F495199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1648 | 528 | 3296 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300053096|Ga0500641_0002272|Ga0500641_0002272_559_1311 |
| Length | 233 |
| Sequence | MSDSLRELGEYIAGALGPTVVGTNVALNELTVELRPADIVKASKFLRDDPNCLFKMLIDIAGVDYPEREKRFDVVYHLLSLKKNHRIRLRAKLGEEEAIPSVDSIWPAAQWFEREAYDMYGIYFSDNPDLRRLLTDYGFEGHPFRKDFPLTGYIEVRYDEAQKRVVYEPVELRQEFRSFDFLSPWEGMLQPRVLPGDEKALAPVTAAVAPAXXSGPKANPTNNPGATSSPKAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 32 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 103 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 128 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 129 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 130 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 131 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 134 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 152 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 173 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 258 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 259 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 261 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 264 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 269 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 270 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 274 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 276 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 277 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 280 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 281 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 282 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 283 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 285 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 286 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 287 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 288 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 290 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 299 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 300 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 317 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 318 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 319 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 322 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 323 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 324 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 325 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 326 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 327 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 331 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 332 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 333 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 334 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 335 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 340 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 341 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 342 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 343 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 344 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 418 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 419 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 420 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 421 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 422 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 425 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 426 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 427 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 428 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 429 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 432 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 433 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 484 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 486 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 489 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 490 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 491 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 492 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 493 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 499 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 501 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 502 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 504 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 505 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 508 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 509 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 510 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 511 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 512 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 513 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 514 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 515 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 516 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 517 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 518 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 519 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 520 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 521 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 522 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 523 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 524 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 525 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 526 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 527 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 528 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.73 |
| Metatranscriptomes | 0.06 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.73 |
| Nodule | 0.18 |
| Rhizoplane | 7.28 |
| Rhizosphere | 87.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500641_0002272 | 3300053096 | Bacteria | 6810 |
| 2 | SwRhRL2b_contig_309045 | 2162886007 | Bacteria | 1975 |
| 3 | 2214755772 | 2209111006 | Bacteria | 864 |
| 4 | 2214770210 | 2209111006 | Bacteria | 2695 |
| 5 | ARcpr5oldR_c000101 | 3300000041 | Bacteria | 15420 |
| 6 | ARSoilYngRDRAFT_c00241 | 3300000042 | Bacteria | 8764 |
| 7 | ARcpr5yngRDRAFT_c000102 | 3300000043 | Bacteria | 13547 |
| 8 | ARSoilOldRDRAFT_c000134 | 3300000044 | Bacteria | 13034 |
| 9 | ARCol0oldRDRAFT_c00121 | 3300000045 | Bacteria | 6899 |
| 10 | ARCol0yngRDRAFT_1000058 | 3300000652 | Bacteria | 19902 |
| 11 | JGI24032J14994_100156 | 3300001430 | Bacteria | 3340 |
| 12 | JGI24752J21851_1000685 | 3300001976 | Bacteria | 4517 |
| 13 | JGI24746J21847_1000232 | 3300001977 | Bacteria | 7655 |
| 14 | JGI24747J21853_1015233 | 3300001978 | Bacteria | 805 |
| 15 | JGI24739J22299_10000103 | 3300001989 | Bacteria | 25576 |
| 16 | JGI24739J22299_10035598 | 3300001989 | Bacteria | 1686 |
| 17 | JGI24737J22298_10001448 | 3300001990 | Bacteria | 8467 |
| 18 | JGI24737J22298_10008010 | 3300001990 | Bacteria | 3551 |
| 19 | JGI24737J22298_10029151 | 3300001990 | Bacteria | 1732 |
| 20 | JGI24743J22301_10004796 | 3300001991 | Bacteria | 2223 |
| 21 | JGI24750J21931_1000146 | 3300002070 | Bacteria | 11547 |
| 22 | JGI24750J21931_1001748 | 3300002070 | Bacteria | 2654 |
| 23 | JGI24745J21846_1000381 | 3300002073 | Bacteria | 3881 |
| 24 | JGI24745J21846_1029319 | 3300002073 | Bacteria | 661 |
| 25 | JGI24748J21848_1000880 | 3300002074 | Bacteria | 3254 |
| 26 | JGI24738J21930_10000080 | 3300002075 | Bacteria | 21134 |
| 27 | JGI24035J26624_1000077 | 3300002126 | Bacteria | 7943 |
| 28 | JGI24033J26618_1000650 | 3300002155 | Bacteria | 3318 |
| 29 | JGI24034J26672_10000241 | 3300002239 | Bacteria | 7230 |
| 30 | JGI24034J26672_10009334 | 3300002239 | Bacteria | 1445 |
| 31 | JGI24742J22300_10000066 | 3300002244 | Bacteria | 15346 |
| 32 | JGI24742J22300_10010687 | 3300002244 | Bacteria | 1520 |
| 33 | JGI24751J29686_10003146 | 3300002459 | Bacteria | 3325 |
| 34 | JGI24751J29686_10004621 | 3300002459 | Bacteria | 2797 |
| 35 | JGI25153J46596_10000012 | 3300003215 | Bacteria | 308056 |
| 36 | rootH2_10024840 | 3300003320 | Bacteria | 1274 |
| 37 | rootH1_10138961 | 3300003323 | Bacteria | 1394 |
| 38 | Ga0055531_10017501 | 3300003794 | Bacteria | 3021 |
| 39 | JGI25405J52794_10007814 | 3300003911 | Bacteria | 1982 |
| 40 | Ga0065717_1002263 | 3300005276 | Bacteria | 2305 |
| 41 | Ga0065716_1001748 | 3300005277 | Bacteria | 3601 |
| 42 | Ga0065704_10073258 | 3300005289 | Bacteria | 7373 |
| 43 | Ga0065704_10297603 | 3300005289 | Bacteria | 891 |
| 44 | Ga0065712_10006326 | 3300005290 | Bacteria | 4719 |
| 45 | Ga0065712_10077314 | 3300005290 | Bacteria | 3474 |
| 46 | Ga0065712_10082297 | 3300005290 | Bacteria | 2928 |
| 47 | Ga0065712_10119729 | 3300005290 | Bacteria | 1683 |
| 48 | Ga0065715_10089784 | 3300005293 | Bacteria | 8534 |
| 49 | Ga0065715_10119480 | 3300005293 | Bacteria | 2285 |
| 50 | Ga0065707_10169025 | 3300005295 | Bacteria | 1491 |
| 51 | Ga0070658_10041006 | 3300005327 | Bacteria | 3735 |
| 52 | Ga0070658_10054057 | 3300005327 | Bacteria | 3260 |
| 53 | Ga0070658_10216384 | 3300005327 | Bacteria | 1619 |
| 54 | Ga0070676_10010179 | 3300005328 | Bacteria | 5098 |
| 55 | Ga0070676_10025524 | 3300005328 | Bacteria | 3341 |
| 56 | Ga0070676_10469042 | 3300005328 | Bacteria | 888 |
| 57 | Ga0070683_100001199 | 3300005329 | Bacteria | 19731 |
| 58 | Ga0070683_100102147 | 3300005329 | Bacteria | 2700 |
| 59 | Ga0070683_100216813 | 3300005329 | Bacteria | 1818 |
| 60 | Ga0070683_100304765 | 3300005329 | Bacteria | 1515 |
| 61 | Ga0070690_100001740 | 3300005330 | Bacteria | 11501 |
| 62 | Ga0070690_100034038 | 3300005330 | Bacteria | 3191 |
| 63 | Ga0070690_100041801 | 3300005330 | Bacteria | 2903 |
| 64 | Ga0070670_100019604 | 3300005331 | Bacteria | 5806 |
| 65 | Ga0070670_100037807 | 3300005331 | Bacteria | 4152 |
| 66 | Ga0070670_100057926 | 3300005331 | Bacteria | 3325 |
| 67 | Ga0070670_100179979 | 3300005331 | Bacteria | 1835 |
| 68 | Ga0070677_10000497 | 3300005333 | Bacteria | 13540 |
| 69 | Ga0068869_100000236 | 3300005334 | Bacteria | 29097 |
| 70 | Ga0068869_100076887 | 3300005334 | Bacteria | 2482 |
| 71 | Ga0068869_100737423 | 3300005334 | Bacteria | 842 |
| 72 | Ga0070666_10002453 | 3300005335 | Bacteria | 11218 |
| 73 | Ga0070666_10008751 | 3300005335 | Bacteria | 6293 |
| 74 | Ga0070680_100007477 | 3300005336 | Bacteria | 8331 |
| 75 | Ga0070680_100017862 | 3300005336 | Bacteria | 5596 |
| 76 | Ga0070680_100031380 | 3300005336 | Bacteria | 4271 |
| 77 | Ga0070680_100076653 | 3300005336 | Bacteria | 2753 |
| 78 | Ga0070680_100236345 | 3300005336 | Bacteria | 1544 |
| 79 | Ga0070680_100555056 | 3300005336 | Bacteria | 985 |
| 80 | Ga0070682_100001100 | 3300005337 | Bacteria | 15523 |
| 81 | Ga0070682_100002602 | 3300005337 | Bacteria | 9963 |
| 82 | Ga0068868_100013245 | 3300005338 | Bacteria | 6042 |
| 83 | Ga0068868_100098536 | 3300005338 | Bacteria | 2364 |
| 84 | Ga0070660_100003492 | 3300005339 | Bacteria | 10828 |
| 85 | Ga0070660_100042365 | 3300005339 | Bacteria | 3474 |
| 86 | Ga0070660_100101864 | 3300005339 | Bacteria | 2276 |
| 87 | Ga0070660_100281957 | 3300005339 | Bacteria | 1360 |
| 88 | Ga0070689_100000466 | 3300005340 | Bacteria | 23849 |
| 89 | Ga0070689_100001040 | 3300005340 | Bacteria | 17412 |
| 90 | Ga0070689_100345745 | 3300005340 | Bacteria | 1246 |
| 91 | Ga0070689_100480293 | 3300005340 | Bacteria | 1061 |
| 92 | Ga0070691_10002256 | 3300005341 | Bacteria | 8534 |
| 93 | Ga0070691_10013301 | 3300005341 | Bacteria | 3770 |
| 94 | Ga0070691_10022786 | 3300005341 | Bacteria | 2907 |
| 95 | Ga0070687_100000277 | 3300005343 | Bacteria | 17398 |
| 96 | Ga0070687_100005651 | 3300005343 | Bacteria | 5073 |
| 97 | Ga0070687_100165924 | 3300005343 | Bacteria | 1310 |
| 98 | Ga0070661_100000444 | 3300005344 | Bacteria | 31791 |
| 99 | Ga0070661_100000827 | 3300005344 | Bacteria | 22257 |
| 100 | Ga0070661_100252817 | 3300005344 | Bacteria | 1360 |
| 101 | Ga0070661_100818290 | 3300005344 | Bacteria | 765 |
| 102 | Ga0070692_10002292 | 3300005345 | Bacteria | 7364 |
| 103 | Ga0070692_10022458 | 3300005345 | Bacteria | 3082 |
| 104 | Ga0070692_10142335 | 3300005345 | Bacteria | 1358 |
| 105 | Ga0070668_100000073 | 3300005347 | Bacteria | 62170 |
| 106 | Ga0070668_100010921 | 3300005347 | Bacteria | 6757 |
| 107 | Ga0070668_100178834 | 3300005347 | Bacteria | 1732 |
| 108 | Ga0070668_100282898 | 3300005347 | Bacteria | 1386 |
| 109 | Ga0070668_100353187 | 3300005347 | Bacteria | 1245 |
| 110 | Ga0070668_100628320 | 3300005347 | Bacteria | 942 |
| 111 | Ga0070668_100783763 | 3300005347 | Bacteria | 846 |
| 112 | Ga0070668_101173540 | 3300005347 | Bacteria | 695 |
| 113 | Ga0070669_100002399 | 3300005353 | Bacteria | 13560 |
| 114 | Ga0070669_100005353 | 3300005353 | Bacteria | 9263 |
| 115 | Ga0070675_100005703 | 3300005354 | Bacteria | 9530 |
| 116 | Ga0070675_100354821 | 3300005354 | Bacteria | 1301 |
| 117 | Ga0070675_100796216 | 3300005354 | Bacteria | 864 |
| 118 | Ga0070671_100000736 | 3300005355 | Bacteria | 23441 |
| 119 | Ga0070671_100007103 | 3300005355 | Bacteria | 8957 |
| 120 | Ga0070671_100119314 | 3300005355 | Bacteria | 2219 |
| 121 | Ga0070671_100164568 | 3300005355 | Bacteria | 1875 |
| 122 | Ga0070674_100010959 | 3300005356 | Bacteria | 5499 |
| 123 | Ga0070674_100024433 | 3300005356 | Bacteria | 3922 |
| 124 | Ga0070674_100407318 | 3300005356 | Bacteria | 1113 |
| 125 | Ga0070673_100000302 | 3300005364 | Bacteria | 25831 |
| 126 | Ga0070673_100000548 | 3300005364 | Bacteria | 20333 |
| 127 | Ga0070673_100663916 | 3300005364 | Bacteria | 955 |
| 128 | Ga0070688_100000195 | 3300005365 | Bacteria | 32155 |
| 129 | Ga0070688_100004878 | 3300005365 | Bacteria | 7018 |
| 130 | Ga0070688_100012314 | 3300005365 | Bacteria | 4789 |
| 131 | Ga0070659_100000822 | 3300005366 | Bacteria | 22680 |
| 132 | Ga0070659_100001555 | 3300005366 | Bacteria | 16548 |
| 133 | Ga0070659_100054692 | 3300005366 | Bacteria | 3144 |
| 134 | Ga0070659_100323925 | 3300005366 | Bacteria | 1289 |
| 135 | Ga0070659_100637490 | 3300005366 | Bacteria | 918 |
| 136 | Ga0070667_100002225 | 3300005367 | Bacteria | 17061 |
| 137 | Ga0070667_100002272 | 3300005367 | Bacteria | 16919 |
| 138 | Ga0070667_100065449 | 3300005367 | Bacteria | 3086 |
| 139 | Ga0070667_100120120 | 3300005367 | Bacteria | 2286 |
| 140 | Ga0070667_100433302 | 3300005367 | Bacteria | 1200 |
| 141 | Ga0070703_10001123 | 3300005406 | Bacteria | 8283 |
| 142 | Ga0070703_10009774 | 3300005406 | Bacteria | 2704 |
| 143 | Ga0070709_10007205 | 3300005434 | Bacteria | 6093 |
| 144 | Ga0070709_10016552 | 3300005434 | Bacteria | 4213 |
| 145 | Ga0070709_10018980 | 3300005434 | Bacteria | 3969 |
| 146 | Ga0070709_10052725 | 3300005434 | Bacteria | 2558 |
| 147 | Ga0070709_10190331 | 3300005434 | Bacteria | 1447 |
| 148 | Ga0070714_100002308 | 3300005435 | Bacteria | 14036 |
| 149 | Ga0070714_100031420 | 3300005435 | Bacteria | 4430 |
| 150 | Ga0070714_100043457 | 3300005435 | Bacteria | 3800 |
| 151 | Ga0070714_100072813 | 3300005435 | Bacteria | 2975 |
| 152 | Ga0070714_100080604 | 3300005435 | Bacteria | 2832 |
| 153 | Ga0070714_100132687 | 3300005435 | Bacteria | 2227 |
| 154 | Ga0070714_101061404 | 3300005435 | Bacteria | 789 |
| 155 | Ga0070713_100004212 | 3300005436 | Bacteria | 9605 |
| 156 | Ga0070713_100222693 | 3300005436 | Bacteria | 1712 |
| 157 | Ga0070710_10007408 | 3300005437 | Bacteria | 5313 |
| 158 | Ga0070710_10014126 | 3300005437 | Bacteria | 4012 |
| 159 | Ga0070710_10016794 | 3300005437 | Bacteria | 3732 |
| 160 | Ga0070710_10588971 | 3300005437 | Bacteria | 773 |
| 161 | Ga0070701_10000864 | 3300005438 | Bacteria | 10897 |
| 162 | Ga0070701_10006785 | 3300005438 | Bacteria | 4839 |
| 163 | Ga0070701_10302493 | 3300005438 | Bacteria | 984 |
| 164 | Ga0070711_100000336 | 3300005439 | Bacteria | 24119 |
| 165 | Ga0070711_100050762 | 3300005439 | Bacteria | 2845 |
| 166 | Ga0070711_100080319 | 3300005439 | Bacteria | 2322 |
| 167 | Ga0070711_100103656 | 3300005439 | Bacteria | 2074 |
| 168 | Ga0070711_100115857 | 3300005439 | Bacteria | 1974 |
| 169 | Ga0070711_100157542 | 3300005439 | Bacteria | 1718 |
| 170 | Ga0070711_100380264 | 3300005439 | Bacteria | 1142 |
| 171 | Ga0070705_100001041 | 3300005440 | Bacteria | 15446 |
| 172 | Ga0070705_100001212 | 3300005440 | Bacteria | 13972 |
| 173 | Ga0070705_100100465 | 3300005440 | Bacteria | 1825 |
| 174 | Ga0070700_100000209 | 3300005441 | Bacteria | 32736 |
| 175 | Ga0070700_100001313 | 3300005441 | Bacteria | 12331 |
| 176 | Ga0070700_100028154 | 3300005441 | Bacteria | 3339 |
| 177 | Ga0070694_100000343 | 3300005444 | Bacteria | 24947 |
| 178 | Ga0070694_100003865 | 3300005444 | Bacteria | 8952 |
| 179 | Ga0070694_100071827 | 3300005444 | Bacteria | 2386 |
| 180 | Ga0070694_100148829 | 3300005444 | Bacteria | 1708 |
| 181 | Ga0070694_100175963 | 3300005444 | Bacteria | 1580 |
| 182 | Ga0070694_100407296 | 3300005444 | Bacteria | 1066 |
| 183 | Ga0070708_100499273 | 3300005445 | Bacteria | 1148 |
| 184 | Ga0070663_100018174 | 3300005455 | Bacteria | 4603 |
| 185 | Ga0070663_100021939 | 3300005455 | Bacteria | 4258 |
| 186 | Ga0070663_100402824 | 3300005455 | Bacteria | 1119 |
| 187 | Ga0070663_100553294 | 3300005455 | Bacteria | 962 |
| 188 | Ga0070678_100000082 | 3300005456 | Bacteria | 35799 |
| 189 | Ga0070678_100005062 | 3300005456 | Bacteria | 7560 |
| 190 | Ga0070678_100133772 | 3300005456 | Bacteria | 1974 |
| 191 | Ga0070662_100004072 | 3300005457 | Bacteria | 9188 |
| 192 | Ga0070662_100019074 | 3300005457 | Bacteria | 4651 |
| 193 | Ga0070662_100086416 | 3300005457 | Bacteria | 2346 |
| 194 | Ga0070662_100141427 | 3300005457 | Bacteria | 1865 |
| 195 | Ga0070681_10058442 | 3300005458 | Bacteria | 3836 |
| 196 | Ga0070681_10169297 | 3300005458 | Bacteria | 2107 |
| 197 | Ga0070681_10342265 | 3300005458 | Bacteria | 1405 |
| 198 | Ga0070681_10391767 | 3300005458 | Bacteria | 1300 |
| 199 | Ga0070681_10831937 | 3300005458 | Bacteria | 841 |
| 200 | Ga0070681_10933106 | 3300005458 | Bacteria | 787 |
| 201 | Ga0068867_100001495 | 3300005459 | Bacteria | 16179 |
| 202 | Ga0068867_100069902 | 3300005459 | Bacteria | 2623 |
| 203 | Ga0070685_10005500 | 3300005466 | Bacteria | 6420 |
| 204 | Ga0070685_10005707 | 3300005466 | Bacteria | 6320 |
| 205 | Ga0070685_10071039 | 3300005466 | Bacteria | 2063 |
| 206 | Ga0070706_100085616 | 3300005467 | Bacteria | 2921 |
| 207 | Ga0070698_100002489 | 3300005471 | Bacteria | 20297 |
| 208 | Ga0070699_100060595 | 3300005518 | Bacteria | 3280 |
| 209 | Ga0070699_100541878 | 3300005518 | Bacteria | 1059 |
| 210 | Ga0070679_100003133 | 3300005530 | Bacteria | 15118 |
| 211 | Ga0070679_100021336 | 3300005530 | Bacteria | 6322 |
| 212 | Ga0070679_100027099 | 3300005530 | Bacteria | 5636 |
| 213 | Ga0070679_100095625 | 3300005530 | Bacteria | 2958 |
| 214 | Ga0070679_100179346 | 3300005530 | Bacteria | 2091 |
| 215 | Ga0070679_100429212 | 3300005530 | Bacteria | 1267 |
| 216 | Ga0070684_100005932 | 3300005535 | Bacteria | 9408 |
| 217 | Ga0070684_100009801 | 3300005535 | Bacteria | 7563 |
| 218 | Ga0070684_100079817 | 3300005535 | Bacteria | 2894 |
| 219 | Ga0070684_100452692 | 3300005535 | Bacteria | 1186 |
| 220 | Ga0070697_100007418 | 3300005536 | Bacteria | 8540 |
| 221 | Ga0070697_100323743 | 3300005536 | Bacteria | 1328 |
| 222 | Ga0070697_100392305 | 3300005536 | Bacteria | 1204 |
| 223 | Ga0068853_100000919 | 3300005539 | Bacteria | 20601 |
| 224 | Ga0068853_100001418 | 3300005539 | Bacteria | 17296 |
| 225 | Ga0068853_100237770 | 3300005539 | Bacteria | 1668 |
| 226 | Ga0068853_100537083 | 3300005539 | Bacteria | 1107 |
| 227 | Ga0070672_100004500 | 3300005543 | Bacteria | 9131 |
| 228 | Ga0070672_100012678 | 3300005543 | Bacteria | 5932 |
| 229 | Ga0070672_100278007 | 3300005543 | Bacteria | 1415 |
| 230 | Ga0070672_100558303 | 3300005543 | Bacteria | 994 |
| 231 | Ga0070686_100000488 | 3300005544 | Bacteria | 24002 |
| 232 | Ga0070686_100016109 | 3300005544 | Bacteria | 4343 |
| 233 | Ga0070686_100019659 | 3300005544 | Bacteria | 3983 |
| 234 | Ga0070686_100026543 | 3300005544 | Bacteria | 3497 |
| 235 | Ga0070695_100000199 | 3300005545 | Bacteria | 29292 |
| 236 | Ga0070695_100002834 | 3300005545 | Bacteria | 10077 |
| 237 | Ga0070696_100025653 | 3300005546 | Bacteria | 4008 |
| 238 | Ga0070696_100038159 | 3300005546 | Bacteria | 3315 |
| 239 | Ga0070696_100039045 | 3300005546 | Bacteria | 3278 |
| 240 | Ga0070696_100134549 | 3300005546 | Bacteria | 1801 |
| 241 | Ga0070696_100263134 | 3300005546 | Bacteria | 1309 |
| 242 | Ga0070693_100001088 | 3300005547 | Bacteria | 12187 |
| 243 | Ga0070693_100002155 | 3300005547 | Bacteria | 9028 |
| 244 | Ga0070693_100604826 | 3300005547 | Bacteria | 792 |
| 245 | Ga0070665_100036419 | 3300005548 | Bacteria | 4949 |
| 246 | Ga0070665_100539115 | 3300005548 | Bacteria | 1179 |
| 247 | Ga0070665_100604063 | 3300005548 | Bacteria | 1110 |
| 248 | Ga0070704_100002291 | 3300005549 | Bacteria | 10696 |
| 249 | Ga0070704_100009996 | 3300005549 | Bacteria | 5761 |
| 250 | Ga0070704_100016677 | 3300005549 | Bacteria | 4648 |
| 251 | Ga0070704_100674305 | 3300005549 | Bacteria | 915 |
| 252 | Ga0068855_100007603 | 3300005563 | Bacteria | 13112 |
| 253 | Ga0068855_100087832 | 3300005563 | Bacteria | 3592 |
| 254 | Ga0068855_100104984 | 3300005563 | Bacteria | 3249 |
| 255 | Ga0068855_100210414 | 3300005563 | Bacteria | 2185 |
| 256 | Ga0070664_100002753 | 3300005564 | Bacteria | 14191 |
| 257 | Ga0070664_100008587 | 3300005564 | Bacteria | 8265 |
| 258 | Ga0070664_100059778 | 3300005564 | Bacteria | 3243 |
| 259 | Ga0070664_100384799 | 3300005564 | Bacteria | 1281 |
| 260 | Ga0068857_100001539 | 3300005577 | Bacteria | 18457 |
| 261 | Ga0068857_100014667 | 3300005577 | Bacteria | 6835 |
| 262 | Ga0068857_100317658 | 3300005577 | Bacteria | 1438 |
| 263 | Ga0068857_100322633 | 3300005577 | Bacteria | 1426 |
| 264 | Ga0068854_100000611 | 3300005578 | Bacteria | 21143 |
| 265 | Ga0068854_100002718 | 3300005578 | Bacteria | 10971 |
| 266 | Ga0068856_100001722 | 3300005614 | Bacteria | 22877 |
| 267 | Ga0068856_100004058 | 3300005614 | Bacteria | 14654 |
| 268 | Ga0068856_100472386 | 3300005614 | Bacteria | 1275 |
| 269 | Ga0068856_100637316 | 3300005614 | Bacteria | 1086 |
| 270 | Ga0068856_101434292 | 3300005614 | Bacteria | 705 |
| 271 | Ga0070702_100000629 | 3300005615 | Bacteria | 13027 |
| 272 | Ga0070702_100007674 | 3300005615 | Bacteria | 5177 |
| 273 | Ga0068852_100001817 | 3300005616 | Bacteria | 14500 |
| 274 | Ga0068852_100019347 | 3300005616 | Bacteria | 5387 |
| 275 | Ga0068852_100345453 | 3300005616 | Bacteria | 1451 |
| 276 | Ga0068859_100010286 | 3300005617 | Bacteria | 9417 |
| 277 | Ga0068859_100028582 | 3300005617 | Bacteria | 5590 |
| 278 | Ga0068859_100067731 | 3300005617 | Bacteria | 3605 |
| 279 | Ga0068859_100445196 | 3300005617 | Bacteria | 1391 |
| 280 | Ga0068859_100631253 | 3300005617 | Bacteria | 1164 |
| 281 | Ga0068864_100001077 | 3300005618 | Bacteria | 22916 |
| 282 | Ga0068864_100002498 | 3300005618 | Bacteria | 15204 |
| 283 | Ga0068866_10003421 | 3300005718 | Bacteria | 6504 |
| 284 | Ga0068866_10004287 | 3300005718 | Bacteria | 5858 |
| 285 | Ga0068866_10079424 | 3300005718 | Bacteria | 1758 |
| 286 | Ga0068866_10461815 | 3300005718 | Bacteria | 833 |
| 287 | Ga0068866_10471624 | 3300005718 | Bacteria | 825 |
| 288 | Ga0068861_100000276 | 3300005719 | Bacteria | 28799 |
| 289 | Ga0068861_100000668 | 3300005719 | Bacteria | 20402 |
| 290 | Ga0068861_100746055 | 3300005719 | Bacteria | 914 |
| 291 | Ga0068861_101141037 | 3300005719 | Bacteria | 751 |
| 292 | Ga0068851_10088430 | 3300005834 | Bacteria | 1628 |
| 293 | Ga0068870_10000676 | 3300005840 | Bacteria | 13010 |
| 294 | Ga0068863_100004649 | 3300005841 | Bacteria | 13532 |
| 295 | Ga0068863_100079646 | 3300005841 | Bacteria | 3102 |
| 296 | Ga0068863_100149658 | 3300005841 | Bacteria | 2233 |
| 297 | Ga0068858_100008130 | 3300005842 | Bacteria | 10087 |
| 298 | Ga0068858_100040605 | 3300005842 | Bacteria | 4315 |
| 299 | Ga0068858_100049152 | 3300005842 | Bacteria | 3906 |
| 300 | Ga0068858_100266723 | 3300005842 | Bacteria | 1628 |
| 301 | Ga0068860_100001413 | 3300005843 | Bacteria | 26001 |
| 302 | Ga0068860_100007431 | 3300005843 | Bacteria | 10959 |
| 303 | Ga0068860_100055702 | 3300005843 | Bacteria | 3759 |
| 304 | Ga0068860_100580770 | 3300005843 | Bacteria | 1125 |
| 305 | Ga0068860_100693620 | 3300005843 | Bacteria | 1028 |
| 306 | Ga0068862_100003455 | 3300005844 | Bacteria | 13587 |
| 307 | Ga0068862_100008906 | 3300005844 | Bacteria | 8308 |
| 308 | Ga0068862_100043721 | 3300005844 | Bacteria | 3819 |
| 309 | Ga0068862_100317644 | 3300005844 | Bacteria | 1437 |
| 310 | Ga0068862_101205480 | 3300005844 | Bacteria | 756 |
| 311 | Ga0081455_10000327 | 3300005937 | Bacteria | 62253 |
| 312 | Ga0081455_10001182 | 3300005937 | Bacteria | 32680 |
| 313 | Ga0081455_10021675 | 3300005937 | Bacteria | 6020 |
| 314 | Ga0081455_10517411 | 3300005937 | Bacteria | 797 |
| 315 | Ga0081540_1000205 | 3300005983 | Bacteria | 61689 |
| 316 | Ga0081540_1002248 | 3300005983 | Bacteria | 15898 |
| 317 | Ga0070717_10000258 | 3300006028 | Bacteria | 36170 |
| 318 | Ga0070717_10001681 | 3300006028 | Bacteria | 15390 |
| 319 | Ga0070717_10186052 | 3300006028 | Bacteria | 1813 |
| 320 | Ga0070717_10261035 | 3300006028 | Bacteria | 1533 |
| 321 | Ga0075365_10363787 | 3300006038 | Bacteria | 1020 |
| 322 | Ga0075363_100107412 | 3300006048 | Bacteria | 1549 |
| 323 | Ga0075432_10008052 | 3300006058 | Bacteria | 3597 |
| 324 | Ga0075432_10037257 | 3300006058 | Bacteria | 1692 |
| 325 | Ga0070715_10016112 | 3300006163 | Bacteria | 2801 |
| 326 | Ga0070716_100003087 | 3300006173 | Bacteria | 7775 |
| 327 | Ga0070716_100007734 | 3300006173 | Bacteria | 5305 |
| 328 | Ga0070712_100004644 | 3300006175 | Bacteria | 8496 |
| 329 | Ga0070712_100006392 | 3300006175 | Bacteria | 7307 |
| 330 | Ga0070712_100150712 | 3300006175 | Bacteria | 1785 |
| 331 | Ga0070712_100160167 | 3300006175 | Bacteria | 1737 |
| 332 | Ga0070712_100412959 | 3300006175 | Bacteria | 1117 |
| 333 | Ga0070712_100481331 | 3300006175 | Bacteria | 1038 |
| 334 | Ga0070712_100662480 | 3300006175 | Bacteria | 887 |
| 335 | Ga0075367_10217734 | 3300006178 | Bacteria | 1194 |
| 336 | Ga0075367_10244842 | 3300006178 | Bacteria | 1124 |
| 337 | Ga0097621_100000892 | 3300006237 | Bacteria | 20916 |
| 338 | Ga0097621_100097765 | 3300006237 | Bacteria | 2465 |
| 339 | Ga0097621_100345971 | 3300006237 | Bacteria | 1321 |
| 340 | Ga0075370_10014898 | 3300006353 | Bacteria | 4153 |
| 341 | Ga0068871_100010466 | 3300006358 | Bacteria | 6771 |
| 342 | Ga0068871_100034066 | 3300006358 | Bacteria | 4038 |
| 343 | Ga0068871_100061166 | 3300006358 | Bacteria | 3075 |
| 344 | Ga0068871_100157416 | 3300006358 | Bacteria | 1941 |
| 345 | Ga0075428_100035887 | 3300006844 | Bacteria | 5464 |
| 346 | Ga0075428_100098461 | 3300006844 | Bacteria | 3188 |
| 347 | Ga0075428_100221947 | 3300006844 | Bacteria | 2041 |
| 348 | Ga0075428_100286031 | 3300006844 | Bacteria | 1774 |
| 349 | Ga0075430_100007678 | 3300006846 | Bacteria | 9110 |
| 350 | Ga0075431_100007378 | 3300006847 | Bacteria | 10949 |
| 351 | Ga0075431_100047137 | 3300006847 | Bacteria | 4443 |
| 352 | Ga0075433_10002306 | 3300006852 | Bacteria | 14532 |
| 353 | Ga0075433_10003286 | 3300006852 | Bacteria | 12487 |
| 354 | Ga0075433_10006637 | 3300006852 | Bacteria | 9161 |
| 355 | Ga0075433_10370612 | 3300006852 | Bacteria | 1265 |
| 356 | Ga0075434_100000110 | 3300006871 | Bacteria | 46873 |
| 357 | Ga0075434_100001583 | 3300006871 | Bacteria | 19278 |
| 358 | Ga0075434_100023586 | 3300006871 | Bacteria | 5999 |
| 359 | Ga0075434_100023964 | 3300006871 | Bacteria | 5959 |
| 360 | Ga0075434_100424611 | 3300006871 | Bacteria | 1350 |
| 361 | Ga0075434_100441836 | 3300006871 | Bacteria | 1322 |
| 362 | Ga0075434_100520746 | 3300006871 | Bacteria | 1209 |
| 363 | Ga0075429_100006496 | 3300006880 | Bacteria | 10126 |
| 364 | Ga0075429_100051597 | 3300006880 | Bacteria | 3578 |
| 365 | Ga0068865_100000452 | 3300006881 | Bacteria | 22857 |
| 366 | Ga0068865_100059223 | 3300006881 | Bacteria | 2678 |
| 367 | Ga0068865_100127075 | 3300006881 | Bacteria | 1905 |
| 368 | Ga0075436_100009283 | 3300006914 | Bacteria | 6731 |
| 369 | Ga0075436_100082624 | 3300006914 | Bacteria | 2228 |
| 370 | Ga0075436_100251899 | 3300006914 | Bacteria | 1258 |
| 371 | Ga0097620_100010289 | 3300006931 | Bacteria | 9417 |
| 372 | Ga0097620_100028581 | 3300006931 | Bacteria | 5590 |
| 373 | Ga0097620_100067730 | 3300006931 | Bacteria | 3605 |
| 374 | Ga0097620_100445196 | 3300006931 | Bacteria | 1391 |
| 375 | Ga0097620_100631251 | 3300006931 | Bacteria | 1164 |
| 376 | Ga0075435_100026293 | 3300007076 | Bacteria | 4538 |
| 377 | Ga0075435_100066443 | 3300007076 | Bacteria | 2934 |
| 378 | Ga0075435_100069762 | 3300007076 | Bacteria | 2867 |
| 379 | Ga0075435_100086971 | 3300007076 | Bacteria | 2575 |
| 380 | Ga0075435_100459165 | 3300007076 | Bacteria | 1099 |
| 381 | Ga0099795_10003149 | 3300007788 | Bacteria | 4043 |
| 382 | Ga0105251_10032957 | 3300009011 | Bacteria | 2576 |
| 383 | Ga0105250_10092556 | 3300009092 | Bacteria | 1231 |
| 384 | Ga0105240_10215689 | 3300009093 | Bacteria | 2239 |
| 385 | Ga0105240_10230619 | 3300009093 | Bacteria | 2152 |
| 386 | Ga0105240_10377979 | 3300009093 | Bacteria | 1600 |
| 387 | Ga0105240_10605736 | 3300009093 | Bacteria | 1205 |
| 388 | Ga0105240_10911785 | 3300009093 | Bacteria | 945 |
| 389 | Ga0111539_10002712 | 3300009094 | Bacteria | 23487 |
| 390 | Ga0111539_10011154 | 3300009094 | Bacteria | 11302 |
| 391 | Ga0111539_10016303 | 3300009094 | Bacteria | 9213 |
| 392 | Ga0111539_10126058 | 3300009094 | Bacteria | 3000 |
| 393 | Ga0111539_10379568 | 3300009094 | Bacteria | 1646 |
| 394 | Ga0111539_10747682 | 3300009094 | Bacteria | 1138 |
| 395 | Ga0111539_11156871 | 3300009094 | Bacteria | 899 |
| 396 | Ga0105245_10000380 | 3300009098 | Bacteria | 41293 |
| 397 | Ga0105245_10006135 | 3300009098 | Bacteria | 10575 |
| 398 | Ga0105245_10175950 | 3300009098 | Bacteria | 2041 |
| 399 | Ga0105245_10501778 | 3300009098 | Bacteria | 1229 |
| 400 | Ga0105247_10000149 | 3300009101 | Bacteria | 68765 |
| 401 | Ga0105247_10065522 | 3300009101 | Bacteria | 2260 |
| 402 | Ga0105247_10095025 | 3300009101 | Bacteria | 1897 |
| 403 | Ga0105247_10095195 | 3300009101 | Bacteria | 1896 |
| 404 | Ga0105247_10260251 | 3300009101 | Bacteria | 1189 |
| 405 | Ga0105247_10494361 | 3300009101 | Bacteria | 890 |
| 406 | Ga0114129_10058215 | 3300009147 | Bacteria | 5405 |
| 407 | Ga0114129_10086721 | 3300009147 | Bacteria | 4341 |
| 408 | Ga0114129_10624243 | 3300009147 | Bacteria | 1394 |
| 409 | Ga0114129_10900172 | 3300009147 | Bacteria | 1121 |
| 410 | Ga0105243_10002254 | 3300009148 | Bacteria | 16204 |
| 411 | Ga0105243_10010900 | 3300009148 | Bacteria | 6877 |
| 412 | Ga0105243_10020668 | 3300009148 | Bacteria | 4992 |
| 413 | Ga0105243_10109431 | 3300009148 | Bacteria | 2308 |
| 414 | Ga0105241_10000342 | 3300009174 | Bacteria | 35383 |
| 415 | Ga0105241_10028423 | 3300009174 | Bacteria | 4168 |
| 416 | Ga0105241_10049537 | 3300009174 | Bacteria | 3199 |
| 417 | Ga0105242_10000855 | 3300009176 | Bacteria | 23621 |
| 418 | Ga0105242_10010407 | 3300009176 | Bacteria | 7136 |
| 419 | Ga0105242_10114826 | 3300009176 | Bacteria | 2301 |
| 420 | Ga0105242_10678911 | 3300009176 | Bacteria | 1005 |
| 421 | Ga0105248_10012394 | 3300009177 | Bacteria | 9405 |
| 422 | Ga0105248_10020318 | 3300009177 | Bacteria | 7358 |
| 423 | Ga0105248_10027173 | 3300009177 | Bacteria | 6366 |
| 424 | Ga0105248_10197918 | 3300009177 | Bacteria | 2264 |
| 425 | Ga0105248_10227162 | 3300009177 | Bacteria | 2101 |
| 426 | Ga0105248_10530630 | 3300009177 | Bacteria | 1327 |
| 427 | Ga0105248_10542817 | 3300009177 | Bacteria | 1311 |
| 428 | Ga0105248_10566771 | 3300009177 | Bacteria | 1281 |
| 429 | Ga0105237_10007867 | 3300009545 | Bacteria | 11620 |
| 430 | Ga0105237_10165865 | 3300009545 | Bacteria | 2208 |
| 431 | Ga0105237_10350105 | 3300009545 | Bacteria | 1482 |
| 432 | Ga0105237_10350974 | 3300009545 | Bacteria | 1479 |
| 433 | Ga0105237_10677464 | 3300009545 | Bacteria | 1038 |
| 434 | Ga0105238_10034607 | 3300009551 | Bacteria | 5139 |
| 435 | Ga0105238_10053194 | 3300009551 | Bacteria | 4068 |
| 436 | Ga0105238_10123478 | 3300009551 | Bacteria | 2569 |
| 437 | Ga0105238_10161315 | 3300009551 | Bacteria | 2217 |
| 438 | Ga0105238_10282017 | 3300009551 | Bacteria | 1643 |
| 439 | Ga0105249_10001149 | 3300009553 | Bacteria | 23441 |
| 440 | Ga0105249_10001982 | 3300009553 | Bacteria | 17778 |
| 441 | Ga0105249_10019413 | 3300009553 | Bacteria | 6064 |
| 442 | Ga0105249_10089178 | 3300009553 | Bacteria | 2881 |
| 443 | Ga0105249_10492087 | 3300009553 | Bacteria | 1270 |
| 444 | Ga0105249_10655476 | 3300009553 | Bacteria | 1107 |
| 445 | Ga0105239_10009977 | 3300010375 | Bacteria | 10658 |
| 446 | Ga0105239_10012830 | 3300010375 | Bacteria | 9320 |
| 447 | Ga0105239_10016747 | 3300010375 | Bacteria | 8102 |
| 448 | Ga0105239_10042492 | 3300010375 | Bacteria | 4981 |
| 449 | Ga0105239_10128052 | 3300010375 | Bacteria | 2823 |
| 450 | Ga0105239_10172256 | 3300010375 | Bacteria | 2421 |
| 451 | Ga0105239_10366397 | 3300010375 | Bacteria | 1628 |
| 452 | Ga0105239_10489591 | 3300010375 | Bacteria | 1398 |
| 453 | Ga0105246_10000185 | 3300011119 | Bacteria | 30744 |
| 454 | Ga0105246_10000551 | 3300011119 | Bacteria | 20625 |
| 455 | Ga0105246_10181057 | 3300011119 | Bacteria | 1623 |
| 456 | Ga0105246_10231406 | 3300011119 | Bacteria | 1455 |
| 457 | Ga0157316_1005628 | 3300012510 | Bacteria | 997 |
| 458 | Ga0157326_1002949 | 3300012513 | Bacteria | 1798 |
| 459 | Ga0157373_10003537 | 3300013100 | Bacteria | 11802 |
| 460 | Ga0157373_10162794 | 3300013100 | Bacteria | 1570 |
| 461 | Ga0157371_10003492 | 3300013102 | Bacteria | 14217 |
| 462 | Ga0157371_10290611 | 3300013102 | Bacteria | 1182 |
| 463 | Ga0157371_10503394 | 3300013102 | Bacteria | 895 |
| 464 | Ga0157370_10017515 | 3300013104 | Bacteria | 7228 |
| 465 | Ga0157370_10156140 | 3300013104 | Bacteria | 2123 |
| 466 | Ga0157370_10347936 | 3300013104 | Bacteria | 1366 |
| 467 | Ga0157369_10009077 | 3300013105 | Bacteria | 11382 |
| 468 | Ga0157369_10323622 | 3300013105 | Bacteria | 1603 |
| 469 | Ga0157369_10433702 | 3300013105 | Bacteria | 1361 |
| 470 | Ga0157369_11153545 | 3300013105 | Bacteria | 791 |
| 471 | Ga0157374_10001986 | 3300013296 | Bacteria | 17156 |
| 472 | Ga0157374_10033399 | 3300013296 | Bacteria | 4694 |
| 473 | Ga0157374_10393963 | 3300013296 | Bacteria | 1381 |
| 474 | Ga0157378_10000562 | 3300013297 | Bacteria | 35265 |
| 475 | Ga0157378_10001729 | 3300013297 | Bacteria | 19618 |
| 476 | Ga0157378_10354418 | 3300013297 | Bacteria | 1434 |
| 477 | Ga0157378_10645780 | 3300013297 | Bacteria | 1073 |
| 478 | Ga0163162_10002599 | 3300013306 | Bacteria | 17110 |
| 479 | Ga0163162_10012026 | 3300013306 | Bacteria | 8439 |
| 480 | Ga0163162_10026532 | 3300013306 | Bacteria | 5725 |
| 481 | Ga0163162_10057878 | 3300013306 | Bacteria | 3904 |
| 482 | Ga0163162_11109611 | 3300013306 | Bacteria | 896 |
| 483 | Ga0163162_11176548 | 3300013306 | Bacteria | 870 |
| 484 | Ga0157372_10013072 | 3300013307 | Bacteria | 8856 |
| 485 | Ga0157372_10024601 | 3300013307 | Bacteria | 6544 |
| 486 | Ga0157372_10469662 | 3300013307 | Bacteria | 1466 |
| 487 | Ga0157372_10704144 | 3300013307 | Bacteria | 1175 |
| 488 | Ga0157372_11055238 | 3300013307 | Bacteria | 940 |
| 489 | Ga0157372_11545538 | 3300013307 | Bacteria | 764 |
| 490 | Ga0157372_11829562 | 3300013307 | Bacteria | 698 |
| 491 | Ga0157375_10001883 | 3300013308 | Bacteria | 18038 |
| 492 | Ga0157375_10009804 | 3300013308 | Bacteria | 8421 |
| 493 | Ga0157375_10735558 | 3300013308 | Bacteria | 1138 |
| 494 | Ga0163163_10010785 | 3300014325 | Bacteria | 8246 |
| 495 | Ga0163163_10052955 | 3300014325 | Bacteria | 4005 |
| 496 | Ga0163163_10295679 | 3300014325 | Bacteria | 1671 |
| 497 | Ga0163163_11087474 | 3300014325 | Bacteria | 863 |
| 498 | Ga0157380_10007676 | 3300014326 | Bacteria | 7677 |
| 499 | Ga0157380_10044469 | 3300014326 | Bacteria | 3481 |
| 500 | Ga0157380_10604439 | 3300014326 | Bacteria | 1086 |
| 501 | Ga0182008_10339647 | 3300014497 | Bacteria | 794 |
| 502 | Ga0157377_10000643 | 3300014745 | Bacteria | 14554 |
| 503 | Ga0157377_10000976 | 3300014745 | Bacteria | 12030 |
| 504 | Ga0157377_10251475 | 3300014745 | Bacteria | 1146 |
| 505 | Ga0157379_10001319 | 3300014968 | Bacteria | 20254 |
| 506 | Ga0157379_10010633 | 3300014968 | Bacteria | 8021 |
| 507 | Ga0157379_10026543 | 3300014968 | Bacteria | 5156 |
| 508 | Ga0157379_10542342 | 3300014968 | Bacteria | 1082 |
| 509 | Ga0157379_10721946 | 3300014968 | Bacteria | 936 |
| 510 | Ga0157379_10836867 | 3300014968 | Bacteria | 870 |
| 511 | Ga0157376_10000920 | 3300014969 | Bacteria | 19113 |
| 512 | Ga0157376_10331481 | 3300014969 | Bacteria | 1450 |
| 513 | Ga0157376_10821294 | 3300014969 | Bacteria | 943 |
| 514 | Ga0163161_10000379 | 3300017792 | Bacteria | 37281 |
| 515 | Ga0163161_10050582 | 3300017792 | Bacteria | 3008 |
| 516 | Ga0213872_10005036 | 3300021361 | Bacteria | 6856 |
| 517 | Ga0213872_10019936 | 3300021361 | Bacteria | 3088 |
| 518 | Ga0213872_10044651 | 3300021361 | Bacteria | 2016 |
| 519 | Ga0213872_10052410 | 3300021361 | Bacteria | 1851 |
| 520 | Ga0213872_10064084 | 3300021361 | Bacteria | 1660 |
| 521 | Ga0213872_10191674 | 3300021361 | Bacteria | 879 |
| 522 | Ga0213872_10198763 | 3300021361 | Bacteria | 860 |
| 523 | Ga0213872_10251927 | 3300021361 | Bacteria | 743 |
| 524 | Ga0213876_10056342 | 3300021384 | Bacteria | 2075 |
| 525 | Ga0213876_10235051 | 3300021384 | Bacteria | 974 |
| 526 | Ga0224712_10226411 | 3300022467 | Bacteria | 857 |
| 527 | Ga0228598_1010359 | 3300024227 | Bacteria | 1857 |
| 528 | Ga0207666_1000046 | 3300025271 | Bacteria | 24194 |
| 529 | Ga0207673_1000461 | 3300025290 | Bacteria | 4236 |
| 530 | Ga0209675_1000815 | 3300025291 | Bacteria | 20536 |
| 531 | Ga0209758_1000059 | 3300025297 | Bacteria | 328458 |
| 532 | Ga0209050_1007717 | 3300025298 | Bacteria | 5943 |
| 533 | Ga0209257_1002470 | 3300025304 | Bacteria | 18283 |
| 534 | Ga0207697_10000714 | 3300025315 | Bacteria | 18891 |
| 535 | Ga0207697_10080072 | 3300025315 | Bacteria | 1376 |
| 536 | Ga0207697_10097630 | 3300025315 | Bacteria | 1250 |
| 537 | Ga0207656_10152083 | 3300025321 | Bacteria | 1096 |
| 538 | Ga0207713_1076792 | 3300025735 | Bacteria | 1215 |
| 539 | Ga0207653_10004733 | 3300025885 | Bacteria | 4259 |
| 540 | Ga0207653_10024086 | 3300025885 | Bacteria | 1942 |
| 541 | Ga0207682_10000043 | 3300025893 | Bacteria | 52108 |
| 542 | Ga0207692_10007751 | 3300025898 | Bacteria | 4414 |
| 543 | Ga0207692_10031679 | 3300025898 | Bacteria | 2534 |
| 544 | Ga0207692_10055266 | 3300025898 | Bacteria | 2031 |
| 545 | Ga0207692_10109043 | 3300025898 | Bacteria | 1533 |
| 546 | Ga0207692_10243538 | 3300025898 | Bacteria | 1075 |
| 547 | Ga0207692_10416306 | 3300025898 | Bacteria | 841 |
| 548 | Ga0207642_10002212 | 3300025899 | Bacteria | 6031 |
| 549 | Ga0207642_10179129 | 3300025899 | Bacteria | 1153 |
| 550 | Ga0207710_10001577 | 3300025900 | Bacteria | 11193 |
| 551 | Ga0207710_10002657 | 3300025900 | Bacteria | 8239 |
| 552 | Ga0207710_10004284 | 3300025900 | Bacteria | 6246 |
| 553 | Ga0207710_10019470 | 3300025900 | Bacteria | 2896 |
| 554 | Ga0207710_10079101 | 3300025900 | Bacteria | 1522 |
| 555 | Ga0207688_10000083 | 3300025901 | Bacteria | 36050 |
| 556 | Ga0207688_10010182 | 3300025901 | Bacteria | 5117 |
| 557 | Ga0207688_10036653 | 3300025901 | Bacteria | 2719 |
| 558 | Ga0207680_10005187 | 3300025903 | Bacteria | 6214 |
| 559 | Ga0207680_10056824 | 3300025903 | Bacteria | 2365 |
| 560 | Ga0207647_10000860 | 3300025904 | Bacteria | 23528 |
| 561 | Ga0207647_10025829 | 3300025904 | Bacteria | 3851 |
| 562 | Ga0207647_10147142 | 3300025904 | Bacteria | 1378 |
| 563 | Ga0207647_10165868 | 3300025904 | Bacteria | 1287 |
| 564 | Ga0207685_10000556 | 3300025905 | Bacteria | 6458 |
| 565 | Ga0207685_10015976 | 3300025905 | Bacteria | 2391 |
| 566 | Ga0207699_10009985 | 3300025906 | Bacteria | 4748 |
| 567 | Ga0207699_10035800 | 3300025906 | Bacteria | 2826 |
| 568 | Ga0207699_10065818 | 3300025906 | Bacteria | 2198 |
| 569 | Ga0207699_10335319 | 3300025906 | Bacteria | 1064 |
| 570 | Ga0207645_10002954 | 3300025907 | Bacteria | 13126 |
| 571 | Ga0207645_10012797 | 3300025907 | Bacteria | 5682 |
| 572 | Ga0207645_10015101 | 3300025907 | Bacteria | 5143 |
| 573 | Ga0207645_10160586 | 3300025907 | Bacteria | 1470 |
| 574 | Ga0207643_10000128 | 3300025908 | Bacteria | 51191 |
| 575 | Ga0207684_10081199 | 3300025910 | Bacteria | 2759 |
| 576 | Ga0207654_10001559 | 3300025911 | Bacteria | 12036 |
| 577 | Ga0207654_10022636 | 3300025911 | Bacteria | 3355 |
| 578 | Ga0207654_10073229 | 3300025911 | Bacteria | 2041 |
| 579 | Ga0207707_10004600 | 3300025912 | Bacteria | 12117 |
| 580 | Ga0207707_10154688 | 3300025912 | Bacteria | 2005 |
| 581 | Ga0207707_10165913 | 3300025912 | Bacteria | 1930 |
| 582 | Ga0207707_10352748 | 3300025912 | Bacteria | 1267 |
| 583 | Ga0207707_10354102 | 3300025912 | Bacteria | 1264 |
| 584 | Ga0207695_10074493 | 3300025913 | Bacteria | 3457 |
| 585 | Ga0207695_10302312 | 3300025913 | Bacteria | 1491 |
| 586 | Ga0207695_10496752 | 3300025913 | Bacteria | 1102 |
| 587 | Ga0207695_10784858 | 3300025913 | Bacteria | 833 |
| 588 | Ga0207671_10013743 | 3300025914 | Bacteria | 6427 |
| 589 | Ga0207671_10097503 | 3300025914 | Bacteria | 2223 |
| 590 | Ga0207671_10151757 | 3300025914 | Bacteria | 1790 |
| 591 | Ga0207671_10563248 | 3300025914 | Bacteria | 908 |
| 592 | Ga0207693_10000529 | 3300025915 | Bacteria | 34501 |
| 593 | Ga0207693_10008254 | 3300025915 | Bacteria | 8526 |
| 594 | Ga0207693_10012476 | 3300025915 | Bacteria | 6864 |
| 595 | Ga0207693_10013222 | 3300025915 | Bacteria | 6660 |
| 596 | Ga0207693_10022622 | 3300025915 | Bacteria | 4994 |
| 597 | Ga0207693_10116477 | 3300025915 | Bacteria | 2098 |
| 598 | Ga0207693_10122173 | 3300025915 | Bacteria | 2045 |
| 599 | Ga0207693_10137404 | 3300025915 | Bacteria | 1922 |
| 600 | Ga0207693_10208215 | 3300025915 | Bacteria | 1537 |
| 601 | Ga0207663_10009148 | 3300025916 | Bacteria | 5224 |
| 602 | Ga0207663_10016239 | 3300025916 | Bacteria | 4123 |
| 603 | Ga0207663_10019053 | 3300025916 | Bacteria | 3857 |
| 604 | Ga0207663_10079527 | 3300025916 | Bacteria | 2141 |
| 605 | Ga0207663_10396746 | 3300025916 | Bacteria | 1054 |
| 606 | Ga0207660_10001486 | 3300025917 | Bacteria | 15770 |
| 607 | Ga0207660_10019957 | 3300025917 | Bacteria | 4491 |
| 608 | Ga0207660_10058413 | 3300025917 | Bacteria | 2766 |
| 609 | Ga0207660_10317464 | 3300025917 | Bacteria | 1243 |
| 610 | Ga0207662_10000301 | 3300025918 | Bacteria | 22744 |
| 611 | Ga0207662_10017285 | 3300025918 | Bacteria | 4078 |
| 612 | Ga0207662_10034661 | 3300025918 | Bacteria | 2945 |
| 613 | Ga0207662_10347895 | 3300025918 | Bacteria | 995 |
| 614 | Ga0207657_10000034 | 3300025919 | Bacteria | 127192 |
| 615 | Ga0207657_10001859 | 3300025919 | Bacteria | 22810 |
| 616 | Ga0207657_10047359 | 3300025919 | Bacteria | 3760 |
| 617 | Ga0207657_10107787 | 3300025919 | Bacteria | 2304 |
| 618 | Ga0207657_10126814 | 3300025919 | Bacteria | 2096 |
| 619 | Ga0207657_10210978 | 3300025919 | Bacteria | 1559 |
| 620 | Ga0207657_10554621 | 3300025919 | Bacteria | 898 |
| 621 | Ga0207649_10003562 | 3300025920 | Bacteria | 8508 |
| 622 | Ga0207649_10046661 | 3300025920 | Bacteria | 2663 |
| 623 | Ga0207649_10579136 | 3300025920 | Bacteria | 861 |
| 624 | Ga0207652_10016674 | 3300025921 | Bacteria | 6003 |
| 625 | Ga0207652_10016935 | 3300025921 | Bacteria | 5960 |
| 626 | Ga0207652_10028837 | 3300025921 | Bacteria | 4633 |
| 627 | Ga0207652_10153811 | 3300025921 | Bacteria | 2060 |
| 628 | Ga0207652_10259840 | 3300025921 | Bacteria | 1566 |
| 629 | Ga0207652_10425761 | 3300025921 | Bacteria | 1197 |
| 630 | Ga0207652_10667733 | 3300025921 | Bacteria | 929 |
| 631 | Ga0207681_10004864 | 3300025923 | Bacteria | 8251 |
| 632 | Ga0207681_10074552 | 3300025923 | Bacteria | 2377 |
| 633 | Ga0207681_10184177 | 3300025923 | Bacteria | 1593 |
| 634 | Ga0207694_10076101 | 3300025924 | Bacteria | 2628 |
| 635 | Ga0207694_10430842 | 3300025924 | Bacteria | 1099 |
| 636 | Ga0207694_11039257 | 3300025924 | Bacteria | 693 |
| 637 | Ga0207650_10019558 | 3300025925 | Bacteria | 4761 |
| 638 | Ga0207650_10227170 | 3300025925 | Bacteria | 1504 |
| 639 | Ga0207659_10000411 | 3300025926 | Bacteria | 25858 |
| 640 | Ga0207659_10079974 | 3300025926 | Bacteria | 2413 |
| 641 | Ga0207659_10508788 | 3300025926 | Bacteria | 1020 |
| 642 | Ga0207687_10000667 | 3300025927 | Bacteria | 23099 |
| 643 | Ga0207687_10018650 | 3300025927 | Bacteria | 4584 |
| 644 | Ga0207687_10259128 | 3300025927 | Bacteria | 1386 |
| 645 | Ga0207687_10371082 | 3300025927 | Bacteria | 1170 |
| 646 | Ga0207687_10626340 | 3300025927 | Bacteria | 909 |
| 647 | Ga0207687_10713498 | 3300025927 | Bacteria | 852 |
| 648 | Ga0207700_10000412 | 3300025928 | Bacteria | 25028 |
| 649 | Ga0207700_10040508 | 3300025928 | Bacteria | 3401 |
| 650 | Ga0207700_10127157 | 3300025928 | Bacteria | 2075 |
| 651 | Ga0207700_10189586 | 3300025928 | Bacteria | 1727 |
| 652 | Ga0207700_10442670 | 3300025928 | Bacteria | 1144 |
| 653 | Ga0207664_10050429 | 3300025929 | Bacteria | 3282 |
| 654 | Ga0207664_10107056 | 3300025929 | Bacteria | 2319 |
| 655 | Ga0207664_10146170 | 3300025929 | Bacteria | 2005 |
| 656 | Ga0207664_10571302 | 3300025929 | Bacteria | 1015 |
| 657 | Ga0207664_10663317 | 3300025929 | Bacteria | 938 |
| 658 | Ga0207644_10005279 | 3300025931 | Bacteria | 8432 |
| 659 | Ga0207644_10009684 | 3300025931 | Bacteria | 6334 |
| 660 | Ga0207644_10100107 | 3300025931 | Bacteria | 2176 |
| 661 | Ga0207690_10002854 | 3300025932 | Bacteria | 10412 |
| 662 | Ga0207690_10009329 | 3300025932 | Bacteria | 5830 |
| 663 | Ga0207690_10015321 | 3300025932 | Bacteria | 4644 |
| 664 | Ga0207690_10255426 | 3300025932 | Bacteria | 1356 |
| 665 | Ga0207690_10632295 | 3300025932 | Bacteria | 876 |
| 666 | Ga0207706_10000076 | 3300025933 | Bacteria | 102376 |
| 667 | Ga0207706_10004082 | 3300025933 | Bacteria | 13792 |
| 668 | Ga0207706_10031063 | 3300025933 | Bacteria | 4760 |
| 669 | Ga0207706_10581919 | 3300025933 | Bacteria | 962 |
| 670 | Ga0207686_10000579 | 3300025934 | Bacteria | 22963 |
| 671 | Ga0207686_10006100 | 3300025934 | Bacteria | 6474 |
| 672 | Ga0207686_10028646 | 3300025934 | Bacteria | 3277 |
| 673 | Ga0207686_10033530 | 3300025934 | Bacteria | 3066 |
| 674 | Ga0207709_10000551 | 3300025935 | Bacteria | 32038 |
| 675 | Ga0207709_10183425 | 3300025935 | Bacteria | 1480 |
| 676 | Ga0207670_10000556 | 3300025936 | Bacteria | 20667 |
| 677 | Ga0207670_10087654 | 3300025936 | Bacteria | 2193 |
| 678 | Ga0207670_10503842 | 3300025936 | Bacteria | 983 |
| 679 | Ga0207669_10000675 | 3300025937 | Bacteria | 14703 |
| 680 | Ga0207669_10005589 | 3300025937 | Bacteria | 5659 |
| 681 | Ga0207669_10015571 | 3300025937 | Bacteria | 3838 |
| 682 | Ga0207704_10002887 | 3300025938 | Bacteria | 7772 |
| 683 | Ga0207704_10052578 | 3300025938 | Bacteria | 2470 |
| 684 | Ga0207704_10109694 | 3300025938 | Bacteria | 1862 |
| 685 | Ga0207704_10147674 | 3300025938 | Bacteria | 1654 |
| 686 | Ga0207665_10004186 | 3300025939 | Bacteria | 9597 |
| 687 | Ga0207665_10014619 | 3300025939 | Bacteria | 5167 |
| 688 | Ga0207665_10628799 | 3300025939 | Bacteria | 840 |
| 689 | Ga0207691_10000599 | 3300025940 | Bacteria | 35997 |
| 690 | Ga0207691_10001503 | 3300025940 | Bacteria | 23199 |
| 691 | Ga0207691_10063150 | 3300025940 | Bacteria | 3360 |
| 692 | Ga0207691_10118905 | 3300025940 | Bacteria | 2344 |
| 693 | Ga0207691_10191152 | 3300025940 | Bacteria | 1785 |
| 694 | Ga0207711_10010308 | 3300025941 | Bacteria | 7762 |
| 695 | Ga0207711_10073399 | 3300025941 | Bacteria | 2973 |
| 696 | Ga0207711_10102849 | 3300025941 | Bacteria | 2529 |
| 697 | Ga0207711_10312423 | 3300025941 | Bacteria | 1451 |
| 698 | Ga0207711_10597243 | 3300025941 | Bacteria | 1030 |
| 699 | Ga0207711_10612320 | 3300025941 | Bacteria | 1016 |
| 700 | Ga0207689_10000165 | 3300025942 | Bacteria | 57494 |
| 701 | Ga0207689_10510297 | 3300025942 | Bacteria | 1008 |
| 702 | Ga0207661_10008897 | 3300025944 | Bacteria | 7188 |
| 703 | Ga0207661_10390719 | 3300025944 | Bacteria | 1260 |
| 704 | Ga0207661_10445194 | 3300025944 | Bacteria | 1179 |
| 705 | Ga0207661_10573814 | 3300025944 | Bacteria | 1034 |
| 706 | Ga0207679_10000112 | 3300025945 | Bacteria | 65716 |
| 707 | Ga0207679_10022367 | 3300025945 | Bacteria | 4304 |
| 708 | Ga0207679_10044874 | 3300025945 | Bacteria | 3193 |
| 709 | Ga0207679_10235269 | 3300025945 | Bacteria | 1549 |
| 710 | Ga0207679_10508258 | 3300025945 | Bacteria | 1076 |
| 711 | Ga0207679_10593120 | 3300025945 | Bacteria | 998 |
| 712 | Ga0207667_10017788 | 3300025949 | Bacteria | 7992 |
| 713 | Ga0207667_10038289 | 3300025949 | Bacteria | 5123 |
| 714 | Ga0207667_10039284 | 3300025949 | Bacteria | 5045 |
| 715 | Ga0207651_10000099 | 3300025960 | Bacteria | 38059 |
| 716 | Ga0207651_10006660 | 3300025960 | Bacteria | 6078 |
| 717 | Ga0207651_10938824 | 3300025960 | Bacteria | 771 |
| 718 | Ga0207712_10001637 | 3300025961 | Bacteria | 15094 |
| 719 | Ga0207712_10019595 | 3300025961 | Bacteria | 4422 |
| 720 | Ga0207712_10267370 | 3300025961 | Bacteria | 1389 |
| 721 | Ga0207712_10548364 | 3300025961 | Bacteria | 994 |
| 722 | Ga0207668_10000608 | 3300025972 | Bacteria | 22267 |
| 723 | Ga0207668_10000713 | 3300025972 | Bacteria | 20303 |
| 724 | Ga0207668_10105270 | 3300025972 | Bacteria | 2105 |
| 725 | Ga0207668_10239295 | 3300025972 | Bacteria | 1468 |
| 726 | Ga0207668_10339214 | 3300025972 | Bacteria | 1253 |
| 727 | Ga0207668_10684886 | 3300025972 | Bacteria | 900 |
| 728 | Ga0207668_10757489 | 3300025972 | Bacteria | 857 |
| 729 | Ga0207640_10002957 | 3300025981 | Bacteria | 9147 |
| 730 | Ga0207640_10015077 | 3300025981 | Bacteria | 4466 |
| 731 | Ga0207640_10119188 | 3300025981 | Bacteria | 1887 |
| 732 | Ga0207640_11345309 | 3300025981 | Bacteria | 639 |
| 733 | Ga0207658_10003702 | 3300025986 | Bacteria | 10772 |
| 734 | Ga0207658_10007098 | 3300025986 | Bacteria | 7628 |
| 735 | Ga0207658_10067675 | 3300025986 | Bacteria | 2691 |
| 736 | Ga0207658_10441690 | 3300025986 | Bacteria | 1150 |
| 737 | Ga0207677_10010465 | 3300026023 | Bacteria | 5249 |
| 738 | Ga0207677_10189705 | 3300026023 | Bacteria | 1624 |
| 739 | Ga0207703_10018016 | 3300026035 | Bacteria | 5515 |
| 740 | Ga0207703_10058062 | 3300026035 | Bacteria | 3157 |
| 741 | Ga0207703_10177919 | 3300026035 | Bacteria | 1875 |
| 742 | Ga0207639_10002883 | 3300026041 | Bacteria | 11555 |
| 743 | Ga0207639_10040112 | 3300026041 | Bacteria | 3493 |
| 744 | Ga0207639_10054896 | 3300026041 | Bacteria | 3047 |
| 745 | Ga0207639_11049938 | 3300026041 | Bacteria | 764 |
| 746 | Ga0207678_10000036 | 3300026067 | Bacteria | 104164 |
| 747 | Ga0207678_10001329 | 3300026067 | Bacteria | 22814 |
| 748 | Ga0207678_10029433 | 3300026067 | Bacteria | 4793 |
| 749 | Ga0207678_10036192 | 3300026067 | Bacteria | 4297 |
| 750 | Ga0207708_10000862 | 3300026075 | Bacteria | 22870 |
| 751 | Ga0207708_10002574 | 3300026075 | Bacteria | 13351 |
| 752 | Ga0207708_10019839 | 3300026075 | Bacteria | 5069 |
| 753 | Ga0207702_10007796 | 3300026078 | Bacteria | 9086 |
| 754 | Ga0207702_10014330 | 3300026078 | Bacteria | 6583 |
| 755 | Ga0207702_10148575 | 3300026078 | Bacteria | 2129 |
| 756 | Ga0207702_10307944 | 3300026078 | Bacteria | 1505 |
| 757 | Ga0207641_10001462 | 3300026088 | Bacteria | 23160 |
| 758 | Ga0207648_10001891 | 3300026089 | Bacteria | 22870 |
| 759 | Ga0207648_10071963 | 3300026089 | Bacteria | 3013 |
| 760 | Ga0207648_10081422 | 3300026089 | Bacteria | 2824 |
| 761 | Ga0207648_10287023 | 3300026089 | Bacteria | 1473 |
| 762 | Ga0207648_10288236 | 3300026089 | Bacteria | 1469 |
| 763 | Ga0207676_10001459 | 3300026095 | Bacteria | 17574 |
| 764 | Ga0207676_10051116 | 3300026095 | Bacteria | 3225 |
| 765 | Ga0207676_10136555 | 3300026095 | Bacteria | 2093 |
| 766 | Ga0207674_10006899 | 3300026116 | Bacteria | 13310 |
| 767 | Ga0207674_10010119 | 3300026116 | Bacteria | 10722 |
| 768 | Ga0207674_10212794 | 3300026116 | Bacteria | 1882 |
| 769 | Ga0207675_100000970 | 3300026118 | Bacteria | 28501 |
| 770 | Ga0207675_100001575 | 3300026118 | Bacteria | 22801 |
| 771 | Ga0207675_100040944 | 3300026118 | Bacteria | 4328 |
| 772 | Ga0207675_100111099 | 3300026118 | Bacteria | 2586 |
| 773 | Ga0207675_100171943 | 3300026118 | Bacteria | 2071 |
| 774 | Ga0207683_10000015 | 3300026121 | Bacteria | 125989 |
| 775 | Ga0207683_10001273 | 3300026121 | Bacteria | 22829 |
| 776 | Ga0207683_10004182 | 3300026121 | Bacteria | 12489 |
| 777 | Ga0207683_10026331 | 3300026121 | Bacteria | 5020 |
| 778 | Ga0207698_10006111 | 3300026142 | Bacteria | 7493 |
| 779 | Ga0207698_10133389 | 3300026142 | Bacteria | 2126 |
| 780 | Ga0207698_10428258 | 3300026142 | Bacteria | 1271 |
| 781 | Ga0209967_1010797 | 3300027364 | Bacteria | 1276 |
| 782 | Ga0210002_1002548 | 3300027617 | Bacteria | 2635 |
| 783 | Ga0209966_1007471 | 3300027695 | Bacteria | 1917 |
| 784 | Ga0209998_10008713 | 3300027717 | Bacteria | 2102 |
| 785 | Ga0209998_10009907 | 3300027717 | Bacteria | 1975 |
| 786 | Ga0209998_10012414 | 3300027717 | Bacteria | 1768 |
| 787 | Ga0209813_10091554 | 3300027866 | Bacteria | 1021 |
| 788 | Ga0209974_10020171 | 3300027876 | Bacteria | 2210 |
| 789 | Ga0209974_10037821 | 3300027876 | Bacteria | 1603 |
| 790 | Ga0209974_10101701 | 3300027876 | Bacteria | 1005 |
| 791 | Ga0209974_10183133 | 3300027876 | Bacteria | 768 |
| 792 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 793 | Ga0207428_10000242 | 3300027907 | Bacteria | 74839 |
| 794 | Ga0207428_10003078 | 3300027907 | Bacteria | 16410 |
| 795 | Ga0207428_10006523 | 3300027907 | Bacteria | 10765 |
| 796 | Ga0207428_10018880 | 3300027907 | Bacteria | 5882 |
| 797 | Ga0207428_10116694 | 3300027907 | Bacteria | 2050 |
| 798 | Ga0207428_10393931 | 3300027907 | Bacteria | 1015 |
| 799 | Ga0268266_10010320 | 3300028379 | Bacteria | 8170 |
| 800 | Ga0268266_10052520 | 3300028379 | Bacteria | 3500 |
| 801 | Ga0268266_10279011 | 3300028379 | Bacteria | 1553 |
| 802 | Ga0268266_10366594 | 3300028379 | Bacteria | 1356 |
| 803 | Ga0268265_10003386 | 3300028380 | Bacteria | 11479 |
| 804 | Ga0268265_10017919 | 3300028380 | Bacteria | 4898 |
| 805 | Ga0268265_10064227 | 3300028380 | Bacteria | 2827 |
| 806 | Ga0268265_10149253 | 3300028380 | Bacteria | 1969 |
| 807 | Ga0268265_10312259 | 3300028380 | Bacteria | 1420 |
| 808 | Ga0268265_10540866 | 3300028380 | Bacteria | 1104 |
| 809 | Ga0268264_10003086 | 3300028381 | Bacteria | 14418 |
| 810 | Ga0268264_10029045 | 3300028381 | Bacteria | 4528 |
| 811 | Ga0268264_10385373 | 3300028381 | Bacteria | 1343 |
| 812 | Ga0265337_1001177 | 3300028556 | Bacteria | 13325 |
| 813 | Ga0307517_10170521 | 3300028786 | Bacteria | 1432 |
| 814 | Ga0307515_10399551 | 3300028794 | Bacteria | 1000 |
| 815 | Ga0265338_10258059 | 3300028800 | Bacteria | 1283 |
| 816 | Ga0265338_10495578 | 3300028800 | Bacteria | 860 |
| 817 | Ga0307512_10153748 | 3300030522 | Bacteria | 1368 |
| 818 | Ga0265332_10121148 | 3300031238 | Bacteria | 1099 |
| 819 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 820 | Ga0265325_10004786 | 3300031241 | Bacteria | 8480 |
| 821 | Ga0265325_10046663 | 3300031241 | Bacteria | 2246 |
| 822 | Ga0265340_10125513 | 3300031247 | Bacteria | 1179 |
| 823 | Ga0265339_10004854 | 3300031249 | Bacteria | 9086 |
| 824 | Ga0265339_10120475 | 3300031249 | Bacteria | 1349 |
| 825 | Ga0265331_10001499 | 3300031250 | Bacteria | 17228 |
| 826 | Ga0265331_10028325 | 3300031250 | Bacteria | 2802 |
| 827 | Ga0265331_10115002 | 3300031250 | Bacteria | 1232 |
| 828 | Ga0265316_10085349 | 3300031344 | Bacteria | 2416 |
| 829 | Ga0265316_10238217 | 3300031344 | Bacteria | 1338 |
| 830 | Ga0307513_10110818 | 3300031456 | Bacteria | 2739 |
| 831 | Ga0307513_10377135 | 3300031456 | Bacteria | 1159 |
| 832 | Ga0265313_10000607 | 3300031595 | Bacteria | 37291 |
| 833 | Ga0265313_10001122 | 3300031595 | Bacteria | 25603 |
| 834 | Ga0265313_10004369 | 3300031595 | Bacteria | 10912 |
| 835 | Ga0265313_10004848 | 3300031595 | Bacteria | 10112 |
| 836 | Ga0265313_10005418 | 3300031595 | Bacteria | 9399 |
| 837 | Ga0265313_10009773 | 3300031595 | Bacteria | 6181 |
| 838 | Ga0265313_10018409 | 3300031595 | Bacteria | 3922 |
| 839 | Ga0265313_10031666 | 3300031595 | Bacteria | 2709 |
| 840 | Ga0265313_10139042 | 3300031595 | Bacteria | 1046 |
| 841 | Ga0307508_10416473 | 3300031616 | Bacteria | 935 |
| 842 | Ga0316579_10058416 | 3300031691 | Bacteria | 1812 |
| 843 | Ga0265314_10001736 | 3300031711 | Bacteria | 23585 |
| 844 | Ga0265314_10017596 | 3300031711 | Bacteria | 5604 |
| 845 | Ga0265314_10276337 | 3300031711 | Bacteria | 952 |
| 846 | Ga0265342_10001631 | 3300031712 | Bacteria | 20687 |
| 847 | Ga0307516_10105803 | 3300031730 | Bacteria | 2624 |
| 848 | Ga0307405_10118164 | 3300031731 | Bacteria | 1809 |
| 849 | Ga0307405_10121183 | 3300031731 | Bacteria | 1790 |
| 850 | Ga0307413_10009874 | 3300031824 | Bacteria | 4593 |
| 851 | Ga0307413_10009990 | 3300031824 | Bacteria | 4575 |
| 852 | Ga0307410_10043510 | 3300031852 | Bacteria | 2977 |
| 853 | Ga0307410_10242584 | 3300031852 | Bacteria | 1397 |
| 854 | Ga0307409_100061798 | 3300031995 | Bacteria | 2929 |
| 855 | Ga0307409_100240162 | 3300031995 | Bacteria | 1649 |
| 856 | Ga0307416_100294688 | 3300032002 | Bacteria | 1608 |
| 857 | Ga0307414_10015861 | 3300032004 | Bacteria | 4561 |
| 858 | Ga0307414_10249203 | 3300032004 | Bacteria | 1475 |
| 859 | Ga0316583_10027901 | 3300032133 | Bacteria | 2015 |
| 860 | Ga0373930_0065650 | 3300034816 | Bacteria | 817 |
| 861 | Ga0373948_0002551 | 3300034817 | Bacteria | 2707 |
| 862 | Ga0373948_0008375 | 3300034817 | Bacteria | 1759 |
| 863 | Ga0373950_0000575 | 3300034818 | Bacteria | 4508 |
| 864 | Ga0373950_0032149 | 3300034818 | Bacteria | 976 |
| 865 | Ga0373958_0002130 | 3300034819 | Bacteria | 2742 |
| 866 | Ga0373958_0002762 | 3300034819 | Bacteria | 2489 |
| 867 | Ga0373958_0005151 | 3300034819 | Bacteria | 1972 |
| 868 | Ga0373958_0050053 | 3300034819 | Bacteria | 880 |
| 869 | Ga0373959_0001506 | 3300034820 | Bacteria | 3726 |
| 870 | Ga0373959_0014183 | 3300034820 | Bacteria | 1447 |
| 871 | Ga0373938_0000276 | 3300034957 | Bacteria | 8189 |
| 872 | Ga0373938_0027355 | 3300034957 | Bacteria | 1199 |
| 873 | Ga0373926_0010141 | 3300035083 | Bacteria | 3153 |
| 874 | Ga0373928_0000820 | 3300035084 | Bacteria | 6070 |
| 875 | Ga0373929_0000359 | 3300035085 | Bacteria | 8495 |
| 876 | Ga0373934_0023173 | 3300035086 | Bacteria | 2398 |
| 877 | Ga0373934_0179501 | 3300035086 | Bacteria | 870 |
| 878 | Ga0373940_0000049 | 3300035088 | Bacteria | 13501 |
| 879 | Ga0373944_0006580 | 3300035089 | Bacteria | 3087 |
| 880 | Ga0373949_0001191 | 3300035090 | Bacteria | 7712 |
| 881 | Ga0373949_0002203 | 3300035090 | Bacteria | 5099 |
| 882 | Ga0373949_0007218 | 3300035090 | Bacteria | 2435 |
| 883 | Ga0373949_0013764 | 3300035090 | Bacteria | 1797 |
| 884 | Ga0373949_0037096 | 3300035090 | Bacteria | 1184 |
| 885 | Ga0373951_0000518 | 3300035091 | Bacteria | 10973 |
| 886 | Ga0373951_0022569 | 3300035091 | Bacteria | 1449 |
| 887 | Ga0373951_0039210 | 3300035091 | Bacteria | 1138 |
| 888 | Ga0373952_0000453 | 3300035092 | Bacteria | 7153 |
| 889 | Ga0373952_0000483 | 3300035092 | Bacteria | 6949 |
| 890 | Ga0373923_0001175 | 3300035111 | Bacteria | 7302 |
| 891 | Ga0373923_0068057 | 3300035111 | Bacteria | 1524 |
| 892 | Ga0373923_0071871 | 3300035111 | Bacteria | 1487 |
| 893 | Ga0373923_0215839 | 3300035111 | Bacteria | 890 |
| 894 | Ga0373932_0000462 | 3300035112 | Bacteria | 12458 |
| 895 | Ga0373932_0002820 | 3300035112 | Bacteria | 4300 |
| 896 | Ga0373932_0027182 | 3300035112 | Bacteria | 1563 |
| 897 | Ga0373936_0000328 | 3300035113 | Bacteria | 16031 |
| 898 | Ga0373939_0001076 | 3300035114 | Bacteria | 6716 |
| 899 | Ga0373939_0003300 | 3300035114 | Bacteria | 3787 |
| 900 | Ga0373939_0071596 | 3300035114 | Bacteria | 1130 |
| 901 | Ga0373941_0000219 | 3300035115 | Bacteria | 11007 |
| 902 | Ga0373941_0001129 | 3300035115 | Bacteria | 5569 |
| 903 | Ga0373941_0048238 | 3300035115 | Bacteria | 1344 |
| 904 | Ga0373945_0000123 | 3300035116 | Bacteria | 19133 |
| 905 | Ga0373954_0012572 | 3300035118 | Bacteria | 3765 |
| 906 | Ga0373954_0026139 | 3300035118 | Bacteria | 2674 |
| 907 | Ga0373954_0161299 | 3300035118 | Bacteria | 1097 |
| 908 | Ga0373956_0045117 | 3300035119 | Bacteria | 1966 |
| 909 | Ga0373956_0048847 | 3300035119 | Bacteria | 1896 |
| 910 | Ga0373956_0094785 | 3300035119 | Bacteria | 1380 |
| 911 | Ga0373957_0002486 | 3300035120 | Bacteria | 5276 |
| 912 | Ga0373957_0004774 | 3300035120 | Bacteria | 4152 |
| 913 | Ga0373957_0032381 | 3300035120 | Bacteria | 1925 |
| 914 | Ga0373957_0047990 | 3300035120 | Bacteria | 1626 |
| 915 | Ga0373957_0124575 | 3300035120 | Bacteria | 1045 |
| 916 | Ga0373960_0001504 | 3300035121 | Bacteria | 5184 |
| 917 | Ga0373960_0013304 | 3300035121 | Bacteria | 2062 |
| 918 | Ga0373960_0046765 | 3300035121 | Bacteria | 1271 |
| 919 | Ga0373943_0001821 | 3300035170 | Bacteria | 9632 |
| 920 | Ga0373943_0028120 | 3300035170 | Bacteria | 2648 |
| 921 | Ga0373946_0003579 | 3300035171 | Bacteria | 5512 |
| 922 | Ga0373946_0006894 | 3300035171 | Bacteria | 4135 |
| 923 | Ga0373946_0018373 | 3300035171 | Bacteria | 2685 |
| 924 | Ga0373946_0029864 | 3300035171 | Bacteria | 2173 |
| 925 | Ga0373955_0001781 | 3300035172 | Bacteria | 9242 |
| 926 | Ga0373955_0003764 | 3300035172 | Bacteria | 6683 |
| 927 | Ga0373955_0053359 | 3300035172 | Bacteria | 2207 |
| 928 | Ga0373955_0140688 | 3300035172 | Bacteria | 1415 |
| 929 | Ga0373942_0004252 | 3300035207 | Bacteria | 3335 |
| 930 | Ga0373942_0012705 | 3300035207 | Bacteria | 2016 |
| 931 | Ga0373942_0023528 | 3300035207 | Bacteria | 1573 |
| 932 | Ga0373961_0013321 | 3300035241 | Bacteria | 2072 |
| 933 | Ga0373961_0019442 | 3300035241 | Bacteria | 1784 |
| 934 | Ga0373962_0000215 | 3300035242 | Bacteria | 12190 |
| 935 | Ga0373962_0001429 | 3300035242 | Bacteria | 5635 |
| 936 | Ga0373962_0002252 | 3300035242 | Bacteria | 4611 |
| 937 | Ga0373962_0006643 | 3300035242 | Bacteria | 2805 |
| 938 | Ga0373962_0041030 | 3300035242 | Bacteria | 1303 |
| 939 | Ga0316574_0536579 | 3300035398 | Bacteria | 727 |
| 940 | Ga0373924_0005980 | 3300035410 | Bacteria | 4339 |
| 941 | Ga0373924_0024323 | 3300035410 | Bacteria | 2386 |
| 942 | Ga0373931_0004700 | 3300035691 | Bacteria | 6252 |
| 943 | Ga0373931_0006133 | 3300035691 | Bacteria | 5601 |
| 944 | Ga0373931_0006569 | 3300035691 | Bacteria | 5441 |
| 945 | Ga0373931_0014856 | 3300035691 | Bacteria | 3813 |
| 946 | Ga0373931_0021068 | 3300035691 | Bacteria | 3268 |
| 947 | Ga0373931_0047512 | 3300035691 | Bacteria | 2272 |
| 948 | Ga0373931_0047908 | 3300035691 | Bacteria | 2263 |
| 949 | Ga0373931_0118356 | 3300035691 | Bacteria | 1511 |
| 950 | Ga0373931_0149622 | 3300035691 | Bacteria | 1359 |
| 951 | Ga0373935_0008365 | 3300035692 | Bacteria | 6190 |
| 952 | Ga0373935_0010930 | 3300035692 | Bacteria | 5449 |
| 953 | Ga0373935_0136849 | 3300035692 | Bacteria | 1651 |
| 954 | Ga0373935_0243858 | 3300035692 | Bacteria | 1255 |
| 955 | Ga0373927_0002377 | 3300035695 | Bacteria | 13712 |
| 956 | Ga0373927_0009145 | 3300035695 | Bacteria | 6651 |
| 957 | Ga0373927_0059332 | 3300035695 | Bacteria | 2474 |
| 958 | Ga0373927_0159507 | 3300035695 | Bacteria | 1478 |
| 959 | Ga0373927_0303532 | 3300035695 | Bacteria | 1051 |
| 960 | Ga0373933_0003512 | 3300035724 | Bacteria | 8728 |
| 961 | Ga0373933_0005999 | 3300035724 | Bacteria | 6610 |
| 962 | Ga0373933_0014137 | 3300035724 | Bacteria | 4433 |
| 963 | Ga0373933_0133774 | 3300035724 | Bacteria | 1561 |
| 964 | Ga0373933_0436573 | 3300035724 | Bacteria | 856 |
| 965 | Ga0373947_0002454 | 3300035725 | Bacteria | 11164 |
| 966 | Ga0373947_0003283 | 3300035725 | Bacteria | 9588 |
| 967 | Ga0373947_0005390 | 3300035725 | Bacteria | 7462 |
| 968 | Ga0373947_0028558 | 3300035725 | Bacteria | 3271 |
| 969 | Ga0373947_0155628 | 3300035725 | Bacteria | 1475 |
| 970 | Ga0373937_0000977 | 3300036401 | Bacteria | 24260 |
| 971 | Ga0373937_0000998 | 3300036401 | Bacteria | 23980 |
| 972 | Ga0373937_0011819 | 3300036401 | Bacteria | 7666 |
| 973 | Ga0373937_0013390 | 3300036401 | Bacteria | 7226 |
| 974 | Ga0373937_0067460 | 3300036401 | Bacteria | 3296 |
| 975 | Ga0373937_0076111 | 3300036401 | Bacteria | 3099 |
| 976 | Ga0373937_0090816 | 3300036401 | Bacteria | 2829 |
| 977 | Ga0373937_0145830 | 3300036401 | Bacteria | 2216 |
| 978 | Ga0373937_0204092 | 3300036401 | Bacteria | 1859 |
| 979 | Ga0373937_0512692 | 3300036401 | Bacteria | 1139 |
| 980 | Ga0373937_0612640 | 3300036401 | Bacteria | 1033 |
| 981 | Ga0373937_0686032 | 3300036401 | Bacteria | 970 |
| 982 | Ga0373925_0002457 | 3300037068 | Bacteria | 14848 |
| 983 | Ga0373925_0005022 | 3300037068 | Bacteria | 9926 |
| 984 | Ga0373925_0027418 | 3300037068 | Bacteria | 4169 |
| 985 | Ga0373925_0109865 | 3300037068 | Bacteria | 2128 |
| 986 | Ga0373925_0240585 | 3300037068 | Bacteria | 1449 |
| 987 | Ga0395899_0057420 | 3300037312 | Bacteria | 2873 |
| 988 | Ga0395899_0146243 | 3300037312 | Bacteria | 1678 |
| 989 | Ga0395900_0017768 | 3300037418 | Bacteria | 7260 |
| 990 | Ga0395900_0019767 | 3300037418 | Bacteria | 6864 |
| 991 | Ga0395900_0086905 | 3300037418 | Bacteria | 3213 |
| 992 | Ga0395900_0634675 | 3300037418 | Bacteria | 1006 |
| 993 | Ga0395898_0019586 | 3300037466 | Bacteria | 6884 |
| 994 | Ga0395898_0047491 | 3300037466 | Bacteria | 4213 |
| 995 | Ga0395898_0054044 | 3300037466 | Bacteria | 3920 |
| 996 | Ga0395898_0081580 | 3300037466 | Bacteria | 3118 |
| 997 | Ga0395905_0002014 | 3300037471 | Bacteria | 23216 |
| 998 | Ga0436364_1021069 | 3300037853 | Bacteria | 939 |
| 999 | Ga0395901_0003370 | 3300038443 | Bacteria | 16101 |
| 1000 | Ga0395901_0029286 | 3300038443 | Bacteria | 5667 |
| 1001 | Ga0395901_0145242 | 3300038443 | Bacteria | 2493 |
| 1002 | Ga0395901_1384808 | 3300038443 | Bacteria | 662 |
| 1003 | Ga0242420_022331 | 3300038996 | Bacteria | 1137 |
| 1004 | Ga0436365_0648744 | 3300039437 | Bacteria | 945 |
| 1005 | Ga0436365_1068563 | 3300039437 | Bacteria | 2089 |
| 1006 | Ga0436365_1158499 | 3300039437 | Bacteria | 974 |
| 1007 | Ga0436361_0024076 | 3300039447 | Bacteria | 2029 |
| 1008 | Ga0436361_0120642 | 3300039447 | Bacteria | 705 |
| 1009 | Ga0436361_0125156 | 3300039447 | Bacteria | 2105 |
| 1010 | Ga0436361_0244861 | 3300039447 | Bacteria | 1278 |
| 1011 | Ga0436361_0294175 | 3300039447 | Bacteria | 1021 |
| 1012 | Ga0436361_0407501 | 3300039447 | Bacteria | 2303 |
| 1013 | Ga0436361_0484050 | 3300039447 | Bacteria | 861 |
| 1014 | Ga0436361_0724345 | 3300039447 | Bacteria | 3516 |
| 1015 | Ga0436361_0795199 | 3300039447 | Bacteria | 71391 |
| 1016 | Ga0436361_1098427 | 3300039447 | Bacteria | 1495 |
| 1017 | Ga0436363_0925274 | 3300039450 | Bacteria | 1572 |
| 1018 | Ga0436363_1200294 | 3300039450 | Bacteria | 1415 |
| 1019 | Ga0436362_1126626 | 3300039453 | Bacteria | 1166 |
| 1020 | Ga0439443_016357 | 3300042003 | Bacteria | 1133 |
| 1021 | Ga0439448_0056871 | 3300042005 | Bacteria | 1288 |
| 1022 | Ga0451577_0110442 | 3300042876 | Bacteria | 2460 |
| 1023 | Ga0451577_0614127 | 3300042876 | Bacteria | 986 |
| 1024 | Ga0466969_0000193 | 3300044656 | Bacteria | 32883 |
| 1025 | Ga0466966_0009486 | 3300044684 | Bacteria | 6444 |
| 1026 | Ga0466966_0069666 | 3300044684 | Bacteria | 2206 |
| 1027 | Ga0466961_0009053 | 3300044693 | Bacteria | 6349 |
| 1028 | Ga0466963_0025049 | 3300044694 | Bacteria | 3801 |
| 1029 | Ga0466963_0244355 | 3300044694 | Bacteria | 1259 |
| 1030 | Ga0466964_0163124 | 3300044706 | Bacteria | 1043 |
| 1031 | Ga0453684_0010839 | 3300044712 | Bacteria | 15449 |
| 1032 | Ga0453684_0198644 | 3300044712 | Bacteria | 2339 |
| 1033 | Ga0453684_0469786 | 3300044712 | Bacteria | 1397 |
| 1034 | Ga0466971_0092771 | 3300044719 | Bacteria | 1383 |
| 1035 | Ga0466968_0369160 | 3300044735 | Bacteria | 699 |
| 1036 | Ga0466970_0004501 | 3300044765 | Bacteria | 6872 |
| 1037 | Ga0466957_0118503 | 3300044842 | Bacteria | 1686 |
| 1038 | Ga0466957_0455909 | 3300044842 | Bacteria | 882 |
| 1039 | Ga0466959_0000118 | 3300045049 | Bacteria | 51145 |
| 1040 | Ga0451576_0105771 | 3300045051 | Bacteria | 2928 |
| 1041 | Ga0451576_1698745 | 3300045051 | Bacteria | 654 |
| 1042 | Ga0466958_0000804 | 3300045836 | Bacteria | 13846 |
| 1043 | Ga0466958_0049465 | 3300045836 | Bacteria | 2543 |
| 1044 | Ga0466958_0407568 | 3300045836 | Bacteria | 878 |
| 1045 | Ga0466958_0532629 | 3300045836 | Bacteria | 763 |
| 1046 | Ga0466967_0002046 | 3300045976 | Bacteria | 12320 |
| 1047 | Ga0466967_0071094 | 3300045976 | Bacteria | 3115 |
| 1048 | Ga0466967_0534660 | 3300045976 | Bacteria | 1153 |
| 1049 | Ga0466967_0617482 | 3300045976 | Bacteria | 1071 |
| 1050 | Ga0495617_119755 | 3300046452 | Bacteria | 848 |
| 1051 | Ga0495592_0002187 | 3300046454 | Bacteria | 13770 |
| 1052 | Ga0495592_0003145 | 3300046454 | Bacteria | 11808 |
| 1053 | Ga0495592_0011852 | 3300046454 | Bacteria | 6605 |
| 1054 | Ga0495592_0153609 | 3300046454 | Bacteria | 1589 |
| 1055 | Ga0495603_0000127 | 3300046455 | Bacteria | 37048 |
| 1056 | Ga0495603_0006157 | 3300046455 | Bacteria | 7172 |
| 1057 | Ga0495603_0010152 | 3300046455 | Bacteria | 5698 |
| 1058 | Ga0495603_0011477 | 3300046455 | Bacteria | 5362 |
| 1059 | Ga0495629_0000474 | 3300046459 | Bacteria | 33674 |
| 1060 | Ga0495629_0001081 | 3300046459 | Bacteria | 21648 |
| 1061 | Ga0495629_0001491 | 3300046459 | Bacteria | 18414 |
| 1062 | Ga0495629_0037772 | 3300046459 | Bacteria | 3403 |
| 1063 | Ga0495629_0095292 | 3300046459 | Bacteria | 2076 |
| 1064 | Ga0495638_0252564 | 3300046460 | Bacteria | 971 |
| 1065 | Ga0495641_0000716 | 3300046461 | Bacteria | 28072 |
| 1066 | Ga0495641_0069602 | 3300046461 | Bacteria | 1581 |
| 1067 | Ga0495651_0001830 | 3300046462 | Bacteria | 16422 |
| 1068 | Ga0495651_0063498 | 3300046462 | Bacteria | 2822 |
| 1069 | Ga0495651_0206807 | 3300046462 | Bacteria | 1369 |
| 1070 | Ga0495653_0001477 | 3300046463 | Bacteria | 18333 |
| 1071 | Ga0495653_0002011 | 3300046463 | Bacteria | 16000 |
| 1072 | Ga0495653_0101812 | 3300046463 | Bacteria | 2080 |
| 1073 | Ga0495653_0277799 | 3300046463 | Bacteria | 1100 |
| 1074 | Ga0495580_0000533 | 3300046472 | Bacteria | 32237 |
| 1075 | Ga0495580_0001373 | 3300046472 | Bacteria | 21360 |
| 1076 | Ga0495580_0029341 | 3300046472 | Bacteria | 3993 |
| 1077 | Ga0495582_0000310 | 3300046473 | Bacteria | 26965 |
| 1078 | Ga0495582_0001241 | 3300046473 | Bacteria | 14349 |
| 1079 | Ga0495582_0131370 | 3300046473 | Bacteria | 1415 |
| 1080 | Ga0495605_0061919 | 3300046474 | Bacteria | 1789 |
| 1081 | Ga0495605_0133320 | 3300046474 | Bacteria | 1119 |
| 1082 | Ga0495639_0000593 | 3300046475 | Bacteria | 16896 |
| 1083 | Ga0495639_0000991 | 3300046475 | Bacteria | 12814 |
| 1084 | Ga0495639_0005266 | 3300046475 | Bacteria | 5562 |
| 1085 | Ga0495662_0000599 | 3300046476 | Bacteria | 16654 |
| 1086 | Ga0495664_0001780 | 3300046477 | Bacteria | 11436 |
| 1087 | Ga0495664_0008385 | 3300046477 | Bacteria | 5765 |
| 1088 | Ga0495664_0089917 | 3300046477 | Bacteria | 1846 |
| 1089 | Ga0495664_0120397 | 3300046477 | Bacteria | 1587 |
| 1090 | Ga0495584_0019476 | 3300046491 | Bacteria | 3447 |
| 1091 | Ga0495585_0012307 | 3300046492 | Bacteria | 5040 |
| 1092 | Ga0495594_0000972 | 3300046499 | Bacteria | 14868 |
| 1093 | Ga0495594_0004519 | 3300046499 | Bacteria | 7157 |
| 1094 | Ga0495594_0023664 | 3300046499 | Bacteria | 3293 |
| 1095 | Ga0495594_0282116 | 3300046499 | Bacteria | 946 |
| 1096 | Ga0495608_0000844 | 3300046511 | Bacteria | 21431 |
| 1097 | Ga0495608_0029605 | 3300046511 | Bacteria | 3712 |
| 1098 | Ga0495608_0035340 | 3300046511 | Bacteria | 3371 |
| 1099 | Ga0495618_0003351 | 3300046514 | Bacteria | 9989 |
| 1100 | Ga0495618_0006349 | 3300046514 | Bacteria | 7176 |
| 1101 | Ga0495618_0010591 | 3300046514 | Bacteria | 5579 |
| 1102 | Ga0495618_0112356 | 3300046514 | Bacteria | 1744 |
| 1103 | Ga0495628_0017046 | 3300046516 | Bacteria | 6053 |
| 1104 | Ga0495628_0022156 | 3300046516 | Bacteria | 5221 |
| 1105 | Ga0495628_0079335 | 3300046516 | Bacteria | 2552 |
| 1106 | Ga0495628_0201198 | 3300046516 | Bacteria | 1501 |
| 1107 | Ga0495630_0031825 | 3300046517 | Bacteria | 3928 |
| 1108 | Ga0495637_0131902 | 3300046520 | Bacteria | 954 |
| 1109 | Ga0495644_0001924 | 3300046523 | Bacteria | 8344 |
| 1110 | Ga0495666_0005432 | 3300046526 | Bacteria | 6419 |
| 1111 | Ga0495666_0020312 | 3300046526 | Bacteria | 3292 |
| 1112 | Ga0495666_0164387 | 3300046526 | Bacteria | 1028 |
| 1113 | Ga0495652_0001947 | 3300046529 | Bacteria | 21945 |
| 1114 | Ga0495652_0003249 | 3300046529 | Bacteria | 16200 |
| 1115 | Ga0495652_0012241 | 3300046529 | Bacteria | 7747 |
| 1116 | Ga0495652_0026434 | 3300046529 | Bacteria | 5129 |
| 1117 | Ga0495665_0000185 | 3300046531 | Bacteria | 31863 |
| 1118 | Ga0495665_0007528 | 3300046531 | Bacteria | 5894 |
| 1119 | Ga0495665_0009023 | 3300046531 | Bacteria | 5410 |
| 1120 | Ga0495640_0006612 | 3300046533 | Bacteria | 9144 |
| 1121 | Ga0495640_0006875 | 3300046533 | Bacteria | 8963 |
| 1122 | Ga0495640_0149666 | 3300046533 | Bacteria | 1500 |
| 1123 | Ga0495640_0207370 | 3300046533 | Bacteria | 1240 |
| 1124 | Ga0495640_0404409 | 3300046533 | Bacteria | 838 |
| 1125 | Ga0495586_0003393 | 3300046535 | Bacteria | 8540 |
| 1126 | Ga0495586_0028093 | 3300046535 | Bacteria | 3010 |
| 1127 | Ga0495587_0000732 | 3300046536 | Bacteria | 21969 |
| 1128 | Ga0495587_0011211 | 3300046536 | Bacteria | 5683 |
| 1129 | Ga0495587_0017113 | 3300046536 | Bacteria | 4507 |
| 1130 | Ga0495609_0106058 | 3300046538 | Bacteria | 1215 |
| 1131 | Ga0495621_0033590 | 3300046539 | Bacteria | 1769 |
| 1132 | Ga0495645_0003961 | 3300046543 | Bacteria | 10097 |
| 1133 | Ga0495622_0001379 | 3300046557 | Bacteria | 12379 |
| 1134 | Ga0495622_0028177 | 3300046557 | Bacteria | 2622 |
| 1135 | Ga0495622_0155688 | 3300046557 | Bacteria | 1032 |
| 1136 | Ga0495633_0004731 | 3300046558 | Bacteria | 8549 |
| 1137 | Ga0495633_0253866 | 3300046558 | Bacteria | 802 |
| 1138 | Ga0495633_0254472 | 3300046558 | Bacteria | 801 |
| 1139 | Ga0495667_0002039 | 3300046559 | Bacteria | 13390 |
| 1140 | Ga0495667_0002260 | 3300046559 | Bacteria | 12888 |
| 1141 | Ga0495667_0007395 | 3300046559 | Bacteria | 7447 |
| 1142 | Ga0495667_0008839 | 3300046559 | Bacteria | 6849 |
| 1143 | Ga0495667_0076054 | 3300046559 | Bacteria | 2184 |
| 1144 | Ga0495667_0403086 | 3300046559 | Bacteria | 861 |
| 1145 | Ga0495656_0000505 | 3300046615 | Bacteria | 12799 |
| 1146 | Ga0495656_0104372 | 3300046615 | Bacteria | 1316 |
| 1147 | Ga0495634_0005916 | 3300046642 | Bacteria | 9344 |
| 1148 | Ga0495634_0006195 | 3300046642 | Bacteria | 9115 |
| 1149 | Ga0495634_0027885 | 3300046642 | Bacteria | 3925 |
| 1150 | Ga0495634_0047227 | 3300046642 | Bacteria | 2902 |
| 1151 | Ga0495634_0136594 | 3300046642 | Bacteria | 1559 |
| 1152 | Ga0495611_0018877 | 3300046648 | Bacteria | 2959 |
| 1153 | Ga0495625_0308326 | 3300046660 | Bacteria | 1011 |
| 1154 | Ga0495635_0002667 | 3300046663 | Bacteria | 12193 |
| 1155 | Ga0495635_0008996 | 3300046663 | Bacteria | 6966 |
| 1156 | Ga0495635_0018383 | 3300046663 | Bacteria | 4878 |
| 1157 | Ga0495635_0035752 | 3300046663 | Bacteria | 3444 |
| 1158 | Ga0495659_0000862 | 3300046664 | Bacteria | 10792 |
| 1159 | Ga0495659_0114240 | 3300046664 | Bacteria | 1057 |
| 1160 | Ga0495588_0000855 | 3300046674 | Bacteria | 13493 |
| 1161 | Ga0495588_0006169 | 3300046674 | Bacteria | 5383 |
| 1162 | Ga0495588_0042747 | 3300046674 | Bacteria | 2317 |
| 1163 | Ga0495657_0019080 | 3300046675 | Bacteria | 4953 |
| 1164 | Ga0495657_0061658 | 3300046675 | Bacteria | 2480 |
| 1165 | Ga0495599_0013241 | 3300046678 | Bacteria | 5096 |
| 1166 | Ga0495599_0037130 | 3300046678 | Bacteria | 3060 |
| 1167 | Ga0495599_0052645 | 3300046678 | Bacteria | 2550 |
| 1168 | Ga0495599_0114342 | 3300046678 | Bacteria | 1679 |
| 1169 | Ga0495623_0003160 | 3300046679 | Bacteria | 10870 |
| 1170 | Ga0495623_0040188 | 3300046679 | Bacteria | 2987 |
| 1171 | Ga0495623_0078630 | 3300046679 | Bacteria | 2044 |
| 1172 | Ga0495646_0000681 | 3300046680 | Bacteria | 18660 |
| 1173 | Ga0495646_0009918 | 3300046680 | Bacteria | 6052 |
| 1174 | Ga0495646_0109730 | 3300046680 | Bacteria | 1572 |
| 1175 | Ga0495647_0006977 | 3300046681 | Bacteria | 3765 |
| 1176 | Ga0495647_0010913 | 3300046681 | Bacteria | 3103 |
| 1177 | Ga0495647_0016276 | 3300046681 | Bacteria | 2615 |
| 1178 | Ga0495658_0000453 | 3300046683 | Bacteria | 22768 |
| 1179 | Ga0495658_0000640 | 3300046683 | Bacteria | 18972 |
| 1180 | Ga0495658_0003124 | 3300046683 | Bacteria | 8268 |
| 1181 | Ga0495658_0011916 | 3300046683 | Bacteria | 4387 |
| 1182 | Ga0495658_0146918 | 3300046683 | Bacteria | 1446 |
| 1183 | Ga0495669_0000388 | 3300046684 | Bacteria | 21895 |
| 1184 | Ga0495613_0000450 | 3300046689 | Bacteria | 35062 |
| 1185 | Ga0495613_0005450 | 3300046689 | Bacteria | 9558 |
| 1186 | Ga0495613_0010177 | 3300046689 | Bacteria | 6988 |
| 1187 | Ga0495613_0059445 | 3300046689 | Bacteria | 2802 |
| 1188 | Ga0495624_0000990 | 3300046690 | Bacteria | 22455 |
| 1189 | Ga0495624_0285763 | 3300046690 | Bacteria | 996 |
| 1190 | Ga0495670_0014504 | 3300046691 | Bacteria | 3873 |
| 1191 | Ga0495649_0168837 | 3300046694 | Bacteria | 1146 |
| 1192 | Ga0495600_0000326 | 3300046809 | Bacteria | 25282 |
| 1193 | Ga0495600_0055531 | 3300046809 | Bacteria | 2586 |
| 1194 | Ga0495600_0058587 | 3300046809 | Bacteria | 2516 |
| 1195 | Ga0495600_0088439 | 3300046809 | Bacteria | 2021 |
| 1196 | Ga0495581_0000462 | 3300047315 | Bacteria | 20789 |
| 1197 | Ga0495581_0010642 | 3300047315 | Bacteria | 5317 |
| 1198 | Ga0495604_0000643 | 3300047317 | Bacteria | 29876 |
| 1199 | Ga0495604_0002511 | 3300047317 | Bacteria | 14648 |
| 1200 | Ga0495604_0009753 | 3300047317 | Bacteria | 7596 |
| 1201 | Ga0495604_0050376 | 3300047317 | Bacteria | 3234 |
| 1202 | Ga0495604_0310948 | 3300047317 | Bacteria | 1056 |
| 1203 | Ga0495604_0321008 | 3300047317 | Bacteria | 1035 |
| 1204 | Ga0495674_0003479 | 3300047319 | Bacteria | 15302 |
| 1205 | Ga0495674_0008425 | 3300047319 | Bacteria | 9822 |
| 1206 | Ga0495674_0027234 | 3300047319 | Bacteria | 5224 |
| 1207 | Ga0495674_0039411 | 3300047319 | Bacteria | 4235 |
| 1208 | Ga0495674_0064848 | 3300047319 | Bacteria | 3174 |
| 1209 | Ga0495674_0231509 | 3300047319 | Bacteria | 1525 |
| 1210 | Ga0495674_0358057 | 3300047319 | Bacteria | 1184 |
| 1211 | Ga0495676_0003716 | 3300047321 | Bacteria | 13857 |
| 1212 | Ga0495676_0017497 | 3300047321 | Bacteria | 6337 |
| 1213 | Ga0495676_0054793 | 3300047321 | Bacteria | 3167 |
| 1214 | Ga0495680_0001401 | 3300047322 | Bacteria | 26002 |
| 1215 | Ga0495680_0006685 | 3300047322 | Bacteria | 10678 |
| 1216 | Ga0495680_0006889 | 3300047322 | Bacteria | 10490 |
| 1217 | Ga0495680_0012123 | 3300047322 | Bacteria | 7605 |
| 1218 | Ga0495680_0012637 | 3300047322 | Bacteria | 7417 |
| 1219 | Ga0495680_0086555 | 3300047322 | Bacteria | 2357 |
| 1220 | Ga0495680_0286359 | 3300047322 | Bacteria | 1160 |
| 1221 | Ga0495680_0350701 | 3300047322 | Bacteria | 1028 |
| 1222 | Ga0495675_0005017 | 3300047444 | Bacteria | 8053 |
| 1223 | Ga0495675_0033575 | 3300047444 | Bacteria | 3275 |
| 1224 | Ga0495679_013128 | 3300047446 | Bacteria | 3123 |
| 1225 | Ga0495684_0020107 | 3300047471 | Bacteria | 5142 |
| 1226 | Ga0495684_0042671 | 3300047471 | Bacteria | 3473 |
| 1227 | Ga0495684_0052577 | 3300047471 | Bacteria | 3109 |
| 1228 | Ga0495593_0000730 | 3300047673 | Bacteria | 19058 |
| 1229 | Ga0495593_0002845 | 3300047673 | Bacteria | 10425 |
| 1230 | Ga0495593_0010817 | 3300047673 | Bacteria | 5260 |
| 1231 | Ga0495593_0191604 | 3300047673 | Bacteria | 1028 |
| 1232 | Ga0495602_0003673 | 3300048088 | Bacteria | 15906 |
| 1233 | Ga0495602_0005637 | 3300048088 | Bacteria | 13125 |
| 1234 | Ga0495602_0010516 | 3300048088 | Bacteria | 9605 |
| 1235 | Ga0495602_0075932 | 3300048088 | Bacteria | 2850 |
| 1236 | Ga0495602_0175882 | 3300048088 | Bacteria | 1656 |
| 1237 | Ga0495614_0021658 | 3300048089 | Bacteria | 2775 |
| 1238 | Ga0495614_0131372 | 3300048089 | Bacteria | 1108 |
| 1239 | Ga0496100_0001758 | 3300048903 | Bacteria | 10807 |
| 1240 | Ga0496100_0003708 | 3300048903 | Bacteria | 8002 |
| 1241 | Ga0496100_0076198 | 3300048903 | Bacteria | 2251 |
| 1242 | Ga0496100_0158496 | 3300048903 | Bacteria | 1621 |
| 1243 | Ga0496100_0569101 | 3300048903 | Bacteria | 878 |
| 1244 | Ga0496100_0579935 | 3300048903 | Bacteria | 869 |
| 1245 | Ga0496101_0012951 | 3300048904 | Bacteria | 5577 |
| 1246 | Ga0496101_0074915 | 3300048904 | Bacteria | 2490 |
| 1247 | Ga0496101_0310860 | 3300048904 | Bacteria | 1235 |
| 1248 | Ga0496102_0002938 | 3300048905 | Bacteria | 14454 |
| 1249 | Ga0496102_0011898 | 3300048905 | Bacteria | 7511 |
| 1250 | Ga0496102_0060150 | 3300048905 | Bacteria | 3475 |
| 1251 | Ga0496102_0284822 | 3300048905 | Bacteria | 1557 |
| 1252 | Ga0496102_0332539 | 3300048905 | Bacteria | 1431 |
| 1253 | Ga0496102_0503010 | 3300048905 | Bacteria | 1134 |
| 1254 | Ga0496102_0641472 | 3300048905 | Bacteria | 985 |
| 1255 | Ga0496102_0750684 | 3300048905 | Bacteria | 898 |
| 1256 | Ga0496102_0750689 | 3300048905 | Bacteria | 898 |
| 1257 | Ga0496102_0890921 | 3300048905 | Bacteria | 811 |
| 1258 | Ga0496103_0003026 | 3300048906 | Bacteria | 10356 |
| 1259 | Ga0496103_0013998 | 3300048906 | Bacteria | 4762 |
| 1260 | Ga0496103_0040060 | 3300048906 | Bacteria | 2879 |
| 1261 | Ga0496103_0042071 | 3300048906 | Bacteria | 2810 |
| 1262 | Ga0496103_0163846 | 3300048906 | Bacteria | 1426 |
| 1263 | Ga0496104_0000146 | 3300048907 | Bacteria | 65212 |
| 1264 | Ga0496104_0000741 | 3300048907 | Bacteria | 27998 |
| 1265 | Ga0496104_0002220 | 3300048907 | Bacteria | 16765 |
| 1266 | Ga0496104_0003698 | 3300048907 | Bacteria | 13197 |
| 1267 | Ga0496104_0079305 | 3300048907 | Bacteria | 3129 |
| 1268 | Ga0496104_0150014 | 3300048907 | Bacteria | 2238 |
| 1269 | Ga0496104_0159085 | 3300048907 | Bacteria | 2167 |
| 1270 | Ga0496104_0194289 | 3300048907 | Bacteria | 1941 |
| 1271 | Ga0496104_0342230 | 3300048907 | Bacteria | 1408 |
| 1272 | Ga0496104_0424694 | 3300048907 | Bacteria | 1241 |
| 1273 | Ga0496104_0747876 | 3300048907 | Bacteria | 885 |
| 1274 | Ga0496105_0000025 | 3300048908 | Bacteria | 150594 |
| 1275 | Ga0496105_0011046 | 3300048908 | Bacteria | 7119 |
| 1276 | Ga0496105_0011482 | 3300048908 | Bacteria | 6999 |
| 1277 | Ga0496105_0019370 | 3300048908 | Bacteria | 5488 |
| 1278 | Ga0496105_0033779 | 3300048908 | Bacteria | 4203 |
| 1279 | Ga0496105_0096191 | 3300048908 | Bacteria | 2445 |
| 1280 | Ga0496105_0116549 | 3300048908 | Bacteria | 2203 |
| 1281 | Ga0496105_0195977 | 3300048908 | Bacteria | 1650 |
| 1282 | Ga0496105_0505203 | 3300048908 | Bacteria | 948 |
| 1283 | Ga0496106_0009990 | 3300048909 | Bacteria | 7008 |
| 1284 | Ga0496106_0012004 | 3300048909 | Bacteria | 6393 |
| 1285 | Ga0496106_0037988 | 3300048909 | Bacteria | 3602 |
| 1286 | Ga0496106_0042813 | 3300048909 | Bacteria | 3396 |
| 1287 | Ga0496106_0062646 | 3300048909 | Bacteria | 2824 |
| 1288 | Ga0496106_0088279 | 3300048909 | Bacteria | 2390 |
| 1289 | Ga0496106_0184538 | 3300048909 | Bacteria | 1657 |
| 1290 | Ga0496106_0195793 | 3300048909 | Bacteria | 1608 |
| 1291 | Ga0496107_0014021 | 3300048910 | Bacteria | 5610 |
| 1292 | Ga0496107_0015547 | 3300048910 | Bacteria | 5336 |
| 1293 | Ga0496107_0039322 | 3300048910 | Bacteria | 3393 |
| 1294 | Ga0496107_0054442 | 3300048910 | Bacteria | 2887 |
| 1295 | Ga0496107_0071713 | 3300048910 | Bacteria | 2517 |
| 1296 | Ga0496107_0104657 | 3300048910 | Bacteria | 2077 |
| 1297 | Ga0496107_0509455 | 3300048910 | Bacteria | 892 |
| 1298 | Ga0496108_0007653 | 3300048911 | Bacteria | 8745 |
| 1299 | Ga0496108_0023258 | 3300048911 | Bacteria | 5097 |
| 1300 | Ga0496108_0078821 | 3300048911 | Bacteria | 2788 |
| 1301 | Ga0496108_0092967 | 3300048911 | Bacteria | 2565 |
| 1302 | Ga0496108_0241538 | 3300048911 | Bacteria | 1571 |
| 1303 | Ga0496108_0322150 | 3300048911 | Bacteria | 1347 |
| 1304 | Ga0496108_0426455 | 3300048911 | Bacteria | 1158 |
| 1305 | Ga0496109_0000526 | 3300048912 | Bacteria | 32410 |
| 1306 | Ga0496109_0064201 | 3300048912 | Bacteria | 3359 |
| 1307 | Ga0496109_0079373 | 3300048912 | Bacteria | 3023 |
| 1308 | Ga0496109_0264545 | 3300048912 | Bacteria | 1620 |
| 1309 | Ga0496109_0288539 | 3300048912 | Bacteria | 1547 |
| 1310 | Ga0496109_0421351 | 3300048912 | Bacteria | 1261 |
| 1311 | Ga0496109_0845297 | 3300048912 | Bacteria | 853 |
| 1312 | Ga0496110_0011465 | 3300048913 | Bacteria | 7255 |
| 1313 | Ga0496110_0079401 | 3300048913 | Bacteria | 2922 |
| 1314 | Ga0496110_0080027 | 3300048913 | Bacteria | 2910 |
| 1315 | Ga0496110_0283477 | 3300048913 | Bacteria | 1509 |
| 1316 | Ga0496110_0416662 | 3300048913 | Bacteria | 1224 |
| 1317 | Ga0496110_0843190 | 3300048913 | Bacteria | 822 |
| 1318 | Ga0496111_0010814 | 3300048914 | Bacteria | 6135 |
| 1319 | Ga0496111_0030122 | 3300048914 | Bacteria | 3858 |
| 1320 | Ga0496111_0033387 | 3300048914 | Bacteria | 3670 |
| 1321 | Ga0496111_0049275 | 3300048914 | Bacteria | 3036 |
| 1322 | Ga0496111_0114400 | 3300048914 | Bacteria | 1989 |
| 1323 | Ga0496111_0199372 | 3300048914 | Bacteria | 1488 |
| 1324 | Ga0496111_0356989 | 3300048914 | Bacteria | 1082 |
| 1325 | Ga0496112_0001549 | 3300048915 | Bacteria | 17768 |
| 1326 | Ga0496112_0005706 | 3300048915 | Bacteria | 10813 |
| 1327 | Ga0496112_0084195 | 3300048915 | Bacteria | 3145 |
| 1328 | Ga0496112_0200372 | 3300048915 | Bacteria | 1955 |
| 1329 | Ga0496112_0209448 | 3300048915 | Bacteria | 1907 |
| 1330 | Ga0496112_0250174 | 3300048915 | Bacteria | 1724 |
| 1331 | Ga0496112_0382401 | 3300048915 | Bacteria | 1348 |
| 1332 | Ga0496112_0777462 | 3300048915 | Bacteria | 883 |
| 1333 | Ga0496112_0868395 | 3300048915 | Bacteria | 825 |
| 1334 | Ga0496113_0001026 | 3300048916 | Bacteria | 15018 |
| 1335 | Ga0496113_0005648 | 3300048916 | Bacteria | 7828 |
| 1336 | Ga0496113_0008212 | 3300048916 | Bacteria | 6782 |
| 1337 | Ga0496113_0041681 | 3300048916 | Bacteria | 3389 |
| 1338 | Ga0496113_0075727 | 3300048916 | Bacteria | 2569 |
| 1339 | Ga0496113_0088268 | 3300048916 | Bacteria | 2385 |
| 1340 | Ga0496113_0130021 | 3300048916 | Bacteria | 1975 |
| 1341 | Ga0496113_0184655 | 3300048916 | Bacteria | 1653 |
| 1342 | Ga0496113_0294641 | 3300048916 | Bacteria | 1298 |
| 1343 | Ga0496114_0018559 | 3300048917 | Bacteria | 5626 |
| 1344 | Ga0496114_0019225 | 3300048917 | Bacteria | 5535 |
| 1345 | Ga0496114_0023712 | 3300048917 | Bacteria | 5008 |
| 1346 | Ga0496114_0027954 | 3300048917 | Bacteria | 4624 |
| 1347 | Ga0496114_0034001 | 3300048917 | Bacteria | 4203 |
| 1348 | Ga0496114_0060267 | 3300048917 | Bacteria | 3172 |
| 1349 | Ga0496114_0281421 | 3300048917 | Bacteria | 1466 |
| 1350 | Ga0496114_0611005 | 3300048917 | Bacteria | 961 |
| 1351 | Ga0496115_0008590 | 3300048918 | Bacteria | 7560 |
| 1352 | Ga0496115_0019401 | 3300048918 | Bacteria | 5231 |
| 1353 | Ga0496115_0080857 | 3300048918 | Bacteria | 2646 |
| 1354 | Ga0496115_0205546 | 3300048918 | Bacteria | 1626 |
| 1355 | Ga0496115_0258376 | 3300048918 | Bacteria | 1433 |
| 1356 | Ga0496115_0267331 | 3300048918 | Bacteria | 1405 |
| 1357 | Ga0496115_0470901 | 3300048918 | Bacteria | 1012 |
| 1358 | Ga0496115_0599936 | 3300048918 | Bacteria | 875 |
| 1359 | Ga0496119_0003812 | 3300048922 | Bacteria | 15411 |
| 1360 | Ga0496119_0312295 | 3300048922 | Bacteria | 772 |
| 1361 | Ga0496124_0417189 | 3300048927 | Bacteria | 926 |
| 1362 | Ga0496125_0003219 | 3300048928 | Bacteria | 20151 |
| 1363 | Ga0496125_0152138 | 3300048928 | Bacteria | 1587 |
| 1364 | Ga0501031_0068303 | 3300049568 | Bacteria | 2315 |
| 1365 | Ga0501031_0147447 | 3300049568 | Bacteria | 1537 |
| 1366 | Ga0501031_0173204 | 3300049568 | Bacteria | 1410 |
| 1367 | Ga0501031_0186891 | 3300049568 | Bacteria | 1353 |
| 1368 | Ga0501032_0000951 | 3300049569 | Bacteria | 23376 |
| 1369 | Ga0501032_0416689 | 3300049569 | Bacteria | 862 |
| 1370 | Ga0501033_0007292 | 3300049570 | Bacteria | 8626 |
| 1371 | Ga0501033_0144107 | 3300049570 | Bacteria | 1722 |
| 1372 | Ga0501033_0467263 | 3300049570 | Bacteria | 875 |
| 1373 | Ga0501034_0014184 | 3300049571 | Bacteria | 8213 |
| 1374 | Ga0501034_0093404 | 3300049571 | Bacteria | 3005 |
| 1375 | Ga0501034_0154152 | 3300049571 | Bacteria | 2272 |
| 1376 | Ga0501034_0161437 | 3300049571 | Bacteria | 2212 |
| 1377 | Ga0501034_0328195 | 3300049571 | Bacteria | 1462 |
| 1378 | Ga0501034_0487547 | 3300049571 | Bacteria | 1147 |
| 1379 | Ga0501036_0002920 | 3300049572 | Bacteria | 13573 |
| 1380 | Ga0501036_0067554 | 3300049572 | Bacteria | 3025 |
| 1381 | Ga0501036_0596101 | 3300049572 | Bacteria | 917 |
| 1382 | Ga0501036_1012189 | 3300049572 | Bacteria | 680 |
| 1383 | Ga0501037_0037819 | 3300049573 | Bacteria | 3558 |
| 1384 | Ga0501037_0083705 | 3300049573 | Bacteria | 2311 |
| 1385 | Ga0501037_0121788 | 3300049573 | Bacteria | 1875 |
| 1386 | Ga0501038_0000730 | 3300049574 | Bacteria | 29345 |
| 1387 | Ga0501038_0053534 | 3300049574 | Bacteria | 3474 |
| 1388 | Ga0501038_0265785 | 3300049574 | Bacteria | 1354 |
| 1389 | Ga0501038_0456075 | 3300049574 | Bacteria | 982 |
| 1390 | Ga0501039_0027260 | 3300049575 | Bacteria | 4392 |
| 1391 | Ga0501039_0034671 | 3300049575 | Bacteria | 3894 |
| 1392 | Ga0501039_0114603 | 3300049575 | Bacteria | 2109 |
| 1393 | Ga0501039_0179388 | 3300049575 | Bacteria | 1666 |
| 1394 | Ga0501039_0509014 | 3300049575 | Bacteria | 945 |
| 1395 | Ga0501040_0006194 | 3300049576 | Bacteria | 7759 |
| 1396 | Ga0501040_0012426 | 3300049576 | Bacteria | 5579 |
| 1397 | Ga0501040_0020813 | 3300049576 | Bacteria | 4374 |
| 1398 | Ga0501040_0186223 | 3300049576 | Bacteria | 1472 |
| 1399 | Ga0501040_0318711 | 3300049576 | Bacteria | 1112 |
| 1400 | Ga0501041_0049033 | 3300049577 | Bacteria | 2572 |
| 1401 | Ga0501041_0185798 | 3300049577 | Bacteria | 1301 |
| 1402 | Ga0501041_0213212 | 3300049577 | Bacteria | 1211 |
| 1403 | Ga0501041_0517895 | 3300049577 | Bacteria | 759 |
| 1404 | Ga0501042_0104841 | 3300049578 | Bacteria | 2034 |
| 1405 | Ga0501042_0377546 | 3300049578 | Bacteria | 1026 |
| 1406 | Ga0501042_0517420 | 3300049578 | Bacteria | 867 |
| 1407 | Ga0501043_0002840 | 3300049579 | Bacteria | 14469 |
| 1408 | Ga0501043_0029899 | 3300049579 | Bacteria | 4280 |
| 1409 | Ga0501043_0047395 | 3300049579 | Bacteria | 3379 |
| 1410 | Ga0501043_0093205 | 3300049579 | Bacteria | 2368 |
| 1411 | Ga0501043_0328648 | 3300049579 | Bacteria | 1165 |
| 1412 | Ga0501043_0473058 | 3300049579 | Bacteria | 939 |
| 1413 | Ga0501046_0008883 | 3300049580 | Bacteria | 8727 |
| 1414 | Ga0501046_0071471 | 3300049580 | Bacteria | 2696 |
| 1415 | Ga0501046_0214783 | 3300049580 | Bacteria | 1426 |
| 1416 | Ga0501047_0004007 | 3300049581 | Bacteria | 13845 |
| 1417 | Ga0501047_0005283 | 3300049581 | Bacteria | 12137 |
| 1418 | Ga0501047_0138641 | 3300049581 | Bacteria | 2311 |
| 1419 | Ga0501047_0211652 | 3300049581 | Bacteria | 1797 |
| 1420 | Ga0501048_0009382 | 3300049582 | Bacteria | 7348 |
| 1421 | Ga0501048_0010281 | 3300049582 | Bacteria | 6996 |
| 1422 | Ga0501048_0053832 | 3300049582 | Bacteria | 2860 |
| 1423 | Ga0501048_0058804 | 3300049582 | Bacteria | 2724 |
| 1424 | Ga0501048_0084754 | 3300049582 | Bacteria | 2235 |
| 1425 | Ga0501048_0444557 | 3300049582 | Bacteria | 928 |
| 1426 | Ga0501048_0718619 | 3300049582 | Bacteria | 717 |
| 1427 | Ga0501067_0007181 | 3300049583 | Bacteria | 6191 |
| 1428 | Ga0501068_0013567 | 3300049584 | Bacteria | 4639 |
| 1429 | Ga0501068_0049923 | 3300049584 | Bacteria | 2528 |
| 1430 | Ga0501068_0135268 | 3300049584 | Bacteria | 1543 |
| 1431 | Ga0501068_0141110 | 3300049584 | Bacteria | 1510 |
| 1432 | Ga0501069_0000066 | 3300049585 | Bacteria | 55164 |
| 1433 | Ga0501069_0175876 | 3300049585 | Bacteria | 1236 |
| 1434 | Ga0501070_0003216 | 3300049586 | Bacteria | 14207 |
| 1435 | Ga0501070_0409669 | 3300049586 | Bacteria | 1096 |
| 1436 | Ga0501070_0547120 | 3300049586 | Bacteria | 927 |
| 1437 | Ga0501071_0027265 | 3300049587 | Bacteria | 4018 |
| 1438 | Ga0501071_0144258 | 3300049587 | Bacteria | 1774 |
| 1439 | Ga0501072_0053327 | 3300049588 | Bacteria | 3185 |
| 1440 | Ga0501072_0065168 | 3300049588 | Bacteria | 2872 |
| 1441 | Ga0501072_0107586 | 3300049588 | Bacteria | 2218 |
| 1442 | Ga0501072_0454009 | 3300049588 | Bacteria | 1015 |
| 1443 | Ga0501072_0508653 | 3300049588 | Bacteria | 952 |
| 1444 | Ga0501072_0631102 | 3300049588 | Bacteria | 844 |
| 1445 | Ga0501073_0000746 | 3300049589 | Bacteria | 23011 |
| 1446 | Ga0501073_0005526 | 3300049589 | Bacteria | 9465 |
| 1447 | Ga0501073_0115761 | 3300049589 | Bacteria | 1858 |
| 1448 | Ga0501073_0239647 | 3300049589 | Bacteria | 1253 |
| 1449 | Ga0501073_0367453 | 3300049589 | Bacteria | 994 |
| 1450 | Ga0501074_0018931 | 3300049590 | Bacteria | 5001 |
| 1451 | Ga0501074_0076835 | 3300049590 | Bacteria | 2396 |
| 1452 | Ga0501074_0080978 | 3300049590 | Bacteria | 2328 |
| 1453 | Ga0501074_0107336 | 3300049590 | Bacteria | 1999 |
| 1454 | Ga0501074_0175972 | 3300049590 | Bacteria | 1527 |
| 1455 | Ga0501074_0502727 | 3300049590 | Bacteria | 859 |
| 1456 | Ga0501075_0016547 | 3300049591 | Bacteria | 5315 |
| 1457 | Ga0501075_0024884 | 3300049591 | Bacteria | 4395 |
| 1458 | Ga0501075_0133121 | 3300049591 | Bacteria | 1894 |
| 1459 | Ga0501075_0211054 | 3300049591 | Bacteria | 1481 |
| 1460 | Ga0501075_0219629 | 3300049591 | Bacteria | 1450 |
| 1461 | Ga0501075_0586129 | 3300049591 | Bacteria | 851 |
| 1462 | Ga0501076_0004802 | 3300049592 | Bacteria | 9646 |
| 1463 | Ga0501076_0026917 | 3300049592 | Bacteria | 4458 |
| 1464 | Ga0501076_0110472 | 3300049592 | Bacteria | 2222 |
| 1465 | Ga0501076_0357888 | 3300049592 | Bacteria | 1199 |
| 1466 | Ga0501077_0021468 | 3300049593 | Bacteria | 4085 |
| 1467 | Ga0501077_0055271 | 3300049593 | Bacteria | 2520 |
| 1468 | Ga0501077_0362397 | 3300049593 | Bacteria | 925 |
| 1469 | Ga0501079_0052649 | 3300049741 | Bacteria | 3141 |
| 1470 | Ga0501079_0084440 | 3300049741 | Bacteria | 2456 |
| 1471 | Ga0501079_0480961 | 3300049741 | Bacteria | 976 |
| 1472 | Ga0501080_0001309 | 3300049742 | Bacteria | 20742 |
| 1473 | Ga0501080_0072402 | 3300049742 | Bacteria | 3206 |
| 1474 | Ga0501080_0340580 | 3300049742 | Bacteria | 1355 |
| 1475 | Ga0501080_0440647 | 3300049742 | Bacteria | 1169 |
| 1476 | Ga0501080_0635065 | 3300049742 | Bacteria | 946 |
| 1477 | Ga0501080_0767860 | 3300049742 | Bacteria | 847 |
| 1478 | Ga0501081_0015652 | 3300049743 | Bacteria | 5005 |
| 1479 | Ga0501081_0018032 | 3300049743 | Bacteria | 4685 |
| 1480 | Ga0501081_0079452 | 3300049743 | Bacteria | 2294 |
| 1481 | Ga0501081_0086674 | 3300049743 | Bacteria | 2198 |
| 1482 | Ga0501081_0267643 | 3300049743 | Bacteria | 1250 |
| 1483 | Ga0501083_0006526 | 3300049744 | Bacteria | 8272 |
| 1484 | Ga0501083_0593685 | 3300049744 | Bacteria | 721 |
| 1485 | Ga0501035_0008196 | 3300049822 | Bacteria | 9738 |
| 1486 | Ga0501035_0203673 | 3300049822 | Bacteria | 1696 |
| 1487 | Ga0501035_0350421 | 3300049822 | Bacteria | 1235 |
| 1488 | Ga0501035_0519590 | 3300049822 | Bacteria | 978 |
| 1489 | Ga0501044_0006024 | 3300049823 | Bacteria | 13394 |
| 1490 | Ga0501044_0006624 | 3300049823 | Bacteria | 12776 |
| 1491 | Ga0501044_0012740 | 3300049823 | Bacteria | 9106 |
| 1492 | Ga0501044_0071868 | 3300049823 | Bacteria | 3518 |
| 1493 | Ga0501044_0130005 | 3300049823 | Bacteria | 2513 |
| 1494 | Ga0501044_0137076 | 3300049823 | Bacteria | 2438 |
| 1495 | Ga0501044_0493016 | 3300049823 | Bacteria | 1127 |
| 1496 | Ga0501044_0577928 | 3300049823 | Bacteria | 1018 |
| 1497 | Ga0501045_0025666 | 3300049824 | Bacteria | 4237 |
| 1498 | Ga0501045_0144854 | 3300049824 | Bacteria | 1767 |
| 1499 | Ga0501045_0236887 | 3300049824 | Bacteria | 1359 |
| 1500 | Ga0501045_0686297 | 3300049824 | Bacteria | 756 |
| 1501 | nmdc:mga0k408_53973_c1 | 3300050493 | Bacteria | 2329 |
| 1502 | nmdc:mga06z11_407115_c1 | 3300050494 | Bacteria | 819 |
| 1503 | nmdc:mga04h51_108206_c1 | 3300050495 | Bacteria | 1021 |
| 1504 | nmdc:mga05p37_13983_c1 | 3300050507 | Bacteria | 9625 |
| 1505 | nmdc:mga05p37_263414_c1 | 3300050507 | Bacteria | 2062 |
| 1506 | nmdc:mga05p37_30534_c1 | 3300050507 | Bacteria | 6575 |
| 1507 | nmdc:mga05p37_71264_c1 | 3300050507 | Bacteria | 4275 |
| 1508 | nmdc:mga05p37_96945_c1 | 3300050507 | Bacteria | 3633 |
| 1509 | nmdc:mga09592_5091_c1 | 3300050508 | Bacteria | 10670 |
| 1510 | nmdc:mga09592_70531_c1 | 3300050508 | Bacteria | 2965 |
| 1511 | nmdc:mga0qj67_15114_c1 | 3300050509 | Bacteria | 5842 |
| 1512 | nmdc:mga0qj67_539406_c1 | 3300050509 | Bacteria | 936 |
| 1513 | nmdc:mga06r32_111538_c1 | 3300050510 | Bacteria | 2691 |
| 1514 | nmdc:mga06r32_14111_c1 | 3300050510 | Bacteria | 7248 |
| 1515 | nmdc:mga06r32_177830_c1 | 3300050510 | Bacteria | 2113 |
| 1516 | nmdc:mga08y16_15444_c1 | 3300050511 | Bacteria | 8031 |
| 1517 | nmdc:mga08y16_216415_c1 | 3300050511 | Bacteria | 1984 |
| 1518 | nmdc:mga08y16_232785_c1 | 3300050511 | Bacteria | 1905 |
| 1519 | nmdc:mga08y16_27362_c1 | 3300050511 | Bacteria | 6008 |
| 1520 | nmdc:mga08y16_35_c1 | 3300050511 | Bacteria | 157578 |
| 1521 | nmdc:mga08y16_56956_c1 | 3300050511 | Bacteria | 4085 |
| 1522 | nmdc:mga0n895_14103_c1 | 3300050512 | Bacteria | 7245 |
| 1523 | nmdc:mga0n895_18419_c1 | 3300050512 | Bacteria | 6462 |
| 1524 | nmdc:mga0n895_221760_c1 | 3300050512 | Bacteria | 1920 |
| 1525 | nmdc:mga0n895_272211_c1 | 3300050512 | Bacteria | 1718 |
| 1526 | nmdc:mga0n895_27429_c1 | 3300050512 | Bacteria | 5411 |
| 1527 | nmdc:mga0n895_339682_c1 | 3300050512 | Bacteria | 1521 |
| 1528 | nmdc:mga0n895_341278_c1 | 3300050512 | Bacteria | 1517 |
| 1529 | nmdc:mga0n895_384110_c1 | 3300050512 | Bacteria | 1421 |
| 1530 | nmdc:mga0n895_560757_c1 | 3300050512 | Bacteria | 1147 |
| 1531 | nmdc:mga0n895_88587_c1 | 3300050512 | Bacteria | 3095 |
| 1532 | nmdc:mga0rr50_106723_c1 | 3300050513 | Bacteria | 2210 |
| 1533 | nmdc:mga0rr50_43412_c1 | 3300050513 | Bacteria | 3290 |
| 1534 | nmdc:mga0rr50_5086_c1 | 3300050513 | Bacteria | 7801 |
| 1535 | nmdc:mga0rr50_52572_c1 | 3300050513 | Bacteria | 3028 |
| 1536 | nmdc:mga0rr50_55233_c1 | 3300050513 | Bacteria | 2962 |
| 1537 | nmdc:mga0rr50_7345_c1 | 3300050513 | Bacteria | 6788 |
| 1538 | nmdc:mga08x19_178479_c1 | 3300050514 | Bacteria | 1449 |
| 1539 | nmdc:mga08x19_636687_c1 | 3300050514 | Bacteria | 756 |
| 1540 | nmdc:mga0a205_288258_c1 | 3300050515 | Bacteria | 1517 |
| 1541 | nmdc:mga0a205_38013_c1 | 3300050515 | Bacteria | 1119 |
| 1542 | nmdc:mga0a205_4498_c1 | 3300050515 | Bacteria | 12508 |
| 1543 | nmdc:mga0a205_490233_c1 | 3300050515 | Bacteria | 1086 |
| 1544 | nmdc:mga0a205_51984_c1 | 3300050515 | Bacteria | 3955 |
| 1545 | nmdc:mga0a205_595661_c1 | 3300050515 | Bacteria | 959 |
| 1546 | nmdc:mga0a205_94481_c1 | 3300050515 | Bacteria | 2889 |
| 1547 | Ga0495601_0001598 | 3300053077 | Bacteria | 12496 |
| 1548 | Ga0495601_0003108 | 3300053077 | Bacteria | 9482 |
| 1549 | Ga0495601_0004088 | 3300053077 | Bacteria | 8413 |
| 1550 | Ga0495601_0007203 | 3300053077 | Bacteria | 6526 |
| 1551 | Ga0495601_0016195 | 3300053077 | Bacteria | 4515 |
| 1552 | Ga0495601_0016516 | 3300053077 | Bacteria | 4474 |
| 1553 | Ga0495601_0021870 | 3300053077 | Bacteria | 3921 |
| 1554 | Ga0495601_0354545 | 3300053077 | Bacteria | 953 |
| 1555 | Ga0495601_0546898 | 3300053077 | Bacteria | 745 |
| 1556 | Ga0495612_0000389 | 3300053078 | Bacteria | 17611 |
| 1557 | Ga0495612_0001478 | 3300053078 | Bacteria | 9675 |
| 1558 | Ga0495612_0001959 | 3300053078 | Bacteria | 8479 |
| 1559 | Ga0495612_0002008 | 3300053078 | Bacteria | 8382 |
| 1560 | Ga0495612_0011538 | 3300053078 | Bacteria | 3560 |
| 1561 | Ga0495612_0055753 | 3300053078 | Bacteria | 1630 |
| 1562 | Ga0495655_0002844 | 3300053083 | Bacteria | 2786 |
| 1563 | Ga0495595_0000245 | 3300053084 | Bacteria | 21413 |
| 1564 | Ga0495595_0000948 | 3300053084 | Bacteria | 11166 |
| 1565 | Ga0495595_0001617 | 3300053084 | Bacteria | 8798 |
| 1566 | Ga0495595_0003200 | 3300053084 | Bacteria | 6495 |
| 1567 | Ga0495595_0012754 | 3300053084 | Bacteria | 3540 |
| 1568 | Ga0495595_0055601 | 3300053084 | Bacteria | 1842 |
| 1569 | Ga0495595_0056082 | 3300053084 | Bacteria | 1835 |
| 1570 | Ga0495619_0000097 | 3300053085 | Bacteria | 65411 |
| 1571 | Ga0495619_0000374 | 3300053085 | Bacteria | 30825 |
| 1572 | Ga0495619_0000478 | 3300053085 | Bacteria | 26805 |
| 1573 | Ga0495619_0003878 | 3300053085 | Bacteria | 9612 |
| 1574 | Ga0495619_0004827 | 3300053085 | Bacteria | 8559 |
| 1575 | Ga0495619_0004978 | 3300053085 | Bacteria | 8438 |
| 1576 | Ga0495619_0012506 | 3300053085 | Bacteria | 5346 |
| 1577 | Ga0495619_0022784 | 3300053085 | Bacteria | 4010 |
| 1578 | Ga0495619_0034703 | 3300053085 | Bacteria | 3280 |
| 1579 | Ga0495619_0091923 | 3300053085 | Bacteria | 2055 |
| 1580 | Ga0495619_0128208 | 3300053085 | Bacteria | 1742 |
| 1581 | Ga0495619_0239609 | 3300053085 | Bacteria | 1257 |
| 1582 | Ga0500578_0116573 | 3300053086 | Bacteria | 1681 |
| 1583 | Ga0500644_0045361 | 3300053088 | Bacteria | 1480 |
| 1584 | Ga0500651_0077124 | 3300053093 | Bacteria | 2068 |
| 1585 | Ga0500566_0066894 | 3300053094 | Bacteria | 2024 |
| 1586 | Ga0500566_0150400 | 3300053094 | Bacteria | 1225 |
| 1587 | Ga0500641_0009368 | 3300053096 | Bacteria | 3522 |
| 1588 | Ga0500556_0057515 | 3300053104 | Bacteria | 1423 |
| 1589 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1590 | Ga0500595_004561 | 3300053119 | Bacteria | 6185 |
| 1591 | Ga0500595_009773 | 3300053119 | Bacteria | 3854 |
| 1592 | Ga0500608_227735 | 3300053122 | Bacteria | 747 |
| 1593 | Ga0500614_054725 | 3300053123 | Bacteria | 1058 |
| 1594 | Ga0500642_0186617 | 3300053130 | Bacteria | 968 |
| 1595 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 1596 | Ga0500652_000573 | 3300053131 | Bacteria | 12839 |
| 1597 | Ga0500658_0158250 | 3300053134 | Bacteria | 1024 |
| 1598 | Ga0500559_0004376 | 3300053136 | Bacteria | 6725 |
| 1599 | Ga0500568_0064881 | 3300053139 | Bacteria | 1406 |
| 1600 | Ga0500577_0111117 | 3300053142 | Bacteria | 1131 |
| 1601 | Ga0500588_0125125 | 3300053146 | Bacteria | 910 |
| 1602 | Ga0500604_0000195 | 3300053151 | Bacteria | 17351 |
| 1603 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1604 | Ga0500616_0001203 | 3300053153 | Bacteria | 26255 |
| 1605 | Ga0500616_0151567 | 3300053153 | Bacteria | 1072 |
| 1606 | Ga0500624_051645 | 3300053157 | Bacteria | 766 |
| 1607 | Ga0500634_0000044 | 3300053161 | Bacteria | 56580 |
| 1608 | Ga0500645_000754 | 3300053730 | Bacteria | 19812 |
| 1609 | Ga0500609_002739 | 3300053731 | Bacteria | 2512 |
| 1610 | Ga0500599_011949 | 3300053736 | Bacteria | 1162 |
| 1611 | Ga0501084_0023104 | 3300054114 | Bacteria | 5191 |
| 1612 | Ga0501084_0044964 | 3300054114 | Bacteria | 3697 |
| 1613 | Ga0501084_0084758 | 3300054114 | Bacteria | 2660 |
| 1614 | Ga0501084_0271606 | 3300054114 | Bacteria | 1431 |
| 1615 | Ga0501084_0412750 | 3300054114 | Bacteria | 1141 |
| 1616 | Ga0501084_0416655 | 3300054114 | Bacteria | 1135 |
| 1617 | Ga0501084_0457806 | 3300054114 | Bacteria | 1078 |
| 1618 | Ga0501082_0006052 | 3300060353 | Bacteria | 10500 |
| 1619 | Ga0501082_0011230 | 3300060353 | Bacteria | 7695 |
| 1620 | Ga0501082_0049211 | 3300060353 | Bacteria | 3634 |
| 1621 | Ga0501082_0227781 | 3300060353 | Bacteria | 1622 |
| 1622 | Ga0501082_0544200 | 3300060353 | Bacteria | 1015 |
| 1623 | Ga0501082_0698736 | 3300060353 | Bacteria | 888 |
| 1624 | Ga0466962_0157991 | 3300061719 | Bacteria | 1101 |
| 1625 | Ga0530510_0009437 | 3300061734 | Bacteria | 6843 |
| 1626 | Ga0530510_0123555 | 3300061734 | Bacteria | 1901 |
| 1627 | Ga0530510_0126443 | 3300061734 | Bacteria | 1879 |
| 1628 | Ga0530510_0779242 | 3300061734 | Bacteria | 729 |
| 1629 | 2643756254 | 2643221547 | Bacteria | 4740017 |
| 1630 | 2643912273 | 2643221580 | Bacteria | 3816678 |
| 1631 | 2643963466 | 2643221591 | Bacteria | 4397626 |
| 1632 | 2644410585 | 2643221674 | Bacteria | 3919126 |
| 1633 | 2644735972 | 2643221734 | Bacteria | 5365412 |
| 1634 | 2738946401 | 2738541317 | Bacteria | 5340176 |
| 1635 | 2739791261 | 2739367756 | Bacteria | 4553612 |
| 1636 | 2821124470 | 2821123053 | Bacteria | 7836056 |
| 1637 | 2838741035 | 2838736955 | Bacteria | 5760694 |
| 1638 | 2840883833 | 2840878972 | Bacteria | 5483153 |
| 1639 | 2841845068 | 2841840854 | Bacteria | 5761912 |
| 1640 | 2842144791 | 2842140634 | Bacteria | 5759631 |
| 1641 | 2857532051 | 2857531043 | Bacteria | 6754041 |
| 1642 | 2891050945 | 2891048133 | Bacteria | 4447501 |
| 1643 | 2913310814 | 2913308742 | Bacteria | 5350706 |
| 1644 | 2919680980 | 2919679072 | Bacteria | 4629602 |
| 1645 | 2932403294 | 2932401849 | Bacteria | 4262978 |
| 1646 | 2995393147 | 2995392953 | Bacteria | 4539380 |
| 1647 | 3000409126 | 3000405567 | Bacteria | 3779330 |
| 1648 | 8045865187 | 8045864390 | Bacteria | 5043873 |
| 1649 | Ga0500641_0002272 | |||
| 1650 | SwRhRL2b_contig_309045 | |||
| 1651 | 2214755772 | |||
| 1652 | 2214770210 | |||
| 1653 | ARcpr5oldR_c000101 | |||
| 1654 | ARSoilYngRDRAFT_c00241 | |||
| 1655 | ARcpr5yngRDRAFT_c000102 | |||
| 1656 | ARSoilOldRDRAFT_c000134 | |||
| 1657 | ARCol0oldRDRAFT_c00121 | |||
| 1658 | ARCol0yngRDRAFT_1000058 | |||
| 1659 | JGI24032J14994_100156 | |||
| 1660 | JGI24752J21851_1000685 | |||
| 1661 | JGI24746J21847_1000232 | |||
| 1662 | JGI24747J21853_1015233 | |||
| 1663 | JGI24739J22299_10000103 | |||
| 1664 | JGI24739J22299_10035598 | |||
| 1665 | JGI24737J22298_10001448 | |||
| 1666 | JGI24737J22298_10008010 | |||
| 1667 | JGI24737J22298_10029151 | |||
| 1668 | JGI24743J22301_10004796 | |||
| 1669 | JGI24750J21931_1000146 | |||
| 1670 | JGI24750J21931_1001748 | |||
| 1671 | JGI24745J21846_1000381 | |||
| 1672 | JGI24745J21846_1029319 | |||
| 1673 | JGI24748J21848_1000880 | |||
| 1674 | JGI24738J21930_10000080 | |||
| 1675 | JGI24035J26624_1000077 | |||
| 1676 | JGI24033J26618_1000650 | |||
| 1677 | JGI24034J26672_10000241 | |||
| 1678 | JGI24034J26672_10009334 | |||
| 1679 | JGI24742J22300_10000066 | |||
| 1680 | JGI24742J22300_10010687 | |||
| 1681 | JGI24751J29686_10003146 | |||
| 1682 | JGI24751J29686_10004621 | |||
| 1683 | JGI25153J46596_10000012 | |||
| 1684 | rootH2_10024840 | |||
| 1685 | rootH1_10138961 | |||
| 1686 | Ga0055531_10017501 | |||
| 1687 | JGI25405J52794_10007814 | |||
| 1688 | Ga0065717_1002263 | |||
| 1689 | Ga0065716_1001748 | |||
| 1690 | Ga0065704_10073258 | |||
| 1691 | Ga0065704_10297603 | |||
| 1692 | Ga0065712_10006326 | |||
| 1693 | Ga0065712_10077314 | |||
| 1694 | Ga0065712_10082297 | |||
| 1695 | Ga0065712_10119729 | |||
| 1696 | Ga0065715_10089784 | |||
| 1697 | Ga0065715_10119480 | |||
| 1698 | Ga0065707_10169025 | |||
| 1699 | Ga0070658_10041006 | |||
| 1700 | Ga0070658_10054057 | |||
| 1701 | Ga0070658_10216384 | |||
| 1702 | Ga0070676_10010179 | |||
| 1703 | Ga0070676_10025524 | |||
| 1704 | Ga0070676_10469042 | |||
| 1705 | Ga0070683_100001199 | |||
| 1706 | Ga0070683_100102147 | |||
| 1707 | Ga0070683_100216813 | |||
| 1708 | Ga0070683_100304765 | |||
| 1709 | Ga0070690_100001740 | |||
| 1710 | Ga0070690_100034038 | |||
| 1711 | Ga0070690_100041801 | |||
| 1712 | Ga0070670_100019604 | |||
| 1713 | Ga0070670_100037807 | |||
| 1714 | Ga0070670_100057926 | |||
| 1715 | Ga0070670_100179979 | |||
| 1716 | Ga0070677_10000497 | |||
| 1717 | Ga0068869_100000236 | |||
| 1718 | Ga0068869_100076887 | |||
| 1719 | Ga0068869_100737423 | |||
| 1720 | Ga0070666_10002453 | |||
| 1721 | Ga0070666_10008751 | |||
| 1722 | Ga0070680_100007477 | |||
| 1723 | Ga0070680_100017862 | |||
| 1724 | Ga0070680_100031380 | |||
| 1725 | Ga0070680_100076653 | |||
| 1726 | Ga0070680_100236345 | |||
| 1727 | Ga0070680_100555056 | |||
| 1728 | Ga0070682_100001100 | |||
| 1729 | Ga0070682_100002602 | |||
| 1730 | Ga0068868_100013245 | |||
| 1731 | Ga0068868_100098536 | |||
| 1732 | Ga0070660_100003492 | |||
| 1733 | Ga0070660_100042365 | |||
| 1734 | Ga0070660_100101864 | |||
| 1735 | Ga0070660_100281957 | |||
| 1736 | Ga0070689_100000466 | |||
| 1737 | Ga0070689_100001040 | |||
| 1738 | Ga0070689_100345745 | |||
| 1739 | Ga0070689_100480293 | |||
| 1740 | Ga0070691_10002256 | |||
| 1741 | Ga0070691_10013301 | |||
| 1742 | Ga0070691_10022786 | |||
| 1743 | Ga0070687_100000277 | |||
| 1744 | Ga0070687_100005651 | |||
| 1745 | Ga0070687_100165924 | |||
| 1746 | Ga0070661_100000444 | |||
| 1747 | Ga0070661_100000827 | |||
| 1748 | Ga0070661_100252817 | |||
| 1749 | Ga0070661_100818290 | |||
| 1750 | Ga0070692_10002292 | |||
| 1751 | Ga0070692_10022458 | |||
| 1752 | Ga0070692_10142335 | |||
| 1753 | Ga0070668_100000073 | |||
| 1754 | Ga0070668_100010921 | |||
| 1755 | Ga0070668_100178834 | |||
| 1756 | Ga0070668_100282898 | |||
| 1757 | Ga0070668_100353187 | |||
| 1758 | Ga0070668_100628320 | |||
| 1759 | Ga0070668_100783763 | |||
| 1760 | Ga0070668_101173540 | |||
| 1761 | Ga0070669_100002399 | |||
| 1762 | Ga0070669_100005353 | |||
| 1763 | Ga0070675_100005703 | |||
| 1764 | Ga0070675_100354821 | |||
| 1765 | Ga0070675_100796216 | |||
| 1766 | Ga0070671_100000736 | |||
| 1767 | Ga0070671_100007103 | |||
| 1768 | Ga0070671_100119314 | |||
| 1769 | Ga0070671_100164568 | |||
| 1770 | Ga0070674_100010959 | |||
| 1771 | Ga0070674_100024433 | |||
| 1772 | Ga0070674_100407318 | |||
| 1773 | Ga0070673_100000302 | |||
| 1774 | Ga0070673_100000548 | |||
| 1775 | Ga0070673_100663916 | |||
| 1776 | Ga0070688_100000195 | |||
| 1777 | Ga0070688_100004878 | |||
| 1778 | Ga0070688_100012314 | |||
| 1779 | Ga0070659_100000822 | |||
| 1780 | Ga0070659_100001555 | |||
| 1781 | Ga0070659_100054692 | |||
| 1782 | Ga0070659_100323925 | |||
| 1783 | Ga0070659_100637490 | |||
| 1784 | Ga0070667_100002225 | |||
| 1785 | Ga0070667_100002272 | |||
| 1786 | Ga0070667_100065449 | |||
| 1787 | Ga0070667_100120120 | |||
| 1788 | Ga0070667_100433302 | |||
| 1789 | Ga0070703_10001123 | |||
| 1790 | Ga0070703_10009774 | |||
| 1791 | Ga0070709_10007205 | |||
| 1792 | Ga0070709_10016552 | |||
| 1793 | Ga0070709_10018980 | |||
| 1794 | Ga0070709_10052725 | |||
| 1795 | Ga0070709_10190331 | |||
| 1796 | Ga0070714_100002308 | |||
| 1797 | Ga0070714_100031420 | |||
| 1798 | Ga0070714_100043457 | |||
| 1799 | Ga0070714_100072813 | |||
| 1800 | Ga0070714_100080604 | |||
| 1801 | Ga0070714_100132687 | |||
| 1802 | Ga0070714_101061404 | |||
| 1803 | Ga0070713_100004212 | |||
| 1804 | Ga0070713_100222693 | |||
| 1805 | Ga0070710_10007408 | |||
| 1806 | Ga0070710_10014126 | |||
| 1807 | Ga0070710_10016794 | |||
| 1808 | Ga0070710_10588971 | |||
| 1809 | Ga0070701_10000864 | |||
| 1810 | Ga0070701_10006785 | |||
| 1811 | Ga0070701_10302493 | |||
| 1812 | Ga0070711_100000336 | |||
| 1813 | Ga0070711_100050762 | |||
| 1814 | Ga0070711_100080319 | |||
| 1815 | Ga0070711_100103656 | |||
| 1816 | Ga0070711_100115857 | |||
| 1817 | Ga0070711_100157542 | |||
| 1818 | Ga0070711_100380264 | |||
| 1819 | Ga0070705_100001041 | |||
| 1820 | Ga0070705_100001212 | |||
| 1821 | Ga0070705_100100465 | |||
| 1822 | Ga0070700_100000209 | |||
| 1823 | Ga0070700_100001313 | |||
| 1824 | Ga0070700_100028154 | |||
| 1825 | Ga0070694_100000343 | |||
| 1826 | Ga0070694_100003865 | |||
| 1827 | Ga0070694_100071827 | |||
| 1828 | Ga0070694_100148829 | |||
| 1829 | Ga0070694_100175963 | |||
| 1830 | Ga0070694_100407296 | |||
| 1831 | Ga0070708_100499273 | |||
| 1832 | Ga0070663_100018174 | |||
| 1833 | Ga0070663_100021939 | |||
| 1834 | Ga0070663_100402824 | |||
| 1835 | Ga0070663_100553294 | |||
| 1836 | Ga0070678_100000082 | |||
| 1837 | Ga0070678_100005062 | |||
| 1838 | Ga0070678_100133772 | |||
| 1839 | Ga0070662_100004072 | |||
| 1840 | Ga0070662_100019074 | |||
| 1841 | Ga0070662_100086416 | |||
| 1842 | Ga0070662_100141427 | |||
| 1843 | Ga0070681_10058442 | |||
| 1844 | Ga0070681_10169297 | |||
| 1845 | Ga0070681_10342265 | |||
| 1846 | Ga0070681_10391767 | |||
| 1847 | Ga0070681_10831937 | |||
| 1848 | Ga0070681_10933106 | |||
| 1849 | Ga0068867_100001495 | |||
| 1850 | Ga0068867_100069902 | |||
| 1851 | Ga0070685_10005500 | |||
| 1852 | Ga0070685_10005707 | |||
| 1853 | Ga0070685_10071039 | |||
| 1854 | Ga0070706_100085616 | |||
| 1855 | Ga0070698_100002489 | |||
| 1856 | Ga0070699_100060595 | |||
| 1857 | Ga0070699_100541878 | |||
| 1858 | Ga0070679_100003133 | |||
| 1859 | Ga0070679_100021336 | |||
| 1860 | Ga0070679_100027099 | |||
| 1861 | Ga0070679_100095625 | |||
| 1862 | Ga0070679_100179346 | |||
| 1863 | Ga0070679_100429212 | |||
| 1864 | Ga0070684_100005932 | |||
| 1865 | Ga0070684_100009801 | |||
| 1866 | Ga0070684_100079817 | |||
| 1867 | Ga0070684_100452692 | |||
| 1868 | Ga0070697_100007418 | |||
| 1869 | Ga0070697_100323743 | |||
| 1870 | Ga0070697_100392305 | |||
| 1871 | Ga0068853_100000919 | |||
| 1872 | Ga0068853_100001418 | |||
| 1873 | Ga0068853_100237770 | |||
| 1874 | Ga0068853_100537083 | |||
| 1875 | Ga0070672_100004500 | |||
| 1876 | Ga0070672_100012678 | |||
| 1877 | Ga0070672_100278007 | |||
| 1878 | Ga0070672_100558303 | |||
| 1879 | Ga0070686_100000488 | |||
| 1880 | Ga0070686_100016109 | |||
| 1881 | Ga0070686_100019659 | |||
| 1882 | Ga0070686_100026543 | |||
| 1883 | Ga0070695_100000199 | |||
| 1884 | Ga0070695_100002834 | |||
| 1885 | Ga0070696_100025653 | |||
| 1886 | Ga0070696_100038159 | |||
| 1887 | Ga0070696_100039045 | |||
| 1888 | Ga0070696_100134549 | |||
| 1889 | Ga0070696_100263134 | |||
| 1890 | Ga0070693_100001088 | |||
| 1891 | Ga0070693_100002155 | |||
| 1892 | Ga0070693_100604826 | |||
| 1893 | Ga0070665_100036419 | |||
| 1894 | Ga0070665_100539115 | |||
| 1895 | Ga0070665_100604063 | |||
| 1896 | Ga0070704_100002291 | |||
| 1897 | Ga0070704_100009996 | |||
| 1898 | Ga0070704_100016677 | |||
| 1899 | Ga0070704_100674305 | |||
| 1900 | Ga0068855_100007603 | |||
| 1901 | Ga0068855_100087832 | |||
| 1902 | Ga0068855_100104984 | |||
| 1903 | Ga0068855_100210414 | |||
| 1904 | Ga0070664_100002753 | |||
| 1905 | Ga0070664_100008587 | |||
| 1906 | Ga0070664_100059778 | |||
| 1907 | Ga0070664_100384799 | |||
| 1908 | Ga0068857_100001539 | |||
| 1909 | Ga0068857_100014667 | |||
| 1910 | Ga0068857_100317658 | |||
| 1911 | Ga0068857_100322633 | |||
| 1912 | Ga0068854_100000611 | |||
| 1913 | Ga0068854_100002718 | |||
| 1914 | Ga0068856_100001722 | |||
| 1915 | Ga0068856_100004058 | |||
| 1916 | Ga0068856_100472386 | |||
| 1917 | Ga0068856_100637316 | |||
| 1918 | Ga0068856_101434292 | |||
| 1919 | Ga0070702_100000629 | |||
| 1920 | Ga0070702_100007674 | |||
| 1921 | Ga0068852_100001817 | |||
| 1922 | Ga0068852_100019347 | |||
| 1923 | Ga0068852_100345453 | |||
| 1924 | Ga0068859_100010286 | |||
| 1925 | Ga0068859_100028582 | |||
| 1926 | Ga0068859_100067731 | |||
| 1927 | Ga0068859_100445196 | |||
| 1928 | Ga0068859_100631253 | |||
| 1929 | Ga0068864_100001077 | |||
| 1930 | Ga0068864_100002498 | |||
| 1931 | Ga0068866_10003421 | |||
| 1932 | Ga0068866_10004287 | |||
| 1933 | Ga0068866_10079424 | |||
| 1934 | Ga0068866_10461815 | |||
| 1935 | Ga0068866_10471624 | |||
| 1936 | Ga0068861_100000276 | |||
| 1937 | Ga0068861_100000668 | |||
| 1938 | Ga0068861_100746055 | |||
| 1939 | Ga0068861_101141037 | |||
| 1940 | Ga0068851_10088430 | |||
| 1941 | Ga0068870_10000676 | |||
| 1942 | Ga0068863_100004649 | |||
| 1943 | Ga0068863_100079646 | |||
| 1944 | Ga0068863_100149658 | |||
| 1945 | Ga0068858_100008130 | |||
| 1946 | Ga0068858_100040605 | |||
| 1947 | Ga0068858_100049152 | |||
| 1948 | Ga0068858_100266723 | |||
| 1949 | Ga0068860_100001413 | |||
| 1950 | Ga0068860_100007431 | |||
| 1951 | Ga0068860_100055702 | |||
| 1952 | Ga0068860_100580770 | |||
| 1953 | Ga0068860_100693620 | |||
| 1954 | Ga0068862_100003455 | |||
| 1955 | Ga0068862_100008906 | |||
| 1956 | Ga0068862_100043721 | |||
| 1957 | Ga0068862_100317644 | |||
| 1958 | Ga0068862_101205480 | |||
| 1959 | Ga0081455_10000327 | |||
| 1960 | Ga0081455_10001182 | |||
| 1961 | Ga0081455_10021675 | |||
| 1962 | Ga0081455_10517411 | |||
| 1963 | Ga0081540_1000205 | |||
| 1964 | Ga0081540_1002248 | |||
| 1965 | Ga0070717_10000258 | |||
| 1966 | Ga0070717_10001681 | |||
| 1967 | Ga0070717_10186052 | |||
| 1968 | Ga0070717_10261035 | |||
| 1969 | Ga0075365_10363787 | |||
| 1970 | Ga0075363_100107412 | |||
| 1971 | Ga0075432_10008052 | |||
| 1972 | Ga0075432_10037257 | |||
| 1973 | Ga0070715_10016112 | |||
| 1974 | Ga0070716_100003087 | |||
| 1975 | Ga0070716_100007734 | |||
| 1976 | Ga0070712_100004644 | |||
| 1977 | Ga0070712_100006392 | |||
| 1978 | Ga0070712_100150712 | |||
| 1979 | Ga0070712_100160167 | |||
| 1980 | Ga0070712_100412959 | |||
| 1981 | Ga0070712_100481331 | |||
| 1982 | Ga0070712_100662480 | |||
| 1983 | Ga0075367_10217734 | |||
| 1984 | Ga0075367_10244842 | |||
| 1985 | Ga0097621_100000892 | |||
| 1986 | Ga0097621_100097765 | |||
| 1987 | Ga0097621_100345971 | |||
| 1988 | Ga0075370_10014898 | |||
| 1989 | Ga0068871_100010466 | |||
| 1990 | Ga0068871_100034066 | |||
| 1991 | Ga0068871_100061166 | |||
| 1992 | Ga0068871_100157416 | |||
| 1993 | Ga0075428_100035887 | |||
| 1994 | Ga0075428_100098461 | |||
| 1995 | Ga0075428_100221947 | |||
| 1996 | Ga0075428_100286031 | |||
| 1997 | Ga0075430_100007678 | |||
| 1998 | Ga0075431_100007378 | |||
| 1999 | Ga0075431_100047137 | |||
| 2000 | Ga0075433_10002306 | |||
| 2001 | Ga0075433_10003286 | |||
| 2002 | Ga0075433_10006637 | |||
| 2003 | Ga0075433_10370612 | |||
| 2004 | Ga0075434_100000110 | |||
| 2005 | Ga0075434_100001583 | |||
| 2006 | Ga0075434_100023586 | |||
| 2007 | Ga0075434_100023964 | |||
| 2008 | Ga0075434_100424611 | |||
| 2009 | Ga0075434_100441836 | |||
| 2010 | Ga0075434_100520746 | |||
| 2011 | Ga0075429_100006496 | |||
| 2012 | Ga0075429_100051597 | |||
| 2013 | Ga0068865_100000452 | |||
| 2014 | Ga0068865_100059223 | |||
| 2015 | Ga0068865_100127075 | |||
| 2016 | Ga0075436_100009283 | |||
| 2017 | Ga0075436_100082624 | |||
| 2018 | Ga0075436_100251899 | |||
| 2019 | Ga0097620_100010289 | |||
| 2020 | Ga0097620_100028581 | |||
| 2021 | Ga0097620_100067730 | |||
| 2022 | Ga0097620_100445196 | |||
| 2023 | Ga0097620_100631251 | |||
| 2024 | Ga0075435_100026293 | |||
| 2025 | Ga0075435_100066443 | |||
| 2026 | Ga0075435_100069762 | |||
| 2027 | Ga0075435_100086971 | |||
| 2028 | Ga0075435_100459165 | |||
| 2029 | Ga0099795_10003149 | |||
| 2030 | Ga0105251_10032957 | |||
| 2031 | Ga0105250_10092556 | |||
| 2032 | Ga0105240_10215689 | |||
| 2033 | Ga0105240_10230619 | |||
| 2034 | Ga0105240_10377979 | |||
| 2035 | Ga0105240_10605736 | |||
| 2036 | Ga0105240_10911785 | |||
| 2037 | Ga0111539_10002712 | |||
| 2038 | Ga0111539_10011154 | |||
| 2039 | Ga0111539_10016303 | |||
| 2040 | Ga0111539_10126058 | |||
| 2041 | Ga0111539_10379568 | |||
| 2042 | Ga0111539_10747682 | |||
| 2043 | Ga0111539_11156871 | |||
| 2044 | Ga0105245_10000380 | |||
| 2045 | Ga0105245_10006135 | |||
| 2046 | Ga0105245_10175950 | |||
| 2047 | Ga0105245_10501778 | |||
| 2048 | Ga0105247_10000149 | |||
| 2049 | Ga0105247_10065522 | |||
| 2050 | Ga0105247_10095025 | |||
| 2051 | Ga0105247_10095195 | |||
| 2052 | Ga0105247_10260251 | |||
| 2053 | Ga0105247_10494361 | |||
| 2054 | Ga0114129_10058215 | |||
| 2055 | Ga0114129_10086721 | |||
| 2056 | Ga0114129_10624243 | |||
| 2057 | Ga0114129_10900172 | |||
| 2058 | Ga0105243_10002254 | |||
| 2059 | Ga0105243_10010900 | |||
| 2060 | Ga0105243_10020668 | |||
| 2061 | Ga0105243_10109431 | |||
| 2062 | Ga0105241_10000342 | |||
| 2063 | Ga0105241_10028423 | |||
| 2064 | Ga0105241_10049537 | |||
| 2065 | Ga0105242_10000855 | |||
| 2066 | Ga0105242_10010407 | |||
| 2067 | Ga0105242_10114826 | |||
| 2068 | Ga0105242_10678911 | |||
| 2069 | Ga0105248_10012394 | |||
| 2070 | Ga0105248_10020318 | |||
| 2071 | Ga0105248_10027173 | |||
| 2072 | Ga0105248_10197918 | |||
| 2073 | Ga0105248_10227162 | |||
| 2074 | Ga0105248_10530630 | |||
| 2075 | Ga0105248_10542817 | |||
| 2076 | Ga0105248_10566771 | |||
| 2077 | Ga0105237_10007867 | |||
| 2078 | Ga0105237_10165865 | |||
| 2079 | Ga0105237_10350105 | |||
| 2080 | Ga0105237_10350974 | |||
| 2081 | Ga0105237_10677464 | |||
| 2082 | Ga0105238_10034607 | |||
| 2083 | Ga0105238_10053194 | |||
| 2084 | Ga0105238_10123478 | |||
| 2085 | Ga0105238_10161315 | |||
| 2086 | Ga0105238_10282017 | |||
| 2087 | Ga0105249_10001149 | |||
| 2088 | Ga0105249_10001982 | |||
| 2089 | Ga0105249_10019413 | |||
| 2090 | Ga0105249_10089178 | |||
| 2091 | Ga0105249_10492087 | |||
| 2092 | Ga0105249_10655476 | |||
| 2093 | Ga0105239_10009977 | |||
| 2094 | Ga0105239_10012830 | |||
| 2095 | Ga0105239_10016747 | |||
| 2096 | Ga0105239_10042492 | |||
| 2097 | Ga0105239_10128052 | |||
| 2098 | Ga0105239_10172256 | |||
| 2099 | Ga0105239_10366397 | |||
| 2100 | Ga0105239_10489591 | |||
| 2101 | Ga0105246_10000185 | |||
| 2102 | Ga0105246_10000551 | |||
| 2103 | Ga0105246_10181057 | |||
| 2104 | Ga0105246_10231406 | |||
| 2105 | Ga0157316_1005628 | |||
| 2106 | Ga0157326_1002949 | |||
| 2107 | Ga0157373_10003537 | |||
| 2108 | Ga0157373_10162794 | |||
| 2109 | Ga0157371_10003492 | |||
| 2110 | Ga0157371_10290611 | |||
| 2111 | Ga0157371_10503394 | |||
| 2112 | Ga0157370_10017515 | |||
| 2113 | Ga0157370_10156140 | |||
| 2114 | Ga0157370_10347936 | |||
| 2115 | Ga0157369_10009077 | |||
| 2116 | Ga0157369_10323622 | |||
| 2117 | Ga0157369_10433702 | |||
| 2118 | Ga0157369_11153545 | |||
| 2119 | Ga0157374_10001986 | |||
| 2120 | Ga0157374_10033399 | |||
| 2121 | Ga0157374_10393963 | |||
| 2122 | Ga0157378_10000562 | |||
| 2123 | Ga0157378_10001729 | |||
| 2124 | Ga0157378_10354418 | |||
| 2125 | Ga0157378_10645780 | |||
| 2126 | Ga0163162_10002599 | |||
| 2127 | Ga0163162_10012026 | |||
| 2128 | Ga0163162_10026532 | |||
| 2129 | Ga0163162_10057878 | |||
| 2130 | Ga0163162_11109611 | |||
| 2131 | Ga0163162_11176548 | |||
| 2132 | Ga0157372_10013072 | |||
| 2133 | Ga0157372_10024601 | |||
| 2134 | Ga0157372_10469662 | |||
| 2135 | Ga0157372_10704144 | |||
| 2136 | Ga0157372_11055238 | |||
| 2137 | Ga0157372_11545538 | |||
| 2138 | Ga0157372_11829562 | |||
| 2139 | Ga0157375_10001883 | |||
| 2140 | Ga0157375_10009804 | |||
| 2141 | Ga0157375_10735558 | |||
| 2142 | Ga0163163_10010785 | |||
| 2143 | Ga0163163_10052955 | |||
| 2144 | Ga0163163_10295679 | |||
| 2145 | Ga0163163_11087474 | |||
| 2146 | Ga0157380_10007676 | |||
| 2147 | Ga0157380_10044469 | |||
| 2148 | Ga0157380_10604439 | |||
| 2149 | Ga0182008_10339647 | |||
| 2150 | Ga0157377_10000643 | |||
| 2151 | Ga0157377_10000976 | |||
| 2152 | Ga0157377_10251475 | |||
| 2153 | Ga0157379_10001319 | |||
| 2154 | Ga0157379_10010633 | |||
| 2155 | Ga0157379_10026543 | |||
| 2156 | Ga0157379_10542342 | |||
| 2157 | Ga0157379_10721946 | |||
| 2158 | Ga0157379_10836867 | |||
| 2159 | Ga0157376_10000920 | |||
| 2160 | Ga0157376_10331481 | |||
| 2161 | Ga0157376_10821294 | |||
| 2162 | Ga0163161_10000379 | |||
| 2163 | Ga0163161_10050582 | |||
| 2164 | Ga0213872_10005036 | |||
| 2165 | Ga0213872_10019936 | |||
| 2166 | Ga0213872_10044651 | |||
| 2167 | Ga0213872_10052410 | |||
| 2168 | Ga0213872_10064084 | |||
| 2169 | Ga0213872_10191674 | |||
| 2170 | Ga0213872_10198763 | |||
| 2171 | Ga0213872_10251927 | |||
| 2172 | Ga0213876_10056342 | |||
| 2173 | Ga0213876_10235051 | |||
| 2174 | Ga0224712_10226411 | |||
| 2175 | Ga0228598_1010359 | |||
| 2176 | Ga0207666_1000046 | |||
| 2177 | Ga0207673_1000461 | |||
| 2178 | Ga0209675_1000815 | |||
| 2179 | Ga0209758_1000059 | |||
| 2180 | Ga0209050_1007717 | |||
| 2181 | Ga0209257_1002470 | |||
| 2182 | Ga0207697_10000714 | |||
| 2183 | Ga0207697_10080072 | |||
| 2184 | Ga0207697_10097630 | |||
| 2185 | Ga0207656_10152083 | |||
| 2186 | Ga0207713_1076792 | |||
| 2187 | Ga0207653_10004733 | |||
| 2188 | Ga0207653_10024086 | |||
| 2189 | Ga0207682_10000043 | |||
| 2190 | Ga0207692_10007751 | |||
| 2191 | Ga0207692_10031679 | |||
| 2192 | Ga0207692_10055266 | |||
| 2193 | Ga0207692_10109043 | |||
| 2194 | Ga0207692_10243538 | |||
| 2195 | Ga0207692_10416306 | |||
| 2196 | Ga0207642_10002212 | |||
| 2197 | Ga0207642_10179129 | |||
| 2198 | Ga0207710_10001577 | |||
| 2199 | Ga0207710_10002657 | |||
| 2200 | Ga0207710_10004284 | |||
| 2201 | Ga0207710_10019470 | |||
| 2202 | Ga0207710_10079101 | |||
| 2203 | Ga0207688_10000083 | |||
| 2204 | Ga0207688_10010182 | |||
| 2205 | Ga0207688_10036653 | |||
| 2206 | Ga0207680_10005187 | |||
| 2207 | Ga0207680_10056824 | |||
| 2208 | Ga0207647_10000860 | |||
| 2209 | Ga0207647_10025829 | |||
| 2210 | Ga0207647_10147142 | |||
| 2211 | Ga0207647_10165868 | |||
| 2212 | Ga0207685_10000556 | |||
| 2213 | Ga0207685_10015976 | |||
| 2214 | Ga0207699_10009985 | |||
| 2215 | Ga0207699_10035800 | |||
| 2216 | Ga0207699_10065818 | |||
| 2217 | Ga0207699_10335319 | |||
| 2218 | Ga0207645_10002954 | |||
| 2219 | Ga0207645_10012797 | |||
| 2220 | Ga0207645_10015101 | |||
| 2221 | Ga0207645_10160586 | |||
| 2222 | Ga0207643_10000128 | |||
| 2223 | Ga0207684_10081199 | |||
| 2224 | Ga0207654_10001559 | |||
| 2225 | Ga0207654_10022636 | |||
| 2226 | Ga0207654_10073229 | |||
| 2227 | Ga0207707_10004600 | |||
| 2228 | Ga0207707_10154688 | |||
| 2229 | Ga0207707_10165913 | |||
| 2230 | Ga0207707_10352748 | |||
| 2231 | Ga0207707_10354102 | |||
| 2232 | Ga0207695_10074493 | |||
| 2233 | Ga0207695_10302312 | |||
| 2234 | Ga0207695_10496752 | |||
| 2235 | Ga0207695_10784858 | |||
| 2236 | Ga0207671_10013743 | |||
| 2237 | Ga0207671_10097503 | |||
| 2238 | Ga0207671_10151757 | |||
| 2239 | Ga0207671_10563248 | |||
| 2240 | Ga0207693_10000529 | |||
| 2241 | Ga0207693_10008254 | |||
| 2242 | Ga0207693_10012476 | |||
| 2243 | Ga0207693_10013222 | |||
| 2244 | Ga0207693_10022622 | |||
| 2245 | Ga0207693_10116477 | |||
| 2246 | Ga0207693_10122173 | |||
| 2247 | Ga0207693_10137404 | |||
| 2248 | Ga0207693_10208215 | |||
| 2249 | Ga0207663_10009148 | |||
| 2250 | Ga0207663_10016239 | |||
| 2251 | Ga0207663_10019053 | |||
| 2252 | Ga0207663_10079527 | |||
| 2253 | Ga0207663_10396746 | |||
| 2254 | Ga0207660_10001486 | |||
| 2255 | Ga0207660_10019957 | |||
| 2256 | Ga0207660_10058413 | |||
| 2257 | Ga0207660_10317464 | |||
| 2258 | Ga0207662_10000301 | |||
| 2259 | Ga0207662_10017285 | |||
| 2260 | Ga0207662_10034661 | |||
| 2261 | Ga0207662_10347895 | |||
| 2262 | Ga0207657_10000034 | |||
| 2263 | Ga0207657_10001859 | |||
| 2264 | Ga0207657_10047359 | |||
| 2265 | Ga0207657_10107787 | |||
| 2266 | Ga0207657_10126814 | |||
| 2267 | Ga0207657_10210978 | |||
| 2268 | Ga0207657_10554621 | |||
| 2269 | Ga0207649_10003562 | |||
| 2270 | Ga0207649_10046661 | |||
| 2271 | Ga0207649_10579136 | |||
| 2272 | Ga0207652_10016674 | |||
| 2273 | Ga0207652_10016935 | |||
| 2274 | Ga0207652_10028837 | |||
| 2275 | Ga0207652_10153811 | |||
| 2276 | Ga0207652_10259840 | |||
| 2277 | Ga0207652_10425761 | |||
| 2278 | Ga0207652_10667733 | |||
| 2279 | Ga0207681_10004864 | |||
| 2280 | Ga0207681_10074552 | |||
| 2281 | Ga0207681_10184177 | |||
| 2282 | Ga0207694_10076101 | |||
| 2283 | Ga0207694_10430842 | |||
| 2284 | Ga0207694_11039257 | |||
| 2285 | Ga0207650_10019558 | |||
| 2286 | Ga0207650_10227170 | |||
| 2287 | Ga0207659_10000411 | |||
| 2288 | Ga0207659_10079974 | |||
| 2289 | Ga0207659_10508788 | |||
| 2290 | Ga0207687_10000667 | |||
| 2291 | Ga0207687_10018650 | |||
| 2292 | Ga0207687_10259128 | |||
| 2293 | Ga0207687_10371082 | |||
| 2294 | Ga0207687_10626340 | |||
| 2295 | Ga0207687_10713498 | |||
| 2296 | Ga0207700_10000412 | |||
| 2297 | Ga0207700_10040508 | |||
| 2298 | Ga0207700_10127157 | |||
| 2299 | Ga0207700_10189586 | |||
| 2300 | Ga0207700_10442670 | |||
| 2301 | Ga0207664_10050429 | |||
| 2302 | Ga0207664_10107056 | |||
| 2303 | Ga0207664_10146170 | |||
| 2304 | Ga0207664_10571302 | |||
| 2305 | Ga0207664_10663317 | |||
| 2306 | Ga0207644_10005279 | |||
| 2307 | Ga0207644_10009684 | |||
| 2308 | Ga0207644_10100107 | |||
| 2309 | Ga0207690_10002854 | |||
| 2310 | Ga0207690_10009329 | |||
| 2311 | Ga0207690_10015321 | |||
| 2312 | Ga0207690_10255426 | |||
| 2313 | Ga0207690_10632295 | |||
| 2314 | Ga0207706_10000076 | |||
| 2315 | Ga0207706_10004082 | |||
| 2316 | Ga0207706_10031063 | |||
| 2317 | Ga0207706_10581919 | |||
| 2318 | Ga0207686_10000579 | |||
| 2319 | Ga0207686_10006100 | |||
| 2320 | Ga0207686_10028646 | |||
| 2321 | Ga0207686_10033530 | |||
| 2322 | Ga0207709_10000551 | |||
| 2323 | Ga0207709_10183425 | |||
| 2324 | Ga0207670_10000556 | |||
| 2325 | Ga0207670_10087654 | |||
| 2326 | Ga0207670_10503842 | |||
| 2327 | Ga0207669_10000675 | |||
| 2328 | Ga0207669_10005589 | |||
| 2329 | Ga0207669_10015571 | |||
| 2330 | Ga0207704_10002887 | |||
| 2331 | Ga0207704_10052578 | |||
| 2332 | Ga0207704_10109694 | |||
| 2333 | Ga0207704_10147674 | |||
| 2334 | Ga0207665_10004186 | |||
| 2335 | Ga0207665_10014619 | |||
| 2336 | Ga0207665_10628799 | |||
| 2337 | Ga0207691_10000599 | |||
| 2338 | Ga0207691_10001503 | |||
| 2339 | Ga0207691_10063150 | |||
| 2340 | Ga0207691_10118905 | |||
| 2341 | Ga0207691_10191152 | |||
| 2342 | Ga0207711_10010308 | |||
| 2343 | Ga0207711_10073399 | |||
| 2344 | Ga0207711_10102849 | |||
| 2345 | Ga0207711_10312423 | |||
| 2346 | Ga0207711_10597243 | |||
| 2347 | Ga0207711_10612320 | |||
| 2348 | Ga0207689_10000165 | |||
| 2349 | Ga0207689_10510297 | |||
| 2350 | Ga0207661_10008897 | |||
| 2351 | Ga0207661_10390719 | |||
| 2352 | Ga0207661_10445194 | |||
| 2353 | Ga0207661_10573814 | |||
| 2354 | Ga0207679_10000112 | |||
| 2355 | Ga0207679_10022367 | |||
| 2356 | Ga0207679_10044874 | |||
| 2357 | Ga0207679_10235269 | |||
| 2358 | Ga0207679_10508258 | |||
| 2359 | Ga0207679_10593120 | |||
| 2360 | Ga0207667_10017788 | |||
| 2361 | Ga0207667_10038289 | |||
| 2362 | Ga0207667_10039284 | |||
| 2363 | Ga0207651_10000099 | |||
| 2364 | Ga0207651_10006660 | |||
| 2365 | Ga0207651_10938824 | |||
| 2366 | Ga0207712_10001637 | |||
| 2367 | Ga0207712_10019595 | |||
| 2368 | Ga0207712_10267370 | |||
| 2369 | Ga0207712_10548364 | |||
| 2370 | Ga0207668_10000608 | |||
| 2371 | Ga0207668_10000713 | |||
| 2372 | Ga0207668_10105270 | |||
| 2373 | Ga0207668_10239295 | |||
| 2374 | Ga0207668_10339214 | |||
| 2375 | Ga0207668_10684886 | |||
| 2376 | Ga0207668_10757489 | |||
| 2377 | Ga0207640_10002957 | |||
| 2378 | Ga0207640_10015077 | |||
| 2379 | Ga0207640_10119188 | |||
| 2380 | Ga0207640_11345309 | |||
| 2381 | Ga0207658_10003702 | |||
| 2382 | Ga0207658_10007098 | |||
| 2383 | Ga0207658_10067675 | |||
| 2384 | Ga0207658_10441690 | |||
| 2385 | Ga0207677_10010465 | |||
| 2386 | Ga0207677_10189705 | |||
| 2387 | Ga0207703_10018016 | |||
| 2388 | Ga0207703_10058062 | |||
| 2389 | Ga0207703_10177919 | |||
| 2390 | Ga0207639_10002883 | |||
| 2391 | Ga0207639_10040112 | |||
| 2392 | Ga0207639_10054896 | |||
| 2393 | Ga0207639_11049938 | |||
| 2394 | Ga0207678_10000036 | |||
| 2395 | Ga0207678_10001329 | |||
| 2396 | Ga0207678_10029433 | |||
| 2397 | Ga0207678_10036192 | |||
| 2398 | Ga0207708_10000862 | |||
| 2399 | Ga0207708_10002574 | |||
| 2400 | Ga0207708_10019839 | |||
| 2401 | Ga0207702_10007796 | |||
| 2402 | Ga0207702_10014330 | |||
| 2403 | Ga0207702_10148575 | |||
| 2404 | Ga0207702_10307944 | |||
| 2405 | Ga0207641_10001462 | |||
| 2406 | Ga0207648_10001891 | |||
| 2407 | Ga0207648_10071963 | |||
| 2408 | Ga0207648_10081422 | |||
| 2409 | Ga0207648_10287023 | |||
| 2410 | Ga0207648_10288236 | |||
| 2411 | Ga0207676_10001459 | |||
| 2412 | Ga0207676_10051116 | |||
| 2413 | Ga0207676_10136555 | |||
| 2414 | Ga0207674_10006899 | |||
| 2415 | Ga0207674_10010119 | |||
| 2416 | Ga0207674_10212794 | |||
| 2417 | Ga0207675_100000970 | |||
| 2418 | Ga0207675_100001575 | |||
| 2419 | Ga0207675_100040944 | |||
| 2420 | Ga0207675_100111099 | |||
| 2421 | Ga0207675_100171943 | |||
| 2422 | Ga0207683_10000015 | |||
| 2423 | Ga0207683_10001273 | |||
| 2424 | Ga0207683_10004182 | |||
| 2425 | Ga0207683_10026331 | |||
| 2426 | Ga0207698_10006111 | |||
| 2427 | Ga0207698_10133389 | |||
| 2428 | Ga0207698_10428258 | |||
| 2429 | Ga0209967_1010797 | |||
| 2430 | Ga0210002_1002548 | |||
| 2431 | Ga0209966_1007471 | |||
| 2432 | Ga0209998_10008713 | |||
| 2433 | Ga0209998_10009907 | |||
| 2434 | Ga0209998_10012414 | |||
| 2435 | Ga0209813_10091554 | |||
| 2436 | Ga0209974_10020171 | |||
| 2437 | Ga0209974_10037821 | |||
| 2438 | Ga0209974_10101701 | |||
| 2439 | Ga0209974_10183133 | |||
| 2440 | Ga0207428_10000064 | |||
| 2441 | Ga0207428_10000242 | |||
| 2442 | Ga0207428_10003078 | |||
| 2443 | Ga0207428_10006523 | |||
| 2444 | Ga0207428_10018880 | |||
| 2445 | Ga0207428_10116694 | |||
| 2446 | Ga0207428_10393931 | |||
| 2447 | Ga0268266_10010320 | |||
| 2448 | Ga0268266_10052520 | |||
| 2449 | Ga0268266_10279011 | |||
| 2450 | Ga0268266_10366594 | |||
| 2451 | Ga0268265_10003386 | |||
| 2452 | Ga0268265_10017919 | |||
| 2453 | Ga0268265_10064227 | |||
| 2454 | Ga0268265_10149253 | |||
| 2455 | Ga0268265_10312259 | |||
| 2456 | Ga0268265_10540866 | |||
| 2457 | Ga0268264_10003086 | |||
| 2458 | Ga0268264_10029045 | |||
| 2459 | Ga0268264_10385373 | |||
| 2460 | Ga0265337_1001177 | |||
| 2461 | Ga0307517_10170521 | |||
| 2462 | Ga0307515_10399551 | |||
| 2463 | Ga0265338_10258059 | |||
| 2464 | Ga0265338_10495578 | |||
| 2465 | Ga0307512_10153748 | |||
| 2466 | Ga0265332_10121148 | |||
| 2467 | Ga0265325_10000006 | |||
| 2468 | Ga0265325_10004786 | |||
| 2469 | Ga0265325_10046663 | |||
| 2470 | Ga0265340_10125513 | |||
| 2471 | Ga0265339_10004854 | |||
| 2472 | Ga0265339_10120475 | |||
| 2473 | Ga0265331_10001499 | |||
| 2474 | Ga0265331_10028325 | |||
| 2475 | Ga0265331_10115002 | |||
| 2476 | Ga0265316_10085349 | |||
| 2477 | Ga0265316_10238217 | |||
| 2478 | Ga0307513_10110818 | |||
| 2479 | Ga0307513_10377135 | |||
| 2480 | Ga0265313_10000607 | |||
| 2481 | Ga0265313_10001122 | |||
| 2482 | Ga0265313_10004369 | |||
| 2483 | Ga0265313_10004848 | |||
| 2484 | Ga0265313_10005418 | |||
| 2485 | Ga0265313_10009773 | |||
| 2486 | Ga0265313_10018409 | |||
| 2487 | Ga0265313_10031666 | |||
| 2488 | Ga0265313_10139042 | |||
| 2489 | Ga0307508_10416473 | |||
| 2490 | Ga0316579_10058416 | |||
| 2491 | Ga0265314_10001736 | |||
| 2492 | Ga0265314_10017596 | |||
| 2493 | Ga0265314_10276337 | |||
| 2494 | Ga0265342_10001631 | |||
| 2495 | Ga0307516_10105803 | |||
| 2496 | Ga0307405_10118164 | |||
| 2497 | Ga0307405_10121183 | |||
| 2498 | Ga0307413_10009874 | |||
| 2499 | Ga0307413_10009990 | |||
| 2500 | Ga0307410_10043510 | |||
| 2501 | Ga0307410_10242584 | |||
| 2502 | Ga0307409_100061798 | |||
| 2503 | Ga0307409_100240162 | |||
| 2504 | Ga0307416_100294688 | |||
| 2505 | Ga0307414_10015861 | |||
| 2506 | Ga0307414_10249203 | |||
| 2507 | Ga0316583_10027901 | |||
| 2508 | Ga0373930_0065650 | |||
| 2509 | Ga0373948_0002551 | |||
| 2510 | Ga0373948_0008375 | |||
| 2511 | Ga0373950_0000575 | |||
| 2512 | Ga0373950_0032149 | |||
| 2513 | Ga0373958_0002130 | |||
| 2514 | Ga0373958_0002762 | |||
| 2515 | Ga0373958_0005151 | |||
| 2516 | Ga0373958_0050053 | |||
| 2517 | Ga0373959_0001506 | |||
| 2518 | Ga0373959_0014183 | |||
| 2519 | Ga0373938_0000276 | |||
| 2520 | Ga0373938_0027355 | |||
| 2521 | Ga0373926_0010141 | |||
| 2522 | Ga0373928_0000820 | |||
| 2523 | Ga0373929_0000359 | |||
| 2524 | Ga0373934_0023173 | |||
| 2525 | Ga0373934_0179501 | |||
| 2526 | Ga0373940_0000049 | |||
| 2527 | Ga0373944_0006580 | |||
| 2528 | Ga0373949_0001191 | |||
| 2529 | Ga0373949_0002203 | |||
| 2530 | Ga0373949_0007218 | |||
| 2531 | Ga0373949_0013764 | |||
| 2532 | Ga0373949_0037096 | |||
| 2533 | Ga0373951_0000518 | |||
| 2534 | Ga0373951_0022569 | |||
| 2535 | Ga0373951_0039210 | |||
| 2536 | Ga0373952_0000453 | |||
| 2537 | Ga0373952_0000483 | |||
| 2538 | Ga0373923_0001175 | |||
| 2539 | Ga0373923_0068057 | |||
| 2540 | Ga0373923_0071871 | |||
| 2541 | Ga0373923_0215839 | |||
| 2542 | Ga0373932_0000462 | |||
| 2543 | Ga0373932_0002820 | |||
| 2544 | Ga0373932_0027182 | |||
| 2545 | Ga0373936_0000328 | |||
| 2546 | Ga0373939_0001076 | |||
| 2547 | Ga0373939_0003300 | |||
| 2548 | Ga0373939_0071596 | |||
| 2549 | Ga0373941_0000219 | |||
| 2550 | Ga0373941_0001129 | |||
| 2551 | Ga0373941_0048238 | |||
| 2552 | Ga0373945_0000123 | |||
| 2553 | Ga0373954_0012572 | |||
| 2554 | Ga0373954_0026139 | |||
| 2555 | Ga0373954_0161299 | |||
| 2556 | Ga0373956_0045117 | |||
| 2557 | Ga0373956_0048847 | |||
| 2558 | Ga0373956_0094785 | |||
| 2559 | Ga0373957_0002486 | |||
| 2560 | Ga0373957_0004774 | |||
| 2561 | Ga0373957_0032381 | |||
| 2562 | Ga0373957_0047990 | |||
| 2563 | Ga0373957_0124575 | |||
| 2564 | Ga0373960_0001504 | |||
| 2565 | Ga0373960_0013304 | |||
| 2566 | Ga0373960_0046765 | |||
| 2567 | Ga0373943_0001821 | |||
| 2568 | Ga0373943_0028120 | |||
| 2569 | Ga0373946_0003579 | |||
| 2570 | Ga0373946_0006894 | |||
| 2571 | Ga0373946_0018373 | |||
| 2572 | Ga0373946_0029864 | |||
| 2573 | Ga0373955_0001781 | |||
| 2574 | Ga0373955_0003764 | |||
| 2575 | Ga0373955_0053359 | |||
| 2576 | Ga0373955_0140688 | |||
| 2577 | Ga0373942_0004252 | |||
| 2578 | Ga0373942_0012705 | |||
| 2579 | Ga0373942_0023528 | |||
| 2580 | Ga0373961_0013321 | |||
| 2581 | Ga0373961_0019442 | |||
| 2582 | Ga0373962_0000215 | |||
| 2583 | Ga0373962_0001429 | |||
| 2584 | Ga0373962_0002252 | |||
| 2585 | Ga0373962_0006643 | |||
| 2586 | Ga0373962_0041030 | |||
| 2587 | Ga0316574_0536579 | |||
| 2588 | Ga0373924_0005980 | |||
| 2589 | Ga0373924_0024323 | |||
| 2590 | Ga0373931_0004700 | |||
| 2591 | Ga0373931_0006133 | |||
| 2592 | Ga0373931_0006569 | |||
| 2593 | Ga0373931_0014856 | |||
| 2594 | Ga0373931_0021068 | |||
| 2595 | Ga0373931_0047512 | |||
| 2596 | Ga0373931_0047908 | |||
| 2597 | Ga0373931_0118356 | |||
| 2598 | Ga0373931_0149622 | |||
| 2599 | Ga0373935_0008365 | |||
| 2600 | Ga0373935_0010930 | |||
| 2601 | Ga0373935_0136849 | |||
| 2602 | Ga0373935_0243858 | |||
| 2603 | Ga0373927_0002377 | |||
| 2604 | Ga0373927_0009145 | |||
| 2605 | Ga0373927_0059332 | |||
| 2606 | Ga0373927_0159507 | |||
| 2607 | Ga0373927_0303532 | |||
| 2608 | Ga0373933_0003512 | |||
| 2609 | Ga0373933_0005999 | |||
| 2610 | Ga0373933_0014137 | |||
| 2611 | Ga0373933_0133774 | |||
| 2612 | Ga0373933_0436573 | |||
| 2613 | Ga0373947_0002454 | |||
| 2614 | Ga0373947_0003283 | |||
| 2615 | Ga0373947_0005390 | |||
| 2616 | Ga0373947_0028558 | |||
| 2617 | Ga0373947_0155628 | |||
| 2618 | Ga0373937_0000977 | |||
| 2619 | Ga0373937_0000998 | |||
| 2620 | Ga0373937_0011819 | |||
| 2621 | Ga0373937_0013390 | |||
| 2622 | Ga0373937_0067460 | |||
| 2623 | Ga0373937_0076111 | |||
| 2624 | Ga0373937_0090816 | |||
| 2625 | Ga0373937_0145830 | |||
| 2626 | Ga0373937_0204092 | |||
| 2627 | Ga0373937_0512692 | |||
| 2628 | Ga0373937_0612640 | |||
| 2629 | Ga0373937_0686032 | |||
| 2630 | Ga0373925_0002457 | |||
| 2631 | Ga0373925_0005022 | |||
| 2632 | Ga0373925_0027418 | |||
| 2633 | Ga0373925_0109865 | |||
| 2634 | Ga0373925_0240585 | |||
| 2635 | Ga0395899_0057420 | |||
| 2636 | Ga0395899_0146243 | |||
| 2637 | Ga0395900_0017768 | |||
| 2638 | Ga0395900_0019767 | |||
| 2639 | Ga0395900_0086905 | |||
| 2640 | Ga0395900_0634675 | |||
| 2641 | Ga0395898_0019586 | |||
| 2642 | Ga0395898_0047491 | |||
| 2643 | Ga0395898_0054044 | |||
| 2644 | Ga0395898_0081580 | |||
| 2645 | Ga0395905_0002014 | |||
| 2646 | Ga0436364_1021069 | |||
| 2647 | Ga0395901_0003370 | |||
| 2648 | Ga0395901_0029286 | |||
| 2649 | Ga0395901_0145242 | |||
| 2650 | Ga0395901_1384808 | |||
| 2651 | Ga0242420_022331 | |||
| 2652 | Ga0436365_0648744 | |||
| 2653 | Ga0436365_1068563 | |||
| 2654 | Ga0436365_1158499 | |||
| 2655 | Ga0436361_0024076 | |||
| 2656 | Ga0436361_0120642 | |||
| 2657 | Ga0436361_0125156 | |||
| 2658 | Ga0436361_0244861 | |||
| 2659 | Ga0436361_0294175 | |||
| 2660 | Ga0436361_0407501 | |||
| 2661 | Ga0436361_0484050 | |||
| 2662 | Ga0436361_0724345 | |||
| 2663 | Ga0436361_0795199 | |||
| 2664 | Ga0436361_1098427 | |||
| 2665 | Ga0436363_0925274 | |||
| 2666 | Ga0436363_1200294 | |||
| 2667 | Ga0436362_1126626 | |||
| 2668 | Ga0439443_016357 | |||
| 2669 | Ga0439448_0056871 | |||
| 2670 | Ga0451577_0110442 | |||
| 2671 | Ga0451577_0614127 | |||
| 2672 | Ga0466969_0000193 | |||
| 2673 | Ga0466966_0009486 | |||
| 2674 | Ga0466966_0069666 | |||
| 2675 | Ga0466961_0009053 | |||
| 2676 | Ga0466963_0025049 | |||
| 2677 | Ga0466963_0244355 | |||
| 2678 | Ga0466964_0163124 | |||
| 2679 | Ga0453684_0010839 | |||
| 2680 | Ga0453684_0198644 | |||
| 2681 | Ga0453684_0469786 | |||
| 2682 | Ga0466971_0092771 | |||
| 2683 | Ga0466968_0369160 | |||
| 2684 | Ga0466970_0004501 | |||
| 2685 | Ga0466957_0118503 | |||
| 2686 | Ga0466957_0455909 | |||
| 2687 | Ga0466959_0000118 | |||
| 2688 | Ga0451576_0105771 | |||
| 2689 | Ga0451576_1698745 | |||
| 2690 | Ga0466958_0000804 | |||
| 2691 | Ga0466958_0049465 | |||
| 2692 | Ga0466958_0407568 | |||
| 2693 | Ga0466958_0532629 | |||
| 2694 | Ga0466967_0002046 | |||
| 2695 | Ga0466967_0071094 | |||
| 2696 | Ga0466967_0534660 | |||
| 2697 | Ga0466967_0617482 | |||
| 2698 | Ga0495617_119755 | |||
| 2699 | Ga0495592_0002187 | |||
| 2700 | Ga0495592_0003145 | |||
| 2701 | Ga0495592_0011852 | |||
| 2702 | Ga0495592_0153609 | |||
| 2703 | Ga0495603_0000127 | |||
| 2704 | Ga0495603_0006157 | |||
| 2705 | Ga0495603_0010152 | |||
| 2706 | Ga0495603_0011477 | |||
| 2707 | Ga0495629_0000474 | |||
| 2708 | Ga0495629_0001081 | |||
| 2709 | Ga0495629_0001491 | |||
| 2710 | Ga0495629_0037772 | |||
| 2711 | Ga0495629_0095292 | |||
| 2712 | Ga0495638_0252564 | |||
| 2713 | Ga0495641_0000716 | |||
| 2714 | Ga0495641_0069602 | |||
| 2715 | Ga0495651_0001830 | |||
| 2716 | Ga0495651_0063498 | |||
| 2717 | Ga0495651_0206807 | |||
| 2718 | Ga0495653_0001477 | |||
| 2719 | Ga0495653_0002011 | |||
| 2720 | Ga0495653_0101812 | |||
| 2721 | Ga0495653_0277799 | |||
| 2722 | Ga0495580_0000533 | |||
| 2723 | Ga0495580_0001373 | |||
| 2724 | Ga0495580_0029341 | |||
| 2725 | Ga0495582_0000310 | |||
| 2726 | Ga0495582_0001241 | |||
| 2727 | Ga0495582_0131370 | |||
| 2728 | Ga0495605_0061919 | |||
| 2729 | Ga0495605_0133320 | |||
| 2730 | Ga0495639_0000593 | |||
| 2731 | Ga0495639_0000991 | |||
| 2732 | Ga0495639_0005266 | |||
| 2733 | Ga0495662_0000599 | |||
| 2734 | Ga0495664_0001780 | |||
| 2735 | Ga0495664_0008385 | |||
| 2736 | Ga0495664_0089917 | |||
| 2737 | Ga0495664_0120397 | |||
| 2738 | Ga0495584_0019476 | |||
| 2739 | Ga0495585_0012307 | |||
| 2740 | Ga0495594_0000972 | |||
| 2741 | Ga0495594_0004519 | |||
| 2742 | Ga0495594_0023664 | |||
| 2743 | Ga0495594_0282116 | |||
| 2744 | Ga0495608_0000844 | |||
| 2745 | Ga0495608_0029605 | |||
| 2746 | Ga0495608_0035340 | |||
| 2747 | Ga0495618_0003351 | |||
| 2748 | Ga0495618_0006349 | |||
| 2749 | Ga0495618_0010591 | |||
| 2750 | Ga0495618_0112356 | |||
| 2751 | Ga0495628_0017046 | |||
| 2752 | Ga0495628_0022156 | |||
| 2753 | Ga0495628_0079335 | |||
| 2754 | Ga0495628_0201198 | |||
| 2755 | Ga0495630_0031825 | |||
| 2756 | Ga0495637_0131902 | |||
| 2757 | Ga0495644_0001924 | |||
| 2758 | Ga0495666_0005432 | |||
| 2759 | Ga0495666_0020312 | |||
| 2760 | Ga0495666_0164387 | |||
| 2761 | Ga0495652_0001947 | |||
| 2762 | Ga0495652_0003249 | |||
| 2763 | Ga0495652_0012241 | |||
| 2764 | Ga0495652_0026434 | |||
| 2765 | Ga0495665_0000185 | |||
| 2766 | Ga0495665_0007528 | |||
| 2767 | Ga0495665_0009023 | |||
| 2768 | Ga0495640_0006612 | |||
| 2769 | Ga0495640_0006875 | |||
| 2770 | Ga0495640_0149666 | |||
| 2771 | Ga0495640_0207370 | |||
| 2772 | Ga0495640_0404409 | |||
| 2773 | Ga0495586_0003393 | |||
| 2774 | Ga0495586_0028093 | |||
| 2775 | Ga0495587_0000732 | |||
| 2776 | Ga0495587_0011211 | |||
| 2777 | Ga0495587_0017113 | |||
| 2778 | Ga0495609_0106058 | |||
| 2779 | Ga0495621_0033590 | |||
| 2780 | Ga0495645_0003961 | |||
| 2781 | Ga0495622_0001379 | |||
| 2782 | Ga0495622_0028177 | |||
| 2783 | Ga0495622_0155688 | |||
| 2784 | Ga0495633_0004731 | |||
| 2785 | Ga0495633_0253866 | |||
| 2786 | Ga0495633_0254472 | |||
| 2787 | Ga0495667_0002039 | |||
| 2788 | Ga0495667_0002260 | |||
| 2789 | Ga0495667_0007395 | |||
| 2790 | Ga0495667_0008839 | |||
| 2791 | Ga0495667_0076054 | |||
| 2792 | Ga0495667_0403086 | |||
| 2793 | Ga0495656_0000505 | |||
| 2794 | Ga0495656_0104372 | |||
| 2795 | Ga0495634_0005916 | |||
| 2796 | Ga0495634_0006195 | |||
| 2797 | Ga0495634_0027885 | |||
| 2798 | Ga0495634_0047227 | |||
| 2799 | Ga0495634_0136594 | |||
| 2800 | Ga0495611_0018877 | |||
| 2801 | Ga0495625_0308326 | |||
| 2802 | Ga0495635_0002667 | |||
| 2803 | Ga0495635_0008996 | |||
| 2804 | Ga0495635_0018383 | |||
| 2805 | Ga0495635_0035752 | |||
| 2806 | Ga0495659_0000862 | |||
| 2807 | Ga0495659_0114240 | |||
| 2808 | Ga0495588_0000855 | |||
| 2809 | Ga0495588_0006169 | |||
| 2810 | Ga0495588_0042747 | |||
| 2811 | Ga0495657_0019080 | |||
| 2812 | Ga0495657_0061658 | |||
| 2813 | Ga0495599_0013241 | |||
| 2814 | Ga0495599_0037130 | |||
| 2815 | Ga0495599_0052645 | |||
| 2816 | Ga0495599_0114342 | |||
| 2817 | Ga0495623_0003160 | |||
| 2818 | Ga0495623_0040188 | |||
| 2819 | Ga0495623_0078630 | |||
| 2820 | Ga0495646_0000681 | |||
| 2821 | Ga0495646_0009918 | |||
| 2822 | Ga0495646_0109730 | |||
| 2823 | Ga0495647_0006977 | |||
| 2824 | Ga0495647_0010913 | |||
| 2825 | Ga0495647_0016276 | |||
| 2826 | Ga0495658_0000453 | |||
| 2827 | Ga0495658_0000640 | |||
| 2828 | Ga0495658_0003124 | |||
| 2829 | Ga0495658_0011916 | |||
| 2830 | Ga0495658_0146918 | |||
| 2831 | Ga0495669_0000388 | |||
| 2832 | Ga0495613_0000450 | |||
| 2833 | Ga0495613_0005450 | |||
| 2834 | Ga0495613_0010177 | |||
| 2835 | Ga0495613_0059445 | |||
| 2836 | Ga0495624_0000990 | |||
| 2837 | Ga0495624_0285763 | |||
| 2838 | Ga0495670_0014504 | |||
| 2839 | Ga0495649_0168837 | |||
| 2840 | Ga0495600_0000326 | |||
| 2841 | Ga0495600_0055531 | |||
| 2842 | Ga0495600_0058587 | |||
| 2843 | Ga0495600_0088439 | |||
| 2844 | Ga0495581_0000462 | |||
| 2845 | Ga0495581_0010642 | |||
| 2846 | Ga0495604_0000643 | |||
| 2847 | Ga0495604_0002511 | |||
| 2848 | Ga0495604_0009753 | |||
| 2849 | Ga0495604_0050376 | |||
| 2850 | Ga0495604_0310948 | |||
| 2851 | Ga0495604_0321008 | |||
| 2852 | Ga0495674_0003479 | |||
| 2853 | Ga0495674_0008425 | |||
| 2854 | Ga0495674_0027234 | |||
| 2855 | Ga0495674_0039411 | |||
| 2856 | Ga0495674_0064848 | |||
| 2857 | Ga0495674_0231509 | |||
| 2858 | Ga0495674_0358057 | |||
| 2859 | Ga0495676_0003716 | |||
| 2860 | Ga0495676_0017497 | |||
| 2861 | Ga0495676_0054793 | |||
| 2862 | Ga0495680_0001401 | |||
| 2863 | Ga0495680_0006685 | |||
| 2864 | Ga0495680_0006889 | |||
| 2865 | Ga0495680_0012123 | |||
| 2866 | Ga0495680_0012637 | |||
| 2867 | Ga0495680_0086555 | |||
| 2868 | Ga0495680_0286359 | |||
| 2869 | Ga0495680_0350701 | |||
| 2870 | Ga0495675_0005017 | |||
| 2871 | Ga0495675_0033575 | |||
| 2872 | Ga0495679_013128 | |||
| 2873 | Ga0495684_0020107 | |||
| 2874 | Ga0495684_0042671 | |||
| 2875 | Ga0495684_0052577 | |||
| 2876 | Ga0495593_0000730 | |||
| 2877 | Ga0495593_0002845 | |||
| 2878 | Ga0495593_0010817 | |||
| 2879 | Ga0495593_0191604 | |||
| 2880 | Ga0495602_0003673 | |||
| 2881 | Ga0495602_0005637 | |||
| 2882 | Ga0495602_0010516 | |||
| 2883 | Ga0495602_0075932 | |||
| 2884 | Ga0495602_0175882 | |||
| 2885 | Ga0495614_0021658 | |||
| 2886 | Ga0495614_0131372 | |||
| 2887 | Ga0496100_0001758 | |||
| 2888 | Ga0496100_0003708 | |||
| 2889 | Ga0496100_0076198 | |||
| 2890 | Ga0496100_0158496 | |||
| 2891 | Ga0496100_0569101 | |||
| 2892 | Ga0496100_0579935 | |||
| 2893 | Ga0496101_0012951 | |||
| 2894 | Ga0496101_0074915 | |||
| 2895 | Ga0496101_0310860 | |||
| 2896 | Ga0496102_0002938 | |||
| 2897 | Ga0496102_0011898 | |||
| 2898 | Ga0496102_0060150 | |||
| 2899 | Ga0496102_0284822 | |||
| 2900 | Ga0496102_0332539 | |||
| 2901 | Ga0496102_0503010 | |||
| 2902 | Ga0496102_0641472 | |||
| 2903 | Ga0496102_0750684 | |||
| 2904 | Ga0496102_0750689 | |||
| 2905 | Ga0496102_0890921 | |||
| 2906 | Ga0496103_0003026 | |||
| 2907 | Ga0496103_0013998 | |||
| 2908 | Ga0496103_0040060 | |||
| 2909 | Ga0496103_0042071 | |||
| 2910 | Ga0496103_0163846 | |||
| 2911 | Ga0496104_0000146 | |||
| 2912 | Ga0496104_0000741 | |||
| 2913 | Ga0496104_0002220 | |||
| 2914 | Ga0496104_0003698 | |||
| 2915 | Ga0496104_0079305 | |||
| 2916 | Ga0496104_0150014 | |||
| 2917 | Ga0496104_0159085 | |||
| 2918 | Ga0496104_0194289 | |||
| 2919 | Ga0496104_0342230 | |||
| 2920 | Ga0496104_0424694 | |||
| 2921 | Ga0496104_0747876 | |||
| 2922 | Ga0496105_0000025 | |||
| 2923 | Ga0496105_0011046 | |||
| 2924 | Ga0496105_0011482 | |||
| 2925 | Ga0496105_0019370 | |||
| 2926 | Ga0496105_0033779 | |||
| 2927 | Ga0496105_0096191 | |||
| 2928 | Ga0496105_0116549 | |||
| 2929 | Ga0496105_0195977 | |||
| 2930 | Ga0496105_0505203 | |||
| 2931 | Ga0496106_0009990 | |||
| 2932 | Ga0496106_0012004 | |||
| 2933 | Ga0496106_0037988 | |||
| 2934 | Ga0496106_0042813 | |||
| 2935 | Ga0496106_0062646 | |||
| 2936 | Ga0496106_0088279 | |||
| 2937 | Ga0496106_0184538 | |||
| 2938 | Ga0496106_0195793 | |||
| 2939 | Ga0496107_0014021 | |||
| 2940 | Ga0496107_0015547 | |||
| 2941 | Ga0496107_0039322 | |||
| 2942 | Ga0496107_0054442 | |||
| 2943 | Ga0496107_0071713 | |||
| 2944 | Ga0496107_0104657 | |||
| 2945 | Ga0496107_0509455 | |||
| 2946 | Ga0496108_0007653 | |||
| 2947 | Ga0496108_0023258 | |||
| 2948 | Ga0496108_0078821 | |||
| 2949 | Ga0496108_0092967 | |||
| 2950 | Ga0496108_0241538 | |||
| 2951 | Ga0496108_0322150 | |||
| 2952 | Ga0496108_0426455 | |||
| 2953 | Ga0496109_0000526 | |||
| 2954 | Ga0496109_0064201 | |||
| 2955 | Ga0496109_0079373 | |||
| 2956 | Ga0496109_0264545 | |||
| 2957 | Ga0496109_0288539 | |||
| 2958 | Ga0496109_0421351 | |||
| 2959 | Ga0496109_0845297 | |||
| 2960 | Ga0496110_0011465 | |||
| 2961 | Ga0496110_0079401 | |||
| 2962 | Ga0496110_0080027 | |||
| 2963 | Ga0496110_0283477 | |||
| 2964 | Ga0496110_0416662 | |||
| 2965 | Ga0496110_0843190 | |||
| 2966 | Ga0496111_0010814 | |||
| 2967 | Ga0496111_0030122 | |||
| 2968 | Ga0496111_0033387 | |||
| 2969 | Ga0496111_0049275 | |||
| 2970 | Ga0496111_0114400 | |||
| 2971 | Ga0496111_0199372 | |||
| 2972 | Ga0496111_0356989 | |||
| 2973 | Ga0496112_0001549 | |||
| 2974 | Ga0496112_0005706 | |||
| 2975 | Ga0496112_0084195 | |||
| 2976 | Ga0496112_0200372 | |||
| 2977 | Ga0496112_0209448 | |||
| 2978 | Ga0496112_0250174 | |||
| 2979 | Ga0496112_0382401 | |||
| 2980 | Ga0496112_0777462 | |||
| 2981 | Ga0496112_0868395 | |||
| 2982 | Ga0496113_0001026 | |||
| 2983 | Ga0496113_0005648 | |||
| 2984 | Ga0496113_0008212 | |||
| 2985 | Ga0496113_0041681 | |||
| 2986 | Ga0496113_0075727 | |||
| 2987 | Ga0496113_0088268 | |||
| 2988 | Ga0496113_0130021 | |||
| 2989 | Ga0496113_0184655 | |||
| 2990 | Ga0496113_0294641 | |||
| 2991 | Ga0496114_0018559 | |||
| 2992 | Ga0496114_0019225 | |||
| 2993 | Ga0496114_0023712 | |||
| 2994 | Ga0496114_0027954 | |||
| 2995 | Ga0496114_0034001 | |||
| 2996 | Ga0496114_0060267 | |||
| 2997 | Ga0496114_0281421 | |||
| 2998 | Ga0496114_0611005 | |||
| 2999 | Ga0496115_0008590 | |||
| 3000 | Ga0496115_0019401 | |||
| 3001 | Ga0496115_0080857 | |||
| 3002 | Ga0496115_0205546 | |||
| 3003 | Ga0496115_0258376 | |||
| 3004 | Ga0496115_0267331 | |||
| 3005 | Ga0496115_0470901 | |||
| 3006 | Ga0496115_0599936 | |||
| 3007 | Ga0496119_0003812 | |||
| 3008 | Ga0496119_0312295 | |||
| 3009 | Ga0496124_0417189 | |||
| 3010 | Ga0496125_0003219 | |||
| 3011 | Ga0496125_0152138 | |||
| 3012 | Ga0501031_0068303 | |||
| 3013 | Ga0501031_0147447 | |||
| 3014 | Ga0501031_0173204 | |||
| 3015 | Ga0501031_0186891 | |||
| 3016 | Ga0501032_0000951 | |||
| 3017 | Ga0501032_0416689 | |||
| 3018 | Ga0501033_0007292 | |||
| 3019 | Ga0501033_0144107 | |||
| 3020 | Ga0501033_0467263 | |||
| 3021 | Ga0501034_0014184 | |||
| 3022 | Ga0501034_0093404 | |||
| 3023 | Ga0501034_0154152 | |||
| 3024 | Ga0501034_0161437 | |||
| 3025 | Ga0501034_0328195 | |||
| 3026 | Ga0501034_0487547 | |||
| 3027 | Ga0501036_0002920 | |||
| 3028 | Ga0501036_0067554 | |||
| 3029 | Ga0501036_0596101 | |||
| 3030 | Ga0501036_1012189 | |||
| 3031 | Ga0501037_0037819 | |||
| 3032 | Ga0501037_0083705 | |||
| 3033 | Ga0501037_0121788 | |||
| 3034 | Ga0501038_0000730 | |||
| 3035 | Ga0501038_0053534 | |||
| 3036 | Ga0501038_0265785 | |||
| 3037 | Ga0501038_0456075 | |||
| 3038 | Ga0501039_0027260 | |||
| 3039 | Ga0501039_0034671 | |||
| 3040 | Ga0501039_0114603 | |||
| 3041 | Ga0501039_0179388 | |||
| 3042 | Ga0501039_0509014 | |||
| 3043 | Ga0501040_0006194 | |||
| 3044 | Ga0501040_0012426 | |||
| 3045 | Ga0501040_0020813 | |||
| 3046 | Ga0501040_0186223 | |||
| 3047 | Ga0501040_0318711 | |||
| 3048 | Ga0501041_0049033 | |||
| 3049 | Ga0501041_0185798 | |||
| 3050 | Ga0501041_0213212 | |||
| 3051 | Ga0501041_0517895 | |||
| 3052 | Ga0501042_0104841 | |||
| 3053 | Ga0501042_0377546 | |||
| 3054 | Ga0501042_0517420 | |||
| 3055 | Ga0501043_0002840 | |||
| 3056 | Ga0501043_0029899 | |||
| 3057 | Ga0501043_0047395 | |||
| 3058 | Ga0501043_0093205 | |||
| 3059 | Ga0501043_0328648 | |||
| 3060 | Ga0501043_0473058 | |||
| 3061 | Ga0501046_0008883 | |||
| 3062 | Ga0501046_0071471 | |||
| 3063 | Ga0501046_0214783 | |||
| 3064 | Ga0501047_0004007 | |||
| 3065 | Ga0501047_0005283 | |||
| 3066 | Ga0501047_0138641 | |||
| 3067 | Ga0501047_0211652 | |||
| 3068 | Ga0501048_0009382 | |||
| 3069 | Ga0501048_0010281 | |||
| 3070 | Ga0501048_0053832 | |||
| 3071 | Ga0501048_0058804 | |||
| 3072 | Ga0501048_0084754 | |||
| 3073 | Ga0501048_0444557 | |||
| 3074 | Ga0501048_0718619 | |||
| 3075 | Ga0501067_0007181 | |||
| 3076 | Ga0501068_0013567 | |||
| 3077 | Ga0501068_0049923 | |||
| 3078 | Ga0501068_0135268 | |||
| 3079 | Ga0501068_0141110 | |||
| 3080 | Ga0501069_0000066 | |||
| 3081 | Ga0501069_0175876 | |||
| 3082 | Ga0501070_0003216 | |||
| 3083 | Ga0501070_0409669 | |||
| 3084 | Ga0501070_0547120 | |||
| 3085 | Ga0501071_0027265 | |||
| 3086 | Ga0501071_0144258 | |||
| 3087 | Ga0501072_0053327 | |||
| 3088 | Ga0501072_0065168 | |||
| 3089 | Ga0501072_0107586 | |||
| 3090 | Ga0501072_0454009 | |||
| 3091 | Ga0501072_0508653 | |||
| 3092 | Ga0501072_0631102 | |||
| 3093 | Ga0501073_0000746 | |||
| 3094 | Ga0501073_0005526 | |||
| 3095 | Ga0501073_0115761 | |||
| 3096 | Ga0501073_0239647 | |||
| 3097 | Ga0501073_0367453 | |||
| 3098 | Ga0501074_0018931 | |||
| 3099 | Ga0501074_0076835 | |||
| 3100 | Ga0501074_0080978 | |||
| 3101 | Ga0501074_0107336 | |||
| 3102 | Ga0501074_0175972 | |||
| 3103 | Ga0501074_0502727 | |||
| 3104 | Ga0501075_0016547 | |||
| 3105 | Ga0501075_0024884 | |||
| 3106 | Ga0501075_0133121 | |||
| 3107 | Ga0501075_0211054 | |||
| 3108 | Ga0501075_0219629 | |||
| 3109 | Ga0501075_0586129 | |||
| 3110 | Ga0501076_0004802 | |||
| 3111 | Ga0501076_0026917 | |||
| 3112 | Ga0501076_0110472 | |||
| 3113 | Ga0501076_0357888 | |||
| 3114 | Ga0501077_0021468 | |||
| 3115 | Ga0501077_0055271 | |||
| 3116 | Ga0501077_0362397 | |||
| 3117 | Ga0501079_0052649 | |||
| 3118 | Ga0501079_0084440 | |||
| 3119 | Ga0501079_0480961 | |||
| 3120 | Ga0501080_0001309 | |||
| 3121 | Ga0501080_0072402 | |||
| 3122 | Ga0501080_0340580 | |||
| 3123 | Ga0501080_0440647 | |||
| 3124 | Ga0501080_0635065 | |||
| 3125 | Ga0501080_0767860 | |||
| 3126 | Ga0501081_0015652 | |||
| 3127 | Ga0501081_0018032 | |||
| 3128 | Ga0501081_0079452 | |||
| 3129 | Ga0501081_0086674 | |||
| 3130 | Ga0501081_0267643 | |||
| 3131 | Ga0501083_0006526 | |||
| 3132 | Ga0501083_0593685 | |||
| 3133 | Ga0501035_0008196 | |||
| 3134 | Ga0501035_0203673 | |||
| 3135 | Ga0501035_0350421 | |||
| 3136 | Ga0501035_0519590 | |||
| 3137 | Ga0501044_0006024 | |||
| 3138 | Ga0501044_0006624 | |||
| 3139 | Ga0501044_0012740 | |||
| 3140 | Ga0501044_0071868 | |||
| 3141 | Ga0501044_0130005 | |||
| 3142 | Ga0501044_0137076 | |||
| 3143 | Ga0501044_0493016 | |||
| 3144 | Ga0501044_0577928 | |||
| 3145 | Ga0501045_0025666 | |||
| 3146 | Ga0501045_0144854 | |||
| 3147 | Ga0501045_0236887 | |||
| 3148 | Ga0501045_0686297 | |||
| 3149 | nmdc:mga0k408_53973_c1 | |||
| 3150 | nmdc:mga06z11_407115_c1 | |||
| 3151 | nmdc:mga04h51_108206_c1 | |||
| 3152 | nmdc:mga05p37_13983_c1 | |||
| 3153 | nmdc:mga05p37_263414_c1 | |||
| 3154 | nmdc:mga05p37_30534_c1 | |||
| 3155 | nmdc:mga05p37_71264_c1 | |||
| 3156 | nmdc:mga05p37_96945_c1 | |||
| 3157 | nmdc:mga09592_5091_c1 | |||
| 3158 | nmdc:mga09592_70531_c1 | |||
| 3159 | nmdc:mga0qj67_15114_c1 | |||
| 3160 | nmdc:mga0qj67_539406_c1 | |||
| 3161 | nmdc:mga06r32_111538_c1 | |||
| 3162 | nmdc:mga06r32_14111_c1 | |||
| 3163 | nmdc:mga06r32_177830_c1 | |||
| 3164 | nmdc:mga08y16_15444_c1 | |||
| 3165 | nmdc:mga08y16_216415_c1 | |||
| 3166 | nmdc:mga08y16_232785_c1 | |||
| 3167 | nmdc:mga08y16_27362_c1 | |||
| 3168 | nmdc:mga08y16_35_c1 | |||
| 3169 | nmdc:mga08y16_56956_c1 | |||
| 3170 | nmdc:mga0n895_14103_c1 | |||
| 3171 | nmdc:mga0n895_18419_c1 | |||
| 3172 | nmdc:mga0n895_221760_c1 | |||
| 3173 | nmdc:mga0n895_272211_c1 | |||
| 3174 | nmdc:mga0n895_27429_c1 | |||
| 3175 | nmdc:mga0n895_339682_c1 | |||
| 3176 | nmdc:mga0n895_341278_c1 | |||
| 3177 | nmdc:mga0n895_384110_c1 | |||
| 3178 | nmdc:mga0n895_560757_c1 | |||
| 3179 | nmdc:mga0n895_88587_c1 | |||
| 3180 | nmdc:mga0rr50_106723_c1 | |||
| 3181 | nmdc:mga0rr50_43412_c1 | |||
| 3182 | nmdc:mga0rr50_5086_c1 | |||
| 3183 | nmdc:mga0rr50_52572_c1 | |||
| 3184 | nmdc:mga0rr50_55233_c1 | |||
| 3185 | nmdc:mga0rr50_7345_c1 | |||
| 3186 | nmdc:mga08x19_178479_c1 | |||
| 3187 | nmdc:mga08x19_636687_c1 | |||
| 3188 | nmdc:mga0a205_288258_c1 | |||
| 3189 | nmdc:mga0a205_38013_c1 | |||
| 3190 | nmdc:mga0a205_4498_c1 | |||
| 3191 | nmdc:mga0a205_490233_c1 | |||
| 3192 | nmdc:mga0a205_51984_c1 | |||
| 3193 | nmdc:mga0a205_595661_c1 | |||
| 3194 | nmdc:mga0a205_94481_c1 | |||
| 3195 | Ga0495601_0001598 | |||
| 3196 | Ga0495601_0003108 | |||
| 3197 | Ga0495601_0004088 | |||
| 3198 | Ga0495601_0007203 | |||
| 3199 | Ga0495601_0016195 | |||
| 3200 | Ga0495601_0016516 | |||
| 3201 | Ga0495601_0021870 | |||
| 3202 | Ga0495601_0354545 | |||
| 3203 | Ga0495601_0546898 | |||
| 3204 | Ga0495612_0000389 | |||
| 3205 | Ga0495612_0001478 | |||
| 3206 | Ga0495612_0001959 | |||
| 3207 | Ga0495612_0002008 | |||
| 3208 | Ga0495612_0011538 | |||
| 3209 | Ga0495612_0055753 | |||
| 3210 | Ga0495655_0002844 | |||
| 3211 | Ga0495595_0000245 | |||
| 3212 | Ga0495595_0000948 | |||
| 3213 | Ga0495595_0001617 | |||
| 3214 | Ga0495595_0003200 | |||
| 3215 | Ga0495595_0012754 | |||
| 3216 | Ga0495595_0055601 | |||
| 3217 | Ga0495595_0056082 | |||
| 3218 | Ga0495619_0000097 | |||
| 3219 | Ga0495619_0000374 | |||
| 3220 | Ga0495619_0000478 | |||
| 3221 | Ga0495619_0003878 | |||
| 3222 | Ga0495619_0004827 | |||
| 3223 | Ga0495619_0004978 | |||
| 3224 | Ga0495619_0012506 | |||
| 3225 | Ga0495619_0022784 | |||
| 3226 | Ga0495619_0034703 | |||
| 3227 | Ga0495619_0091923 | |||
| 3228 | Ga0495619_0128208 | |||
| 3229 | Ga0495619_0239609 | |||
| 3230 | Ga0500578_0116573 | |||
| 3231 | Ga0500644_0045361 | |||
| 3232 | Ga0500651_0077124 | |||
| 3233 | Ga0500566_0066894 | |||
| 3234 | Ga0500566_0150400 | |||
| 3235 | Ga0500641_0009368 | |||
| 3236 | Ga0500556_0057515 | |||
| 3237 | Ga0500595_000002 | |||
| 3238 | Ga0500595_004561 | |||
| 3239 | Ga0500595_009773 | |||
| 3240 | Ga0500608_227735 | |||
| 3241 | Ga0500614_054725 | |||
| 3242 | Ga0500642_0186617 | |||
| 3243 | Ga0500652_000002 | |||
| 3244 | Ga0500652_000573 | |||
| 3245 | Ga0500658_0158250 | |||
| 3246 | Ga0500559_0004376 | |||
| 3247 | Ga0500568_0064881 | |||
| 3248 | Ga0500577_0111117 | |||
| 3249 | Ga0500588_0125125 | |||
| 3250 | Ga0500604_0000195 | |||
| 3251 | Ga0500616_0000002 | |||
| 3252 | Ga0500616_0001203 | |||
| 3253 | Ga0500616_0151567 | |||
| 3254 | Ga0500624_051645 | |||
| 3255 | Ga0500634_0000044 | |||
| 3256 | Ga0500645_000754 | |||
| 3257 | Ga0500609_002739 | |||
| 3258 | Ga0500599_011949 | |||
| 3259 | Ga0501084_0023104 | |||
| 3260 | Ga0501084_0044964 | |||
| 3261 | Ga0501084_0084758 | |||
| 3262 | Ga0501084_0271606 | |||
| 3263 | Ga0501084_0412750 | |||
| 3264 | Ga0501084_0416655 | |||
| 3265 | Ga0501084_0457806 | |||
| 3266 | Ga0501082_0006052 | |||
| 3267 | Ga0501082_0011230 | |||
| 3268 | Ga0501082_0049211 | |||
| 3269 | Ga0501082_0227781 | |||
| 3270 | Ga0501082_0544200 | |||
| 3271 | Ga0501082_0698736 | |||
| 3272 | Ga0466962_0157991 | |||
| 3273 | Ga0530510_0009437 | |||
| 3274 | Ga0530510_0123555 | |||
| 3275 | Ga0530510_0126443 | |||
| 3276 | Ga0530510_0779242 | |||
| 3277 | 2643756254 | |||
| 3278 | 2643912273 | |||
| 3279 | 2643963466 | |||
| 3280 | 2644410585 | |||
| 3281 | 2644735972 | |||
| 3282 | 2738946401 | |||
| 3283 | 2739791261 | |||
| 3284 | 2821124470 | |||
| 3285 | 2838741035 | |||
| 3286 | 2840883833 | |||
| 3287 | 2841845068 | |||
| 3288 | 2842144791 | |||
| 3289 | 2857532051 | |||
| 3290 | 2891050945 | |||
| 3291 | 2913310814 | |||
| 3292 | 2919680980 | |||
| 3293 | 2932403294 | |||
| 3294 | 2995393147 | |||
| 3295 | 3000409126 | |||
| 3296 | 8045865187 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mcr-assembly1.cif.gz_A | crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution | 0.8818 | 3 | 128 |
| 6h8k-assembly1.cif.gz_G | crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i | 0.8333 | 5 | 143 |
| 4wz7-assembly1.cif.gz_G | crystal structure of mitochondrial nadh:ubiquinone oxidoreductase from yarrowia lipolytica. | 0.829 | 5 | 143 |
| 6h8k-assembly1.cif.gz_G | crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i | 0.8161 | 5 | 143 |
| 7z84-assembly1.cif.gz_C | complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, open-ready state | 0.8138 | 1 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PJ73_47_194_3.30.460.80 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit | 0.9883 | 2 | 132 | 3.30.460.80 |
| af_Q9VZU4_36_188_3.30.460.80 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit | 0.9837 | 2 | 132 | 3.30.460.80 |
| af_A0A2P2CLF6_6_131_3.30.460.80 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit | 0.9591 | 10 | 132 | 3.30.460.80 |
| af_P22237_2_142_3.30.460.80 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit | 0.9508 | 2 | 132 | 3.30.460.80 |
| af_A0A2P2CLF6_6_131_3.30.460.80 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit | 0.9298 | 10 | 132 | 3.30.460.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5PJ69-F1-model_v4 | NADH-quinone oxidoreductase subunit C | 0.9954 | 1 | 111 |
GO:0008137
|
| AF-A0A5N7YEC3-F1-model_v4 | deleted | 0.9945 | 1 | 93 |
|
| AF-A0A1S3JCK3-F1-model_v4 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial | 0.9895 | 2 | 114 |
GO:0008137
|
| AF-A0A820PU55-F1-model_v4 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial | 0.9886 | 2 | 109 |
GO:0008137
|
| AF-A0A7R9MNB3-F1-model_v4 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial | 0.988 | 2 | 99 |
GO:0008137
|