3300031824 Bacteria 1141
1025 Ga0307413_10719035 3300031824 Bacteria 831
1026 Ga0307413_10830798 3300031824 Bacteria 779
1027 Ga0307410_10066701 3300031852 Bacteria 2480
1028 Ga0307410_10130313 3300031852 Bacteria 1847
1029 Ga0307410_10240715 3300031852 Bacteria 1402
1030 Ga0307410_10362644 3300031852 Bacteria 1161
1031 Ga0307410_10635081 3300031852 Bacteria 894
1032 Ga0307410_10794964 3300031852 Bacteria 804
1033 Ga0326468_10000995 3300031889 Bacteria 2708
1034 Ga0326468_10035108 3300031889 Bacteria 687
1035 Ga0307406_10055824 3300031901 Bacteria 2526
1036 Ga0307406_10109119 3300031901 Bacteria 1901
1037 Ga0307406_10332983 3300031901 Bacteria 1179
1038 Ga0307406_10390710 3300031901 Bacteria 1100
1039 Ga0307406_11080589 3300031901 Bacteria 692
1040 Ga0307407_10019680 3300031903 Bacteria 3442
1041 Ga0307407_10173572 3300031903 Bacteria 1422
1042 Ga0307407_10199424 3300031903 Bacteria 1340
1043 Ga0307407_10406436 3300031903 Bacteria 978
1044 Ga0307407_10447582 3300031903 Bacteria 937
1045 Ga0307412_10093639 3300031911 Bacteria 2108
1046 Ga0307412_10494437 3300031911 Bacteria 1017
1047 Ga0307409_100002006 3300031995 Bacteria 10448
1048 Ga0307409_100030641 3300031995 Bacteria 3868
1049 Ga0307409_100038809 3300031995 Bacteria 3526
1050 Ga0307409_100075937 3300031995 Bacteria 2693
1051 Ga0307409_100128104 3300031995 Bacteria 2163
1052 Ga0307409_100498193 3300031995 Bacteria 1186
1053 Ga0307409_101118998 3300031995 Bacteria 809
1054 Ga0307416_100003319 3300032002 Bacteria 9411
1055 Ga0307416_100040166 3300032002 Bacteria 3632
1056 Ga0307416_100331325 3300032002 Bacteria 1530
1057 Ga0307416_100492169 3300032002 Bacteria 1289
1058 Ga0307414_10253726 3300032004 Bacteria 1464
1059 Ga0307411_10122776 3300032005 Bacteria 1883
1060 Ga0307411_10383926 3300032005 Bacteria 1156
1061 Ga0307411_10701320 3300032005 Bacteria 882
1062 Ga0307411_11008333 3300032005 Bacteria 746
1063 Ga0307415_100000333 3300032126 Bacteria 20354
1064 Ga0307415_100018602 3300032126 Bacteria 4200
1065 Ga0307415_100052588 3300032126 Bacteria 2771
1066 Ga0307415_100099813 3300032126 Bacteria 2126
1067 Ga0307415_100269891 3300032126 Bacteria 1393
1068 Ga0307415_102052415 3300032126 Bacteria 557
1069 Ga0316593_10092232 3300032168 Bacteria 1067
1070 Ga0307507_10012883 3300033179 Bacteria 10256
1071 Ga0307510_10103011 3300033180 Bacteria 2633
1072 Ga0373930_0012677 3300034816 Bacteria 1542
1073 Ga0373938_0020687 3300034957 Bacteria 1328
1074 Ga0373926_0104616 3300035083 Bacteria 1060
1075 Ga0373928_0051543 3300035084 Bacteria 973
1076 Ga0373928_0061378 3300035084 Bacteria 910
1077 Ga0373944_0055315 3300035089 Bacteria 1260
1078 Ga0373951_0001290 3300035091 Bacteria 6623
1079 Ga0373951_0005095 3300035091 Bacteria 3070
1080 Ga0373952_0071351 3300035092 Bacteria 869
1081 Ga0373923_0115873 3300035111 Bacteria 1193
1082 Ga0373932_0024030 3300035112 Bacteria 1636
1083 Ga0373932_0047387 3300035112 Bacteria 1263
1084 Ga0373932_0092999 3300035112 Bacteria 971
1085 Ga0373936_0112008 3300035113 Bacteria 1159
1086 Ga0373939_0060161 3300035114 Bacteria 1207
1087 Ga0373939_0163637 3300035114 Bacteria 819
1088 Ga0373939_0173522 3300035114 Bacteria 799
1089 Ga0373941_0007127 3300035115 Bacteria 2724
1090 Ga0373945_0056445 3300035116 Bacteria 1456
1091 Ga0373953_0082825 3300035117 Bacteria 1335
1092 Ga0373954_0094880 3300035118 Bacteria 1436
1093 Ga0373954_0107458 3300035118 Bacteria 1348
1094 Ga0373956_0112945 3300035119 Bacteria 1265
1095 Ga0373957_0137350 3300035120 Bacteria 998
1096 Ga0373960_0020023 3300035121 Bacteria 1765
1097 Ga0373960_0026562 3300035121 Bacteria 1583
1098 Ga0373960_0085605 3300035121 Bacteria 1000
1099 Ga0373943_0063581 3300035170 Bacteria 1850
1100 Ga0373943_0388505 3300035170 Bacteria 804
1101 Ga0373946_0172120 3300035171 Bacteria 1023
1102 Ga0373955_0042730 3300035172 Bacteria 2435
1103 Ga0373955_0463670 3300035172 Bacteria 772
1104 Ga0373942_0000141 3300035207 Bacteria 17170
1105 Ga0373961_0019576 3300035241 Bacteria 1780
1106 Ga0373961_0032022 3300035241 Bacteria 1472
1107 Ga0373962_0010656 3300035242 Bacteria 2296
1108 Ga0373931_0001768 3300035691 Bacteria 9385
1109 Ga0373931_0007330 3300035691 Bacteria 5190
1110 Ga0373931_0029729 3300035691 Bacteria 2808
1111 Ga0373931_0391277 3300035691 Bacteria 878
1112 Ga0373935_0010076 3300035692 Bacteria 5661
1113 Ga0373935_0309364 3300035692 Bacteria 1118
1114 Ga0373927_0211295 3300035695 Bacteria 1274
1115 Ga0373933_0327555 3300035724 Bacteria 993
1116 Ga0373947_0100487 3300035725 Bacteria 1817
1117 Ga0373947_0259221 3300035725 Bacteria 1152
1118 Ga0373925_0074570 3300037068 Bacteria 2570
1119 Ga0373925_0238902 3300037068 Bacteria 1454
1120 Ga0373925_0508032 3300037068 Bacteria 990
1121 Ga0373925_0667984 3300037068 Bacteria 856
1122 Ga0395900_0017984 3300037418 Bacteria 7217
1123 Ga0395900_0070245 3300037418 Bacteria 3600
1124 Ga0395898_0017125 3300037466 Bacteria 7402
1125 Ga0395898_0866107 3300037466 Bacteria 842
1126 Ga0395898_0907409 3300037466 Bacteria 819
1127 Ga0436364_0256774 3300037853 Bacteria 34884
1128 Ga0436364_0624094 3300037853 Bacteria 124588
1129 Ga0436364_0655629 3300037853 Bacteria 934
1130 Ga0436364_1008100 3300037853 Bacteria 5451
1131 Ga0436364_1097018 3300037853 Bacteria 4049
1132 Ga0395901_0050065 3300038443 Bacteria 4341
1133 Ga0436365_0233412 3300039437 Bacteria 6249
1134 Ga0436365_1177168 3300039437 Bacteria 16605
1135 Ga0436365_1378611 3300039437 Bacteria 178407
1136 Ga0436365_1640827 3300039437 Bacteria 22352
1137 Ga0436360_0152897 3300039438 Bacteria 702
1138 Ga0436360_0154004 3300039438 Bacteria 1077
1139 Ga0436361_0496618 3300039447 Bacteria 928
1140 Ga0436361_0789278 3300039447 Bacteria 2070
1141 Ga0436363_0481504 3300039450 Bacteria 3543
1142 Ga0436363_1329912 3300039450 Bacteria 2314
1143 Ga0439436_0022269 3300041404 Bacteria 1877
1144 Ga0439438_002106 3300041405 Bacteria 8579
1145 Ga0439438_012001 3300041405 Bacteria 2675
1146 Ga0439439_0000552 3300041406 Bacteria 6515
1147 Ga0439461_0000433 3300041410 Bacteria 6019
1148 Ga0439461_0000739 3300041410 Bacteria 4749
1149 Ga0439461_0007041 3300041410 Bacteria 1979
1150 Ga0439466_0003809 3300041411 Bacteria 5821
1151 Ga0439466_0004182 3300041411 Bacteria 5570
1152 Ga0439466_0013539 3300041411 Bacteria 2984
1153 Ga0439465_0000954 3300041413 Bacteria 9186
1154 Ga0439465_0025003 3300041413 Bacteria 1883
1155 Ga0439465_0029394 3300041413 Bacteria 1745
1156 Ga0439465_0035635 3300041413 Bacteria 1595
1157 Ga0439465_0065452 3300041413 Bacteria 1210
1158 Ga0451789_0348754 3300041443 Bacteria 1249
1159 Ga0451793_1057108 3300041452 Bacteria 1343
1160 Ga0451793_1109950 3300041452 Bacteria 1078
1161 Ga0451793_1118605 3300041452 Bacteria 2292
1162 Ga0451797_0799585 3300041453 Bacteria 938
1163 Ga0451797_1361400 3300041453 Bacteria 889
1164 Ga0451795_0766706 3300041456 Bacteria 1950
1165 Ga0451800_1271939 3300041459 Bacteria 711
1166 Ga0451806_706470 3300041462 Bacteria 1095
1167 Ga0451837_0801649 3300041494 Bacteria 1902
1168 Ga0451837_1794285 3300041494 Bacteria 711
1169 Ga0451839_0574548 3300041496 Bacteria 719
1170 Ga0451839_0740234 3300041496 Bacteria 929
1171 Ga0451841_0211351 3300041498 Bacteria 843
1172 Ga0451841_0501317 3300041498 Bacteria 1120
1173 Ga0451845_0169045 3300041501 Bacteria 880
1174 Ga0451847_0275342 3300041503 Bacteria 653
1175 Ga0451843_1140858 3300041509 Bacteria 814
1176 Ga0451853_1266289 3300041512 Bacteria 1078
1177 Ga0451853_1314489 3300041512 Bacteria 807
1178 Ga0439433_0000523 3300041999 Bacteria 7230
1179 Ga0439442_001509 3300042002 Bacteria 4595
1180 Ga0439442_016096 3300042002 Bacteria 1541
1181 Ga0439445_0007032 3300042004 Bacteria 2600
1182 Ga0439445_0032195 3300042004 Bacteria 1366
1183 Ga0439432_006985 3300042006 Bacteria 4015
1184 Ga0439449_0003159 3300042007 Bacteria 6412
1185 Ga0439449_0024501 3300042007 Bacteria 2255
1186 Ga0439449_0091897 3300042007 Bacteria 1120
1187 Ga0439450_026235 3300042008 Bacteria 1283
1188 Ga0439450_058318 3300042008 Bacteria 929
1189 Ga0439452_001774 3300042010 Bacteria 8411
1190 Ga0439457_001826 3300042014 Bacteria 6288
1191 Ga0439462_0012860 3300042015 Bacteria 2141
1192 Ga0439463_045927 3300042016 Bacteria 1112
1193 Ga0439463_077060 3300042016 Bacteria 856
1194 Ga0450911_025168 3300042115 Bacteria 772
1195 Ga0450919_000811 3300042121 Bacteria 4014
1196 Ga0450920_000800 3300042122 Bacteria 5080
1197 Ga0450906_013520 3300042145 Bacteria 1503
1198 Ga0450907_002780 3300042146 Bacteria 3240
1199 Ga0439446_0001396 3300042156 Bacteria 5470
1200 Ga0450908_001690 3300042184 Bacteria 4299
1201 Ga0450909_000244 3300042185 Bacteria 6457
1202 Ga0439434_0000302 3300042435 Bacteria 14133
1203 Ga0439434_0006329 3300042435 Bacteria 3452
1204 Ga0439459_0007846 3300042438 Bacteria 1811
1205 Ga0439464_0081925 3300042439 Bacteria 965
1206 Ga0450918_001330 3300042531 Bacteria 4963
1207 Ga0466969_0007583 3300044656 Bacteria 5765
1208 Ga0466969_0026295 3300044656 Bacteria 2985
1209 Ga0466969_0040110 3300044656 Bacteria 2347
1210 Ga0466972_0014004 3300044658 Bacteria 4021
1211 Ga0466972_0029047 3300044658 Bacteria 2724
1212 Ga0466972_0033962 3300044658 Bacteria 2502
1213 Ga0466972_0036756 3300044658 Bacteria 2394
1214 Ga0466972_0039070 3300044658 Bacteria 2317
1215 Ga0466972_0041411 3300044658 Bacteria 2243
1216 Ga0466972_0042307 3300044658 Bacteria 2216
1217 Ga0466965_0007603 3300044683 Bacteria 4986
1218 Ga0466965_0008942 3300044683 Bacteria 4643
1219 Ga0466965_0020157 3300044683 Bacteria 3203
1220 Ga0466965_0030289 3300044683 Bacteria 2636
1221 Ga0466965_0145768 3300044683 Bacteria 1235
1222 Ga0466965_0300302 3300044683 Bacteria 871
1223 Ga0466966_0005323 3300044684 Bacteria 8463
1224 Ga0466966_0007809 3300044684 Bacteria 7082
1225 Ga0466966_0011119 3300044684 Bacteria 5972
1226 Ga0466966_0016593 3300044684 Bacteria 4864
1227 Ga0466966_0017019 3300044684 Bacteria 4806
1228 Ga0466966_0107748 3300044684 Bacteria 1719
1229 Ga0466966_0250253 3300044684 Bacteria 1067
1230 Ga0466961_0004780 3300044693 Bacteria 8528
1231 Ga0466961_0011981 3300044693 Bacteria 5542
1232 Ga0466961_0016723 3300044693 Bacteria 4716
1233 Ga0466961_0309431 3300044693 Bacteria 964
1234 Ga0466963_0016976 3300044694 Bacteria 4535
1235 Ga0466963_0040181 3300044694 Bacteria 3066
1236 Ga0466963_0260104 3300044694 Bacteria 1218
1237 Ga0466963_0279254 3300044694 Bacteria 1174
1238 Ga0466963_0853962 3300044694 Bacteria 642
1239 Ga0466964_0083490 3300044706 Bacteria 1376
1240 Ga0466964_0181336 3300044706 Bacteria 999
1241 Ga0466964_0435623 3300044706 Bacteria 692
1242 Ga0466964_0477064 3300044706 Bacteria 666
1243 Ga0466971_0040159 3300044719 Bacteria 2101
1244 Ga0466971_0082756 3300044719 Bacteria 1465
1245 Ga0466968_0002317 3300044735 Bacteria 6962
1246 Ga0466968_0004259 3300044735 Bacteria 5337
1247 Ga0466968_0080290 3300044735 Bacteria 1432
1248 Ga0466968_0110083 3300044735 Bacteria 1238
1249 Ga0466970_0014404 3300044765 Bacteria 4060
1250 Ga0466970_0024846 3300044765 Bacteria 3133
1251 Ga0466970_0034540 3300044765 Bacteria 2677
1252 Ga0466970_0046706 3300044765 Bacteria 2306
1253 Ga0466970_0140077 3300044765 Bacteria 1332
1254 Ga0466970_0491003 3300044765 Bacteria 706
1255 Ga0466970_0617232 3300044765 Bacteria 630
1256 Ga0466957_0003264 3300044842 Bacteria 8883
1257 Ga0466957_0006350 3300044842 Bacteria 6668
1258 Ga0466957_0043560 3300044842 Bacteria 2718
1259 Ga0466957_0146172 3300044842 Bacteria 1526
1260 Ga0466957_0183293 3300044842 Bacteria 1368
1261 Ga0466957_0402975 3300044842 Bacteria 936
1262 Ga0466957_0574084 3300044842 Bacteria 788
1263 Ga0466960_0000209 3300044901 Bacteria 20329
1264 Ga0466960_0002936 3300044901 Bacteria 6495
1265 Ga0466960_0012557 3300044901 Bacteria 3578
1266 Ga0466960_0025407 3300044901 Bacteria 2680
1267 Ga0466960_0035095 3300044901 Bacteria 2341
1268 Ga0466960_0142737 3300044901 Bacteria 1273
1269 Ga0466960_0227650 3300044901 Bacteria 1028
1270 Ga0466960_0240480 3300044901 Bacteria 1002
1271 Ga0466960_0826648 3300044901 Bacteria 562
1272 Ga0466959_0003040 3300045049 Bacteria 10848
1273 Ga0466959_0004865 3300045049 Bacteria 9087
1274 Ga0466959_0050789 3300045049 Bacteria 3043
1275 Ga0466959_0054402 3300045049 Bacteria 2924
1276 Ga0466959_0127262 3300045049 Bacteria 1807
1277 Ga0466959_0205196 3300045049 Bacteria 1371
1278 Ga0466959_0289491 3300045049 Bacteria 1123
1279 Ga0466958_0006271 3300045836 Bacteria 6459
1280 Ga0466958_0031584 3300045836 Bacteria 3148
1281 Ga0466958_0064683 3300045836 Bacteria 2231
1282 Ga0466958_0203297 3300045836 Bacteria 1261
1283 Ga0466958_0212976 3300045836 Bacteria 1232
1284 Ga0466958_0584268 3300045836 Bacteria 726
1285 Ga0466967_0007446 3300045976 Bacteria 7897
1286 Ga0466967_0011011 3300045976 Bacteria 6824
1287 Ga0466967_0015686 3300045976 Bacteria 5949
1288 Ga0466967_0070024 3300045976 Bacteria 3137
1289 Ga0466967_0110983 3300045976 Bacteria 2519
1290 Ga0466967_0117019 3300045976 Bacteria 2456
1291 Ga0466967_0232752 3300045976 Bacteria 1755
1292 Ga0466967_0263586 3300045976 Bacteria 1649
1293 Ga0466967_0360779 3300045976 Bacteria 1408
1294 Ga0466967_0362372 3300045976 Bacteria 1405
1295 Ga0466967_0825130 3300045976 Bacteria 921
1296 Ga0466967_0836912 3300045976 Bacteria 914
1297 Ga0466967_1131594 3300045976 Bacteria 780
1298 Ga0466967_1416011 3300045976 Bacteria 692
1299 Ga0466967_1591624 3300045976 Bacteria 651
1300 Ga0495592_0007874 3300046454 Bacteria 7987
1301 Ga0495603_0028336 3300046455 Bacteria 3378
1302 Ga0495603_0188708 3300046455 Bacteria 1192
1303 Ga0495629_0028150 3300046459 Bacteria 3990
1304 Ga0495629_0050662 3300046459 Bacteria 2908
1305 Ga0495629_0245141 3300046459 Bacteria 1233
1306 Ga0495638_0000404 3300046460 Bacteria 52857
1307 Ga0495638_0040372 3300046460 Bacteria 2957
1308 Ga0495641_0063617 3300046461 Bacteria 1662
1309 Ga0495651_0005319 3300046462 Bacteria 9818
1310 Ga0495653_0018404 3300046463 Bacteria 5672
1311 Ga0495650_0037786 3300046471 Bacteria 2098
1312 Ga0495580_0152461 3300046472 Bacteria 1601
1313 Ga0495582_0069322 3300046473 Bacteria 1950
1314 Ga0495639_0047426 3300046475 Bacteria 1946
1315 Ga0495639_0180112 3300046475 Bacteria 1029
1316 Ga0495662_0018597 3300046476 Bacteria 3363
1317 Ga0495664_0055818 3300046477 Bacteria 2349
1318 Ga0495584_0426863 3300046491 Bacteria 674
1319 Ga0495594_0032415 3300046499 Bacteria 2836
1320 Ga0495606_0006711 3300046507 Bacteria 10545
1321 Ga0495608_0122041 3300046511 Bacteria 1670
1322 Ga0495618_0041735 3300046514 Bacteria 2890
1323 Ga0495630_0721506 3300046517 Bacteria 762
1324 Ga0495637_0200219 3300046520 Bacteria 734
1325 Ga0495648_0006131 3300046524 Bacteria 9854
1326 Ga0495665_0016311 3300046531 Bacteria 4003
1327 Ga0495640_0075932 3300046533 Bacteria 2243
1328 Ga0495587_0002872 3300046536 Bacteria 11534
1329 Ga0495598_0179830 3300046537 Bacteria 754
1330 Ga0495645_0069873 3300046543 Bacteria 2534
1331 Ga0495667_0010610 3300046559 Bacteria 6232
1332 Ga0495667_0621639 3300046559 Bacteria 672
1333 Ga0495668_0000828 3300046616 Bacteria 35228
1334 Ga0495668_0008637 3300046616 Bacteria 6334
1335 Ga0495611_0048063 3300046648 Bacteria 1916
1336 Ga0495625_0147559 3300046660 Bacteria 1583
1337 Ga0495625_0254479 3300046660 Bacteria 1139
1338 Ga0495625_0446763 3300046660 Bacteria 799
1339 Ga0495635_0067337 3300046663 Bacteria 2456
1340 Ga0495635_0326627 3300046663 Bacteria 1026
1341 Ga0495588_0054430 3300046674 Bacteria 2064
1342 Ga0495588_0225474 3300046674 Bacteria 989
1343 Ga0495657_0032178 3300046675 Bacteria 3662
1344 Ga0495599_0027015 3300046678 Bacteria 3596
1345 Ga0495623_0026144 3300046679 Bacteria 3759
1346 Ga0495646_0004088 3300046680 Bacteria 9153
1347 Ga0495624_0216279 3300046690 Bacteria 1162
1348 Ga0495624_0323288 3300046690 Bacteria 929
1349 Ga0495649_0131025 3300046694 Bacteria 1323
1350 Ga0495600_0046110 3300046809 Bacteria 2844
1351 Ga0495581_0038922 3300047315 Bacteria 2753
1352 Ga0495604_0173564 3300047317 Bacteria 1513
1353 Ga0495674_0024000 3300047319 Bacteria 5611
1354 Ga0495674_0808774 3300047319 Bacteria 728
1355 Ga0495672_0004146 3300047320 Bacteria 12042
1356 Ga0495672_0067610 3300047320 Bacteria 2035
1357 Ga0495676_0202607 3300047321 Bacteria 1378
1358 Ga0495676_0270008 3300047321 Bacteria 1154
1359 Ga0495680_0115646 3300047322 Bacteria 1984
1360 Ga0495683_0000556 3300047323 Bacteria 28183
1361 Ga0495673_0008785 3300047469 Bacteria 5642
1362 Ga0495684_0000810 3300047471 Bacteria 25298
1363 Ga0495686_0003290 3300047472 Bacteria 14125
1364 Ga0495602_0044910 3300048088 Bacteria 4003
1365 Ga0495614_0131231 3300048089 Bacteria 1109
1366 Ga0495614_0288456 3300048089 Bacteria 757
1367 Ga0495626_0000129 3300048091 Bacteria 95400
1368 Ga0495626_0129581 3300048091 Bacteria 1078
1369 Ga0496100_0001059 3300048903 Bacteria 13276
1370 Ga0496100_0001991 3300048903 Bacteria 10232
1371 Ga0496100_0132315 3300048903 Bacteria 1758
1372 Ga0496100_0164189 3300048903 Bacteria 1594
1373 Ga0496101_0000077 3300048904 Bacteria 109236
1374 Ga0496101_0001299 3300048904 Bacteria 14934
1375 Ga0496101_0001446 3300048904 Bacteria 14183
1376 Ga0496101_0014892 3300048904 Bacteria 5234
1377 Ga0496101_0126753 3300048904 Bacteria 1935
1378 Ga0496102_0000037 3300048905 Bacteria 199368
1379 Ga0496102_0000256 3300048905 Bacteria 69381
1380 Ga0496102_0004763 3300048905 Bacteria 11476
1381 Ga0496102_0029265 3300048905 Bacteria 4928
1382 Ga0496102_0069242 3300048905 Bacteria 3239
1383 Ga0496102_0166235 3300048905 Bacteria 2076
1384 Ga0496102_0243316 3300048905 Bacteria 1696
1385 Ga0496102_0631950 3300048905 Bacteria 994
1386 Ga0496102_0731465 3300048905 Bacteria 912
1387 Ga0496102_0858957 3300048905 Bacteria 829
1388 Ga0496103_0000004 3300048906 Bacteria 510080
1389 Ga0496103_0000794 3300048906 Bacteria 23223
1390 Ga0496103_0000989 3300048906 Bacteria 20043
1391 Ga0496103_0005905 3300048906 Bacteria 7318
1392 Ga0496104_0011109 3300048907 Bacteria 8056
1393 Ga0496104_0012595 3300048907 Bacteria 7610
1394 Ga0496104_0014362 3300048907 Bacteria 7154
1395 Ga0496104_0046358 3300048907 Bacteria 4093
1396 Ga0496104_0067920 3300048907 Bacteria 3387
1397 Ga0496104_0168673 3300048907 Bacteria 2099
1398 Ga0496104_0277831 3300048907 Bacteria 1588
1399 Ga0496104_0279915 3300048907 Bacteria 1581
1400 Ga0496104_0339427 3300048907 Bacteria 1415
1401 Ga0496104_0345225 3300048907 Bacteria 1401
1402 Ga0496104_0734080 3300048907 Bacteria 895
1403 Ga0496104_0802844 3300048907 Bacteria 847
1404 Ga0496104_1315809 3300048907 Bacteria 626
1405 Ga0496105_0001050 3300048908 Bacteria 19148
1406 Ga0496105_0008651 3300048908 Bacteria 7915
1407 Ga0496105_0009531 3300048908 Bacteria 7598
1408 Ga0496105_0018635 3300048908 Bacteria 5586
1409 Ga0496105_0065095 3300048908 Bacteria 3009
1410 Ga0496105_0238087 3300048908 Bacteria 1478
1411 Ga0496105_0590551 3300048908 Bacteria 863
1412 Ga0496105_0742591 3300048908 Bacteria 750
1413 Ga0496106_0001022 3300048909 Bacteria 20554
1414 Ga0496106_0001882 3300048909 Bacteria 15718
1415 Ga0496106_0002196 3300048909 Bacteria 14591
1416 Ga0496106_0009913 3300048909 Bacteria 7034
1417 Ga0496106_0040890 3300048909 Bacteria 3473
1418 Ga0496106_0043944 3300048909 Bacteria 3354
1419 Ga0496106_0074263 3300048909 Bacteria 2603
1420 Ga0496106_0131416 3300048909 Bacteria 1964
1421 Ga0496106_0498996 3300048909 Bacteria 978
1422 Ga0496107_0001063 3300048910 Bacteria 16459
1423 Ga0496107_0006939 3300048910 Bacteria 7804
1424 Ga0496107_0129137 3300048910 Bacteria 1865
1425 Ga0496107_0219516 3300048910 Bacteria 1414
1426 Ga0496107_0298049 3300048910 Bacteria 1200
1427 Ga0496107_0416542 3300048910 Bacteria 999
1428 Ga0496108_0000048 3300048911 Bacteria 133539
1429 Ga0496108_0017967 3300048911 Bacteria 5786
1430 Ga0496108_0020013 3300048911 Bacteria 5499
1431 Ga0496108_0022936 3300048911 Bacteria 5136
1432 Ga0496108_0024627 3300048911 Bacteria 4956
1433 Ga0496108_0055912 3300048911 Bacteria 3314
1434 Ga0496108_0067656 3300048911 Bacteria 3013
1435 Ga0496108_0265099 3300048911 Bacteria 1495
1436 Ga0496108_0473256 3300048911 Bacteria 1095
1437 Ga0496108_0601456 3300048911 Bacteria 958
1438 Ga0496108_0666890 3300048911 Bacteria 903
1439 Ga0496108_1059205 3300048911 Bacteria 691
1440 Ga0496109_0014524 3300048912 Bacteria 6850
1441 Ga0496109_0034038 3300048912 Bacteria 4585
1442 Ga0496109_0097687 3300048912 Bacteria 2722
1443 Ga0496109_0175660 3300048912 Bacteria 2010
1444 Ga0496109_0273200 3300048912 Bacteria 1593
1445 Ga0496109_0329027 3300048912 Bacteria 1442
1446 Ga0496109_0472378 3300048912 Bacteria 1184
1447 Ga0496109_0473563 3300048912 Bacteria 1182
1448 Ga0496109_0829819 3300048912 Bacteria 862
1449 Ga0496110_0012522 3300048913 Bacteria 6976
1450 Ga0496110_0086041 3300048913 Bacteria 2806
1451 Ga0496110_0167350 3300048913 Bacteria 1994
1452 Ga0496110_0221531 3300048913 Bacteria 1720
1453 Ga0496110_0412374 3300048913 Bacteria 1231
1454 Ga0496110_0535011 3300048913 Bacteria 1065
1455 Ga0496110_0648793 3300048913 Bacteria 955
1456 Ga0496110_0686945 3300048913 Bacteria 924
1457 Ga0496110_0702286 3300048913 Bacteria 913
1458 Ga0496111_0014059 3300048914 Bacteria 5460
1459 Ga0496111_0076563 3300048914 Bacteria 2439
1460 Ga0496111_0099203 3300048914 Bacteria 2139
1461 Ga0496111_0199593 3300048914 Bacteria 1487
1462 Ga0496111_0213470 3300048914 Bacteria 1433
1463 Ga0496111_0261281 3300048914 Bacteria 1285
1464 Ga0496111_0843153 3300048914 Bacteria 662
1465 Ga0496112_0034664 3300048915 Bacteria 4912
1466 Ga0496112_0046141 3300048915 Bacteria 4273
1467 Ga0496112_0056105 3300048915 Bacteria 3876
1468 Ga0496112_0071994 3300048915 Bacteria 3416
1469 Ga0496112_0127973 3300048915 Bacteria 2510
1470 Ga0496112_0131442 3300048915 Bacteria 2474
1471 Ga0496112_0867844 3300048915 Bacteria 825
1472 Ga0496112_0881046 3300048915 Bacteria 818
1473 Ga0496113_0012604 3300048916 Bacteria 5689
1474 Ga0496113_0033257 3300048916 Bacteria 3753
1475 Ga0496113_0035130 3300048916 Bacteria 3664
1476 Ga0496113_0076174 3300048916 Bacteria 2562
1477 Ga0496113_0113040 3300048916 Bacteria 2116
1478 Ga0496113_0156392 3300048916 Bacteria 1801
1479 Ga0496113_0212305 3300048916 Bacteria 1541
1480 Ga0496113_0495253 3300048916 Bacteria 981
1481 Ga0496114_0000183 3300048917 Bacteria 44987
1482 Ga0496114_0017184 3300048917 Bacteria 5835
1483 Ga0496114_0021514 3300048917 Bacteria 5248
1484 Ga0496114_0273624 3300048917 Bacteria 1488
1485 Ga0496114_0305629 3300048917 Bacteria 1404
1486 Ga0496114_0353884 3300048917 Bacteria 1299
1487 Ga0496114_0730061 3300048917 Bacteria 867
1488 Ga0496114_0774833 3300048917 Bacteria 837
1489 Ga0496115_0000622 3300048918 Bacteria 26858
1490 Ga0496115_0005063 3300048918 Bacteria 9583
1491 Ga0496115_0023839 3300048918 Bacteria 4752
1492 Ga0496115_0085539 3300048918 Bacteria 2572
1493 Ga0496115_0215640 3300048918 Bacteria 1585
1494 Ga0496115_0334015 3300048918 Bacteria 1238
1495 Ga0496116_0000056 3300048919 Bacteria 282554
1496 Ga0496116_0027028 3300048919 Bacteria 4182
1497 Ga0496117_0000003 3300048920 Bacteria 1881097
1498 Ga0496117_0008065 3300048920 Bacteria 10089
1499 Ga0496117_0134985 3300048920 Bacteria 1488
1500 Ga0496118_0000001 3300048921 Bacteria 1881100
1501 Ga0496118_0000275 3300048921 Bacteria 90451
1502 Ga0496118_0000341 3300048921 Bacteria 79469
1503 Ga0496119_0008492 3300048922 Bacteria 9012
1504 Ga0496119_0010721 3300048922 Bacteria 7681
1505 Ga0496120_0012266 3300048923 Bacteria 5841
1506 Ga0496120_0026625 3300048923 Bacteria 3568
1507 Ga0496121_0002761 3300048924 Bacteria 26054
1508 Ga0496121_0009107 3300048924 Bacteria 11488
1509 Ga0496121_0050901 3300048924 Bacteria 3494
1510 Ga0496121_0136099 3300048924 Bacteria 1830
1511 Ga0496123_0281802 3300048926 Bacteria 803
1512 Ga0496124_0102890 3300048927 Bacteria 2310
1513 Ga0496124_0253794 3300048927 Bacteria 1299
1514 Ga0496124_0469445 3300048927 Bacteria 853
1515 Ga0496125_0009039 3300048928 Bacteria 10316
1516 Ga0496125_0034567 3300048928 Bacteria 4453
1517 Ga0496125_0508031 3300048928 Bacteria 677
1518 Ga0496126_0000735 3300048929 Bacteria 59474
1519 Ga0496126_0009468 3300048929 Bacteria 10337
1520 Ga0496126_0016764 3300048929 Bacteria 7317
1521 Ga0496126_0036675 3300048929 Bacteria 4581
1522 Ga0496126_0110320 3300048929 Bacteria 2397
1523 Ga0496126_0129903 3300048929 Bacteria 2178
1524 Ga0496126_0192215 3300048929 Bacteria 1728
1525 Ga0496126_0329622 3300048929 Bacteria 1253
1526 Ga0495682_0139774 3300049460 Bacteria 865
1527 Ga0501032_0000761 3300049569 Bacteria 26188
1528 Ga0501032_0023657 3300049569 Bacteria 4241
1529 Ga0501032_0037709 3300049569 Bacteria 3295
1530 Ga0501033_0069131 3300049570 Bacteria 2596
1531 Ga0501033_0090616 3300049570 Bacteria 2237
1532 Ga0501033_0192753 3300049570 Bacteria 1458
1533 Ga0501034_0002114 3300049571 Bacteria 24741
1534 Ga0501034_0015184 3300049571 Bacteria 7916
1535 Ga0501034_0058841 3300049571 Bacteria 3860
1536 Ga0501036_0030217 3300049572 Bacteria 4578
1537 Ga0501037_0000297 3300049573 Bacteria 41985
1538 Ga0501037_0011758 3300049573 Bacteria 6446
1539 Ga0501038_0002100 3300049574 Bacteria 18466
1540 Ga0501039_0000338 3300049575 Bacteria 33540
1541 Ga0501043_0001384 3300049579 Bacteria 21239
1542 Ga0501043_0078158 3300049579 Bacteria 2600
1543 Ga0501043_0092619 3300049579 Bacteria 2376
1544 Ga0501043_0094547 3300049579 Bacteria 2350
1545 Ga0501043_0336064 3300049579 Bacteria 1150
1546 Ga0501046_0008048 3300049580 Bacteria 9214
1547 Ga0501046_0032765 3300049580 Bacteria 4205
1548 Ga0501047_0010221 3300049581 Bacteria 8875
1549 Ga0501047_0034070 3300049581 Bacteria 4917
1550 Ga0501047_0118531 3300049581 Bacteria 2529
1551 Ga0501048_0004723 3300049582 Bacteria 10371
1552 Ga0501067_0082322 3300049583 Bacteria 1785
1553 Ga0501068_0688282 3300049584 Bacteria 668
1554 Ga0501069_0017938 3300049585 Bacteria 3817
1555 Ga0501070_0000944 3300049586 Bacteria 26242
1556 Ga0501070_0005284 3300049586 Bacteria 11015
1557 Ga0501070_0061667 3300049586 Bacteria 3107
1558 Ga0501070_0224437 3300049586 Bacteria 1540
1559 Ga0501070_0367554 3300049586 Bacteria 1166
1560 Ga0501072_0260317 3300049588 Bacteria 1381
1561 Ga0501072_0339201 3300049588 Bacteria 1194
1562 Ga0501073_0012332 3300049589 Bacteria 6237
1563 Ga0501073_0111885 3300049589 Bacteria 1894
1564 Ga0501073_0230034 3300049589 Bacteria 1281
1565 Ga0501076_0059887 3300049592 Bacteria 3029
1566 Ga0501076_0668079 3300049592 Bacteria 858
1567 Ga0501079_0829705 3300049741 Bacteria 728
1568 Ga0501080_0077126 3300049742 Bacteria 3099
1569 Ga0501080_0549219 3300049742 Bacteria 1029
1570 Ga0501081_0106694 3300049743 Bacteria 1986
1571 Ga0501035_0001031 3300049822 Bacteria 29291
1572 Ga0501035_0114563 3300049822 Bacteria 2360
1573 Ga0501044_0002147 3300049823 Bacteria 22617
1574 Ga0501044_0002404 3300049823 Bacteria 21352
1575 Ga0501044_0005301 3300049823 Bacteria 14338
1576 Ga0501044_0011051 3300049823 Bacteria 9793
1577 Ga0501044_0119124 3300049823 Bacteria 2642
1578 Ga0501044_0871891 3300049823 Bacteria 776
1579 Ga0501044_0983470 3300049823 Bacteria 716
1580 Ga0501045_0583608 3300049824 Bacteria 828
1581 nmdc:mga03683_158329_c1 3300050489 Bacteria 1025
1582 nmdc:mga03683_23268_c1 3300050489 Bacteria 1388
1583 nmdc:mga03683_45109_c2 3300050489 Bacteria 858
1584 nmdc:mga03683_4878_c1 3300050489 Bacteria 4478
1585 nmdc:mga03683_49684_c1 3300050489 Bacteria 1747
1586 nmdc:mga03n38_137296_c1 3300050490 Bacteria 1218
1587 nmdc:mga03n38_147128_c1 3300050490 Bacteria 1182
1588 nmdc:mga03n38_18186_c1 3300050490 Bacteria 2770
1589 nmdc:mga03n38_28716_c1 3300050490 Bacteria 1712
1590 nmdc:mga03n38_309949_c1 3300050490 Bacteria 850
1591 nmdc:mga03n38_322144_c1 3300050490 Bacteria 835
1592 nmdc:mga03n38_358348_c1 3300050490 Bacteria 795
1593 nmdc:mga03n38_498_c1 3300050490 Bacteria 9885
1594 nmdc:mga03n38_5479_c1 3300050490 Bacteria 4326
1595 nmdc:mga03n38_5660_c1 3300050490 Bacteria 4275
1596 nmdc:mga00v17_12539_c1 3300050491 Bacteria 4680
1597 nmdc:mga00v17_186120_c1 3300050491 Bacteria 1340
1598 nmdc:mga00v17_18775_c1 3300050491 Bacteria 3934
1599 nmdc:mga00v17_26002_c1 3300050491 Bacteria 3406
1600 nmdc:mga00v17_2723_c1 3300050491 Bacteria 9073
1601 nmdc:mga00v17_44826_c1 3300050491 Bacteria 2669
1602 nmdc:mga00v17_52017_c1 3300050491 Bacteria 2491
1603 nmdc:mga00v17_52959_c1 3300050491 Bacteria 2472
1604 nmdc:mga00v17_83254_c1 3300050491 Bacteria 2001
1605 nmdc:mga0yw44_129827_c1 3300050492 Bacteria 1630
1606 nmdc:mga0yw44_178329_c1 3300050492 Bacteria 1397
1607 nmdc:mga0yw44_204982_c1 3300050492 Bacteria 1303
1608 nmdc:mga0yw44_295662_c1 3300050492 Bacteria 1084
1609 nmdc:mga0yw44_303245_c1 3300050492 Bacteria 1070
1610 nmdc:mga0yw44_39157_c1 3300050492 Bacteria 2809
1611 nmdc:mga0yw44_47314_c1 3300050492 Bacteria 2588
1612 nmdc:mga0yw44_70558_c1 3300050492 Bacteria 2166
1613 nmdc:mga0k408_242510_c1 3300050493 Bacteria 1076
1614 nmdc:mga06z11_179878_c1 3300050494 Bacteria 1219
1615 nmdc:mga06z11_3681_c1 3300050494 Bacteria 5952
1616 nmdc:mga06z11_374850_c1 3300050494 Bacteria 854
1617 nmdc:mga07m45_23315_c1 3300050496 Bacteria 3383
1618 nmdc:mga07m45_52071_c1 3300050496 Bacteria 742
1619 nmdc:mga07m45_54980_c1 3300050496 Bacteria 2249
1620 nmdc:mga07m45_62216_c1 3300050496 Bacteria 2115
1621 nmdc:mga07m45_7959_c1 3300050496 Bacteria 5430
1622 nmdc:mga07m45_9535_c1 3300050496 Bacteria 5040
1623 nmdc:mga07m45_99100_c1 3300050496 Bacteria 1673
1624 nmdc:mga05p37_194181_c1 3300050507 Bacteria 2463
1625 nmdc:mga05p37_24201_c1 3300050507 Bacteria 7378
1626 nmdc:mga05p37_32606_c1 3300050507 Bacteria 6372
1627 nmdc:mga05p37_552628_c1 3300050507 Bacteria 1310
1628 nmdc:mga09592_355253_c1 3300050508 Bacteria 1268
1629 nmdc:mga09592_534782_c1 3300050508 Bacteria 1007
1630 nmdc:mga09592_58832_c1 3300050508 Bacteria 3250
1631 nmdc:mga09592_616156_c1 3300050508 Bacteria 929
1632 nmdc:mga0qj67_21483_c1 3300050509 Bacteria 4951
1633 nmdc:mga06r32_34294_c1 3300050510 Bacteria 4785
1634 nmdc:mga06r32_46064_c1 3300050510 Bacteria 4160
1635 nmdc:mga06r32_585298_c1 3300050510 Bacteria 1088
1636 nmdc:mga08y16_1033205_c1 3300050511 Bacteria 800
1637 nmdc:mga08y16_224428_c1 3300050511 Bacteria 1944
1638 nmdc:mga08y16_368582_c1 3300050511 Bacteria 1473
1639 nmdc:mga08y16_432714_c1 3300050511 Bacteria 1344
1640 nmdc:mga08y16_95213_c1 3300050511 Bacteria 3101
1641 nmdc:mga08y16_995900_c1 3300050511 Bacteria 818
1642 nmdc:mga0n895_167562_c1 3300050512 Bacteria 2229
1643 nmdc:mga0n895_697853_c1 3300050512 Bacteria 1011
1644 nmdc:mga0rr50_178753_c1 3300050513 Bacteria 1733
1645 nmdc:mga0rr50_212638_c1 3300050513 Bacteria 1594
1646 nmdc:mga08x19_225836_c1 3300050514 Bacteria 1288
1647 nmdc:mga08x19_99547_c1 3300050514 Bacteria 1927
1648 nmdc:mga0a205_76212_c1 3300050515 Bacteria 3241
1649 nmdc:mga0sz30_111511_c1 3300050516 Bacteria 1199
1650 nmdc:mga0sz30_15560_c1 3300050516 Bacteria 3007
1651 nmdc:mga0sz30_155977_c1 3300050516 Bacteria 1011
1652 nmdc:mga0sz30_20202_c2 3300050516 Bacteria 1967
1653 nmdc:mga0sz30_2622_c1 3300050516 Bacteria 6403
1654 nmdc:mga0sz30_28248_c1 3300050516 Bacteria 2307
1655 nmdc:mga0sz30_39845_c1 3300050516 Bacteria 1973
1656 nmdc:mga0sz30_4269_c2 3300050516 Bacteria 4603
1657 nmdc:mga0sz30_4656_c1 3300050516 Bacteria 4974
1658 nmdc:mga0sz30_8261_c1 3300050516 Bacteria 3924
1659 nmdc:mga0sz30_91899_c1 3300050516 Bacteria 1321
1660 Ga0495601_0029727 3300053077 Bacteria 3391
1661 Ga0495601_0160320 3300053077 Bacteria 1470
1662 Ga0495612_0115607 3300053078 Bacteria 1151
1663 Ga0500610_0000982 3300053079 Bacteria 9267
1664 Ga0500635_0004779 3300053080 Bacteria 3508
1665 Ga0495595_0122387 3300053084 Bacteria 1268
1666 Ga0495595_0151731 3300053084 Bacteria 1140
1667 Ga0495619_0033505 3300053085 Bacteria 3336
1668 Ga0495619_0391498 3300053085 Bacteria 960
1669 Ga0500578_0045628 3300053086 Bacteria 2812
1670 Ga0500578_0427449 3300053086 Bacteria 758
1671 Ga0500643_004746 3300053087 Bacteria 6032
1672 Ga0500644_0036174 3300053088 Bacteria 1605
1673 Ga0500644_0151606 3300053088 Bacteria 930
1674 Ga0500646_0000050 3300053090 Bacteria 32838
1675 Ga0500646_0045839 3300053090 Bacteria 1246
1676 Ga0500651_0007483 3300053093 Bacteria 6383
1677 Ga0500556_0006285 3300053104 Bacteria 3367
1678 Ga0500556_0040966 3300053104 Bacteria 1631
1679 Ga0500556_0221358 3300053104 Bacteria 746
1680 Ga0500562_004671 3300053108 Bacteria 3457
1681 Ga0500569_004395 3300053109 Bacteria 2959
1682 Ga0500594_0009954 3300053118 Bacteria 2197
1683 Ga0500595_033838 3300053119 Bacteria 1694
1684 Ga0500608_143955 3300053122 Bacteria 1053
1685 Ga0500652_000561 3300053131 Bacteria 12966
1686 Ga0500652_009193 3300053131 Bacteria 3331
1687 Ga0500652_167040 3300053131 Bacteria 907
1688 Ga0500559_0019361 3300053136 Bacteria 2877
1689 Ga0500568_0011883 3300053139 Bacteria 4020
1690 Ga0500568_0063050 3300053139 Bacteria 1431
1691 Ga0500577_0013602 3300053142 Bacteria 2490
1692 Ga0500579_071196 3300053143 Bacteria 2005
1693 Ga0500600_0176087 3300053149 Bacteria 1034
1694 Ga0500604_0085088 3300053151 Bacteria 1027
1695 Ga0500616_0007284 3300053153 Bacteria 7058
1696 Ga0500627_0169709 3300053158 Bacteria 983
1697 Ga0500645_000195 3300053730 Bacteria 47101
1698 Ga0501084_0202311 3300054114 Bacteria 1676
1699 Ga0587084_056547 3300059477 Bacteria 708
1700 Ga0587066_061295 3300059490 Bacteria 768
1701 Ga0587080_053222 3300059503 Bacteria 770
1702 Ga0587082_020174 3300059504 Bacteria 1077
1703 Ga0587082_041357 3300059504 Bacteria 846
1704 Ga0587082_057647 3300059504 Bacteria 758
1705 Ga0587088_068183 3300059508 Bacteria 736
1706 Ga0587090_044103 3300059510 Bacteria 796
1707 Ga0587067_042575 3300059640 Bacteria 888
1708 Ga0587078_013586 3300059646 Bacteria 966
1709 Ga0587079_040936 3300059647 Bacteria 935
1710 Ga0466962_0004342 3300061719 Bacteria 6799
1711 Ga0466962_0066904 3300061719 Bacteria 1715
1712 Ga0466962_0077158 3300061719 Bacteria 1592
1713 Ga0466962_0206582 3300061719 Bacteria 960
1714 Ga0530510_0347698 3300061734 Bacteria 1114

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046537 Ga0495598_0179830 Ga0495598_0179830_19_591 164
2 3300005842 Ga0068858_101755331 Ga0068858_1017553311 165
3 3300044694 Ga0466963_0853962 Ga0466963_0853962_55_612 165
4 3300045976 Ga0466967_0117019 Ga0466967_0117019_771_1328 166
5 3300026088 Ga0207641_10003733 Ga0207641_100037334 167
6 3300044683 Ga0466965_0030289 Ga0466965_0030289_1682_2239 167
7 3300044842 Ga0466957_0402975 Ga0466957_0402975_43_600 167
8 3300045049 Ga0466959_0205196 Ga0466959_0205196_856_1359 167
9 3300053077 Ga0495601_0160320 Ga0495601_0160320_727_1230 167
10 3300037068 Ga0373925_0667984 Ga0373925_0667984_139_726 168
11 3300041404 Ga0439436_0022269 Ga0439436_0022269_452_1009 168
12 3300041405 Ga0439438_002106 Ga0439438_002106_4866_5423 168
13 3300041406 Ga0439439_0000552 Ga0439439_0000552_843_1400 168
14 3300041410 Ga0439461_0000433 Ga0439461_0000433_5301_5858 168
15 3300041411 Ga0439466_0003809 Ga0439466_0003809_1051_1608 168
16 3300041999 Ga0439433_0000523 Ga0439433_0000523_5124_5681 168
17 3300042002 Ga0439442_001509 Ga0439442_001509_3323_3880 168
18 3300042006 Ga0439432_006985 Ga0439432_006985_1089_1646 168
19 3300042007 Ga0439449_0003159 Ga0439449_0003159_5140_5697 168
20 3300042010 Ga0439452_001774 Ga0439452_001774_5614_6171 168
21 3300042014 Ga0439457_001826 Ga0439457_001826_843_1400 168
22 3300042015 Ga0439462_0012860 Ga0439462_0012860_869_1426 168
23 3300042115 Ga0450911_025168 Ga0450911_025168_144_701 168
24 3300042121 Ga0450919_000811 Ga0450919_000811_2209_2766 168
25 3300042122 Ga0450920_000800 Ga0450920_000800_674_1231 168
26 3300042145 Ga0450906_013520 Ga0450906_013520_417_974 168
27 3300042146 Ga0450907_002780 Ga0450907_002780_475_1032 168
28 3300042156 Ga0439446_0001396 Ga0439446_0001396_3937_4494 168
29 3300042184 Ga0450908_001690 Ga0450908_001690_3097_3654 168
30 3300042185 Ga0450909_000244 Ga0450909_000244_4959_5516 168
31 3300042435 Ga0439434_0000302 Ga0439434_0000302_5190_5747 168
32 3300042531 Ga0450918_001330 Ga0450918_001330_900_1457 168
33 3300005985 Ga0081539_10004121 Ga0081539_1000412120 169
34 3300044765 Ga0466970_0491003 Ga0466970_0491003_36_593 169
35 3300044901 Ga0466960_0025407 Ga0466960_0025407_1195_1752 169
36 3300006051 Ga0075364_10081873 Ga0075364_100818733 172
37 3300006058 Ga0075432_10015091 Ga0075432_100150913 172
38 3300006178 Ga0075367_10124665 Ga0075367_101246652 172
39 3300006353 Ga0075370_10046266 Ga0075370_100462662 172
40 3300025321 Ga0207656_10143703 Ga0207656_101437031 172
41 3300044683 Ga0466965_0020157 Ga0466965_0020157_2284_2841 172
42 3300044683 Ga0466965_0145768 Ga0466965_0145768_473_1030 172
43 3300044684 Ga0466966_0016593 Ga0466966_0016593_888_1445 172
44 3300044901 Ga0466960_0000209 Ga0466960_0000209_7353_7910 172
45 3300046616 Ga0495668_0008637 Ga0495668_0008637_5034_5591 172
46 3300048911 Ga0496108_0020013 Ga0496108_0020013_3066_3623 172
47 3300048929 Ga0496126_0329622 Ga0496126_0329622_219_776 172
48 3300049741 Ga0501079_0829705 Ga0501079_0829705_127_684 172
49 3300050489 nmdc:mga03683_158329_c1 nmdc:mga03683_158329_c1_36_593 172
50 3300050496 nmdc:mga07m45_9535_c1 nmdc:mga07m45_9535_c1_4137_4694 172
51 3300053080 Ga0500635_0004779 Ga0500635_0004779_1690_2247 172
52 3300053131 Ga0500652_000561 Ga0500652_000561_11983_12540 172
53 3300061734 Ga0530510_0347698 Ga0530510_0347698_288_845 172
54 3300026116 Ga0207674_10173618 Ga0207674_101736182 173
55 3300028800 Ga0265338_10208813 Ga0265338_102088132 173
56 3300031995 Ga0307409_100075937 Ga0307409_1000759372 173
57 3300032126 Ga0307415_102052415 Ga0307415_1020524151 173
58 3300035121 Ga0373960_0085605 Ga0373960_0085605_11_532 173
59 3300041512 Ga0451853_1314489 Ga0451853_1314489_273_794 173
60 3300044706 Ga0466964_0083490 Ga0466964_0083490_454_1011 173
61 3300044706 Ga0466964_0435623 Ga0466964_0435623_14_535 173
62 3300044901 Ga0466960_0826648 Ga0466960_0826648_30_551 173
63 3300046517 Ga0495630_0721506 Ga0495630_0721506_225_746 173
64 3300048911 Ga0496108_0666890 Ga0496108_0666890_20_541 173
65 3300050492 nmdc:mga0yw44_47314_c1 nmdc:mga0yw44_47314_c1_29_550 173
66 3300053090 Ga0500646_0045839 Ga0500646_0045839_369_926 173
67 3300006028 Ga0070717_10084531 Ga0070717_100845313 174
68 3300009147 Ga0114129_10140232 Ga0114129_101402324 175
69 3300037418 Ga0395900_0017984 Ga0395900_0017984_6171_6728 176
70 3300037466 Ga0395898_0866107 Ga0395898_0866107_260_817 176
71 3300037466 Ga0395898_0907409 Ga0395898_0907409_93_650 176
72 3300005455 Ga0070663_100404418 Ga0070663_1004044182 177
73 3300005840 Ga0068870_10493554 Ga0068870_104935542 177
74 3300025908 Ga0207643_10252020 Ga0207643_102520202 177
75 3300026067 Ga0207678_10385380 Ga0207678_103853802 177
76 3300032168 Ga0316593_10092232 Ga0316593_100922322 177
77 3300044658 Ga0466972_0014004 Ga0466972_0014004_1190_1747 177
78 3300044683 Ga0466965_0008942 Ga0466965_0008942_2891_3448 177
79 3300044735 Ga0466968_0002317 Ga0466968_0002317_1646_2203 177
80 3300044765 Ga0466970_0024846 Ga0466970_0024846_1206_1763 177
81 3300044842 Ga0466957_0003264 Ga0466957_0003264_1892_2449 177
82 3300044901 Ga0466960_0002936 Ga0466960_0002936_681_1238 177
83 3300045049 Ga0466959_0003040 Ga0466959_0003040_6062_6619 177
84 3300045976 Ga0466967_0011011 Ga0466967_0011011_5888_6445 177
85 3300046674 Ga0495588_0225474 Ga0495588_0225474_211_747 178
86 3300026095 Ga0207676_10201067 Ga0207676_102010672 179
87 3300031824 Ga0307413_10830798 Ga0307413_108307981 179
88 3300028794 Ga0307515_10011360 Ga0307515_100113604 180
89 3300030522 Ga0307512_10005147 Ga0307512_100051477 180
90 3300031456 Ga0307513_10129993 Ga0307513_101299932 180
91 3300031616 Ga0307508_10004695 Ga0307508_100046957 180
92 3300031995 Ga0307409_100498193 Ga0307409_1004981932 180
93 3300053093 Ga0500651_0007483 Ga0500651_0007483_537_1094 180
94 3300053104 Ga0500556_0040966 Ga0500556_0040966_113_670 180
95 3300053109 Ga0500569_004395 Ga0500569_004395_1843_2400 180
96 3300053118 Ga0500594_0009954 Ga0500594_0009954_537_1094 180
97 3300053131 Ga0500652_009193 Ga0500652_009193_2662_3219 180
98 iso_pu_bacteria 2501939600 2501941416 181
99 iso_pu_bacteria 2515154129 2515719782 181
100 iso_pu_bacteria 2515154202 2516082328 181
101 iso_pu_bacteria 2551306166 2552109480 181
102 iso_pu_bacteria 2558860112 2558910921 181
103 iso_pu_bacteria 2565956761 2566996450 181
104 iso_pu_bacteria 2622736626 2623587236 181
105 iso_pu_bacteria 2643221613 2644081820 181
106 iso_pu_bacteria 2643221687 2644486414 181
107 iso_pu_bacteria 2643221692 2644512994 181
108 iso_pu_bacteria 2643221715 2644636728 181
109 iso_pu_bacteria 2643221721 2644665137 181
110 iso_pu_bacteria 2675903059 2676485968 181
111 iso_pu_bacteria 2738541274 2738706117 181
112 iso_pu_bacteria 2738541308 2738889985 181
113 iso_pu_bacteria 2738541356 2739145435 181
114 iso_pu_bacteria 2738543005 2739205352 181
115 iso_pu_bacteria 2738543011 2739238748 181
116 iso_pu_bacteria 2738543028 2739332983 181
117 iso_pu_bacteria 2738543034 2739362182 181
118 iso_pu_bacteria 2744054611 2744957093 181
119 iso_pu_bacteria 2751185725 2753035217 181
120 iso_pu_bacteria 2751185782 2753264692 181
121 iso_pu_bacteria 2751185792 2753323734 181
122 iso_pu_bacteria 2772190715 2772642653 181
123 iso_pu_bacteria 2775506925 2776375322 181
124 iso_pu_bacteria 2831935698 2831937896 181
125 iso_pu_bacteria 2832004796 2832007506 181
126 iso_pu_bacteria 2842134933 2842138434 181
127 iso_pu_bacteria 2855670206 2855671048 181
128 iso_pu_bacteria 2855676851 2855682245 181
129 iso_pu_bacteria 2855683550 2855689293 181
130 iso_pu_bacteria 2856858025 2856861075 181
131 iso_pu_bacteria 2857288857 2857290038 181
132 iso_pu_bacteria 2858848962 2858853002 181
133 iso_pu_bacteria 2858868258 2858872419 181
134 iso_pu_bacteria 2858882152 2858884095 181
135 iso_pu_bacteria 2858888857 2858889751 181
136 iso_pu_bacteria 2858895516 2858896670 181
137 iso_pu_bacteria 2858902515 2858903796 181
138 iso_pu_bacteria 2861520306 2861520661 181
139 iso_pu_bacteria 2863067949 2863071084 181
140 iso_pu_bacteria 2866065130 2866065264 181
141 iso_pu_bacteria 2866552031 2866552656 181
142 iso_pu_bacteria 2867302475 2867304846 181
143 iso_pu_bacteria 2867312974 2867315632 181
144 iso_pu_bacteria 2867319477 2867324403 181
145 iso_pu_bacteria 2867507094 2867507742 181
146 iso_pu_bacteria 2869048445 2869053441 181
147 iso_pu_bacteria 2869061728 2869062102 181
148 iso_pu_bacteria 2869068681 2869073588 181
149 iso_pu_bacteria 2870782633 2870789114 181
150 iso_pu_bacteria 2880489317 2880493033 181
151 iso_pu_bacteria 2880495981 2880499270 181
152 iso_pu_bacteria 2887443736 2887447472 181
153 iso_pu_bacteria 2887478801 2887482811 181
154 iso_pu_bacteria 2889300758 2889301023 181
155 iso_pu_bacteria 2902582711 2902588010 181
156 iso_pu_bacteria 2902792274 2902798465 181
157 iso_pu_bacteria 2902799365 2902801593 181
158 iso_pu_bacteria 2902810491 2902813105 181
159 iso_pu_bacteria 2902837492 2902840169 181
160 iso_pu_bacteria 2904535858 2904538964 181
161 iso_pu_bacteria 2904765812 2904770090 181
162 iso_pu_bacteria 2904770941 2904771061 181
163 iso_pu_bacteria 2905926851 2905927573 181
164 iso_pu_bacteria 2905926851 2905929032 181
165 iso_pu_bacteria 2908811453 2908815105 181
166 iso_pu_bacteria 2919420072 2919424412 181
167 iso_pu_bacteria 2919432681 2919436805 181
168 iso_pu_bacteria 2922554459 2922555627 181
169 iso_pu_bacteria 2928142448 2928144942 181
170 iso_pu_bacteria 2929212328 2929214938 181
171 iso_pu_bacteria 2929219909 2929221254 181
172 iso_pu_bacteria 2929226422 2929227869 181
173 iso_pu_bacteria 2932398195 2932399285 181
174 iso_pu_bacteria 2935890801 2935891304 181
175 iso_pu_bacteria 2939743619 2939744541 181
176 iso_pu_bacteria 2956939328 2956940430 181
177 iso_pu_bacteria 2974315732 2974317280 181
178 iso_pu_bacteria 2984523437 2984525485 181
179 iso_pu_bacteria 2996221748 2996226540 181
180 iso_pu_bacteria 3001119090 3001121855 181
181 iso_pu_bacteria 649633069 649811833 181
182 iso_pu_bacteria 8001781756 8001781877 181
183 iso_pu_bacteria 8003830390 8003833043 181
184 iso_pu_bacteria 8003856774 8003862747 181
185 iso_pu_bacteria 8003870546 8003873655 181
186 iso_pu_bacteria 8054704163 8054707552 181
187 iso_pu_bacteria 8054727385 8054731918 181
188 iso_pu_bacteria 8054734606 8054739146 181
189 iso_pu_bacteria 8055412473 8055416075 181
190 iso_pu_bacteria 8056054917 8056056733 181
191 iso_pu_bacteria 8057568493 8057568960 181
192 3300050516 nmdc:mga0sz30_15560_c1 nmdc:mga0sz30_15560_c1_1950_2501 183
193 3300001977 JGI24746J21847_1001335 JGI24746J21847_10013355 185
194 3300002070 JGI24750J21931_1004234 JGI24750J21931_10042342 185
195 3300002073 JGI24745J21846_1001041 JGI24745J21846_10010411 185
196 3300002073 JGI24745J21846_1007889 JGI24745J21846_10078891 185
197 3300002073 JGI24745J21846_1013857 JGI24745J21846_10138571 185
198 3300002073 JGI24745J21846_1015920 JGI24745J21846_10159202 185
199 3300002075 JGI24738J21930_10020624 JGI24738J21930_100206242 185
200 3300002077 JGI24744J21845_10002828 JGI24744J21845_100028283 185
201 3300002077 JGI24744J21845_10024014 JGI24744J21845_100240142 185
202 3300002244 JGI24742J22300_10000835 JGI24742J22300_100008353 185
203 3300003203 JGI25406J46586_10009063 JGI25406J46586_100090632 185
204 3300003320 rootH2_10060816 rootH2_100608162 185
205 3300003320 rootH2_10238385 rootH2_102383852 185
206 3300003911 JGI25405J52794_10010510 JGI25405J52794_100105102 185
207 3300004800 Ga0058861_11731922 Ga0058861_117319221 185
208 3300005289 Ga0065704_10429919 Ga0065704_104299191 185
209 3300005327 Ga0070658_10021225 Ga0070658_100212253 185
210 3300005327 Ga0070658_10230628 Ga0070658_102306282 185
211 3300005328 Ga0070676_10093106 Ga0070676_100931062 185
212 3300005328 Ga0070676_10123619 Ga0070676_101236192 185
213 3300005328 Ga0070676_10275103 Ga0070676_102751032 185
214 3300005329 Ga0070683_100042830 Ga0070683_1000428303 185
215 3300005329 Ga0070683_100058791 Ga0070683_1000587914 185
216 3300005329 Ga0070683_100092055 Ga0070683_1000920552 185
217 3300005329 Ga0070683_100542962 Ga0070683_1005429622 185
218 3300005330 Ga0070690_100011924 Ga0070690_1000119243 185
219 3300005330 Ga0070690_100842325 Ga0070690_1008423252 185
220 3300005330 Ga0070690_100915004 Ga0070690_1009150041 185
221 3300005331 Ga0070670_100068856 Ga0070670_1000688564 185
222 3300005331 Ga0070670_100291345 Ga0070670_1002913451 185
223 3300005334 Ga0068869_100007122 Ga0068869_1000071227 185
224 3300005334 Ga0068869_100030609 Ga0068869_1000306092 185
225 3300005334 Ga0068869_100082170 Ga0068869_1000821703 185
226 3300005334 Ga0068869_100112786 Ga0068869_1001127861 185
227 3300005334 Ga0068869_100145016 Ga0068869_1001450162 185
228 3300005334 Ga0068869_100356960 Ga0068869_1003569601 185
229 3300005335 Ga0070666_10057426 Ga0070666_100574262 185
230 3300005335 Ga0070666_10488588 Ga0070666_104885882 185
231 3300005336 Ga0070680_100108753 Ga0070680_1001087532 185
232 3300005337 Ga0070682_100048620 Ga0070682_1000486204 185
233 3300005337 Ga0070682_100050343 Ga0070682_1000503433 185
234 3300005337 Ga0070682_100053136 Ga0070682_1000531363 185
235 3300005337 Ga0070682_100085974 Ga0070682_1000859742 185
236 3300005337 Ga0070682_100191149 Ga0070682_1001911492 185
237 3300005337 Ga0070682_100196975 Ga0070682_1001969752 185
238 3300005337 Ga0070682_100249368 Ga0070682_1002493681 185
239 3300005337 Ga0070682_100417346 Ga0070682_1004173462 185
240 3300005337 Ga0070682_100581041 Ga0070682_1005810411 185
241 3300005337 Ga0070682_101094494 Ga0070682_1010944941 185
242 3300005338 Ga0068868_100001250 Ga0068868_10000125010 185
243 3300005338 Ga0068868_100030399 Ga0068868_1000303992 185
244 3300005338 Ga0068868_100089130 Ga0068868_1000891303 185
245 3300005338 Ga0068868_100125414 Ga0068868_1001254142 185
246 3300005338 Ga0068868_100187225 Ga0068868_1001872251 185
247 3300005338 Ga0068868_100193001 Ga0068868_1001930011 185
248 3300005338 Ga0068868_100813910 Ga0068868_1008139101 185
249 3300005338 Ga0068868_101195791 Ga0068868_1011957911 185
250 3300005339 Ga0070660_100043371 Ga0070660_1000433712 185
251 3300005339 Ga0070660_100214062 Ga0070660_1002140621 185
252 3300005339 Ga0070660_100332716 Ga0070660_1003327162 185
253 3300005340 Ga0070689_100016994 Ga0070689_1000169942 185
254 3300005340 Ga0070689_100048266 Ga0070689_1000482664 185
255 3300005340 Ga0070689_100376551 Ga0070689_1003765511 185
256 3300005340 Ga0070689_100476787 Ga0070689_1004767871 185
257 3300005340 Ga0070689_100578827 Ga0070689_1005788272 185
258 3300005341 Ga0070691_10040048 Ga0070691_100400483 185
259 3300005341 Ga0070691_10177565 Ga0070691_101775652 185
260 3300005343 Ga0070687_100051219 Ga0070687_1000512193 185
261 3300005343 Ga0070687_100258358 Ga0070687_1002583581 185
262 3300005343 Ga0070687_100742026 Ga0070687_1007420261 185
263 3300005344 Ga0070661_100071344 Ga0070661_1000713442 185
264 3300005344 Ga0070661_100112490 Ga0070661_1001124902 185
265 3300005344 Ga0070661_100146238 Ga0070661_1001462382 185
266 3300005344 Ga0070661_100308906 Ga0070661_1003089062 185
267 3300005344 Ga0070661_100486662 Ga0070661_1004866622 185
268 3300005344 Ga0070661_100538570 Ga0070661_1005385701 185
269 3300005345 Ga0070692_10030223 Ga0070692_100302233 185
270 3300005345 Ga0070692_10053955 Ga0070692_100539553 185
271 3300005345 Ga0070692_10093348 Ga0070692_100933481 185
272 3300005345 Ga0070692_10587960 Ga0070692_105879602 185
273 3300005347 Ga0070668_100003037 Ga0070668_10000303712 185
274 3300005347 Ga0070668_100049426 Ga0070668_1000494264 185
275 3300005347 Ga0070668_100227273 Ga0070668_1002272731 185
276 3300005347 Ga0070668_100407522 Ga0070668_1004075222 185
277 3300005347 Ga0070668_100423477 Ga0070668_1004234772 185
278 3300005353 Ga0070669_100008356 Ga0070669_1000083565 185
279 3300005353 Ga0070669_100023215 Ga0070669_1000232152 185
280 3300005353 Ga0070669_100198835 Ga0070669_1001988353 185
281 3300005353 Ga0070669_100387977 Ga0070669_1003879772 185
282 3300005353 Ga0070669_101144366 Ga0070669_1011443661 185
283 3300005354 Ga0070675_100002212 Ga0070675_10000221212 185
284 3300005354 Ga0070675_100057136 Ga0070675_1000571364 185
285 3300005354 Ga0070675_100131944 Ga0070675_1001319443 185
286 3300005354 Ga0070675_100163558 Ga0070675_1001635582 185
287 3300005355 Ga0070671_100034479 Ga0070671_1000344794 185
288 3300005355 Ga0070671_100047862 Ga0070671_1000478624 185
289 3300005355 Ga0070671_100157849 Ga0070671_1001578492 185
290 3300005355 Ga0070671_100537995 Ga0070671_1005379952 185
291 3300005356 Ga0070674_100000850 Ga0070674_1000008506 185
292 3300005356 Ga0070674_100028726 Ga0070674_1000287263 185
293 3300005356 Ga0070674_100064174 Ga0070674_1000641742 185
294 3300005364 Ga0070673_100025346 Ga0070673_1000253464 185
295 3300005364 Ga0070673_100038494 Ga0070673_1000384944 185
296 3300005364 Ga0070673_100067119 Ga0070673_1000671193 185
297 3300005365 Ga0070688_100063129 Ga0070688_1000631293 185
298 3300005365 Ga0070688_100157550 Ga0070688_1001575502 185
299 3300005365 Ga0070688_100329039 Ga0070688_1003290391 185
300 3300005366 Ga0070659_100018903 Ga0070659_1000189034 185
301 3300005366 Ga0070659_100046757 Ga0070659_1000467572 185
302 3300005366 Ga0070659_100059912 Ga0070659_1000599122 185
303 3300005366 Ga0070659_100085000 Ga0070659_1000850003 185
304 3300005366 Ga0070659_100086906 Ga0070659_1000869063 185
305 3300005366 Ga0070659_100242023 Ga0070659_1002420232 185
306 3300005367 Ga0070667_100000391 Ga0070667_10000039151 185
307 3300005367 Ga0070667_100008372 Ga0070667_1000083727 185
308 3300005367 Ga0070667_100077191 Ga0070667_1000771913 185
309 3300005367 Ga0070667_100266579 Ga0070667_1002665792 185
310 3300005367 Ga0070667_101516628 Ga0070667_1015166281 185
311 3300005434 Ga0070709_10008373 Ga0070709_100083735 185
312 3300005434 Ga0070709_10061101 Ga0070709_100611011 185
313 3300005434 Ga0070709_10185081 Ga0070709_101850812 185
314 3300005435 Ga0070714_100000056 Ga0070714_10000005690 185
315 3300005435 Ga0070714_100037899 Ga0070714_1000378992 185
316 3300005435 Ga0070714_100102891 Ga0070714_1001028912 185
317 3300005435 Ga0070714_100128268 Ga0070714_1001282682 185
318 3300005435 Ga0070714_100301431 Ga0070714_1003014312 185
319 3300005435 Ga0070714_100348342 Ga0070714_1003483422 185
320 3300005436 Ga0070713_100020391 Ga0070713_1000203915 185
321 3300005437 Ga0070710_10003475 Ga0070710_100034753 185
322 3300005437 Ga0070710_10007995 Ga0070710_100079956 185
323 3300005437 Ga0070710_10029829 Ga0070710_100298292 185
324 3300005437 Ga0070710_10036582 Ga0070710_100365821 185
325 3300005437 Ga0070710_10092930 Ga0070710_100929303 185
326 3300005437 Ga0070710_10807900 Ga0070710_108079001 185
327 3300005438 Ga0070701_10002527 Ga0070701_100025278 185
328 3300005438 Ga0070701_10031045 Ga0070701_100310453 185
329 3300005439 Ga0070711_100000595 Ga0070711_10000059510 185
330 3300005439 Ga0070711_100009414 Ga0070711_1000094146 185
331 3300005439 Ga0070711_100012021 Ga0070711_1000120212 185
332 3300005439 Ga0070711_100181378 Ga0070711_1001813782 185
333 3300005440 Ga0070705_100024538 Ga0070705_1000245385 185
334 3300005440 Ga0070705_100025127 Ga0070705_1000251273 185
335 3300005440 Ga0070705_100038628 Ga0070705_1000386282 185
336 3300005441 Ga0070700_100001993 Ga0070700_1000019935 185
337 3300005441 Ga0070700_100070284 Ga0070700_1000702843 185
338 3300005444 Ga0070694_100025849 Ga0070694_1000258492 185
339 3300005444 Ga0070694_100027673 Ga0070694_1000276733 185
340 3300005444 Ga0070694_100097444 Ga0070694_1000974442 185
341 3300005445 Ga0070708_100161942 Ga0070708_1001619421 185
342 3300005445 Ga0070708_100275757 Ga0070708_1002757572 185
343 3300005455 Ga0070663_100005834 Ga0070663_1000058348 185
344 3300005455 Ga0070663_100039879 Ga0070663_1000398793 185
345 3300005455 Ga0070663_100157788 Ga0070663_1001577882 185
346 3300005456 Ga0070678_100000276 Ga0070678_1000002767 185
347 3300005456 Ga0070678_100072316 Ga0070678_1000723163 185
348 3300005456 Ga0070678_100092341 Ga0070678_1000923412 185
349 3300005456 Ga0070678_100153378 Ga0070678_1001533782 185
350 3300005456 Ga0070678_100374796 Ga0070678_1003747961 185
351 3300005456 Ga0070678_100478293 Ga0070678_1004782932 185
352 3300005457 Ga0070662_100005451 Ga0070662_1000054515 185
353 3300005457 Ga0070662_100055537 Ga0070662_1000555372 185
354 3300005457 Ga0070662_100075255 Ga0070662_1000752553 185
355 3300005457 Ga0070662_100087738 Ga0070662_1000877382 185
356 3300005458 Ga0070681_10179082 Ga0070681_101790823 185
357 3300005458 Ga0070681_10441761 Ga0070681_104417611 185
358 3300005458 Ga0070681_10677359 Ga0070681_106773592 185
359 3300005459 Ga0068867_100000320 Ga0068867_10000032036 185
360 3300005459 Ga0068867_100110924 Ga0068867_1001109243 185
361 3300005459 Ga0068867_100147340 Ga0068867_1001473402 185
362 3300005466 Ga0070685_10215364 Ga0070685_102153642 185
363 3300005467 Ga0070706_100416819 Ga0070706_1004168192 185
364 3300005467 Ga0070706_100611089 Ga0070706_1006110892 185
365 3300005471 Ga0070698_100657706 Ga0070698_1006577061 185
366 3300005530 Ga0070679_100027588 Ga0070679_1000275883 185
367 3300005530 Ga0070679_100057418 Ga0070679_1000574184 185
368 3300005530 Ga0070679_100309092 Ga0070679_1003090922 185
369 3300005530 Ga0070679_100519563 Ga0070679_1005195632 185
370 3300005530 Ga0070679_100547304 Ga0070679_1005473042 185
371 3300005535 Ga0070684_100013677 Ga0070684_1000136774 185
372 3300005535 Ga0070684_100038916 Ga0070684_1000389165 185
373 3300005535 Ga0070684_100183584 Ga0070684_1001835842 185
374 3300005535 Ga0070684_100340572 Ga0070684_1003405722 185
375 3300005535 Ga0070684_100452781 Ga0070684_1004527811 185
376 3300005535 Ga0070684_100653962 Ga0070684_1006539621 185
377 3300005535 Ga0070684_100738755 Ga0070684_1007387552 185
378 3300005535 Ga0070684_100750483 Ga0070684_1007504831 185
379 3300005539 Ga0068853_100001607 Ga0068853_1000016075 185
380 3300005539 Ga0068853_100004868 Ga0068853_1000048688 185
381 3300005539 Ga0068853_100020996 Ga0068853_1000209966 185
382 3300005539 Ga0068853_100051961 Ga0068853_1000519611 185
383 3300005539 Ga0068853_100056739 Ga0068853_1000567393 185
384 3300005539 Ga0068853_100124594 Ga0068853_1001245942 185
385 3300005543 Ga0070672_100126500 Ga0070672_1001265003 185
386 3300005543 Ga0070672_100200148 Ga0070672_1002001482 185
387 3300005544 Ga0070686_100013174 Ga0070686_1000131746 185
388 3300005545 Ga0070695_100071349 Ga0070695_1000713492 185
389 3300005545 Ga0070695_100087038 Ga0070695_1000870382 185
390 3300005545 Ga0070695_100282316 Ga0070695_1002823162 185
391 3300005546 Ga0070696_100003931 Ga0070696_10000393111 185
392 3300005546 Ga0070696_100008598 Ga0070696_1000085985 185
393 3300005546 Ga0070696_100129665 Ga0070696_1001296653 185
394 3300005546 Ga0070696_100617101 Ga0070696_1006171012 185
395 3300005547 Ga0070693_100007579 Ga0070693_1000075792 185
396 3300005547 Ga0070693_100094068 Ga0070693_1000940683 185
397 3300005547 Ga0070693_100309565 Ga0070693_1003095651 185
398 3300005547 Ga0070693_100331306 Ga0070693_1003313062 185
399 3300005548 Ga0070665_100020646 Ga0070665_1000206467 185
400 3300005548 Ga0070665_100165102 Ga0070665_1001651021 185
401 3300005548 Ga0070665_100196213 Ga0070665_1001962132 185
402 3300005548 Ga0070665_100196986 Ga0070665_1001969862 185
403 3300005548 Ga0070665_100552961 Ga0070665_1005529612 185
404 3300005549 Ga0070704_100000184 Ga0070704_10000018422 185
405 3300005549 Ga0070704_100047627 Ga0070704_1000476272 185
406 3300005549 Ga0070704_100383031 Ga0070704_1003830312 185
407 3300005563 Ga0068855_100108544 Ga0068855_1001085442 185
408 3300005563 Ga0068855_100121623 Ga0068855_1001216235 185
409 3300005563 Ga0068855_100199355 Ga0068855_1001993552 185
410 3300005563 Ga0068855_100221382 Ga0068855_1002213822 185
411 3300005563 Ga0068855_100538998 Ga0068855_1005389981 185
412 3300005564 Ga0070664_100003229 Ga0070664_1000032292 185
413 3300005564 Ga0070664_100106454 Ga0070664_1001064541 185
414 3300005564 Ga0070664_101079957 Ga0070664_1010799571 185
415 3300005577 Ga0068857_100132853 Ga0068857_1001328532 185
416 3300005577 Ga0068857_100138500 Ga0068857_1001385002 185
417 3300005577 Ga0068857_100158665 Ga0068857_1001586652 185
418 3300005577 Ga0068857_100266717 Ga0068857_1002667172 185
419 3300005577 Ga0068857_100346305 Ga0068857_1003463052 185
420 3300005577 Ga0068857_100628384 Ga0068857_1006283842 185
421 3300005578 Ga0068854_100001413 Ga0068854_10000141313 185
422 3300005578 Ga0068854_100063636 Ga0068854_1000636361 185
423 3300005578 Ga0068854_100225333 Ga0068854_1002253332 185
424 3300005578 Ga0068854_100229775 Ga0068854_1002297752 185
425 3300005578 Ga0068854_100285756 Ga0068854_1002857562 185
426 3300005578 Ga0068854_100316415 Ga0068854_1003164152 185
427 3300005614 Ga0068856_100154004 Ga0068856_1001540042 185
428 3300005614 Ga0068856_100170942 Ga0068856_1001709423 185
429 3300005614 Ga0068856_100512350 Ga0068856_1005123502 185
430 3300005615 Ga0070702_100010452 Ga0070702_1000104526 185
431 3300005615 Ga0070702_100015026 Ga0070702_1000150265 185
432 3300005615 Ga0070702_100032468 Ga0070702_1000324682 185
433 3300005615 Ga0070702_100148365 Ga0070702_1001483652 185
434 3300005615 Ga0070702_100471760 Ga0070702_1004717602 185
435 3300005616 Ga0068852_100066923 Ga0068852_1000669233 185
436 3300005616 Ga0068852_100085842 Ga0068852_1000858422 185
437 3300005616 Ga0068852_100109092 Ga0068852_1001090923 185
438 3300005616 Ga0068852_100158257 Ga0068852_1001582573 185
439 3300005616 Ga0068852_100290312 Ga0068852_1002903122 185
440 3300005616 Ga0068852_100334689 Ga0068852_1003346892 185
441 3300005616 Ga0068852_100362186 Ga0068852_1003621862 185
442 3300005616 Ga0068852_100381863 Ga0068852_1003818632 185
443 3300005617 Ga0068859_100012772 Ga0068859_1000127725 185
444 3300005617 Ga0068859_100026035 Ga0068859_1000260352 185
445 3300005617 Ga0068859_100054216 Ga0068859_1000542162 185
446 3300005617 Ga0068859_100118004 Ga0068859_1001180042 185
447 3300005617 Ga0068859_100197682 Ga0068859_1001976821 185
448 3300005617 Ga0068859_100295277 Ga0068859_1002952772 185
449 3300005618 Ga0068864_100006670 Ga0068864_1000066703 185
450 3300005618 Ga0068864_100033308 Ga0068864_1000333082 185
451 3300005618 Ga0068864_100036395 Ga0068864_1000363952 185
452 3300005618 Ga0068864_100179316 Ga0068864_1001793163 185
453 3300005618 Ga0068864_100210587 Ga0068864_1002105872 185
454 3300005618 Ga0068864_100281335 Ga0068864_1002813352 185
455 3300005618 Ga0068864_100349542 Ga0068864_1003495422 185
456 3300005618 Ga0068864_101649673 Ga0068864_1016496731 185
457 3300005718 Ga0068866_10000526 Ga0068866_1000052612 185
458 3300005718 Ga0068866_10005191 Ga0068866_100051916 185
459 3300005718 Ga0068866_10046634 Ga0068866_100466343 185
460 3300005718 Ga0068866_10297188 Ga0068866_102971882 185
461 3300005719 Ga0068861_100001788 Ga0068861_10000178811 185
462 3300005719 Ga0068861_100047564 Ga0068861_1000475642 185
463 3300005719 Ga0068861_100077274 Ga0068861_1000772743 185
464 3300005719 Ga0068861_100084706 Ga0068861_1000847063 185
465 3300005719 Ga0068861_100294004 Ga0068861_1002940042 185
466 3300005719 Ga0068861_100391724 Ga0068861_1003917242 185
467 3300005834 Ga0068851_10071493 Ga0068851_100714933 185
468 3300005834 Ga0068851_10235629 Ga0068851_102356292 185
469 3300005840 Ga0068870_10075535 Ga0068870_100755352 185
470 3300005840 Ga0068870_10226249 Ga0068870_102262492 185
471 3300005841 Ga0068863_100000992 Ga0068863_10000099221 185
472 3300005841 Ga0068863_100022881 Ga0068863_1000228814 185
473 3300005841 Ga0068863_100023167 Ga0068863_1000231675 185
474 3300005841 Ga0068863_100044586 Ga0068863_1000445862 185
475 3300005841 Ga0068863_100082944 Ga0068863_1000829443 185
476 3300005841 Ga0068863_100151212 Ga0068863_1001512122 185
477 3300005841 Ga0068863_100158361 Ga0068863_1001583612 185
478 3300005841 Ga0068863_100209541 Ga0068863_1002095412 185
479 3300005841 Ga0068863_100687152 Ga0068863_1006871522 185
480 3300005841 Ga0068863_101044289 Ga0068863_1010442891 185
481 3300005842 Ga0068858_100000750 Ga0068858_10000075020 185
482 3300005842 Ga0068858_100003214 Ga0068858_10000321413 185
483 3300005842 Ga0068858_100006333 Ga0068858_10000633310 185
484 3300005842 Ga0068858_100103526 Ga0068858_1001035262 185
485 3300005842 Ga0068858_100206484 Ga0068858_1002064842 185
486 3300005842 Ga0068858_100544221 Ga0068858_1005442212 185
487 3300005842 Ga0068858_100588892 Ga0068858_1005888921 185
488 3300005843 Ga0068860_100000065 Ga0068860_100000065190 185
489 3300005843 Ga0068860_100016486 Ga0068860_1000164863 185
490 3300005843 Ga0068860_100074449 Ga0068860_1000744494 185
491 3300005843 Ga0068860_100136722 Ga0068860_1001367222 185
492 3300005843 Ga0068860_100217306 Ga0068860_1002173061 185
493 3300005843 Ga0068860_100316612 Ga0068860_1003166122 185
494 3300005843 Ga0068860_100567767 Ga0068860_1005677672 185
495 3300005843 Ga0068860_100734919 Ga0068860_1007349191 185
496 3300005844 Ga0068862_100000028 Ga0068862_100000028184 185
497 3300005844 Ga0068862_100000110 Ga0068862_10000011045 185
498 3300005844 Ga0068862_100006896 Ga0068862_10000689611 185
499 3300005844 Ga0068862_100084719 Ga0068862_1000847193 185
500 3300005844 Ga0068862_100095526 Ga0068862_1000955262 185
501 3300005844 Ga0068862_100528140 Ga0068862_1005281402 185
502 3300005937 Ga0081455_10000011 Ga0081455_10000011114 185
503 3300005937 Ga0081455_10035096 Ga0081455_100350964 185
504 3300005937 Ga0081455_10467276 Ga0081455_104672761 185
505 3300005981 Ga0081538_10112439 Ga0081538_101124392 185
506 3300005983 Ga0081540_1004419 Ga0081540_10044198 185
507 3300005983 Ga0081540_1014293 Ga0081540_10142934 185
508 3300005983 Ga0081540_1041855 Ga0081540_10418552 185
509 3300005983 Ga0081540_1090796 Ga0081540_10907962 185
510 3300005985 Ga0081539_10000357 Ga0081539_1000035768 185
511 3300005985 Ga0081539_10000420 Ga0081539_1000042068 185
512 3300005985 Ga0081539_10000680 Ga0081539_1000068066 185
513 3300005985 Ga0081539_10001106 Ga0081539_100011063 185
514 3300005985 Ga0081539_10003644 Ga0081539_1000364415 185
515 3300005985 Ga0081539_10005819 Ga0081539_100058196 185
516 3300005985 Ga0081539_10202618 Ga0081539_102026182 185
517 3300006028 Ga0070717_10043437 Ga0070717_100434374 185
518 3300006028 Ga0070717_10134693 Ga0070717_101346932 185
519 3300006028 Ga0070717_10545693 Ga0070717_105456932 185
520 3300006038 Ga0075365_10016206 Ga0075365_100162066 185
521 3300006038 Ga0075365_10103485 Ga0075365_101034853 185
522 3300006038 Ga0075365_10118048 Ga0075365_101180482 185
523 3300006038 Ga0075365_10376878 Ga0075365_103768782 185
524 3300006038 Ga0075365_10408943 Ga0075365_104089431 185
525 3300006038 Ga0075365_10475967 Ga0075365_104759672 185
526 3300006048 Ga0075363_100000092 Ga0075363_10000009213 185
527 3300006048 Ga0075363_100001236 Ga0075363_1000012367 185
528 3300006048 Ga0075363_100010691 Ga0075363_1000106913 185
529 3300006048 Ga0075363_100021509 Ga0075363_1000215093 185
530 3300006048 Ga0075363_100148358 Ga0075363_1001483582 185
531 3300006048 Ga0075363_100159758 Ga0075363_1001597582 185
532 3300006048 Ga0075363_100172142 Ga0075363_1001721422 185
533 3300006048 Ga0075363_100261173 Ga0075363_1002611732 185
534 3300006048 Ga0075363_100351874 Ga0075363_1003518742 185
535 3300006051 Ga0075364_10006183 Ga0075364_100061835 185
536 3300006051 Ga0075364_10007880 Ga0075364_100078807 185
537 3300006051 Ga0075364_10055165 Ga0075364_100551653 185
538 3300006051 Ga0075364_10164699 Ga0075364_101646992 185
539 3300006051 Ga0075364_10164862 Ga0075364_101648622 185
540 3300006051 Ga0075364_10423002 Ga0075364_104230022 185
541 3300006163 Ga0070715_10004796 Ga0070715_100047961 185
542 3300006163 Ga0070715_10008061 Ga0070715_100080612 185
543 3300006163 Ga0070715_10180699 Ga0070715_101806992 185
544 3300006163 Ga0070715_10202316 Ga0070715_102023162 185
545 3300006173 Ga0070716_100091011 Ga0070716_1000910112 185
546 3300006173 Ga0070716_100134195 Ga0070716_1001341952 185
547 3300006173 Ga0070716_100305270 Ga0070716_1003052702 185
548 3300006173 Ga0070716_100619009 Ga0070716_1006190092 185
549 3300006175 Ga0070712_100013395 Ga0070712_1000133955 185
550 3300006175 Ga0070712_100019203 Ga0070712_1000192034 185
551 3300006175 Ga0070712_100298843 Ga0070712_1002988432 185
552 3300006175 Ga0070712_100614789 Ga0070712_1006147892 185
553 3300006177 Ga0075362_10004621 Ga0075362_100046216 185
554 3300006177 Ga0075362_10019656 Ga0075362_100196563 185
555 3300006177 Ga0075362_10042906 Ga0075362_100429062 185
556 3300006177 Ga0075362_10059871 Ga0075362_100598712 185
557 3300006177 Ga0075362_10102641 Ga0075362_101026411 185
558 3300006177 Ga0075362_10106025 Ga0075362_101060252 185
559 3300006178 Ga0075367_10008208 Ga0075367_100082082 185
560 3300006178 Ga0075367_10106436 Ga0075367_101064362 185
561 3300006186 Ga0075369_10002792 Ga0075369_100027923 185
562 3300006186 Ga0075369_10008639 Ga0075369_100086392 185
563 3300006186 Ga0075369_10013391 Ga0075369_100133912 185
564 3300006186 Ga0075369_10017409 Ga0075369_100174092 185
565 3300006186 Ga0075369_10018806 Ga0075369_100188064 185
566 3300006186 Ga0075369_10044231 Ga0075369_100442312 185
567 3300006186 Ga0075369_10080164 Ga0075369_100801642 185
568 3300006186 Ga0075369_10135910 Ga0075369_101359102 185
569 3300006195 Ga0075366_10064827 Ga0075366_100648272 185
570 3300006237 Ga0097621_100009195 Ga0097621_1000091953 185
571 3300006237 Ga0097621_100170681 Ga0097621_1001706811 185
572 3300006237 Ga0097621_100240410 Ga0097621_1002404102 185
573 3300006237 Ga0097621_100293640 Ga0097621_1002936402 185
574 3300006353 Ga0075370_10002790 Ga0075370_100027905 185
575 3300006353 Ga0075370_10015604 Ga0075370_100156045 185
576 3300006353 Ga0075370_10027827 Ga0075370_100278271 185
577 3300006353 Ga0075370_10033031 Ga0075370_100330311 185
578 3300006353 Ga0075370_10143710 Ga0075370_101437102 185
579 3300006353 Ga0075370_10153453 Ga0075370_101534532 185
580 3300006353 Ga0075370_10271115 Ga0075370_102711152 185
581 3300006358 Ga0068871_100038545 Ga0068871_1000385452 185
582 3300006358 Ga0068871_100087983 Ga0068871_1000879833 185
583 3300006358 Ga0068871_101086503 Ga0068871_1010865032 185
584 3300006844 Ga0075428_100002313 Ga0075428_1000023137 185
585 3300006844 Ga0075428_100003267 Ga0075428_10000326722 185
586 3300006844 Ga0075428_100313185 Ga0075428_1003131852 185
587 3300006844 Ga0075428_100511938 Ga0075428_1005119382 185
588 3300006846 Ga0075430_100026976 Ga0075430_1000269763 185
589 3300006846 Ga0075430_100085218 Ga0075430_1000852183 185
590 3300006846 Ga0075430_100319826 Ga0075430_1003198262 185
591 3300006846 Ga0075430_100364668 Ga0075430_1003646681 185
592 3300006847 Ga0075431_100080055 Ga0075431_1000800552 185
593 3300006847 Ga0075431_100344471 Ga0075431_1003444712 185
594 3300006847 Ga0075431_100466461 Ga0075431_1004664612 185
595 3300006852 Ga0075433_10122705 Ga0075433_101227052 185
596 3300006871 Ga0075434_100006814 Ga0075434_1000068149 185
597 3300006871 Ga0075434_100279263 Ga0075434_1002792632 185
598 3300006880 Ga0075429_100025079 Ga0075429_1000250798 185
599 3300006880 Ga0075429_100367337 Ga0075429_1003673372 185
600 3300006880 Ga0075429_100380344 Ga0075429_1003803442 185
601 3300006880 Ga0075429_100476280 Ga0075429_1004762802 185
602 3300006881 Ga0068865_100001938 Ga0068865_10000193811 185
603 3300006881 Ga0068865_100018082 Ga0068865_1000180823 185
604 3300006881 Ga0068865_100173594 Ga0068865_1001735942 185
605 3300006881 Ga0068865_100601684 Ga0068865_1006016842 185
606 3300006914 Ga0075436_100312156 Ga0075436_1003121562 185
607 3300006931 Ga0097620_100000322 Ga0097620_10000032222 185
608 3300006931 Ga0097620_100012772 Ga0097620_1000127725 185
609 3300006931 Ga0097620_100026034 Ga0097620_1000260342 185
610 3300006931 Ga0097620_100054218 Ga0097620_1000542182 185
611 3300006931 Ga0097620_100117994 Ga0097620_1001179942 185
612 3300006931 Ga0097620_100197673 Ga0097620_1001976731 185
613 3300006931 Ga0097620_100295268 Ga0097620_1002952682 185
614 3300007076 Ga0075435_100035449 Ga0075435_1000354494 185
615 3300007076 Ga0075435_100158270 Ga0075435_1001582702 185
616 3300007076 Ga0075435_100563921 Ga0075435_1005639212 185
617 3300009011 Ga0105251_10092208 Ga0105251_100922082 185
618 3300009011 Ga0105251_10151879 Ga0105251_101518791 185
619 3300009011 Ga0105251_10261121 Ga0105251_102611211 185
620 3300009092 Ga0105250_10041633 Ga0105250_100416332 185
621 3300009092 Ga0105250_10093203 Ga0105250_100932032 185
622 3300009093 Ga0105240_10040558 Ga0105240_100405584 185
623 3300009093 Ga0105240_10251183 Ga0105240_102511833 185
624 3300009093 Ga0105240_10859993 Ga0105240_108599932 185
625 3300009094 Ga0111539_10002971 Ga0111539_100029719 185
626 3300009094 Ga0111539_10070908 Ga0111539_100709082 185
627 3300009094 Ga0111539_10113639 Ga0111539_101136395 185
628 3300009094 Ga0111539_10521576 Ga0111539_105215762 185
629 3300009098 Ga0105245_10001497 Ga0105245_1000149714 185
630 3300009098 Ga0105245_10048809 Ga0105245_100488092 185
631 3300009098 Ga0105245_10121552 Ga0105245_101215523 185
632 3300009098 Ga0105245_10144613 Ga0105245_101446133 185
633 3300009098 Ga0105245_10235375 Ga0105245_102353752 185
634 3300009098 Ga0105245_10382883 Ga0105245_103828831 185
635 3300009098 Ga0105245_10516402 Ga0105245_105164022 185
636 3300009098 Ga0105245_10529904 Ga0105245_105299041 185
637 3300009098 Ga0105245_10648670 Ga0105245_106486701 185
638 3300009101 Ga0105247_10000232 Ga0105247_100002327 185
639 3300009101 Ga0105247_10000754 Ga0105247_1000075414 185
640 3300009101 Ga0105247_10002255 Ga0105247_1000225514 185
641 3300009101 Ga0105247_10023618 Ga0105247_100236184 185
642 3300009101 Ga0105247_10074245 Ga0105247_100742452 185
643 3300009101 Ga0105247_10142034 Ga0105247_101420342 185
644 3300009101 Ga0105247_10214382 Ga0105247_102143822 185
645 3300009101 Ga0105247_10232005 Ga0105247_102320052 185
646 3300009101 Ga0105247_10381038 Ga0105247_103810381 185
647 3300009101 Ga0105247_10469860 Ga0105247_104698602 185
648 3300009147 Ga0114129_10000007 Ga0114129_1000000789 185
649 3300009147 Ga0114129_10015755 Ga0114129_100157557 185
650 3300009147 Ga0114129_10058537 Ga0114129_100585372 185
651 3300009147 Ga0114129_10399851 Ga0114129_103998512 185
652 3300009147 Ga0114129_10595628 Ga0114129_105956282 185
653 3300009147 Ga0114129_11508375 Ga0114129_115083752 185
654 3300009148 Ga0105243_10008326 Ga0105243_100083265 185
655 3300009148 Ga0105243_10011814 Ga0105243_100118144 185
656 3300009148 Ga0105243_10084722 Ga0105243_100847221 185
657 3300009148 Ga0105243_10213194 Ga0105243_102131942 185
658 3300009148 Ga0105243_10719281 Ga0105243_107192812 185
659 3300009174 Ga0105241_10067727 Ga0105241_100677273 185
660 3300009174 Ga0105241_10137038 Ga0105241_101370382 185
661 3300009174 Ga0105241_10153526 Ga0105241_101535262 185
662 3300009174 Ga0105241_10173812 Ga0105241_101738121 185
663 3300009174 Ga0105241_10253361 Ga0105241_102533612 185
664 3300009176 Ga0105242_10000231 Ga0105242_1000023119 185
665 3300009176 Ga0105242_10035233 Ga0105242_100352334 185
666 3300009176 Ga0105242_10162856 Ga0105242_101628562 185
667 3300009176 Ga0105242_10743525 Ga0105242_107435252 185
668 3300009177 Ga0105248_10000074 Ga0105248_100000747 185
669 3300009177 Ga0105248_10001522 Ga0105248_1000152213 185
670 3300009177 Ga0105248_10026214 Ga0105248_100262146 185
671 3300009177 Ga0105248_10031011 Ga0105248_100310114 185
672 3300009177 Ga0105248_10138265 Ga0105248_101382654 185
673 3300009177 Ga0105248_10142666 Ga0105248_101426662 185
674 3300009177 Ga0105248_10226065 Ga0105248_102260653 185
675 3300009177 Ga0105248_10613528 Ga0105248_106135282 185
676 3300009545 Ga0105237_10000346 Ga0105237_1000034654 185
677 3300009545 Ga0105237_10029171 Ga0105237_100291716 185
678 3300009545 Ga0105237_10037080 Ga0105237_100370803 185
679 3300009545 Ga0105237_10158544 Ga0105237_101585442 185
680 3300009545 Ga0105237_10443456 Ga0105237_104434562 185
681 3300009545 Ga0105237_10517556 Ga0105237_105175562 185
682 3300009545 Ga0105237_10967305 Ga0105237_109673051 185
683 3300009551 Ga0105238_10020202 Ga0105238_100202025 185
684 3300009551 Ga0105238_10070194 Ga0105238_100701942 185
685 3300009551 Ga0105238_10316347 Ga0105238_103163472 185
686 3300009551 Ga0105238_10372256 Ga0105238_103722562 185
687 3300009551 Ga0105238_10420448 Ga0105238_104204482 185
688 3300009551 Ga0105238_10636139 Ga0105238_106361391 185
689 3300009551 Ga0105238_10759295 Ga0105238_107592952 185
690 3300009551 Ga0105238_10916429 Ga0105238_109164291 185
691 3300009551 Ga0105238_11367468 Ga0105238_113674681 185
692 3300009553 Ga0105249_10000011 Ga0105249_10000011273 185
693 3300009553 Ga0105249_10004109 Ga0105249_1000410913 185
694 3300009553 Ga0105249_10010083 Ga0105249_100100834 185
695 3300009553 Ga0105249_10119493 Ga0105249_101194933 185
696 3300009553 Ga0105249_10242691 Ga0105249_102426912 185
697 3300009553 Ga0105249_10246958 Ga0105249_102469582 185
698 3300009553 Ga0105249_10368138 Ga0105249_103681381 185
699 3300009553 Ga0105249_10487925 Ga0105249_104879251 185
700 3300009553 Ga0105249_10948645 Ga0105249_109486451 185
701 3300009979 Ga0105032_105112 Ga0105032_1051122 185
702 3300009984 Ga0105029_100136 Ga0105029_1001362 185
703 3300009988 Ga0105035_101949 Ga0105035_1019492 185
704 3300010375 Ga0105239_10003686 Ga0105239_100036861 185
705 3300010375 Ga0105239_10018741 Ga0105239_100187417 185
706 3300010375 Ga0105239_10084332 Ga0105239_100843324 185
707 3300010375 Ga0105239_10221791 Ga0105239_102217912 185
708 3300010375 Ga0105239_10256025 Ga0105239_102560252 185
709 3300010375 Ga0105239_10276407 Ga0105239_102764072 185
710 3300010375 Ga0105239_10342119 Ga0105239_103421192 185
711 3300010375 Ga0105239_10525655 Ga0105239_105256551 185
712 3300010375 Ga0105239_10882243 Ga0105239_108822432 185
713 3300010375 Ga0105239_10914610 Ga0105239_109146102 185
714 3300011119 Ga0105246_10005154 Ga0105246_100051542 185
715 3300011119 Ga0105246_10014706 Ga0105246_100147068 185
716 3300011119 Ga0105246_10104010 Ga0105246_101040103 185
717 3300011119 Ga0105246_10294995 Ga0105246_102949952 185
718 3300011119 Ga0105246_10488445 Ga0105246_104884452 185
719 3300012495 Ga0157323_1004315 Ga0157323_10043152 185
720 3300012502 Ga0157347_1005832 Ga0157347_10058322 185
721 3300013059 Ga0154012_138397 Ga0154012_1383971 185
722 3300013100 Ga0157373_10364109 Ga0157373_103641092 185
723 3300013102 Ga0157371_10034818 Ga0157371_100348184 185
724 3300013102 Ga0157371_10312917 Ga0157371_103129171 185
725 3300013104 Ga0157370_10020884 Ga0157370_100208842 185
726 3300013104 Ga0157370_10053602 Ga0157370_100536023 185
727 3300013104 Ga0157370_10069658 Ga0157370_100696582 185
728 3300013104 Ga0157370_10247308 Ga0157370_102473082 185
729 3300013104 Ga0157370_10556027 Ga0157370_105560272 185
730 3300013104 Ga0157370_10948379 Ga0157370_109483791 185
731 3300013105 Ga0157369_10008553 Ga0157369_1000855310 185
732 3300013105 Ga0157369_10074745 Ga0157369_100747452 185
733 3300013105 Ga0157369_10340893 Ga0157369_103408931 185
734 3300013105 Ga0157369_10618412 Ga0157369_106184122 185
735 3300013105 Ga0157369_11239925 Ga0157369_112399252 185
736 3300013296 Ga0157374_10013939 Ga0157374_100139396 185
737 3300013296 Ga0157374_10100419 Ga0157374_101004191 185
738 3300013296 Ga0157374_10182704 Ga0157374_101827043 185
739 3300013296 Ga0157374_10295119 Ga0157374_102951192 185
740 3300013296 Ga0157374_10419078 Ga0157374_104190782 185
741 3300013296 Ga0157374_10512663 Ga0157374_105126631 185
742 3300013296 Ga0157374_10717581 Ga0157374_107175812 185
743 3300013296 Ga0157374_10812090 Ga0157374_108120902 185
744 3300013296 Ga0157374_10979151 Ga0157374_109791511 185
745 3300013297 Ga0157378_10001759 Ga0157378_1000175914 185
746 3300013297 Ga0157378_10273058 Ga0157378_102730582 185
747 3300013297 Ga0157378_10752387 Ga0157378_107523871 185
748 3300013297 Ga0157378_11011475 Ga0157378_110114752 185
749 3300013306 Ga0163162_10001663 Ga0163162_100016637 185
750 3300013306 Ga0163162_10063442 Ga0163162_100634423 185
751 3300013306 Ga0163162_10106362 Ga0163162_101063624 185
752 3300013306 Ga0163162_10203582 Ga0163162_102035823 185
753 3300013306 Ga0163162_10293884 Ga0163162_102938842 185
754 3300013306 Ga0163162_10448195 Ga0163162_104481952 185
755 3300013306 Ga0163162_11332066 Ga0163162_113320661 185
756 3300013307 Ga0157372_10003438 Ga0157372_100034385 185
757 3300013307 Ga0157372_10114864 Ga0157372_101148642 185
758 3300013307 Ga0157372_10240053 Ga0157372_102400533 185
759 3300013307 Ga0157372_10325276 Ga0157372_103252762 185
760 3300013307 Ga0157372_10815225 Ga0157372_108152252 185
761 3300013307 Ga0157372_11370791 Ga0157372_113707912 185
762 3300013308 Ga0157375_10000224 Ga0157375_1000022442 185
763 3300013308 Ga0157375_10075779 Ga0157375_100757794 185
764 3300013308 Ga0157375_10101666 Ga0157375_101016662 185
765 3300013308 Ga0157375_10196752 Ga0157375_101967523 185
766 3300013308 Ga0157375_10206687 Ga0157375_102066872 185
767 3300013308 Ga0157375_10231543 Ga0157375_102315432 185
768 3300013308 Ga0157375_11962545 Ga0157375_119625451 185
769 3300013875 Ga0157515_159099 Ga0157515_1590992 185
770 3300014325 Ga0163163_10006085 Ga0163163_100060854 185
771 3300014325 Ga0163163_10034724 Ga0163163_100347245 185
772 3300014325 Ga0163163_10051315 Ga0163163_100513154 185
773 3300014325 Ga0163163_10063624 Ga0163163_100636244 185
774 3300014325 Ga0163163_10079214 Ga0163163_100792144 185
775 3300014325 Ga0163163_10086811 Ga0163163_100868112 185
776 3300014325 Ga0163163_10215661 Ga0163163_102156613 185
777 3300014325 Ga0163163_10253264 Ga0163163_102532642 185
778 3300014325 Ga0163163_10263408 Ga0163163_102634082 185
779 3300014326 Ga0157380_10000982 Ga0157380_1000098215 185
780 3300014326 Ga0157380_10072752 Ga0157380_100727524 185
781 3300014326 Ga0157380_10274460 Ga0157380_102744602 185
782 3300014326 Ga0157380_10373791 Ga0157380_103737912 185
783 3300014326 Ga0157380_11194639 Ga0157380_111946391 185
784 3300014497 Ga0182008_10109855 Ga0182008_101098552 185
785 3300014497 Ga0182008_10197311 Ga0182008_101973112 185
786 3300014745 Ga0157377_10029831 Ga0157377_100298312 185
787 3300014745 Ga0157377_10094235 Ga0157377_100942351 185
788 3300014745 Ga0157377_10223554 Ga0157377_102235542 185
789 3300014968 Ga0157379_10018243 Ga0157379_100182434 185
790 3300014968 Ga0157379_10019041 Ga0157379_100190413 185
791 3300014968 Ga0157379_10022891 Ga0157379_100228914 185
792 3300014968 Ga0157379_10043277 Ga0157379_100432774 185
793 3300014968 Ga0157379_10058626 Ga0157379_100586264 185
794 3300014968 Ga0157379_10133902 Ga0157379_101339022 185
795 3300014968 Ga0157379_10152763 Ga0157379_101527632 185
796 3300014969 Ga0157376_10019006 Ga0157376_100190064 185
797 3300014969 Ga0157376_10066089 Ga0157376_100660893 185
798 3300014969 Ga0157376_10129112 Ga0157376_101291123 185
799 3300014969 Ga0157376_10760586 Ga0157376_107605862 185
800 3300014969 Ga0157376_11008650 Ga0157376_110086501 185
801 3300017792 Ga0163161_10001626 Ga0163161_1000162612 185
802 3300017792 Ga0163161_10027585 Ga0163161_100275852 185
803 3300017792 Ga0163161_10293028 Ga0163161_102930282 185
804 3300017792 Ga0163161_10324724 Ga0163161_103247242 185
805 3300017792 Ga0163161_10490299 Ga0163161_104902992 185
806 3300017792 Ga0163161_10571994 Ga0163161_105719942 185
807 3300020070 Ga0206356_10320805 Ga0206356_103208052 185
808 3300020070 Ga0206356_10609702 Ga0206356_106097021 185
809 3300020070 Ga0206356_11194379 Ga0206356_111943792 185
810 3300020070 Ga0206356_11324533 Ga0206356_113245333 185
811 3300020075 Ga0206349_1101175 Ga0206349_11011754 185
812 3300020075 Ga0206349_1679340 Ga0206349_16793401 185
813 3300020076 Ga0206355_1552033 Ga0206355_15520332 185
814 3300020077 Ga0206351_10158893 Ga0206351_101588931 185
815 3300020077 Ga0206351_10874777 Ga0206351_108747773 185
816 3300020080 Ga0206350_10331501 Ga0206350_103315011 185
817 3300020080 Ga0206350_11237489 Ga0206350_112374892 185
818 3300020081 Ga0206354_10283692 Ga0206354_102836922 185
819 3300020081 Ga0206354_10311176 Ga0206354_103111762 185
820 3300020081 Ga0206354_10683940 Ga0206354_106839402 185
821 3300020081 Ga0206354_11633010 Ga0206354_116330101 185
822 3300020082 Ga0206353_10505886 Ga0206353_105058862 185
823 3300020082 Ga0206353_11472539 Ga0206353_114725392 185
824 3300020082 Ga0206353_11490980 Ga0206353_114909802 185
825 3300021377 Ga0213874_10134824 Ga0213874_101348242 185
826 3300021384 Ga0213876_10006113 Ga0213876_100061136 185
827 3300021384 Ga0213876_10026227 Ga0213876_100262274 185
828 3300021384 Ga0213876_10073349 Ga0213876_100733492 185
829 3300021388 Ga0213875_10034968 Ga0213875_100349683 185
830 3300021388 Ga0213875_10048694 Ga0213875_100486943 185
831 3300022467 Ga0224712_10003696 Ga0224712_100036962 185
832 3300022467 Ga0224712_10006549 Ga0224712_100065492 185
833 3300022467 Ga0224712_10013485 Ga0224712_100134853 185
834 3300022467 Ga0224712_10184953 Ga0224712_101849531 185
835 3300025273 Ga0209673_1023554 Ga0209673_10235542 185
836 3300025303 Ga0209051_1000374 Ga0209051_100037414 185
837 3300025303 Ga0209051_1001965 Ga0209051_10019659 185
838 3300025303 Ga0209051_1013246 Ga0209051_10132462 185
839 3300025315 Ga0207697_10111758 Ga0207697_101117582 185
840 3300025321 Ga0207656_10044127 Ga0207656_100441273 185
841 3300025735 Ga0207713_1083306 Ga0207713_10833062 185
842 3300025885 Ga0207653_10030127 Ga0207653_100301271 185
843 3300025898 Ga0207692_10032636 Ga0207692_100326361 185
844 3300025898 Ga0207692_10103380 Ga0207692_101033802 185
845 3300025898 Ga0207692_10143161 Ga0207692_101431612 185
846 3300025898 Ga0207692_10484039 Ga0207692_104840392 185
847 3300025899 Ga0207642_10000155 Ga0207642_100001556 185
848 3300025899 Ga0207642_10009846 Ga0207642_100098465 185
849 3300025899 Ga0207642_10160828 Ga0207642_101608282 185
850 3300025899 Ga0207642_10231778 Ga0207642_102317782 185
851 3300025899 Ga0207642_10309104 Ga0207642_103091042 185
852 3300025900 Ga0207710_10000020 Ga0207710_10000020101 185
853 3300025900 Ga0207710_10000022 Ga0207710_10000022271 185
854 3300025900 Ga0207710_10003009 Ga0207710_100030095 185
855 3300025900 Ga0207710_10011357 Ga0207710_100113572 185
856 3300025900 Ga0207710_10100678 Ga0207710_101006782 185
857 3300025900 Ga0207710_10158017 Ga0207710_101580172 185
858 3300025901 Ga0207688_10000095 Ga0207688_1000009521 185
859 3300025901 Ga0207688_10006812 Ga0207688_100068125 185
860 3300025901 Ga0207688_10009895 Ga0207688_100098952 185
861 3300025901 Ga0207688_10010258 Ga0207688_100102584 185
862 3300025901 Ga0207688_10091161 Ga0207688_100911612 185
863 3300025901 Ga0207688_10157693 Ga0207688_101576932 185
864 3300025901 Ga0207688_10213715 Ga0207688_102137152 185
865 3300025901 Ga0207688_10403576 Ga0207688_104035761 185
866 3300025901 Ga0207688_10550655 Ga0207688_105506551 185
867 3300025903 Ga0207680_10026861 Ga0207680_100268611 185
868 3300025903 Ga0207680_10071602 Ga0207680_100716023 185
869 3300025904 Ga0207647_10033517 Ga0207647_100335174 185
870 3300025904 Ga0207647_10039238 Ga0207647_100392382 185
871 3300025904 Ga0207647_10143987 Ga0207647_101439872 185
872 3300025905 Ga0207685_10000516 Ga0207685_100005167 185
873 3300025905 Ga0207685_10033102 Ga0207685_100331023 185
874 3300025905 Ga0207685_10034708 Ga0207685_100347081 185
875 3300025905 Ga0207685_10257978 Ga0207685_102579781 185
876 3300025906 Ga0207699_10028451 Ga0207699_100284514 185
877 3300025906 Ga0207699_10470143 Ga0207699_104701432 185
878 3300025906 Ga0207699_10549992 Ga0207699_105499922 185
879 3300025907 Ga0207645_10019743 Ga0207645_100197432 185
880 3300025907 Ga0207645_10030865 Ga0207645_100308654 185
881 3300025907 Ga0207645_10268193 Ga0207645_102681932 185
882 3300025908 Ga0207643_10043313 Ga0207643_100433131 185
883 3300025909 Ga0207705_10235709 Ga0207705_102357092 185
884 3300025910 Ga0207684_10770789 Ga0207684_107707892 185
885 3300025911 Ga0207654_10345848 Ga0207654_103458482 185
886 3300025912 Ga0207707_10311867 Ga0207707_103118672 185
887 3300025912 Ga0207707_10340241 Ga0207707_103402411 185
888 3300025913 Ga0207695_10146181 Ga0207695_101461813 185
889 3300025913 Ga0207695_10313744 Ga0207695_103137442 185
890 3300025914 Ga0207671_10111365 Ga0207671_101113653 185
891 3300025914 Ga0207671_10162404 Ga0207671_101624042 185
892 3300025914 Ga0207671_10210733 Ga0207671_102107332 185
893 3300025914 Ga0207671_10366451 Ga0207671_103664511 185
894 3300025914 Ga0207671_10836998 Ga0207671_108369981 185
895 3300025915 Ga0207693_10001452 Ga0207693_1000145218 185
896 3300025915 Ga0207693_10004541 Ga0207693_100045417 185
897 3300025915 Ga0207693_10030184 Ga0207693_100301843 185
898 3300025915 Ga0207693_10111744 Ga0207693_101117443 185
899 3300025915 Ga0207693_10154825 Ga0207693_101548252 185
900 3300025915 Ga0207693_10179438 Ga0207693_101794382 185
901 3300025915 Ga0207693_10948713 Ga0207693_109487131 185
902 3300025916 Ga0207663_10004097 Ga0207663_100040975 185
903 3300025916 Ga0207663_10007436 Ga0207663_100074365 185
904 3300025916 Ga0207663_10054188 Ga0207663_100541881 185
905 3300025916 Ga0207663_10095605 Ga0207663_100956052 185
906 3300025917 Ga0207660_10437931 Ga0207660_104379311 185
907 3300025917 Ga0207660_10471114 Ga0207660_104711142 185
908 3300025917 Ga0207660_10965274 Ga0207660_109652741 185
909 3300025918 Ga0207662_10025029 Ga0207662_100250295 185
910 3300025918 Ga0207662_10224846 Ga0207662_102248462 185
911 3300025918 Ga0207662_10237631 Ga0207662_102376312 185
912 3300025919 Ga0207657_10064733 Ga0207657_100647333 185
913 3300025919 Ga0207657_10087284 Ga0207657_100872842 185
914 3300025919 Ga0207657_10144460 Ga0207657_101444602 185
915 3300025919 Ga0207657_10374611 Ga0207657_103746112 185
916 3300025919 Ga0207657_10492695 Ga0207657_104926952 185
917 3300025920 Ga0207649_10046561 Ga0207649_100465612 185
918 3300025920 Ga0207649_10307160 Ga0207649_103071602 185
919 3300025921 Ga0207652_10378499 Ga0207652_103784991 185
920 3300025921 Ga0207652_10600323 Ga0207652_106003232 185
921 3300025923 Ga0207681_10002378 Ga0207681_100023786 185
922 3300025923 Ga0207681_10013715 Ga0207681_100137156 185
923 3300025923 Ga0207681_10068786 Ga0207681_100687863 185
924 3300025923 Ga0207681_10124062 Ga0207681_101240622 185
925 3300025923 Ga0207681_10375108 Ga0207681_103751082 185
926 3300025923 Ga0207681_10473438 Ga0207681_104734382 185
927 3300025924 Ga0207694_10052539 Ga0207694_100525393 185
928 3300025924 Ga0207694_10236226 Ga0207694_102362262 185
929 3300025924 Ga0207694_10295833 Ga0207694_102958332 185
930 3300025924 Ga0207694_10746927 Ga0207694_107469272 185
931 3300025924 Ga0207694_10792707 Ga0207694_107927072 185
932 3300025925 Ga0207650_10499409 Ga0207650_104994092 185
933 3300025925 Ga0207650_11125963 Ga0207650_111259631 185
934 3300025926 Ga0207659_10019575 Ga0207659_100195752 185
935 3300025926 Ga0207659_10067037 Ga0207659_100670372 185
936 3300025926 Ga0207659_10558253 Ga0207659_105582532 185
937 3300025927 Ga0207687_10001864 Ga0207687_1000186414 185
938 3300025927 Ga0207687_10042684 Ga0207687_100426842 185
939 3300025927 Ga0207687_10074366 Ga0207687_100743662 185
940 3300025927 Ga0207687_10119978 Ga0207687_101199783 185
941 3300025927 Ga0207687_10207944 Ga0207687_102079442 185
942 3300025927 Ga0207687_10357049 Ga0207687_103570492 185
943 3300025927 Ga0207687_10502793 Ga0207687_105027932 185
944 3300025927 Ga0207687_10800352 Ga0207687_108003521 185
945 3300025928 Ga0207700_10107389 Ga0207700_101073891 185
946 3300025928 Ga0207700_10129377 Ga0207700_101293771 185
947 3300025928 Ga0207700_10186884 Ga0207700_101868842 185
948 3300025928 Ga0207700_10348725 Ga0207700_103487252 185
949 3300025929 Ga0207664_10000074 Ga0207664_1000007413 185
950 3300025929 Ga0207664_10031253 Ga0207664_100312533 185
951 3300025929 Ga0207664_10144357 Ga0207664_101443573 185
952 3300025929 Ga0207664_10156219 Ga0207664_101562192 185
953 3300025929 Ga0207664_10372009 Ga0207664_103720092 185
954 3300025929 Ga0207664_10409549 Ga0207664_104095492 185
955 3300025931 Ga0207644_10066402 Ga0207644_100664022 185
956 3300025931 Ga0207644_10082211 Ga0207644_100822113 185
957 3300025931 Ga0207644_10327493 Ga0207644_103274932 185
958 3300025931 Ga0207644_10356175 Ga0207644_103561752 185
959 3300025931 Ga0207644_10401845 Ga0207644_104018452 185
960 3300025931 Ga0207644_10615829 Ga0207644_106158292 185
961 3300025932 Ga0207690_10030138 Ga0207690_100301385 185
962 3300025932 Ga0207690_10050180 Ga0207690_100501801 185
963 3300025932 Ga0207690_10107286 Ga0207690_101072862 185
964 3300025932 Ga0207690_10180512 Ga0207690_101805122 185
965 3300025932 Ga0207690_10774498 Ga0207690_107744982 185
966 3300025933 Ga0207706_10003964 Ga0207706_1000396414 185
967 3300025933 Ga0207706_10016395 Ga0207706_100163954 185
968 3300025933 Ga0207706_10035096 Ga0207706_100350965 185
969 3300025933 Ga0207706_10187871 Ga0207706_101878712 185
970 3300025933 Ga0207706_10287298 Ga0207706_102872981 185
971 3300025934 Ga0207686_10001659 Ga0207686_100016592 185
972 3300025934 Ga0207686_10039896 Ga0207686_100398963 185
973 3300025934 Ga0207686_10239222 Ga0207686_102392222 185
974 3300025934 Ga0207686_10886648 Ga0207686_108866481 185
975 3300025935 Ga0207709_10004864 Ga0207709_100048645 185
976 3300025935 Ga0207709_10014569 Ga0207709_100145694 185
977 3300025935 Ga0207709_10082435 Ga0207709_100824353 185
978 3300025935 Ga0207709_10340538 Ga0207709_103405381 185
979 3300025936 Ga0207670_10087172 Ga0207670_100871723 185
980 3300025936 Ga0207670_10343258 Ga0207670_103432582 185
981 3300025936 Ga0207670_10379305 Ga0207670_103793052 185
982 3300025936 Ga0207670_10422275 Ga0207670_104222752 185
983 3300025937 Ga0207669_10000776 Ga0207669_1000077612 185
984 3300025937 Ga0207669_10103731 Ga0207669_101037313 185
985 3300025938 Ga0207704_10000975 Ga0207704_100009752 185
986 3300025938 Ga0207704_10116158 Ga0207704_101161582 185
987 3300025938 Ga0207704_10499569 Ga0207704_104995692 185
988 3300025938 Ga0207704_10601388 Ga0207704_106013882 185
989 3300025938 Ga0207704_10729964 Ga0207704_107299641 185
990 3300025939 Ga0207665_10001259 Ga0207665_1000125916 185
991 3300025939 Ga0207665_10002831 Ga0207665_1000283113 185
992 3300025939 Ga0207665_10027039 Ga0207665_100270392 185
993 3300025939 Ga0207665_10043459 Ga0207665_100434593 185
994 3300025939 Ga0207665_10229741 Ga0207665_102297412 185
995 3300025940 Ga0207691_10024110 Ga0207691_100241105 185
996 3300025940 Ga0207691_10156345 Ga0207691_101563452 185
997 3300025940 Ga0207691_10412377 Ga0207691_104123772 185
998 3300025941 Ga0207711_10001226 Ga0207711_1000122625 185
999 3300025941 Ga0207711_10005726 Ga0207711_100057266 185
1000 3300025941 Ga0207711_10016831 Ga0207711_100168316 185
1001 3300025941 Ga0207711_10030901 Ga0207711_100309013 185
1002 3300025941 Ga0207711_10170341 Ga0207711_101703413 185
1003 3300025941 Ga0207711_10292285 Ga0207711_102922852 185
1004 3300025941 Ga0207711_10344703 Ga0207711_103447032 185
1005 3300025942 Ga0207689_10007467 Ga0207689_100074677 185
1006 3300025942 Ga0207689_10010648 Ga0207689_100106485 185
1007 3300025942 Ga0207689_10021484 Ga0207689_100214843 185
1008 3300025942 Ga0207689_10032301 Ga0207689_100323014 185
1009 3300025942 Ga0207689_10038813 Ga0207689_100388132 185
1010 3300025942 Ga0207689_10147339 Ga0207689_101473392 185
1011 3300025942 Ga0207689_10154308 Ga0207689_101543082 185
1012 3300025942 Ga0207689_10400778 Ga0207689_104007782 185
1013 3300025942 Ga0207689_10593394 Ga0207689_105933942 185
1014 3300025944 Ga0207661_10041824 Ga0207661_100418244 185
1015 3300025944 Ga0207661_10072243 Ga0207661_100722432 185
1016 3300025944 Ga0207661_10194886 Ga0207661_101948862 185
1017 3300025944 Ga0207661_10298493 Ga0207661_102984932 185
1018 3300025944 Ga0207661_10793320 Ga0207661_107933202 185
1019 3300025945 Ga0207679_10029260 Ga0207679_100292602 185
1020 3300025945 Ga0207679_10147745 Ga0207679_101477452 185
1021 3300025949 Ga0207667_10048853 Ga0207667_100488532 185
1022 3300025949 Ga0207667_10127042 Ga0207667_101270423 185
1023 3300025949 Ga0207667_10277181 Ga0207667_102771812 185
1024 3300025949 Ga0207667_10292669 Ga0207667_102926692 185
1025 3300025949 Ga0207667_10566676 Ga0207667_105666761 185
1026 3300025960 Ga0207651_10266346 Ga0207651_102663461 185
1027 3300025960 Ga0207651_10319122 Ga0207651_103191222 185
1028 3300025961 Ga0207712_10000020 Ga0207712_100000206 185
1029 3300025961 Ga0207712_10011015 Ga0207712_100110155 185
1030 3300025961 Ga0207712_10032064 Ga0207712_100320641 185
1031 3300025961 Ga0207712_10100044 Ga0207712_101000442 185
1032 3300025961 Ga0207712_10209839 Ga0207712_102098392 185
1033 3300025961 Ga0207712_10228263 Ga0207712_102282632 185
1034 3300025961 Ga0207712_10244011 Ga0207712_102440111 185
1035 3300025972 Ga0207668_10003428 Ga0207668_100034288 185
1036 3300025972 Ga0207668_10012870 Ga0207668_100128706 185
1037 3300025972 Ga0207668_10051507 Ga0207668_100515072 185
1038 3300025972 Ga0207668_10177251 Ga0207668_101772511 185
1039 3300025972 Ga0207668_10382204 Ga0207668_103822042 185
1040 3300025972 Ga0207668_11041429 Ga0207668_110414291 185
1041 3300025981 Ga0207640_10027752 Ga0207640_100277523 185
1042 3300025981 Ga0207640_10082918 Ga0207640_100829182 185
1043 3300025981 Ga0207640_10096021 Ga0207640_100960212 185
1044 3300025981 Ga0207640_10169577 Ga0207640_101695772 185
1045 3300025981 Ga0207640_10187332 Ga0207640_101873321 185
1046 3300025981 Ga0207640_10192597 Ga0207640_101925972 185
1047 3300025981 Ga0207640_10507895 Ga0207640_105078952 185
1048 3300025986 Ga0207658_10000284 Ga0207658_100002846 185
1049 3300025986 Ga0207658_10010717 Ga0207658_100107173 185
1050 3300025986 Ga0207658_10035394 Ga0207658_100353943 185
1051 3300025986 Ga0207658_10039649 Ga0207658_100396491 185
1052 3300025986 Ga0207658_10083706 Ga0207658_100837063 185
1053 3300025986 Ga0207658_10098142 Ga0207658_100981423 185
1054 3300025986 Ga0207658_10247903 Ga0207658_102479033 185
1055 3300025986 Ga0207658_10319633 Ga0207658_103196332 185
1056 3300026023 Ga0207677_10006064 Ga0207677_100060643 185
1057 3300026023 Ga0207677_10039091 Ga0207677_100390912 185
1058 3300026023 Ga0207677_10054785 Ga0207677_100547852 185
1059 3300026023 Ga0207677_10083344 Ga0207677_100833442 185
1060 3300026023 Ga0207677_10187276 Ga0207677_101872763 185
1061 3300026023 Ga0207677_10215975 Ga0207677_102159752 185
1062 3300026035 Ga0207703_10000006 Ga0207703_10000006315 185
1063 3300026035 Ga0207703_10010248 Ga0207703_100102482 185
1064 3300026035 Ga0207703_10022654 Ga0207703_100226541 185
1065 3300026035 Ga0207703_10024649 Ga0207703_100246493 185
1066 3300026035 Ga0207703_10425002 Ga0207703_104250022 185
1067 3300026035 Ga0207703_10482228 Ga0207703_104822281 185
1068 3300026035 Ga0207703_10602143 Ga0207703_106021432 185
1069 3300026041 Ga0207639_10007554 Ga0207639_100075545 185
1070 3300026041 Ga0207639_10025966 Ga0207639_100259666 185
1071 3300026041 Ga0207639_10027838 Ga0207639_100278382 185
1072 3300026041 Ga0207639_10131120 Ga0207639_101311202 185
1073 3300026041 Ga0207639_10911047 Ga0207639_109110471 185
1074 3300026067 Ga0207678_10003538 Ga0207678_100035387 185
1075 3300026067 Ga0207678_10007863 Ga0207678_100078634 185
1076 3300026067 Ga0207678_10027419 Ga0207678_100274195 185
1077 3300026067 Ga0207678_10038475 Ga0207678_100384753 185
1078 3300026067 Ga0207678_10162454 Ga0207678_101624542 185
1079 3300026067 Ga0207678_10332701 Ga0207678_103327012 185
1080 3300026067 Ga0207678_10408279 Ga0207678_104082792 185
1081 3300026075 Ga0207708_10004788 Ga0207708_100047885 185
1082 3300026075 Ga0207708_10011878 Ga0207708_100118784 185
1083 3300026075 Ga0207708_10017706 Ga0207708_100177066 185
1084 3300026075 Ga0207708_10069802 Ga0207708_100698022 185
1085 3300026075 Ga0207708_10078273 Ga0207708_100782731 185
1086 3300026078 Ga0207702_10147966 Ga0207702_101479663 185
1087 3300026078 Ga0207702_11016675 Ga0207702_110166751 185
1088 3300026078 Ga0207702_11045753 Ga0207702_110457531 185
1089 3300026078 Ga0207702_11403425 Ga0207702_114034252 185
1090 3300026088 Ga0207641_10004747 Ga0207641_100047475 185
1091 3300026088 Ga0207641_10047120 Ga0207641_100471204 185
1092 3300026088 Ga0207641_10066764 Ga0207641_100667645 185
1093 3300026088 Ga0207641_10114345 Ga0207641_101143453 185
1094 3300026088 Ga0207641_10150664 Ga0207641_101506642 185
1095 3300026088 Ga0207641_10421622 Ga0207641_104216222 185
1096 3300026088 Ga0207641_10735255 Ga0207641_107352552 185
1097 3300026088 Ga0207641_10755041 Ga0207641_107550412 185
1098 3300026088 Ga0207641_11157933 Ga0207641_111579332 185
1099 3300026089 Ga0207648_10000501 Ga0207648_1000050113 185
1100 3300026089 Ga0207648_10017364 Ga0207648_100173647 185
1101 3300026089 Ga0207648_10613103 Ga0207648_106131031 185
1102 3300026089 Ga0207648_10998676 Ga0207648_109986761 185
1103 3300026095 Ga0207676_10032131 Ga0207676_100321312 185
1104 3300026095 Ga0207676_10045115 Ga0207676_100451153 185
1105 3300026095 Ga0207676_10120092 Ga0207676_101200923 185
1106 3300026095 Ga0207676_10158335 Ga0207676_101583353 185
1107 3300026095 Ga0207676_10218318 Ga0207676_102183182 185
1108 3300026095 Ga0207676_10223543 Ga0207676_102235432 185
1109 3300026095 Ga0207676_10322566 Ga0207676_103225662 185
1110 3300026095 Ga0207676_10528570 Ga0207676_105285702 185
1111 3300026116 Ga0207674_10003917 Ga0207674_1000391710 185
1112 3300026116 Ga0207674_10033808 Ga0207674_100338081 185
1113 3300026116 Ga0207674_10036524 Ga0207674_100365243 185
1114 3300026116 Ga0207674_10098826 Ga0207674_100988262 185
1115 3300026116 Ga0207674_10099507 Ga0207674_100995073 185
1116 3300026116 Ga0207674_10109735 Ga0207674_101097353 185
1117 3300026116 Ga0207674_10115673 Ga0207674_101156732 185
1118 3300026116 Ga0207674_10168463 Ga0207674_101684632 185
1119 3300026116 Ga0207674_10443368 Ga0207674_104433682 185
1120 3300026118 Ga0207675_100009125 Ga0207675_1000091256 185
1121 3300026118 Ga0207675_100020710 Ga0207675_1000207102 185
1122 3300026118 Ga0207675_100063512 Ga0207675_1000635122 185
1123 3300026118 Ga0207675_100411934 Ga0207675_1004119342 185
1124 3300026118 Ga0207675_100421020 Ga0207675_1004210203 185
1125 3300026118 Ga0207675_100628611 Ga0207675_1006286111 185
1126 3300026121 Ga0207683_10000161 Ga0207683_1000016144 185
1127 3300026121 Ga0207683_10021923 Ga0207683_100219232 185
1128 3300026121 Ga0207683_10039876 Ga0207683_100398765 185
1129 3300026121 Ga0207683_10092671 Ga0207683_100926712 185
1130 3300026121 Ga0207683_10273809 Ga0207683_102738091 185
1131 3300026121 Ga0207683_10715202 Ga0207683_107152022 185
1132 3300026142 Ga0207698_10035735 Ga0207698_100357353 185
1133 3300026142 Ga0207698_10190210 Ga0207698_101902102 185
1134 3300026142 Ga0207698_10251834 Ga0207698_102518342 185
1135 3300026142 Ga0207698_10288884 Ga0207698_102888842 185
1136 3300026142 Ga0207698_10460334 Ga0207698_104603342 185
1137 3300026142 Ga0207698_10504066 Ga0207698_105040662 185
1138 3300026142 Ga0207698_10687342 Ga0207698_106873421 185
1139 3300027907 Ga0207428_10033341 Ga0207428_100333412 185
1140 3300028379 Ga0268266_10014275 Ga0268266_100142756 185
1141 3300028379 Ga0268266_10544809 Ga0268266_105448092 185
1142 3300028379 Ga0268266_10988059 Ga0268266_109880592 185
1143 3300028380 Ga0268265_10000004 Ga0268265_10000004450 185
1144 3300028380 Ga0268265_10000019 Ga0268265_10000019185 185
1145 3300028380 Ga0268265_10003934 Ga0268265_100039341 185
1146 3300028380 Ga0268265_10085121 Ga0268265_100851211 185
1147 3300028380 Ga0268265_10106101 Ga0268265_101061013 185
1148 3300028380 Ga0268265_10317703 Ga0268265_103177032 185
1149 3300028380 Ga0268265_10369387 Ga0268265_103693872 185
1150 3300028380 Ga0268265_10673944 Ga0268265_106739442 185
1151 3300028380 Ga0268265_11518236 Ga0268265_115182361 185
1152 3300028381 Ga0268264_10000024 Ga0268264_10000024460 185
1153 3300028381 Ga0268264_10001207 Ga0268264_1000120710 185
1154 3300028381 Ga0268264_10008659 Ga0268264_100086596 185
1155 3300028381 Ga0268264_10084728 Ga0268264_100847283 185
1156 3300028381 Ga0268264_10149039 Ga0268264_101490392 185
1157 3300028381 Ga0268264_10550757 Ga0268264_105507571 185
1158 3300028381 Ga0268264_10636906 Ga0268264_106369061 185
1159 3300028381 Ga0268264_11163093 Ga0268264_111630932 185
1160 3300028786 Ga0307517_10124059 Ga0307517_101240592 185
1161 3300028794 Ga0307515_10000045 Ga0307515_10000045262 185
1162 3300028794 Ga0307515_10036083 Ga0307515_100360835 185
1163 3300028794 Ga0307515_10172678 Ga0307515_101726782 185
1164 3300028794 Ga0307515_10175778 Ga0307515_101757783 185
1165 3300028794 Ga0307515_10202474 Ga0307515_102024742 185
1166 3300028794 Ga0307515_10271514 Ga0307515_102715142 185
1167 3300028794 Ga0307515_10428718 Ga0307515_104287182 185
1168 3300030522 Ga0307512_10029915 Ga0307512_100299153 185
1169 3300030522 Ga0307512_10048863 Ga0307512_100488634 185
1170 3300030522 Ga0307512_10103148 Ga0307512_101031483 185
1171 3300030733 Ga0314311_1113337 Ga0314311_11133372 185
1172 3300030745 Ga0316182_1195261 Ga0316182_11952611 185
1173 3300031239 Ga0265328_10015430 Ga0265328_100154302 185
1174 3300031456 Ga0307513_10000001 Ga0307513_100000011150 185
1175 3300031456 Ga0307513_10010865 Ga0307513_100108659 185
1176 3300031456 Ga0307513_10195918 Ga0307513_101959183 185
1177 3300031507 Ga0307509_10020244 Ga0307509_100202444 185
1178 3300031507 Ga0307509_10402196 Ga0307509_104021962 185
1179 3300031548 Ga0307408_100187190 Ga0307408_1001871902 185
1180 3300031548 Ga0307408_100288348 Ga0307408_1002883482 185
1181 3300031548 Ga0307408_100412233 Ga0307408_1004122332 185
1182 3300031616 Ga0307508_10001514 Ga0307508_100015147 185
1183 3300031616 Ga0307508_10072499 Ga0307508_100724993 185
1184 3300031730 Ga0307516_10002608 Ga0307516_1000260842 185
1185 3300031730 Ga0307516_10008621 Ga0307516_1000862110 185
1186 3300031730 Ga0307516_10047355 Ga0307516_100473552 185
1187 3300031730 Ga0307516_10276451 Ga0307516_102764512 185
1188 3300031730 Ga0307516_10345340 Ga0307516_103453402 185
1189 3300031731 Ga0307405_10048752 Ga0307405_100487522 185
1190 3300031731 Ga0307405_10192186 Ga0307405_101921862 185
1191 3300031731 Ga0307405_10244687 Ga0307405_102446872 185
1192 3300031731 Ga0307405_10352243 Ga0307405_103522432 185
1193 3300031824 Ga0307413_10017913 Ga0307413_100179134 185
1194 3300031824 Ga0307413_10106691 Ga0307413_101066913 185
1195 3300031824 Ga0307413_10348922 Ga0307413_103489222 185
1196 3300031824 Ga0307413_10719035 Ga0307413_107190351 185
1197 3300031852 Ga0307410_10066701 Ga0307410_100667012 185
1198 3300031852 Ga0307410_10130313 Ga0307410_101303132 185
1199 3300031852 Ga0307410_10240715 Ga0307410_102407152 185
1200 3300031852 Ga0307410_10362644 Ga0307410_103626442 185
1201 3300031852 Ga0307410_10635081 Ga0307410_106350812 185
1202 3300031852 Ga0307410_10794964 Ga0307410_107949641 185
1203 3300031889 Ga0326468_10000995 Ga0326468_100009953 185
1204 3300031889 Ga0326468_10035108 Ga0326468_100351081 185
1205 3300031901 Ga0307406_10055824 Ga0307406_100558242 185
1206 3300031901 Ga0307406_10109119 Ga0307406_101091192 185
1207 3300031901 Ga0307406_10332983 Ga0307406_103329832 185
1208 3300031901 Ga0307406_10390710 Ga0307406_103907101 185
1209 3300031901 Ga0307406_11080589 Ga0307406_110805891 185
1210 3300031903 Ga0307407_10019680 Ga0307407_100196802 185
1211 3300031903 Ga0307407_10173572 Ga0307407_101735722 185
1212 3300031903 Ga0307407_10199424 Ga0307407_101994242 185
1213 3300031903 Ga0307407_10406436 Ga0307407_104064362 185
1214 3300031903 Ga0307407_10447582 Ga0307407_104475821 185
1215 3300031911 Ga0307412_10093639 Ga0307412_100936392 185
1216 3300031911 Ga0307412_10494437 Ga0307412_104944372 185
1217 3300031995 Ga0307409_100002006 Ga0307409_1000020068 185
1218 3300031995 Ga0307409_100030641 Ga0307409_1000306412 185
1219 3300031995 Ga0307409_100038809 Ga0307409_1000388093 185
1220 3300031995 Ga0307409_100128104 Ga0307409_1001281041 185
1221 3300031995 Ga0307409_101118998 Ga0307409_1011189981 185
1222 3300032002 Ga0307416_100003319 Ga0307416_1000033194 185
1223 3300032002 Ga0307416_100040166 Ga0307416_1000401663 185
1224 3300032002 Ga0307416_100331325 Ga0307416_1003313252 185
1225 3300032002 Ga0307416_100492169 Ga0307416_1004921692 185
1226 3300032004 Ga0307414_10253726 Ga0307414_102537262 185
1227 3300032005 Ga0307411_10122776 Ga0307411_101227762 185
1228 3300032005 Ga0307411_10383926 Ga0307411_103839262 185
1229 3300032005 Ga0307411_10701320 Ga0307411_107013201 185
1230 3300032005 Ga0307411_11008333 Ga0307411_110083331 185
1231 3300032126 Ga0307415_100000333 Ga0307415_10000033312 185
1232 3300032126 Ga0307415_100018602 Ga0307415_1000186022 185
1233 3300032126 Ga0307415_100052588 Ga0307415_1000525882 185
1234 3300032126 Ga0307415_100099813 Ga0307415_1000998132 185
1235 3300032126 Ga0307415_100269891 Ga0307415_1002698912 185
1236 3300033179 Ga0307507_10012883 Ga0307507_100128835 185
1237 3300033180 Ga0307510_10103011 Ga0307510_101030113 185
1238 3300034816 Ga0373930_0012677 Ga0373930_0012677_973_1530 185
1239 3300034957 Ga0373938_0020687 Ga0373938_0020687_324_881 185
1240 3300035083 Ga0373926_0104616 Ga0373926_0104616_358_915 185
1241 3300035084 Ga0373928_0051543 Ga0373928_0051543_37_594 185
1242 3300035084 Ga0373928_0061378 Ga0373928_0061378_193_750 185
1243 3300035089 Ga0373944_0055315 Ga0373944_0055315_581_1138 185
1244 3300035091 Ga0373951_0001290 Ga0373951_0001290_5703_6260 185
1245 3300035091 Ga0373951_0005095 Ga0373951_0005095_1822_2379 185
1246 3300035092 Ga0373952_0071351 Ga0373952_0071351_297_854 185
1247 3300035111 Ga0373923_0115873 Ga0373923_0115873_482_1039 185
1248 3300035112 Ga0373932_0024030 Ga0373932_0024030_233_790 185
1249 3300035112 Ga0373932_0047387 Ga0373932_0047387_448_1005 185
1250 3300035112 Ga0373932_0092999 Ga0373932_0092999_310_867 185
1251 3300035113 Ga0373936_0112008 Ga0373936_0112008_54_611 185
1252 3300035114 Ga0373939_0060161 Ga0373939_0060161_622_1179 185
1253 3300035114 Ga0373939_0163637 Ga0373939_0163637_56_613 185
1254 3300035114 Ga0373939_0173522 Ga0373939_0173522_110_667 185
1255 3300035115 Ga0373941_0007127 Ga0373941_0007127_509_1066 185
1256 3300035116 Ga0373945_0056445 Ga0373945_0056445_325_882 185
1257 3300035117 Ga0373953_0082825 Ga0373953_0082825_37_594 185
1258 3300035118 Ga0373954_0094880 Ga0373954_0094880_373_930 185
1259 3300035118 Ga0373954_0107458 Ga0373954_0107458_195_752 185
1260 3300035119 Ga0373956_0112945 Ga0373956_0112945_608_1165 185
1261 3300035120 Ga0373957_0137350 Ga0373957_0137350_333_890 185
1262 3300035121 Ga0373960_0020023 Ga0373960_0020023_710_1267 185
1263 3300035121 Ga0373960_0026562 Ga0373960_0026562_43_600 185
1264 3300035170 Ga0373943_0063581 Ga0373943_0063581_656_1213 185
1265 3300035170 Ga0373943_0388505 Ga0373943_0388505_167_724 185
1266 3300035171 Ga0373946_0172120 Ga0373946_0172120_47_604 185
1267 3300035172 Ga0373955_0042730 Ga0373955_0042730_1851_2408 185
1268 3300035172 Ga0373955_0463670 Ga0373955_0463670_152_709 185
1269 3300035207 Ga0373942_0000141 Ga0373942_0000141_4536_5093 185
1270 3300035241 Ga0373961_0019576 Ga0373961_0019576_1071_1628 185
1271 3300035241 Ga0373961_0032022 Ga0373961_0032022_509_1066 185
1272 3300035242 Ga0373962_0010656 Ga0373962_0010656_1057_1614 185
1273 3300035691 Ga0373931_0001768 Ga0373931_0001768_1423_1980 185
1274 3300035691 Ga0373931_0007330 Ga0373931_0007330_3956_4513 185
1275 3300035691 Ga0373931_0029729 Ga0373931_0029729_368_925 185
1276 3300035691 Ga0373931_0391277 Ga0373931_0391277_63_620 185
1277 3300035692 Ga0373935_0010076 Ga0373935_0010076_1856_2413 185
1278 3300035692 Ga0373935_0309364 Ga0373935_0309364_80_637 185
1279 3300035695 Ga0373927_0211295 Ga0373927_0211295_592_1149 185
1280 3300035724 Ga0373933_0327555 Ga0373933_0327555_101_658 185
1281 3300035725 Ga0373947_0100487 Ga0373947_0100487_694_1251 185
1282 3300035725 Ga0373947_0259221 Ga0373947_0259221_131_688 185
1283 3300037068 Ga0373925_0074570 Ga0373925_0074570_586_1143 185
1284 3300037068 Ga0373925_0238902 Ga0373925_0238902_261_818 185
1285 3300037068 Ga0373925_0508032 Ga0373925_0508032_154_711 185
1286 3300037418 Ga0395900_0070245 Ga0395900_0070245_1967_2524 185
1287 3300037466 Ga0395898_0017125 Ga0395898_0017125_3462_4019 185
1288 3300037853 Ga0436364_0256774 Ga0436364_0256774_32911_33468 185
1289 3300037853 Ga0436364_0624094 Ga0436364_0624094_37301_37858 185
1290 3300037853 Ga0436364_0655629 Ga0436364_0655629_220_777 185
1291 3300037853 Ga0436364_1008100 Ga0436364_1008100_3487_4044 185
1292 3300037853 Ga0436364_1097018 Ga0436364_1097018_2318_2875 185
1293 3300038443 Ga0395901_0050065 Ga0395901_0050065_1038_1595 185
1294 3300039437 Ga0436365_0233412 Ga0436365_0233412_1860_2417 185
1295 3300039437 Ga0436365_1177168 Ga0436365_1177168_7524_8081 185
1296 3300039437 Ga0436365_1378611 Ga0436365_1378611_45226_45783 185
1297 3300039437 Ga0436365_1640827 Ga0436365_1640827_6966_7523 185
1298 3300039438 Ga0436360_0152897 Ga0436360_0152897_46_603 185
1299 3300039438 Ga0436360_0154004 Ga0436360_0154004_210_767 185
1300 3300039447 Ga0436361_0496618 Ga0436361_0496618_184_741 185
1301 3300039447 Ga0436361_0789278 Ga0436361_0789278_429_986 185
1302 3300039450 Ga0436363_0481504 Ga0436363_0481504_585_1142 185
1303 3300039450 Ga0436363_1329912 Ga0436363_1329912_357_914 185
1304 3300041405 Ga0439438_012001 Ga0439438_012001_1435_2004 185
1305 3300041410 Ga0439461_0000739 Ga0439461_0000739_4118_4675 185
1306 3300041410 Ga0439461_0007041 Ga0439461_0007041_240_797 185
1307 3300041411 Ga0439466_0004182 Ga0439466_0004182_1057_1626 185
1308 3300041411 Ga0439466_0013539 Ga0439466_0013539_1324_1881 185
1309 3300041413 Ga0439465_0000954 Ga0439465_0000954_3253_3810 185
1310 3300041413 Ga0439465_0025003 Ga0439465_0025003_1105_1662 185
1311 3300041413 Ga0439465_0029394 Ga0439465_0029394_529_1086 185
1312 3300041413 Ga0439465_0035635 Ga0439465_0035635_605_1162 185
1313 3300041413 Ga0439465_0065452 Ga0439465_0065452_98_655 185
1314 3300041443 Ga0451789_0348754 Ga0451789_0348754_208_765 185
1315 3300041452 Ga0451793_1057108 Ga0451793_1057108_449_1006 185
1316 3300041452 Ga0451793_1109950 Ga0451793_1109950_216_773 185
1317 3300041452 Ga0451793_1118605 Ga0451793_1118605_616_1173 185
1318 3300041453 Ga0451797_0799585 Ga0451797_0799585_311_868 185
1319 3300041453 Ga0451797_1361400 Ga0451797_1361400_286_843 185
1320 3300041456 Ga0451795_0766706 Ga0451795_0766706_109_666 185
1321 3300041459 Ga0451800_1271939 Ga0451800_1271939_67_624 185
1322 3300041462 Ga0451806_706470 Ga0451806_706470_157_714 185
1323 3300041494 Ga0451837_0801649 Ga0451837_0801649_1250_1807 185
1324 3300041494 Ga0451837_1794285 Ga0451837_1794285_108_665 185
1325 3300041496 Ga0451839_0574548 Ga0451839_0574548_112_669 185
1326 3300041496 Ga0451839_0740234 Ga0451839_0740234_169_726 185
1327 3300041498 Ga0451841_0211351 Ga0451841_0211351_18_575 185
1328 3300041498 Ga0451841_0501317 Ga0451841_0501317_295_852 185
1329 3300041501 Ga0451845_0169045 Ga0451845_0169045_46_603 185
1330 3300041503 Ga0451847_0275342 Ga0451847_0275342_76_633 185
1331 3300041509 Ga0451843_1140858 Ga0451843_1140858_19_576 185
1332 3300041512 Ga0451853_1266289 Ga0451853_1266289_359_916 185
1333 3300042002 Ga0439442_016096 Ga0439442_016096_380_937 185
1334 3300042004 Ga0439445_0007032 Ga0439445_0007032_732_1289 185
1335 3300042004 Ga0439445_0032195 Ga0439445_0032195_121_678 185
1336 3300042007 Ga0439449_0024501 Ga0439449_0024501_1355_1924 185
1337 3300042007 Ga0439449_0091897 Ga0439449_0091897_139_696 185
1338 3300042008 Ga0439450_026235 Ga0439450_026235_646_1203 185
1339 3300042008 Ga0439450_058318 Ga0439450_058318_33_590 185
1340 3300042016 Ga0439463_045927 Ga0439463_045927_300_857 185
1341 3300042016 Ga0439463_077060 Ga0439463_077060_153_710 185
1342 3300042435 Ga0439434_0006329 Ga0439434_0006329_654_1211 185
1343 3300042438 Ga0439459_0007846 Ga0439459_0007846_899_1456 185
1344 3300042439 Ga0439464_0081925 Ga0439464_0081925_63_620 185
1345 3300044656 Ga0466969_0007583 Ga0466969_0007583_523_1080 185
1346 3300044656 Ga0466969_0026295 Ga0466969_0026295_1066_1623 185
1347 3300044656 Ga0466969_0040110 Ga0466969_0040110_891_1448 185
1348 3300044658 Ga0466972_0029047 Ga0466972_0029047_624_1181 185
1349 3300044658 Ga0466972_0033962 Ga0466972_0033962_1354_1911 185
1350 3300044658 Ga0466972_0036756 Ga0466972_0036756_1689_2246 185
1351 3300044658 Ga0466972_0039070 Ga0466972_0039070_462_1019 185
1352 3300044658 Ga0466972_0041411 Ga0466972_0041411_698_1270 185
1353 3300044658 Ga0466972_0042307 Ga0466972_0042307_234_791 185
1354 3300044683 Ga0466965_0007603 Ga0466965_0007603_2945_3502 185
1355 3300044683 Ga0466965_0300302 Ga0466965_0300302_103_660 185
1356 3300044684 Ga0466966_0005323 Ga0466966_0005323_6533_7090 185
1357 3300044684 Ga0466966_0007809 Ga0466966_0007809_2086_2643 185
1358 3300044684 Ga0466966_0011119 Ga0466966_0011119_2030_2587 185
1359 3300044684 Ga0466966_0017019 Ga0466966_0017019_874_1431 185
1360 3300044684 Ga0466966_0107748 Ga0466966_0107748_538_1095 185
1361 3300044684 Ga0466966_0250253 Ga0466966_0250253_150_707 185
1362 3300044693 Ga0466961_0004780 Ga0466961_0004780_1780_2337 185
1363 3300044693 Ga0466961_0011981 Ga0466961_0011981_3637_4194 185
1364 3300044693 Ga0466961_0016723 Ga0466961_0016723_2179_2736 185
1365 3300044693 Ga0466961_0309431 Ga0466961_0309431_196_753 185
1366 3300044694 Ga0466963_0016976 Ga0466963_0016976_3215_3772 185
1367 3300044694 Ga0466963_0040181 Ga0466963_0040181_261_818 185
1368 3300044694 Ga0466963_0260104 Ga0466963_0260104_634_1191 185
1369 3300044694 Ga0466963_0279254 Ga0466963_0279254_548_1105 185
1370 3300044706 Ga0466964_0181336 Ga0466964_0181336_293_850 185
1371 3300044706 Ga0466964_0477064 Ga0466964_0477064_19_576 185
1372 3300044719 Ga0466971_0040159 Ga0466971_0040159_1396_1953 185
1373 3300044719 Ga0466971_0082756 Ga0466971_0082756_135_692 185
1374 3300044735 Ga0466968_0004259 Ga0466968_0004259_558_1115 185
1375 3300044735 Ga0466968_0080290 Ga0466968_0080290_849_1406 185
1376 3300044735 Ga0466968_0110083 Ga0466968_0110083_641_1198 185
1377 3300044765 Ga0466970_0014404 Ga0466970_0014404_3195_3752 185
1378 3300044765 Ga0466970_0034540 Ga0466970_0034540_1140_1697 185
1379 3300044765 Ga0466970_0046706 Ga0466970_0046706_429_986 185
1380 3300044765 Ga0466970_0140077 Ga0466970_0140077_536_1093 185
1381 3300044765 Ga0466970_0617232 Ga0466970_0617232_25_582 185
1382 3300044842 Ga0466957_0006350 Ga0466957_0006350_4537_5094 185
1383 3300044842 Ga0466957_0043560 Ga0466957_0043560_651_1208 185
1384 3300044842 Ga0466957_0146172 Ga0466957_0146172_410_967 185
1385 3300044842 Ga0466957_0183293 Ga0466957_0183293_242_799 185
1386 3300044842 Ga0466957_0574084 Ga0466957_0574084_143_700 185
1387 3300044901 Ga0466960_0012557 Ga0466960_0012557_1108_1665 185
1388 3300044901 Ga0466960_0035095 Ga0466960_0035095_108_665 185
1389 3300044901 Ga0466960_0142737 Ga0466960_0142737_399_956 185
1390 3300044901 Ga0466960_0227650 Ga0466960_0227650_343_900 185
1391 3300044901 Ga0466960_0240480 Ga0466960_0240480_261_818 185
1392 3300045049 Ga0466959_0004865 Ga0466959_0004865_8244_8801 185
1393 3300045049 Ga0466959_0050789 Ga0466959_0050789_2134_2691 185
1394 3300045049 Ga0466959_0054402 Ga0466959_0054402_149_706 185
1395 3300045049 Ga0466959_0127262 Ga0466959_0127262_677_1234 185
1396 3300045049 Ga0466959_0289491 Ga0466959_0289491_495_1052 185
1397 3300045836 Ga0466958_0006271 Ga0466958_0006271_2936_3493 185
1398 3300045836 Ga0466958_0031584 Ga0466958_0031584_1934_2491 185
1399 3300045836 Ga0466958_0064683 Ga0466958_0064683_1079_1636 185
1400 3300045836 Ga0466958_0203297 Ga0466958_0203297_533_1090 185
1401 3300045836 Ga0466958_0212976 Ga0466958_0212976_250_807 185
1402 3300045836 Ga0466958_0584268 Ga0466958_0584268_31_588 185
1403 3300045976 Ga0466967_0007446 Ga0466967_0007446_5453_6010 185
1404 3300045976 Ga0466967_0015686 Ga0466967_0015686_4708_5265 185
1405 3300045976 Ga0466967_0070024 Ga0466967_0070024_1055_1612 185
1406 3300045976 Ga0466967_0110983 Ga0466967_0110983_795_1352 185
1407 3300045976 Ga0466967_0232752 Ga0466967_0232752_1124_1681 185
1408 3300045976 Ga0466967_0263586 Ga0466967_0263586_880_1437 185
1409 3300045976 Ga0466967_0360779 Ga0466967_0360779_801_1373 185
1410 3300045976 Ga0466967_0362372 Ga0466967_0362372_187_744 185
1411 3300045976 Ga0466967_0825130 Ga0466967_0825130_70_681 185
1412 3300045976 Ga0466967_0836912 Ga0466967_0836912_280_837 185
1413 3300045976 Ga0466967_1131594 Ga0466967_1131594_166_723 185
1414 3300045976 Ga0466967_1416011 Ga0466967_1416011_10_567 185
1415 3300045976 Ga0466967_1591624 Ga0466967_1591624_27_584 185
1416 3300046454 Ga0495592_0007874 Ga0495592_0007874_79_636 185
1417 3300046455 Ga0495603_0028336 Ga0495603_0028336_740_1297 185
1418 3300046455 Ga0495603_0188708 Ga0495603_0188708_43_600 185
1419 3300046459 Ga0495629_0028150 Ga0495629_0028150_3347_3931 185
1420 3300046459 Ga0495629_0050662 Ga0495629_0050662_423_980 185
1421 3300046459 Ga0495629_0245141 Ga0495629_0245141_195_752 185
1422 3300046460 Ga0495638_0000404 Ga0495638_0000404_32540_33121 185
1423 3300046460 Ga0495638_0040372 Ga0495638_0040372_1613_2170 185
1424 3300046461 Ga0495641_0063617 Ga0495641_0063617_747_1304 185
1425 3300046462 Ga0495651_0005319 Ga0495651_0005319_5925_6482 185
1426 3300046463 Ga0495653_0018404 Ga0495653_0018404_3768_4325 185
1427 3300046471 Ga0495650_0037786 Ga0495650_0037786_607_1164 185
1428 3300046472 Ga0495580_0152461 Ga0495580_0152461_819_1376 185
1429 3300046473 Ga0495582_0069322 Ga0495582_0069322_380_937 185
1430 3300046475 Ga0495639_0047426 Ga0495639_0047426_627_1184 185
1431 3300046475 Ga0495639_0180112 Ga0495639_0180112_382_939 185
1432 3300046476 Ga0495662_0018597 Ga0495662_0018597_937_1494 185
1433 3300046477 Ga0495664_0055818 Ga0495664_0055818_707_1264 185
1434 3300046491 Ga0495584_0426863 Ga0495584_0426863_62_619 185
1435 3300046499 Ga0495594_0032415 Ga0495594_0032415_663_1220 185
1436 3300046507 Ga0495606_0006711 Ga0495606_0006711_6029_6586 185
1437 3300046511 Ga0495608_0122041 Ga0495608_0122041_79_636 185
1438 3300046514 Ga0495618_0041735 Ga0495618_0041735_56_613 185
1439 3300046520 Ga0495637_0200219 Ga0495637_0200219_70_627 185
1440 3300046524 Ga0495648_0006131 Ga0495648_0006131_5203_5760 185
1441 3300046531 Ga0495665_0016311 Ga0495665_0016311_3362_3919 185
1442 3300046533 Ga0495640_0075932 Ga0495640_0075932_86_643 185
1443 3300046536 Ga0495587_0002872 Ga0495587_0002872_5297_5854 185
1444 3300046543 Ga0495645_0069873 Ga0495645_0069873_769_1326 185
1445 3300046559 Ga0495667_0010610 Ga0495667_0010610_4446_5003 185
1446 3300046559 Ga0495667_0621639 Ga0495667_0621639_24_581 185
1447 3300046616 Ga0495668_0000828 Ga0495668_0000828_30736_31293 185
1448 3300046648 Ga0495611_0048063 Ga0495611_0048063_1261_1818 185
1449 3300046660 Ga0495625_0147559 Ga0495625_0147559_671_1252 185
1450 3300046660 Ga0495625_0254479 Ga0495625_0254479_54_611 185
1451 3300046660 Ga0495625_0446763 Ga0495625_0446763_198_755 185
1452 3300046663 Ga0495635_0067337 Ga0495635_0067337_348_905 185
1453 3300046663 Ga0495635_0326627 Ga0495635_0326627_411_968 185
1454 3300046674 Ga0495588_0054430 Ga0495588_0054430_673_1230 185
1455 3300046675 Ga0495657_0032178 Ga0495657_0032178_2585_3142 185
1456 3300046678 Ga0495599_0027015 Ga0495599_0027015_56_613 185
1457 3300046679 Ga0495623_0026144 Ga0495623_0026144_1975_2532 185
1458 3300046680 Ga0495646_0004088 Ga0495646_0004088_5441_5998 185
1459 3300046690 Ga0495624_0216279 Ga0495624_0216279_154_711 185
1460 3300046690 Ga0495624_0323288 Ga0495624_0323288_161_718 185
1461 3300046694 Ga0495649_0131025 Ga0495649_0131025_568_1125 185
1462 3300046809 Ga0495600_0046110 Ga0495600_0046110_345_902 185
1463 3300047315 Ga0495581_0038922 Ga0495581_0038922_1805_2362 185
1464 3300047317 Ga0495604_0173564 Ga0495604_0173564_648_1205 185
1465 3300047319 Ga0495674_0024000 Ga0495674_0024000_1946_2503 185
1466 3300047319 Ga0495674_0808774 Ga0495674_0808774_37_594 185
1467 3300047320 Ga0495672_0004146 Ga0495672_0004146_862_1419 185
1468 3300047320 Ga0495672_0067610 Ga0495672_0067610_429_986 185
1469 3300047321 Ga0495676_0202607 Ga0495676_0202607_29_586 185
1470 3300047321 Ga0495676_0270008 Ga0495676_0270008_31_588 185
1471 3300047322 Ga0495680_0115646 Ga0495680_0115646_80_637 185
1472 3300047323 Ga0495683_0000556 Ga0495683_0000556_8116_8730 185
1473 3300047469 Ga0495673_0008785 Ga0495673_0008785_2377_2934 185
1474 3300047471 Ga0495684_0000810 Ga0495684_0000810_8437_8994 185
1475 3300047472 Ga0495686_0003290 Ga0495686_0003290_1860_2417 185
1476 3300048088 Ga0495602_0044910 Ga0495602_0044910_1100_1657 185
1477 3300048089 Ga0495614_0131231 Ga0495614_0131231_57_614 185
1478 3300048089 Ga0495614_0288456 Ga0495614_0288456_15_572 185
1479 3300048091 Ga0495626_0000129 Ga0495626_0000129_90664_91221 185
1480 3300048091 Ga0495626_0129581 Ga0495626_0129581_126_683 185
1481 3300048903 Ga0496100_0001059 Ga0496100_0001059_6172_6729 185
1482 3300048903 Ga0496100_0001991 Ga0496100_0001991_7086_7643 185
1483 3300048903 Ga0496100_0132315 Ga0496100_0132315_26_583 185
1484 3300048903 Ga0496100_0164189 Ga0496100_0164189_928_1485 185
1485 3300048904 Ga0496101_0000077 Ga0496101_0000077_91928_92485 185
1486 3300048904 Ga0496101_0001299 Ga0496101_0001299_6599_7156 185
1487 3300048904 Ga0496101_0001446 Ga0496101_0001446_4477_5034 185
1488 3300048904 Ga0496101_0014892 Ga0496101_0014892_765_1322 185
1489 3300048904 Ga0496101_0126753 Ga0496101_0126753_495_1052 185
1490 3300048905 Ga0496102_0000037 Ga0496102_0000037_106732_107289 185
1491 3300048905 Ga0496102_0000256 Ga0496102_0000256_1881_2438 185
1492 3300048905 Ga0496102_0004763 Ga0496102_0004763_6997_7554 185
1493 3300048905 Ga0496102_0029265 Ga0496102_0029265_3630_4187 185
1494 3300048905 Ga0496102_0069242 Ga0496102_0069242_584_1141 185
1495 3300048905 Ga0496102_0166235 Ga0496102_0166235_575_1132 185
1496 3300048905 Ga0496102_0243316 Ga0496102_0243316_613_1170 185
1497 3300048905 Ga0496102_0631950 Ga0496102_0631950_217_774 185
1498 3300048905 Ga0496102_0731465 Ga0496102_0731465_77_634 185
1499 3300048905 Ga0496102_0858957 Ga0496102_0858957_64_621 185
1500 3300048906 Ga0496103_0000004 Ga0496103_0000004_417444_418001 185
1501 3300048906 Ga0496103_0000794 Ga0496103_0000794_9091_9648 185
1502 3300048906 Ga0496103_0000989 Ga0496103_0000989_18634_19191 185
1503 3300048906 Ga0496103_0005905 Ga0496103_0005905_5878_6435 185
1504 3300048907 Ga0496104_0011109 Ga0496104_0011109_4842_5399 185
1505 3300048907 Ga0496104_0012595 Ga0496104_0012595_2212_2769 185
1506 3300048907 Ga0496104_0014362 Ga0496104_0014362_1291_1848 185
1507 3300048907 Ga0496104_0046358 Ga0496104_0046358_3451_4008 185
1508 3300048907 Ga0496104_0067920 Ga0496104_0067920_1922_2479 185
1509 3300048907 Ga0496104_0168673 Ga0496104_0168673_994_1551 185
1510 3300048907 Ga0496104_0277831 Ga0496104_0277831_847_1404 185
1511 3300048907 Ga0496104_0279915 Ga0496104_0279915_12_569 185
1512 3300048907 Ga0496104_0339427 Ga0496104_0339427_777_1334 185
1513 3300048907 Ga0496104_0345225 Ga0496104_0345225_816_1373 185
1514 3300048907 Ga0496104_0734080 Ga0496104_0734080_231_788 185
1515 3300048907 Ga0496104_0802844 Ga0496104_0802844_172_729 185
1516 3300048907 Ga0496104_1315809 Ga0496104_1315809_24_581 185
1517 3300048908 Ga0496105_0001050 Ga0496105_0001050_4946_5503 185
1518 3300048908 Ga0496105_0008651 Ga0496105_0008651_5992_6549 185
1519 3300048908 Ga0496105_0009531 Ga0496105_0009531_4196_4753 185
1520 3300048908 Ga0496105_0018635 Ga0496105_0018635_1204_1761 185
1521 3300048908 Ga0496105_0065095 Ga0496105_0065095_2253_2810 185
1522 3300048908 Ga0496105_0238087 Ga0496105_0238087_164_721 185
1523 3300048908 Ga0496105_0590551 Ga0496105_0590551_31_588 185
1524 3300048908 Ga0496105_0742591 Ga0496105_0742591_79_636 185
1525 3300048909 Ga0496106_0001022 Ga0496106_0001022_13993_14550 185
1526 3300048909 Ga0496106_0001882 Ga0496106_0001882_6314_6871 185
1527 3300048909 Ga0496106_0002196 Ga0496106_0002196_5956_6513 185
1528 3300048909 Ga0496106_0009913 Ga0496106_0009913_3129_3686 185
1529 3300048909 Ga0496106_0040890 Ga0496106_0040890_2213_2770 185
1530 3300048909 Ga0496106_0043944 Ga0496106_0043944_1242_1799 185
1531 3300048909 Ga0496106_0074263 Ga0496106_0074263_443_1000 185
1532 3300048909 Ga0496106_0131416 Ga0496106_0131416_587_1144 185
1533 3300048909 Ga0496106_0498996 Ga0496106_0498996_392_949 185
1534 3300048910 Ga0496107_0001063 Ga0496107_0001063_9703_10260 185
1535 3300048910 Ga0496107_0006939 Ga0496107_0006939_3355_3912 185
1536 3300048910 Ga0496107_0129137 Ga0496107_0129137_1149_1706 185
1537 3300048910 Ga0496107_0219516 Ga0496107_0219516_324_881 185
1538 3300048910 Ga0496107_0298049 Ga0496107_0298049_108_665 185
1539 3300048910 Ga0496107_0416542 Ga0496107_0416542_13_570 185
1540 3300048911 Ga0496108_0000048 Ga0496108_0000048_20286_20843 185
1541 3300048911 Ga0496108_0017967 Ga0496108_0017967_1867_2424 185
1542 3300048911 Ga0496108_0022936 Ga0496108_0022936_4324_4881 185
1543 3300048911 Ga0496108_0024627 Ga0496108_0024627_2908_3465 185
1544 3300048911 Ga0496108_0055912 Ga0496108_0055912_2443_3000 185
1545 3300048911 Ga0496108_0067656 Ga0496108_0067656_345_902 185
1546 3300048911 Ga0496108_0265099 Ga0496108_0265099_678_1235 185
1547 3300048911 Ga0496108_0473256 Ga0496108_0473256_106_663 185
1548 3300048911 Ga0496108_0601456 Ga0496108_0601456_277_834 185
1549 3300048911 Ga0496108_1059205 Ga0496108_1059205_108_665 185
1550 3300048912 Ga0496109_0014524 Ga0496109_0014524_5161_5718 185
1551 3300048912 Ga0496109_0034038 Ga0496109_0034038_3740_4297 185
1552 3300048912 Ga0496109_0097687 Ga0496109_0097687_303_860 185
1553 3300048912 Ga0496109_0175660 Ga0496109_0175660_375_932 185
1554 3300048912 Ga0496109_0273200 Ga0496109_0273200_263_820 185
1555 3300048912 Ga0496109_0329027 Ga0496109_0329027_249_806 185
1556 3300048912 Ga0496109_0472378 Ga0496109_0472378_186_743 185
1557 3300048912 Ga0496109_0473563 Ga0496109_0473563_314_871 185
1558 3300048912 Ga0496109_0829819 Ga0496109_0829819_98_655 185
1559 3300048913 Ga0496110_0012522 Ga0496110_0012522_3457_4014 185
1560 3300048913 Ga0496110_0086041 Ga0496110_0086041_914_1471 185
1561 3300048913 Ga0496110_0167350 Ga0496110_0167350_868_1425 185
1562 3300048913 Ga0496110_0221531 Ga0496110_0221531_1129_1686 185
1563 3300048913 Ga0496110_0412374 Ga0496110_0412374_122_679 185
1564 3300048913 Ga0496110_0535011 Ga0496110_0535011_10_567 185
1565 3300048913 Ga0496110_0648793 Ga0496110_0648793_271_828 185
1566 3300048913 Ga0496110_0686945 Ga0496110_0686945_316_873 185
1567 3300048913 Ga0496110_0702286 Ga0496110_0702286_254_811 185
1568 3300048914 Ga0496111_0014059 Ga0496111_0014059_3198_3755 185
1569 3300048914 Ga0496111_0076563 Ga0496111_0076563_407_964 185
1570 3300048914 Ga0496111_0099203 Ga0496111_0099203_1537_2094 185
1571 3300048914 Ga0496111_0199593 Ga0496111_0199593_131_688 185
1572 3300048914 Ga0496111_0213470 Ga0496111_0213470_132_689 185
1573 3300048914 Ga0496111_0261281 Ga0496111_0261281_257_814 185
1574 3300048914 Ga0496111_0843153 Ga0496111_0843153_88_645 185
1575 3300048915 Ga0496112_0034664 Ga0496112_0034664_2648_3205 185
1576 3300048915 Ga0496112_0046141 Ga0496112_0046141_569_1126 185
1577 3300048915 Ga0496112_0056105 Ga0496112_0056105_1911_2468 185
1578 3300048915 Ga0496112_0071994 Ga0496112_0071994_679_1236 185
1579 3300048915 Ga0496112_0127973 Ga0496112_0127973_1910_2467 185
1580 3300048915 Ga0496112_0131442 Ga0496112_0131442_1023_1580 185
1581 3300048915 Ga0496112_0867844 Ga0496112_0867844_149_706 185
1582 3300048915 Ga0496112_0881046 Ga0496112_0881046_241_798 185
1583 3300048916 Ga0496113_0012604 Ga0496113_0012604_1991_2548 185
1584 3300048916 Ga0496113_0033257 Ga0496113_0033257_666_1223 185
1585 3300048916 Ga0496113_0035130 Ga0496113_0035130_1119_1676 185
1586 3300048916 Ga0496113_0076174 Ga0496113_0076174_1118_1675 185
1587 3300048916 Ga0496113_0113040 Ga0496113_0113040_400_957 185
1588 3300048916 Ga0496113_0156392 Ga0496113_0156392_758_1315 185
1589 3300048916 Ga0496113_0212305 Ga0496113_0212305_757_1314 185
1590 3300048916 Ga0496113_0495253 Ga0496113_0495253_307_864 185
1591 3300048917 Ga0496114_0000183 Ga0496114_0000183_11896_12453 185
1592 3300048917 Ga0496114_0017184 Ga0496114_0017184_5243_5800 185
1593 3300048917 Ga0496114_0021514 Ga0496114_0021514_4272_4829 185
1594 3300048917 Ga0496114_0273624 Ga0496114_0273624_403_960 185
1595 3300048917 Ga0496114_0305629 Ga0496114_0305629_213_770 185
1596 3300048917 Ga0496114_0353884 Ga0496114_0353884_274_831 185
1597 3300048917 Ga0496114_0730061 Ga0496114_0730061_277_834 185
1598 3300048917 Ga0496114_0774833 Ga0496114_0774833_238_795 185
1599 3300048918 Ga0496115_0000622 Ga0496115_0000622_14848_15405 185
1600 3300048918 Ga0496115_0005063 Ga0496115_0005063_1771_2328 185
1601 3300048918 Ga0496115_0023839 Ga0496115_0023839_2837_3394 185
1602 3300048918 Ga0496115_0085539 Ga0496115_0085539_1241_1798 185
1603 3300048918 Ga0496115_0215640 Ga0496115_0215640_891_1448 185
1604 3300048918 Ga0496115_0334015 Ga0496115_0334015_29_586 185
1605 3300048919 Ga0496116_0000056 Ga0496116_0000056_264694_265251 185
1606 3300048919 Ga0496116_0027028 Ga0496116_0027028_1753_2310 185
1607 3300048920 Ga0496117_0000003 Ga0496117_0000003_1615847_1616404 185
1608 3300048920 Ga0496117_0008065 Ga0496117_0008065_4985_5542 185
1609 3300048920 Ga0496117_0134985 Ga0496117_0134985_373_930 185
1610 3300048921 Ga0496118_0000001 Ga0496118_0000001_1615850_1616407 185
1611 3300048921 Ga0496118_0000275 Ga0496118_0000275_4548_5105 185
1612 3300048921 Ga0496118_0000341 Ga0496118_0000341_49109_49666 185
1613 3300048922 Ga0496119_0008492 Ga0496119_0008492_402_959 185
1614 3300048922 Ga0496119_0010721 Ga0496119_0010721_2754_3311 185
1615 3300048923 Ga0496120_0012266 Ga0496120_0012266_4883_5440 185
1616 3300048923 Ga0496120_0026625 Ga0496120_0026625_2413_2970 185
1617 3300048924 Ga0496121_0002761 Ga0496121_0002761_16752_17309 185
1618 3300048924 Ga0496121_0009107 Ga0496121_0009107_5548_6105 185
1619 3300048924 Ga0496121_0050901 Ga0496121_0050901_1681_2238 185
1620 3300048924 Ga0496121_0136099 Ga0496121_0136099_524_1117 185
1621 3300048926 Ga0496123_0281802 Ga0496123_0281802_99_656 185
1622 3300048927 Ga0496124_0102890 Ga0496124_0102890_1681_2238 185
1623 3300048927 Ga0496124_0253794 Ga0496124_0253794_233_790 185
1624 3300048927 Ga0496124_0469445 Ga0496124_0469445_258_815 185
1625 3300048928 Ga0496125_0009039 Ga0496125_0009039_4882_5439 185
1626 3300048928 Ga0496125_0034567 Ga0496125_0034567_680_1237 185
1627 3300048928 Ga0496125_0508031 Ga0496125_0508031_54_611 185
1628 3300048929 Ga0496126_0000735 Ga0496126_0000735_16810_17367 185
1629 3300048929 Ga0496126_0009468 Ga0496126_0009468_4397_4954 185
1630 3300048929 Ga0496126_0016764 Ga0496126_0016764_4681_5238 185
1631 3300048929 Ga0496126_0036675 Ga0496126_0036675_1071_1628 185
1632 3300048929 Ga0496126_0110320 Ga0496126_0110320_869_1426 185
1633 3300048929 Ga0496126_0129903 Ga0496126_0129903_767_1324 185
1634 3300048929 Ga0496126_0192215 Ga0496126_0192215_922_1479 185
1635 3300049460 Ga0495682_0139774 Ga0495682_0139774_42_599 185
1636 3300049569 Ga0501032_0000761 Ga0501032_0000761_13857_14414 185
1637 3300049569 Ga0501032_0023657 Ga0501032_0023657_1497_2054 185
1638 3300049569 Ga0501032_0037709 Ga0501032_0037709_1161_1718 185
1639 3300049570 Ga0501033_0069131 Ga0501033_0069131_2019_2576 185
1640 3300049570 Ga0501033_0090616 Ga0501033_0090616_1480_2037 185
1641 3300049570 Ga0501033_0192753 Ga0501033_0192753_88_645 185
1642 3300049571 Ga0501034_0002114 Ga0501034_0002114_15910_16467 185
1643 3300049571 Ga0501034_0015184 Ga0501034_0015184_532_1089 185
1644 3300049571 Ga0501034_0058841 Ga0501034_0058841_1381_1938 185
1645 3300049572 Ga0501036_0030217 Ga0501036_0030217_2500_3057 185
1646 3300049573 Ga0501037_0000297 Ga0501037_0000297_15441_15998 185
1647 3300049573 Ga0501037_0011758 Ga0501037_0011758_2162_2719 185
1648 3300049574 Ga0501038_0002100 Ga0501038_0002100_11215_11772 185
1649 3300049575 Ga0501039_0000338 Ga0501039_0000338_12947_13504 185
1650 3300049579 Ga0501043_0001384 Ga0501043_0001384_14278_14835 185
1651 3300049579 Ga0501043_0078158 Ga0501043_0078158_439_996 185
1652 3300049579 Ga0501043_0092619 Ga0501043_0092619_1553_2110 185
1653 3300049579 Ga0501043_0094547 Ga0501043_0094547_988_1545 185
1654 3300049579 Ga0501043_0336064 Ga0501043_0336064_269_826 185
1655 3300049580 Ga0501046_0008048 Ga0501046_0008048_7689_8246 185
1656 3300049580 Ga0501046_0032765 Ga0501046_0032765_2668_3225 185
1657 3300049581 Ga0501047_0010221 Ga0501047_0010221_1717_2274 185
1658 3300049581 Ga0501047_0034070 Ga0501047_0034070_920_1477 185
1659 3300049581 Ga0501047_0118531 Ga0501047_0118531_510_1067 185
1660 3300049582 Ga0501048_0004723 Ga0501048_0004723_5966_6523 185
1661 3300049583 Ga0501067_0082322 Ga0501067_0082322_840_1397 185
1662 3300049584 Ga0501068_0688282 Ga0501068_0688282_48_605 185
1663 3300049585 Ga0501069_0017938 Ga0501069_0017938_2772_3329 185
1664 3300049586 Ga0501070_0000944 Ga0501070_0000944_19245_19802 185
1665 3300049586 Ga0501070_0005284 Ga0501070_0005284_1636_2193 185
1666 3300049586 Ga0501070_0061667 Ga0501070_0061667_1788_2345 185
1667 3300049586 Ga0501070_0224437 Ga0501070_0224437_366_923 185
1668 3300049586 Ga0501070_0367554 Ga0501070_0367554_142_699 185
1669 3300049588 Ga0501072_0260317 Ga0501072_0260317_203_760 185
1670 3300049588 Ga0501072_0339201 Ga0501072_0339201_156_713 185
1671 3300049589 Ga0501073_0012332 Ga0501073_0012332_990_1547 185
1672 3300049589 Ga0501073_0111885 Ga0501073_0111885_548_1105 185
1673 3300049589 Ga0501073_0230034 Ga0501073_0230034_361_918 185
1674 3300049592 Ga0501076_0059887 Ga0501076_0059887_2069_2626 185
1675 3300049592 Ga0501076_0668079 Ga0501076_0668079_252_839 185
1676 3300049742 Ga0501080_0077126 Ga0501080_0077126_1974_2531 185
1677 3300049742 Ga0501080_0549219 Ga0501080_0549219_60_617 185
1678 3300049743 Ga0501081_0106694 Ga0501081_0106694_748_1305 185
1679 3300049822 Ga0501035_0001031 Ga0501035_0001031_4699_5256 185
1680 3300049822 Ga0501035_0114563 Ga0501035_0114563_566_1123 185
1681 3300049823 Ga0501044_0002147 Ga0501044_0002147_18755_19312 185
1682 3300049823 Ga0501044_0002404 Ga0501044_0002404_7328_7885 185
1683 3300049823 Ga0501044_0005301 Ga0501044_0005301_10708_11265 185
1684 3300049823 Ga0501044_0011051 Ga0501044_0011051_7162_7719 185
1685 3300049823 Ga0501044_0119124 Ga0501044_0119124_669_1226 185
1686 3300049823 Ga0501044_0871891 Ga0501044_0871891_76_633 185
1687 3300049823 Ga0501044_0983470 Ga0501044_0983470_122_679 185
1688 3300049824 Ga0501045_0583608 Ga0501045_0583608_118_675 185
1689 3300050489 nmdc:mga03683_23268_c1 nmdc:mga03683_23268_c1_767_1324 185
1690 3300050489 nmdc:mga03683_45109_c2 nmdc:mga03683_45109_c2_257_814 185
1691 3300050489 nmdc:mga03683_4878_c1 nmdc:mga03683_4878_c1_1898_2455 185
1692 3300050489 nmdc:mga03683_49684_c1 nmdc:mga03683_49684_c1_144_701 185
1693 3300050490 nmdc:mga03n38_137296_c1 nmdc:mga03n38_137296_c1_519_1076 185
1694 3300050490 nmdc:mga03n38_147128_c1 nmdc:mga03n38_147128_c1_71_628 185
1695 3300050490 nmdc:mga03n38_18186_c1 nmdc:mga03n38_18186_c1_1196_1753 185
1696 3300050490 nmdc:mga03n38_28716_c1 nmdc:mga03n38_28716_c1_1134_1691 185
1697 3300050490 nmdc:mga03n38_309949_c1 nmdc:mga03n38_309949_c1_181_738 185
1698 3300050490 nmdc:mga03n38_322144_c1 nmdc:mga03n38_322144_c1_159_716 185
1699 3300050490 nmdc:mga03n38_358348_c1 nmdc:mga03n38_358348_c1_82_639 185
1700 3300050490 nmdc:mga03n38_498_c1 nmdc:mga03n38_498_c1_5088_5645 185
1701 3300050490 nmdc:mga03n38_5479_c1 nmdc:mga03n38_5479_c1_1039_1596 185
1702 3300050490 nmdc:mga03n38_5660_c1 nmdc:mga03n38_5660_c1_3225_3782 185
1703 3300050491 nmdc:mga00v17_12539_c1 nmdc:mga00v17_12539_c1_628_1185 185
1704 3300050491 nmdc:mga00v17_186120_c1 nmdc:mga00v17_186120_c1_684_1241 185
1705 3300050491 nmdc:mga00v17_18775_c1 nmdc:mga00v17_18775_c1_1108_1665 185
1706 3300050491 nmdc:mga00v17_26002_c1 nmdc:mga00v17_26002_c1_1749_2306 185
1707 3300050491 nmdc:mga00v17_2723_c1 nmdc:mga00v17_2723_c1_7199_7756 185
1708 3300050491 nmdc:mga00v17_44826_c1 nmdc:mga00v17_44826_c1_99_656 185
1709 3300050491 nmdc:mga00v17_52017_c1 nmdc:mga00v17_52017_c1_950_1507 185
1710 3300050491 nmdc:mga00v17_52959_c1 nmdc:mga00v17_52959_c1_647_1204 185
1711 3300050491 nmdc:mga00v17_83254_c1 nmdc:mga00v17_83254_c1_1069_1626 185
1712 3300050492 nmdc:mga0yw44_129827_c1 nmdc:mga0yw44_129827_c1_688_1245 185
1713 3300050492 nmdc:mga0yw44_178329_c1 nmdc:mga0yw44_178329_c1_191_748 185
1714 3300050492 nmdc:mga0yw44_204982_c1 nmdc:mga0yw44_204982_c1_237_794 185
1715 3300050492 nmdc:mga0yw44_295662_c1 nmdc:mga0yw44_295662_c1_440_997 185
1716 3300050492 nmdc:mga0yw44_303245_c1 nmdc:mga0yw44_303245_c1_152_709 185
1717 3300050492 nmdc:mga0yw44_39157_c1 nmdc:mga0yw44_39157_c1_431_1030 185
1718 3300050492 nmdc:mga0yw44_70558_c1 nmdc:mga0yw44_70558_c1_1043_1600 185
1719 3300050493 nmdc:mga0k408_242510_c1 nmdc:mga0k408_242510_c1_239_796 185
1720 3300050494 nmdc:mga06z11_179878_c1 nmdc:mga06z11_179878_c1_401_1000 185
1721 3300050494 nmdc:mga06z11_3681_c1 nmdc:mga06z11_3681_c1_4621_5178 185
1722 3300050494 nmdc:mga06z11_374850_c1 nmdc:mga06z11_374850_c1_90_647 185
1723 3300050496 nmdc:mga07m45_23315_c1 nmdc:mga07m45_23315_c1_645_1202 185
1724 3300050496 nmdc:mga07m45_52071_c1 nmdc:mga07m45_52071_c1_21_620 185
1725 3300050496 nmdc:mga07m45_54980_c1 nmdc:mga07m45_54980_c1_1247_1804 185
1726 3300050496 nmdc:mga07m45_62216_c1 nmdc:mga07m45_62216_c1_1384_1941 185
1727 3300050496 nmdc:mga07m45_7959_c1 nmdc:mga07m45_7959_c1_1854_2411 185
1728 3300050496 nmdc:mga07m45_99100_c1 nmdc:mga07m45_99100_c1_269_826 185
1729 3300050507 nmdc:mga05p37_194181_c1 nmdc:mga05p37_194181_c1_535_1092 185
1730 3300050507 nmdc:mga05p37_24201_c1 nmdc:mga05p37_24201_c1_2721_3278 185
1731 3300050507 nmdc:mga05p37_32606_c1 nmdc:mga05p37_32606_c1_4994_5551 185
1732 3300050507 nmdc:mga05p37_552628_c1 nmdc:mga05p37_552628_c1_599_1156 185
1733 3300050508 nmdc:mga09592_355253_c1 nmdc:mga09592_355253_c1_586_1143 185
1734 3300050508 nmdc:mga09592_534782_c1 nmdc:mga09592_534782_c1_74_676 185
1735 3300050508 nmdc:mga09592_58832_c1 nmdc:mga09592_58832_c1_1307_1864 185
1736 3300050508 nmdc:mga09592_616156_c1 nmdc:mga09592_616156_c1_345_902 185
1737 3300050509 nmdc:mga0qj67_21483_c1 nmdc:mga0qj67_21483_c1_1156_1713 185
1738 3300050510 nmdc:mga06r32_34294_c1 nmdc:mga06r32_34294_c1_891_1448 185
1739 3300050510 nmdc:mga06r32_46064_c1 nmdc:mga06r32_46064_c1_3422_3979 185
1740 3300050510 nmdc:mga06r32_585298_c1 nmdc:mga06r32_585298_c1_161_718 185
1741 3300050511 nmdc:mga08y16_1033205_c1 nmdc:mga08y16_1033205_c1_136_693 185
1742 3300050511 nmdc:mga08y16_224428_c1 nmdc:mga08y16_224428_c1_1354_1911 185
1743 3300050511 nmdc:mga08y16_368582_c1 nmdc:mga08y16_368582_c1_158_715 185
1744 3300050511 nmdc:mga08y16_432714_c1 nmdc:mga08y16_432714_c1_294_851 185
1745 3300050511 nmdc:mga08y16_95213_c1 nmdc:mga08y16_95213_c1_2331_2888 185
1746 3300050511 nmdc:mga08y16_995900_c1 nmdc:mga08y16_995900_c1_65_622 185
1747 3300050512 nmdc:mga0n895_167562_c1 nmdc:mga0n895_167562_c1_213_770 185
1748 3300050512 nmdc:mga0n895_697853_c1 nmdc:mga0n895_697853_c1_207_764 185
1749 3300050513 nmdc:mga0rr50_178753_c1 nmdc:mga0rr50_178753_c1_281_838 185
1750 3300050513 nmdc:mga0rr50_212638_c1 nmdc:mga0rr50_212638_c1_1010_1567 185
1751 3300050514 nmdc:mga08x19_225836_c1 nmdc:mga08x19_225836_c1_64_621 185
1752 3300050514 nmdc:mga08x19_99547_c1 nmdc:mga08x19_99547_c1_48_605 185
1753 3300050515 nmdc:mga0a205_76212_c1 nmdc:mga0a205_76212_c1_284_841 185
1754 3300050516 nmdc:mga0sz30_111511_c1 nmdc:mga0sz30_111511_c1_184_741 185
1755 3300050516 nmdc:mga0sz30_155977_c1 nmdc:mga0sz30_155977_c1_396_953 185
1756 3300050516 nmdc:mga0sz30_20202_c2 nmdc:mga0sz30_20202_c2_490_1047 185
1757 3300050516 nmdc:mga0sz30_2622_c1 nmdc:mga0sz30_2622_c1_3670_4227 185
1758 3300050516 nmdc:mga0sz30_28248_c1 nmdc:mga0sz30_28248_c1_1085_1642 185
1759 3300050516 nmdc:mga0sz30_39845_c1 nmdc:mga0sz30_39845_c1_1372_1929 185
1760 3300050516 nmdc:mga0sz30_4269_c2 nmdc:mga0sz30_4269_c2_2593_3150 185
1761 3300050516 nmdc:mga0sz30_4656_c1 nmdc:mga0sz30_4656_c1_3016_3573 185
1762 3300050516 nmdc:mga0sz30_8261_c1 nmdc:mga0sz30_8261_c1_2863_3420 185
1763 3300050516 nmdc:mga0sz30_91899_c1 nmdc:mga0sz30_91899_c1_582_1139 185
1764 3300053077 Ga0495601_0029727 Ga0495601_0029727_1139_1696 185
1765 3300053078 Ga0495612_0115607 Ga0495612_0115607_482_1039 185
1766 3300053079 Ga0500610_0000982 Ga0500610_0000982_2447_3004 185
1767 3300053084 Ga0495595_0122387 Ga0495595_0122387_340_897 185
1768 3300053084 Ga0495595_0151731 Ga0495595_0151731_245_802 185
1769 3300053085 Ga0495619_0033505 Ga0495619_0033505_2080_2637 185
1770 3300053085 Ga0495619_0391498 Ga0495619_0391498_346_903 185
1771 3300053086 Ga0500578_0045628 Ga0500578_0045628_1955_2512 185
1772 3300053086 Ga0500578_0427449 Ga0500578_0427449_42_599 185
1773 3300053087 Ga0500643_004746 Ga0500643_004746_2783_3340 185
1774 3300053088 Ga0500644_0036174 Ga0500644_0036174_451_1008 185
1775 3300053088 Ga0500644_0151606 Ga0500644_0151606_79_636 185
1776 3300053090 Ga0500646_0000050 Ga0500646_0000050_29802_30359 185
1777 3300053104 Ga0500556_0006285 Ga0500556_0006285_467_1048 185
1778 3300053104 Ga0500556_0221358 Ga0500556_0221358_164_721 185
1779 3300053108 Ga0500562_004671 Ga0500562_004671_1378_1935 185
1780 3300053119 Ga0500595_033838 Ga0500595_033838_382_939 185
1781 3300053122 Ga0500608_143955 Ga0500608_143955_351_908 185
1782 3300053131 Ga0500652_167040 Ga0500652_167040_112_669 185
1783 3300053136 Ga0500559_0019361 Ga0500559_0019361_601_1158 185
1784 3300053139 Ga0500568_0011883 Ga0500568_0011883_3149_3706 185
1785 3300053139 Ga0500568_0063050 Ga0500568_0063050_797_1354 185
1786 3300053142 Ga0500577_0013602 Ga0500577_0013602_179_736 185
1787 3300053143 Ga0500579_071196 Ga0500579_071196_730_1287 185
1788 3300053149 Ga0500600_0176087 Ga0500600_0176087_33_590 185
1789 3300053151 Ga0500604_0085088 Ga0500604_0085088_145_702 185
1790 3300053153 Ga0500616_0007284 Ga0500616_0007284_4708_5265 185
1791 3300053158 Ga0500627_0169709 Ga0500627_0169709_114_671 185
1792 3300053730 Ga0500645_000195 Ga0500645_000195_30798_31355 185
1793 3300054114 Ga0501084_0202311 Ga0501084_0202311_843_1400 185
1794 3300059477 Ga0587084_056547 Ga0587084_056547_132_689 185
1795 3300059490 Ga0587066_061295 Ga0587066_061295_115_672 185
1796 3300059503 Ga0587080_053222 Ga0587080_053222_111_668 185
1797 3300059504 Ga0587082_020174 Ga0587082_020174_67_624 185
1798 3300059504 Ga0587082_041357 Ga0587082_041357_124_681 185
1799 3300059504 Ga0587082_057647 Ga0587082_057647_66_623 185
1800 3300059508 Ga0587088_068183 Ga0587088_068183_159_716 185
1801 3300059510 Ga0587090_044103 Ga0587090_044103_105_662 185
1802 3300059640 Ga0587067_042575 Ga0587067_042575_150_707 185
1803 3300059646 Ga0587078_013586 Ga0587078_013586_196_753 185
1804 3300059647 Ga0587079_040936 Ga0587079_040936_235_792 185
1805 3300061719 Ga0466962_0004342 Ga0466962_0004342_2760_3317 185
1806 3300061719 Ga0466962_0066904 Ga0466962_0066904_225_782 185
1807 3300061719 Ga0466962_0077158 Ga0466962_0077158_230_787 185
1808 3300061719 Ga0466962_0206582 Ga0466962_0206582_210_767 185
1809 iso_pu_bacteria 2515154088 2515496008 185
1810 iso_pu_bacteria 2515154137 2515757846 185
1811 iso_pu_bacteria 2515154203 2516090244 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

20

181

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1is1-assembly1.cif.gz_A crystal structure of ribosome recycling factor from vibrio parahaemolyticus 0.9473 1 184
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9457 1 184
1is1-assembly1.cif.gz_A crystal structure of ribosome recycling factor from vibrio parahaemolyticus 0.9424 1 184
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.9421 1 181
1ise-assembly1.cif.gz_A crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly 0.9414 3 184
ID Description Score Start End Superfamily
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 1.008 31 105 3.30.1360.40
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9945 31 105 3.30.1360.40
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9881 3 182 1.10.132.20
4kawX01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9827 3 182 1.10.132.20
4kb2A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9825 1 182 1.10.132.20
ID Description Score Start End GO Terms
AF-Q8K9S8-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.976 1 184 GO:0002184
GO:0005829
GO:0043023
AF-A0A1Y4DDG2-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9751 3 184 GO:0005737
GO:0006415
GO:0043023
AF-A0A1V5VD08-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9731 1 184 GO:0005737
GO:0006415
GO:0043023
AF-A0A426HG31-F1-model_v4 deleted 0.9729 1 184
AF-A0A6U4V2J3-F1-model_v4 Ribosome recycling factor domain-containing protein 0.9719 1 184 GO:0006412
GO:0043023

Feature Viewer

pLDDT pTM Quality
92.32 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map