F495199

General Info

Members Datasets Scaffolds Average Seq Length
1648 528 3296 207

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0002272|Ga0500641_0002272_559_1311
Length 233
Sequence MSDSLRELGEYIAGALGPTVVGTNVALNELTVELRPADIVKASKFLRDDPNCLFKMLIDIAGVDYPEREKRFDVVYHLLSLKKNHRIRLRAKLGEEEAIPSVDSIWPAAQWFEREAYDMYGIYFSDNPDLRRLLTDYGFEGHPFRKDFPLTGYIEVRYDEAQKRVVYEPVELRQEFRSFDFLSPWEGMLQPRVLPGDEKALAPVTAAVAPAXXSGPKANPTNNPGATSSPKAP

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
32 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
103 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
152 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
173 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
251 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
257 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
258 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
259 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
260 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
261 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
264 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
265 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
269 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
270 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
274 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
275 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
276 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
277 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
278 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
279 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
280 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
281 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
282 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
283 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
284 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
285 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
286 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
287 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
288 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
289 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
290 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
291 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
292 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
293 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
294 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
295 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
296 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
300 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
301 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
302 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
306 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
307 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
310 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
311 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
315 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
319 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
324 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
325 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
331 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
332 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
333 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
334 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
335 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
341 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
342 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
343 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
362 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
363 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
366 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
367 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
368 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
369 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
372 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
373 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
374 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
375 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
376 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
377 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
378 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
379 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
380 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
383 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
384 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
392 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
393 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
394 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
395 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
396 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
397 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
398 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
399 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
400 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
401 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
409 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
410 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
411 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
412 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
413 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
414 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
415 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
419 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
420 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
421 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
422 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
423 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
432 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
433 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
455 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
456 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
459 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
460 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
461 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
462 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
470 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
471 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
472 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
473 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
474 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
475 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
476 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
477 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
478 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
479 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
480 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
481 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
482 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
483 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
484 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
485 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
486 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
487 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
488 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
489 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
490 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
491 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
492 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
499 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
500 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
501 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
502 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
503 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
504 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
505 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
506 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
507 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
508 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
509 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
510 2643221580 Devosia sp. Root635 Isolate Unclassified
511 2643221591 Devosia sp. Root685 Isolate Unclassified
512 2643221674 Devosia sp. Root436 Isolate Unclassified
513 2643221734 Bosea sp. Root670 Isolate Unclassified
514 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
515 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
516 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
517 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
518 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
519 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
520 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
521 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
522 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
523 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
524 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
525 2932401849 Devosia sp. 2618 Isolate Rhizosphere
526 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
527 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
528 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.06
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0.18
Rhizoplane 7.28
Rhizosphere 87.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0002272 3300053096 Bacteria 6810
2 SwRhRL2b_contig_309045 2162886007 Bacteria 1975
3 2214755772 2209111006 Bacteria 864
4 2214770210 2209111006 Bacteria 2695
5 ARcpr5oldR_c000101 3300000041 Bacteria 15420
6 ARSoilYngRDRAFT_c00241 3300000042 Bacteria 8764
7 ARcpr5yngRDRAFT_c000102 3300000043 Bacteria 13547
8 ARSoilOldRDRAFT_c000134 3300000044 Bacteria 13034
9 ARCol0oldRDRAFT_c00121 3300000045 Bacteria 6899
10 ARCol0yngRDRAFT_1000058 3300000652 Bacteria 19902
11 JGI24032J14994_100156 3300001430 Bacteria 3340
12 JGI24752J21851_1000685 3300001976 Bacteria 4517
13 JGI24746J21847_1000232 3300001977 Bacteria 7655
14 JGI24747J21853_1015233 3300001978 Bacteria 805
15 JGI24739J22299_10000103 3300001989 Bacteria 25576
16 JGI24739J22299_10035598 3300001989 Bacteria 1686
17 JGI24737J22298_10001448 3300001990 Bacteria 8467
18 JGI24737J22298_10008010 3300001990 Bacteria 3551
19 JGI24737J22298_10029151 3300001990 Bacteria 1732
20 JGI24743J22301_10004796 3300001991 Bacteria 2223
21 JGI24750J21931_1000146 3300002070 Bacteria 11547
22 JGI24750J21931_1001748 3300002070 Bacteria 2654
23 JGI24745J21846_1000381 3300002073 Bacteria 3881
24 JGI24745J21846_1029319 3300002073 Bacteria 661
25 JGI24748J21848_1000880 3300002074 Bacteria 3254
26 JGI24738J21930_10000080 3300002075 Bacteria 21134
27 JGI24035J26624_1000077 3300002126 Bacteria 7943
28 JGI24033J26618_1000650 3300002155 Bacteria 3318
29 JGI24034J26672_10000241 3300002239 Bacteria 7230
30 JGI24034J26672_10009334 3300002239 Bacteria 1445
31 JGI24742J22300_10000066 3300002244 Bacteria 15346
32 JGI24742J22300_10010687 3300002244 Bacteria 1520
33 JGI24751J29686_10003146 3300002459 Bacteria 3325
34 JGI24751J29686_10004621 3300002459 Bacteria 2797
35 JGI25153J46596_10000012 3300003215 Bacteria 308056
36 rootH2_10024840 3300003320 Bacteria 1274
37 rootH1_10138961 3300003323 Bacteria 1394
38 Ga0055531_10017501 3300003794 Bacteria 3021
39 JGI25405J52794_10007814 3300003911 Bacteria 1982
40 Ga0065717_1002263 3300005276 Bacteria 2305
41 Ga0065716_1001748 3300005277 Bacteria 3601
42 Ga0065704_10073258 3300005289 Bacteria 7373
43 Ga0065704_10297603 3300005289 Bacteria 891
44 Ga0065712_10006326 3300005290 Bacteria 4719
45 Ga0065712_10077314 3300005290 Bacteria 3474
46 Ga0065712_10082297 3300005290 Bacteria 2928
47 Ga0065712_10119729 3300005290 Bacteria 1683
48 Ga0065715_10089784 3300005293 Bacteria 8534
49 Ga0065715_10119480 3300005293 Bacteria 2285
50 Ga0065707_10169025 3300005295 Bacteria 1491
51 Ga0070658_10041006 3300005327 Bacteria 3735
52 Ga0070658_10054057 3300005327 Bacteria 3260
53 Ga0070658_10216384 3300005327 Bacteria 1619
54 Ga0070676_10010179 3300005328 Bacteria 5098
55 Ga0070676_10025524 3300005328 Bacteria 3341
56 Ga0070676_10469042 3300005328 Bacteria 888
57 Ga0070683_100001199 3300005329 Bacteria 19731
58 Ga0070683_100102147 3300005329 Bacteria 2700
59 Ga0070683_100216813 3300005329 Bacteria 1818
60 Ga0070683_100304765 3300005329 Bacteria 1515
61 Ga0070690_100001740 3300005330 Bacteria 11501
62 Ga0070690_100034038 3300005330 Bacteria 3191
63 Ga0070690_100041801 3300005330 Bacteria 2903
64 Ga0070670_100019604 3300005331 Bacteria 5806
65 Ga0070670_100037807 3300005331 Bacteria 4152
66 Ga0070670_100057926 3300005331 Bacteria 3325
67 Ga0070670_100179979 3300005331 Bacteria 1835
68 Ga0070677_10000497 3300005333 Bacteria 13540
69 Ga0068869_100000236 3300005334 Bacteria 29097
70 Ga0068869_100076887 3300005334 Bacteria 2482
71 Ga0068869_100737423 3300005334 Bacteria 842
72 Ga0070666_10002453 3300005335 Bacteria 11218
73 Ga0070666_10008751 3300005335 Bacteria 6293
74 Ga0070680_100007477 3300005336 Bacteria 8331
75 Ga0070680_100017862 3300005336 Bacteria 5596
76 Ga0070680_100031380 3300005336 Bacteria 4271
77 Ga0070680_100076653 3300005336 Bacteria 2753
78 Ga0070680_100236345 3300005336 Bacteria 1544
79 Ga0070680_100555056 3300005336 Bacteria 985
80 Ga0070682_100001100 3300005337 Bacteria 15523
81 Ga0070682_100002602 3300005337 Bacteria 9963
82 Ga0068868_100013245 3300005338 Bacteria 6042
83 Ga0068868_100098536 3300005338 Bacteria 2364
84 Ga0070660_100003492 3300005339 Bacteria 10828
85 Ga0070660_100042365 3300005339 Bacteria 3474
86 Ga0070660_100101864 3300005339 Bacteria 2276
87 Ga0070660_100281957 3300005339 Bacteria 1360
88 Ga0070689_100000466 3300005340 Bacteria 23849
89 Ga0070689_100001040 3300005340 Bacteria 17412
90 Ga0070689_100345745 3300005340 Bacteria 1246
91 Ga0070689_100480293 3300005340 Bacteria 1061
92 Ga0070691_10002256 3300005341 Bacteria 8534
93 Ga0070691_10013301 3300005341 Bacteria 3770
94 Ga0070691_10022786 3300005341 Bacteria 2907
95 Ga0070687_100000277 3300005343 Bacteria 17398
96 Ga0070687_100005651 3300005343 Bacteria 5073
97 Ga0070687_100165924 3300005343 Bacteria 1310
98 Ga0070661_100000444 3300005344 Bacteria 31791
99 Ga0070661_100000827 3300005344 Bacteria 22257
100 Ga0070661_100252817 3300005344 Bacteria 1360
101 Ga0070661_100818290 3300005344 Bacteria 765
102 Ga0070692_10002292 3300005345 Bacteria 7364
103 Ga0070692_10022458 3300005345 Bacteria 3082
104 Ga0070692_10142335 3300005345 Bacteria 1358
105 Ga0070668_100000073 3300005347 Bacteria 62170
106 Ga0070668_100010921 3300005347 Bacteria 6757
107 Ga0070668_100178834 3300005347 Bacteria 1732
108 Ga0070668_100282898 3300005347 Bacteria 1386
109 Ga0070668_100353187 3300005347 Bacteria 1245
110 Ga0070668_100628320 3300005347 Bacteria 942
111 Ga0070668_100783763 3300005347 Bacteria 846
112 Ga0070668_101173540 3300005347 Bacteria 695
113 Ga0070669_100002399 3300005353 Bacteria 13560
114 Ga0070669_100005353 3300005353 Bacteria 9263
115 Ga0070675_100005703 3300005354 Bacteria 9530
116 Ga0070675_100354821 3300005354 Bacteria 1301
117 Ga0070675_100796216 3300005354 Bacteria 864
118 Ga0070671_100000736 3300005355 Bacteria 23441
119 Ga0070671_100007103 3300005355 Bacteria 8957
120 Ga0070671_100119314 3300005355 Bacteria 2219
121 Ga0070671_100164568 3300005355 Bacteria 1875
122 Ga0070674_100010959 3300005356 Bacteria 5499
123 Ga0070674_100024433 3300005356 Bacteria 3922
124 Ga0070674_100407318 3300005356 Bacteria 1113
125 Ga0070673_100000302 3300005364 Bacteria 25831
126 Ga0070673_100000548 3300005364 Bacteria 20333
127 Ga0070673_100663916 3300005364 Bacteria 955
128 Ga0070688_100000195 3300005365 Bacteria 32155
129 Ga0070688_100004878 3300005365 Bacteria 7018
130 Ga0070688_100012314 3300005365 Bacteria 4789
131 Ga0070659_100000822 3300005366 Bacteria 22680
132 Ga0070659_100001555 3300005366 Bacteria 16548
133 Ga0070659_100054692 3300005366 Bacteria 3144
134 Ga0070659_100323925 3300005366 Bacteria 1289
135 Ga0070659_100637490 3300005366 Bacteria 918
136 Ga0070667_100002225 3300005367 Bacteria 17061
137 Ga0070667_100002272 3300005367 Bacteria 16919
138 Ga0070667_100065449 3300005367 Bacteria 3086
139 Ga0070667_100120120 3300005367 Bacteria 2286
140 Ga0070667_100433302 3300005367 Bacteria 1200
141 Ga0070703_10001123 3300005406 Bacteria 8283
142 Ga0070703_10009774 3300005406 Bacteria 2704
143 Ga0070709_10007205 3300005434 Bacteria 6093
144 Ga0070709_10016552 3300005434 Bacteria 4213
145 Ga0070709_10018980 3300005434 Bacteria 3969
146 Ga0070709_10052725 3300005434 Bacteria 2558
147 Ga0070709_10190331 3300005434 Bacteria 1447
148 Ga0070714_100002308 3300005435 Bacteria 14036
149 Ga0070714_100031420 3300005435 Bacteria 4430
150 Ga0070714_100043457 3300005435 Bacteria 3800
151 Ga0070714_100072813 3300005435 Bacteria 2975
152 Ga0070714_100080604 3300005435 Bacteria 2832
153 Ga0070714_100132687 3300005435 Bacteria 2227
154 Ga0070714_101061404 3300005435 Bacteria 789
155 Ga0070713_100004212 3300005436 Bacteria 9605
156 Ga0070713_100222693 3300005436 Bacteria 1712
157 Ga0070710_10007408 3300005437 Bacteria 5313
158 Ga0070710_10014126 3300005437 Bacteria 4012
159 Ga0070710_10016794 3300005437 Bacteria 3732
160 Ga0070710_10588971 3300005437 Bacteria 773
161 Ga0070701_10000864 3300005438 Bacteria 10897
162 Ga0070701_10006785 3300005438 Bacteria 4839
163 Ga0070701_10302493 3300005438 Bacteria 984
164 Ga0070711_100000336 3300005439 Bacteria 24119
165 Ga0070711_100050762 3300005439 Bacteria 2845
166 Ga0070711_100080319 3300005439 Bacteria 2322
167 Ga0070711_100103656 3300005439 Bacteria 2074
168 Ga0070711_100115857 3300005439 Bacteria 1974
169 Ga0070711_100157542 3300005439 Bacteria 1718
170 Ga0070711_100380264 3300005439 Bacteria 1142
171 Ga0070705_100001041 3300005440 Bacteria 15446
172 Ga0070705_100001212 3300005440 Bacteria 13972
173 Ga0070705_100100465 3300005440 Bacteria 1825
174 Ga0070700_100000209 3300005441 Bacteria 32736
175 Ga0070700_100001313 3300005441 Bacteria 12331
176 Ga0070700_100028154 3300005441 Bacteria 3339
177 Ga0070694_100000343 3300005444 Bacteria 24947
178 Ga0070694_100003865 3300005444 Bacteria 8952
179 Ga0070694_100071827 3300005444 Bacteria 2386
180 Ga0070694_100148829 3300005444 Bacteria 1708
181 Ga0070694_100175963 3300005444 Bacteria 1580
182 Ga0070694_100407296 3300005444 Bacteria 1066
183 Ga0070708_100499273 3300005445 Bacteria 1148
184 Ga0070663_100018174 3300005455 Bacteria 4603
185 Ga0070663_100021939 3300005455 Bacteria 4258
186 Ga0070663_100402824 3300005455 Bacteria 1119
187 Ga0070663_100553294 3300005455 Bacteria 962
188 Ga0070678_100000082 3300005456 Bacteria 35799
189 Ga0070678_100005062 3300005456 Bacteria 7560
190 Ga0070678_100133772 3300005456 Bacteria 1974
191 Ga0070662_100004072 3300005457 Bacteria 9188
192 Ga0070662_100019074 3300005457 Bacteria 4651
193 Ga0070662_100086416 3300005457 Bacteria 2346
194 Ga0070662_100141427 3300005457 Bacteria 1865
195 Ga0070681_10058442 3300005458 Bacteria 3836
196 Ga0070681_10169297 3300005458 Bacteria 2107
197 Ga0070681_10342265 3300005458 Bacteria 1405
198 Ga0070681_10391767 3300005458 Bacteria 1300
199 Ga0070681_10831937 3300005458 Bacteria 841
200 Ga0070681_10933106 3300005458 Bacteria 787
201 Ga0068867_100001495 3300005459 Bacteria 16179
202 Ga0068867_100069902 3300005459 Bacteria 2623
203 Ga0070685_10005500 3300005466 Bacteria 6420
204 Ga0070685_10005707 3300005466 Bacteria 6320
205 Ga0070685_10071039 3300005466 Bacteria 2063
206 Ga0070706_100085616 3300005467 Bacteria 2921
207 Ga0070698_100002489 3300005471 Bacteria 20297
208 Ga0070699_100060595 3300005518 Bacteria 3280
209 Ga0070699_100541878 3300005518 Bacteria 1059
210 Ga0070679_100003133 3300005530 Bacteria 15118
211 Ga0070679_100021336 3300005530 Bacteria 6322
212 Ga0070679_100027099 3300005530 Bacteria 5636
213 Ga0070679_100095625 3300005530 Bacteria 2958
214 Ga0070679_100179346 3300005530 Bacteria 2091
215 Ga0070679_100429212 3300005530 Bacteria 1267
216 Ga0070684_100005932 3300005535 Bacteria 9408
217 Ga0070684_100009801 3300005535 Bacteria 7563
218 Ga0070684_100079817 3300005535 Bacteria 2894
219 Ga0070684_100452692 3300005535 Bacteria 1186
220 Ga0070697_100007418 3300005536 Bacteria 8540
221 Ga0070697_100323743 3300005536 Bacteria 1328
222 Ga0070697_100392305 3300005536 Bacteria 1204
223 Ga0068853_100000919 3300005539 Bacteria 20601
224 Ga0068853_100001418 3300005539 Bacteria 17296
225 Ga0068853_100237770 3300005539 Bacteria 1668
226 Ga0068853_100537083 3300005539 Bacteria 1107
227 Ga0070672_100004500 3300005543 Bacteria 9131
228 Ga0070672_100012678 3300005543 Bacteria 5932
229 Ga0070672_100278007 3300005543 Bacteria 1415
230 Ga0070672_100558303 3300005543 Bacteria 994
231 Ga0070686_100000488 3300005544 Bacteria 24002
232 Ga0070686_100016109 3300005544 Bacteria 4343
233 Ga0070686_100019659 3300005544 Bacteria 3983
234 Ga0070686_100026543 3300005544 Bacteria 3497
235 Ga0070695_100000199 3300005545 Bacteria 29292
236 Ga0070695_100002834 3300005545 Bacteria 10077
237 Ga0070696_100025653 3300005546 Bacteria 4008
238 Ga0070696_100038159 3300005546 Bacteria 3315
239 Ga0070696_100039045 3300005546 Bacteria 3278
240 Ga0070696_100134549 3300005546 Bacteria 1801
241 Ga0070696_100263134 3300005546 Bacteria 1309
242 Ga0070693_100001088 3300005547 Bacteria 12187
243 Ga0070693_100002155 3300005547 Bacteria 9028
244 Ga0070693_100604826 3300005547 Bacteria 792
245 Ga0070665_100036419 3300005548 Bacteria 4949
246 Ga0070665_100539115 3300005548 Bacteria 1179
247 Ga0070665_100604063 3300005548 Bacteria 1110
248 Ga0070704_100002291 3300005549 Bacteria 10696
249 Ga0070704_100009996 3300005549 Bacteria 5761
250 Ga0070704_100016677 3300005549 Bacteria 4648
251 Ga0070704_100674305 3300005549 Bacteria 915
252 Ga0068855_100007603 3300005563 Bacteria 13112
253 Ga0068855_100087832 3300005563 Bacteria 3592
254 Ga0068855_100104984 3300005563 Bacteria 3249
255 Ga0068855_100210414 3300005563 Bacteria 2185
256 Ga0070664_100002753 3300005564 Bacteria 14191
257 Ga0070664_100008587 3300005564 Bacteria 8265
258 Ga0070664_100059778 3300005564 Bacteria 3243
259 Ga0070664_100384799 3300005564 Bacteria 1281
260 Ga0068857_100001539 3300005577 Bacteria 18457
261 Ga0068857_100014667 3300005577 Bacteria 6835
262 Ga0068857_100317658 3300005577 Bacteria 1438
263 Ga0068857_100322633 3300005577 Bacteria 1426
264 Ga0068854_100000611 3300005578 Bacteria 21143
265 Ga0068854_100002718 3300005578 Bacteria 10971
266 Ga0068856_100001722 3300005614 Bacteria 22877
267 Ga0068856_100004058 3300005614 Bacteria 14654
268 Ga0068856_100472386 3300005614 Bacteria 1275
269 Ga0068856_100637316 3300005614 Bacteria 1086
270 Ga0068856_101434292 3300005614 Bacteria 705
271 Ga0070702_100000629 3300005615 Bacteria 13027
272 Ga0070702_100007674 3300005615 Bacteria 5177
273 Ga0068852_100001817 3300005616 Bacteria 14500
274 Ga0068852_100019347 3300005616 Bacteria 5387
275 Ga0068852_100345453 3300005616 Bacteria 1451
276 Ga0068859_100010286 3300005617 Bacteria 9417
277 Ga0068859_100028582 3300005617 Bacteria 5590
278 Ga0068859_100067731 3300005617 Bacteria 3605
279 Ga0068859_100445196 3300005617 Bacteria 1391
280 Ga0068859_100631253 3300005617 Bacteria 1164
281 Ga0068864_100001077 3300005618 Bacteria 22916
282 Ga0068864_100002498 3300005618 Bacteria 15204
283 Ga0068866_10003421 3300005718 Bacteria 6504
284 Ga0068866_10004287 3300005718 Bacteria 5858
285 Ga0068866_10079424 3300005718 Bacteria 1758
286 Ga0068866_10461815 3300005718 Bacteria 833
287 Ga0068866_10471624 3300005718 Bacteria 825
288 Ga0068861_100000276 3300005719 Bacteria 28799
289 Ga0068861_100000668 3300005719 Bacteria 20402
290 Ga0068861_100746055 3300005719 Bacteria 914
291 Ga0068861_101141037 3300005719 Bacteria 751
292 Ga0068851_10088430 3300005834 Bacteria 1628
293 Ga0068870_10000676 3300005840 Bacteria 13010
294 Ga0068863_100004649 3300005841 Bacteria 13532
295 Ga0068863_100079646 3300005841 Bacteria 3102
296 Ga0068863_100149658 3300005841 Bacteria 2233
297 Ga0068858_100008130 3300005842 Bacteria 10087
298 Ga0068858_100040605 3300005842 Bacteria 4315
299 Ga0068858_100049152 3300005842 Bacteria 3906
300 Ga0068858_100266723 3300005842 Bacteria 1628
301 Ga0068860_100001413 3300005843 Bacteria 26001
302 Ga0068860_100007431 3300005843 Bacteria 10959
303 Ga0068860_100055702 3300005843 Bacteria 3759
304 Ga0068860_100580770 3300005843 Bacteria 1125
305 Ga0068860_100693620 3300005843 Bacteria 1028
306 Ga0068862_100003455 3300005844 Bacteria 13587
307 Ga0068862_100008906 3300005844 Bacteria 8308
308 Ga0068862_100043721 3300005844 Bacteria 3819
309 Ga0068862_100317644 3300005844 Bacteria 1437
310 Ga0068862_101205480 3300005844 Bacteria 756
311 Ga0081455_10000327 3300005937 Bacteria 62253
312 Ga0081455_10001182 3300005937 Bacteria 32680
313 Ga0081455_10021675 3300005937 Bacteria 6020
314 Ga0081455_10517411 3300005937 Bacteria 797
315 Ga0081540_1000205 3300005983 Bacteria 61689
316 Ga0081540_1002248 3300005983 Bacteria 15898
317 Ga0070717_10000258 3300006028 Bacteria 36170
318 Ga0070717_10001681 3300006028 Bacteria 15390
319 Ga0070717_10186052 3300006028 Bacteria 1813
320 Ga0070717_10261035 3300006028 Bacteria 1533
321 Ga0075365_10363787 3300006038 Bacteria 1020
322 Ga0075363_100107412 3300006048 Bacteria 1549
323 Ga0075432_10008052 3300006058 Bacteria 3597
324 Ga0075432_10037257 3300006058 Bacteria 1692
325 Ga0070715_10016112 3300006163 Bacteria 2801
326 Ga0070716_100003087 3300006173 Bacteria 7775
327 Ga0070716_100007734 3300006173 Bacteria 5305
328 Ga0070712_100004644 3300006175 Bacteria 8496
329 Ga0070712_100006392 3300006175 Bacteria 7307
330 Ga0070712_100150712 3300006175 Bacteria 1785
331 Ga0070712_100160167 3300006175 Bacteria 1737
332 Ga0070712_100412959 3300006175 Bacteria 1117
333 Ga0070712_100481331 3300006175 Bacteria 1038
334 Ga0070712_100662480 3300006175 Bacteria 887
335 Ga0075367_10217734 3300006178 Bacteria 1194
336 Ga0075367_10244842 3300006178 Bacteria 1124
337 Ga0097621_100000892 3300006237 Bacteria 20916
338 Ga0097621_100097765 3300006237 Bacteria 2465
339 Ga0097621_100345971 3300006237 Bacteria 1321
340 Ga0075370_10014898 3300006353 Bacteria 4153
341 Ga0068871_100010466 3300006358 Bacteria 6771
342 Ga0068871_100034066 3300006358 Bacteria 4038
343 Ga0068871_100061166 3300006358 Bacteria 3075
344 Ga0068871_100157416 3300006358 Bacteria 1941
345 Ga0075428_100035887 3300006844 Bacteria 5464
346 Ga0075428_100098461 3300006844 Bacteria 3188
347 Ga0075428_100221947 3300006844 Bacteria 2041
348 Ga0075428_100286031 3300006844 Bacteria 1774
349 Ga0075430_100007678 3300006846 Bacteria 9110
350 Ga0075431_100007378 3300006847 Bacteria 10949
351 Ga0075431_100047137 3300006847 Bacteria 4443
352 Ga0075433_10002306 3300006852 Bacteria 14532
353 Ga0075433_10003286 3300006852 Bacteria 12487
354 Ga0075433_10006637 3300006852 Bacteria 9161
355 Ga0075433_10370612 3300006852 Bacteria 1265
356 Ga0075434_100000110 3300006871 Bacteria 46873
357 Ga0075434_100001583 3300006871 Bacteria 19278
358 Ga0075434_100023586 3300006871 Bacteria 5999
359 Ga0075434_100023964 3300006871 Bacteria 5959
360 Ga0075434_100424611 3300006871 Bacteria 1350
361 Ga0075434_100441836 3300006871 Bacteria 1322
362 Ga0075434_100520746 3300006871 Bacteria 1209
363 Ga0075429_100006496 3300006880 Bacteria 10126
364 Ga0075429_100051597 3300006880 Bacteria 3578
365 Ga0068865_100000452 3300006881 Bacteria 22857
366 Ga0068865_100059223 3300006881 Bacteria 2678
367 Ga0068865_100127075 3300006881 Bacteria 1905
368 Ga0075436_100009283 3300006914 Bacteria 6731
369 Ga0075436_100082624 3300006914 Bacteria 2228
370 Ga0075436_100251899 3300006914 Bacteria 1258
371 Ga0097620_100010289 3300006931 Bacteria 9417
372 Ga0097620_100028581 3300006931 Bacteria 5590
373 Ga0097620_100067730 3300006931 Bacteria 3605
374 Ga0097620_100445196 3300006931 Bacteria 1391
375 Ga0097620_100631251 3300006931 Bacteria 1164
376 Ga0075435_100026293 3300007076 Bacteria 4538
377 Ga0075435_100066443 3300007076 Bacteria 2934
378 Ga0075435_100069762 3300007076 Bacteria 2867
379 Ga0075435_100086971 3300007076 Bacteria 2575
380 Ga0075435_100459165 3300007076 Bacteria 1099
381 Ga0099795_10003149 3300007788 Bacteria 4043
382 Ga0105251_10032957 3300009011 Bacteria 2576
383 Ga0105250_10092556 3300009092 Bacteria 1231
384 Ga0105240_10215689 3300009093 Bacteria 2239
385 Ga0105240_10230619 3300009093 Bacteria 2152
386 Ga0105240_10377979 3300009093 Bacteria 1600
387 Ga0105240_10605736 3300009093 Bacteria 1205
388 Ga0105240_10911785 3300009093 Bacteria 945
389 Ga0111539_10002712 3300009094 Bacteria 23487
390 Ga0111539_10011154 3300009094 Bacteria 11302
391 Ga0111539_10016303 3300009094 Bacteria 9213
392 Ga0111539_10126058 3300009094 Bacteria 3000
393 Ga0111539_10379568 3300009094 Bacteria 1646
394 Ga0111539_10747682 3300009094 Bacteria 1138
395 Ga0111539_11156871 3300009094 Bacteria 899
396 Ga0105245_10000380 3300009098 Bacteria 41293
397 Ga0105245_10006135 3300009098 Bacteria 10575
398 Ga0105245_10175950 3300009098 Bacteria 2041
399 Ga0105245_10501778 3300009098 Bacteria 1229
400 Ga0105247_10000149 3300009101 Bacteria 68765
401 Ga0105247_10065522 3300009101 Bacteria 2260
402 Ga0105247_10095025 3300009101 Bacteria 1897
403 Ga0105247_10095195 3300009101 Bacteria 1896
404 Ga0105247_10260251 3300009101 Bacteria 1189
405 Ga0105247_10494361 3300009101 Bacteria 890
406 Ga0114129_10058215 3300009147 Bacteria 5405
407 Ga0114129_10086721 3300009147 Bacteria 4341
408 Ga0114129_10624243 3300009147 Bacteria 1394
409 Ga0114129_10900172 3300009147 Bacteria 1121
410 Ga0105243_10002254 3300009148 Bacteria 16204
411 Ga0105243_10010900 3300009148 Bacteria 6877
412 Ga0105243_10020668 3300009148 Bacteria 4992
413 Ga0105243_10109431 3300009148 Bacteria 2308
414 Ga0105241_10000342 3300009174 Bacteria 35383
415 Ga0105241_10028423 3300009174 Bacteria 4168
416 Ga0105241_10049537 3300009174 Bacteria 3199
417 Ga0105242_10000855 3300009176 Bacteria 23621
418 Ga0105242_10010407 3300009176 Bacteria 7136
419 Ga0105242_10114826 3300009176 Bacteria 2301
420 Ga0105242_10678911 3300009176 Bacteria 1005
421 Ga0105248_10012394 3300009177 Bacteria 9405
422 Ga0105248_10020318 3300009177 Bacteria 7358
423 Ga0105248_10027173 3300009177 Bacteria 6366
424 Ga0105248_10197918 3300009177 Bacteria 2264
425 Ga0105248_10227162 3300009177 Bacteria 2101
426 Ga0105248_10530630 3300009177 Bacteria 1327
427 Ga0105248_10542817 3300009177 Bacteria 1311
428 Ga0105248_10566771 3300009177 Bacteria 1281
429 Ga0105237_10007867 3300009545 Bacteria 11620
430 Ga0105237_10165865 3300009545 Bacteria 2208
431 Ga0105237_10350105 3300009545 Bacteria 1482
432 Ga0105237_10350974 3300009545 Bacteria 1479
433 Ga0105237_10677464 3300009545 Bacteria 1038
434 Ga0105238_10034607 3300009551 Bacteria 5139
435 Ga0105238_10053194 3300009551 Bacteria 4068
436 Ga0105238_10123478 3300009551 Bacteria 2569
437 Ga0105238_10161315 3300009551 Bacteria 2217
438 Ga0105238_10282017 3300009551 Bacteria 1643
439 Ga0105249_10001149 3300009553 Bacteria 23441
440 Ga0105249_10001982 3300009553 Bacteria 17778
441 Ga0105249_10019413 3300009553 Bacteria 6064
442 Ga0105249_10089178 3300009553 Bacteria 2881
443 Ga0105249_10492087 3300009553 Bacteria 1270
444 Ga0105249_10655476 3300009553 Bacteria 1107
445 Ga0105239_10009977 3300010375 Bacteria 10658
446 Ga0105239_10012830 3300010375 Bacteria 9320
447 Ga0105239_10016747 3300010375 Bacteria 8102
448 Ga0105239_10042492 3300010375 Bacteria 4981
449 Ga0105239_10128052 3300010375 Bacteria 2823
450 Ga0105239_10172256 3300010375 Bacteria 2421
451 Ga0105239_10366397 3300010375 Bacteria 1628
452 Ga0105239_10489591 3300010375 Bacteria 1398
453 Ga0105246_10000185 3300011119 Bacteria 30744
454 Ga0105246_10000551 3300011119 Bacteria 20625
455 Ga0105246_10181057 3300011119 Bacteria 1623
456 Ga0105246_10231406 3300011119 Bacteria 1455
457 Ga0157316_1005628 3300012510 Bacteria 997
458 Ga0157326_1002949 3300012513 Bacteria 1798
459 Ga0157373_10003537 3300013100 Bacteria 11802
460 Ga0157373_10162794 3300013100 Bacteria 1570
461 Ga0157371_10003492 3300013102 Bacteria 14217
462 Ga0157371_10290611 3300013102 Bacteria 1182
463 Ga0157371_10503394 3300013102 Bacteria 895
464 Ga0157370_10017515 3300013104 Bacteria 7228
465 Ga0157370_10156140 3300013104 Bacteria 2123
466 Ga0157370_10347936 3300013104 Bacteria 1366
467 Ga0157369_10009077 3300013105 Bacteria 11382
468 Ga0157369_10323622 3300013105 Bacteria 1603
469 Ga0157369_10433702 3300013105 Bacteria 1361
470 Ga0157369_11153545 3300013105 Bacteria 791
471 Ga0157374_10001986 3300013296 Bacteria 17156
472 Ga0157374_10033399 3300013296 Bacteria 4694
473 Ga0157374_10393963 3300013296 Bacteria 1381
474 Ga0157378_10000562 3300013297 Bacteria 35265
475 Ga0157378_10001729 3300013297 Bacteria 19618
476 Ga0157378_10354418 3300013297 Bacteria 1434
477 Ga0157378_10645780 3300013297 Bacteria 1073
478 Ga0163162_10002599 3300013306 Bacteria 17110
479 Ga0163162_10012026 3300013306 Bacteria 8439
480 Ga0163162_10026532 3300013306 Bacteria 5725
481 Ga0163162_10057878 3300013306 Bacteria 3904
482 Ga0163162_11109611 3300013306 Bacteria 896
483 Ga0163162_11176548 3300013306 Bacteria 870
484 Ga0157372_10013072 3300013307 Bacteria 8856
485 Ga0157372_10024601 3300013307 Bacteria 6544
486 Ga0157372_10469662 3300013307 Bacteria 1466
487 Ga0157372_10704144 3300013307 Bacteria 1175
488 Ga0157372_11055238 3300013307 Bacteria 940
489 Ga0157372_11545538 3300013307 Bacteria 764
490 Ga0157372_11829562 3300013307 Bacteria 698
491 Ga0157375_10001883 3300013308 Bacteria 18038
492 Ga0157375_10009804 3300013308 Bacteria 8421
493 Ga0157375_10735558 3300013308 Bacteria 1138
494 Ga0163163_10010785 3300014325 Bacteria 8246
495 Ga0163163_10052955 3300014325 Bacteria 4005
496 Ga0163163_10295679 3300014325 Bacteria 1671
497 Ga0163163_11087474 3300014325 Bacteria 863
498 Ga0157380_10007676 3300014326 Bacteria 7677
499 Ga0157380_10044469 3300014326 Bacteria 3481
500 Ga0157380_10604439 3300014326 Bacteria 1086
501 Ga0182008_10339647 3300014497 Bacteria 794
502 Ga0157377_10000643 3300014745 Bacteria 14554
503 Ga0157377_10000976 3300014745 Bacteria 12030
504 Ga0157377_10251475 3300014745 Bacteria 1146
505 Ga0157379_10001319 3300014968 Bacteria 20254
506 Ga0157379_10010633 3300014968 Bacteria 8021
507 Ga0157379_10026543 3300014968 Bacteria 5156
508 Ga0157379_10542342 3300014968 Bacteria 1082
509 Ga0157379_10721946 3300014968 Bacteria 936
510 Ga0157379_10836867 3300014968 Bacteria 870
511 Ga0157376_10000920 3300014969 Bacteria 19113
512 Ga0157376_10331481 3300014969 Bacteria 1450
513 Ga0157376_10821294 3300014969 Bacteria 943
514 Ga0163161_10000379 3300017792 Bacteria 37281
515 Ga0163161_10050582 3300017792 Bacteria 3008
516 Ga0213872_10005036 3300021361 Bacteria 6856
517 Ga0213872_10019936 3300021361 Bacteria 3088
518 Ga0213872_10044651 3300021361 Bacteria 2016
519 Ga0213872_10052410 3300021361 Bacteria 1851
520 Ga0213872_10064084 3300021361 Bacteria 1660
521 Ga0213872_10191674 3300021361 Bacteria 879
522 Ga0213872_10198763 3300021361 Bacteria 860
523 Ga0213872_10251927 3300021361 Bacteria 743
524 Ga0213876_10056342 3300021384 Bacteria 2075
525 Ga0213876_10235051 3300021384 Bacteria 974
526 Ga0224712_10226411 3300022467 Bacteria 857
527 Ga0228598_1010359 3300024227 Bacteria 1857
528 Ga0207666_1000046 3300025271 Bacteria 24194
529 Ga0207673_1000461 3300025290 Bacteria 4236
530 Ga0209675_1000815 3300025291 Bacteria 20536
531 Ga0209758_1000059 3300025297 Bacteria 328458
532 Ga0209050_1007717 3300025298 Bacteria 5943
533 Ga0209257_1002470 3300025304 Bacteria 18283
534 Ga0207697_10000714 3300025315 Bacteria 18891
535 Ga0207697_10080072 3300025315 Bacteria 1376
536 Ga0207697_10097630 3300025315 Bacteria 1250
537 Ga0207656_10152083 3300025321 Bacteria 1096
538 Ga0207713_1076792 3300025735 Bacteria 1215
539 Ga0207653_10004733 3300025885 Bacteria 4259
540 Ga0207653_10024086 3300025885 Bacteria 1942
541 Ga0207682_10000043 3300025893 Bacteria 52108
542 Ga0207692_10007751 3300025898 Bacteria 4414
543 Ga0207692_10031679 3300025898 Bacteria 2534
544 Ga0207692_10055266 3300025898 Bacteria 2031
545 Ga0207692_10109043 3300025898 Bacteria 1533
546 Ga0207692_10243538 3300025898 Bacteria 1075
547 Ga0207692_10416306 3300025898 Bacteria 841
548 Ga0207642_10002212 3300025899 Bacteria 6031
549 Ga0207642_10179129 3300025899 Bacteria 1153
550 Ga0207710_10001577 3300025900 Bacteria 11193
551 Ga0207710_10002657 3300025900 Bacteria 8239
552 Ga0207710_10004284 3300025900 Bacteria 6246
553 Ga0207710_10019470 3300025900 Bacteria 2896
554 Ga0207710_10079101 3300025900 Bacteria 1522
555 Ga0207688_10000083 3300025901 Bacteria 36050
556 Ga0207688_10010182 3300025901 Bacteria 5117
557 Ga0207688_10036653 3300025901 Bacteria 2719
558 Ga0207680_10005187 3300025903 Bacteria 6214
559 Ga0207680_10056824 3300025903 Bacteria 2365
560 Ga0207647_10000860 3300025904 Bacteria 23528
561 Ga0207647_10025829 3300025904 Bacteria 3851
562 Ga0207647_10147142 3300025904 Bacteria 1378
563 Ga0207647_10165868 3300025904 Bacteria 1287
564 Ga0207685_10000556 3300025905 Bacteria 6458
565 Ga0207685_10015976 3300025905 Bacteria 2391
566 Ga0207699_10009985 3300025906 Bacteria 4748
567 Ga0207699_10035800 3300025906 Bacteria 2826
568 Ga0207699_10065818 3300025906 Bacteria 2198
569 Ga0207699_10335319 3300025906 Bacteria 1064
570 Ga0207645_10002954 3300025907 Bacteria 13126
571 Ga0207645_10012797 3300025907 Bacteria 5682
572 Ga0207645_10015101 3300025907 Bacteria 5143
573 Ga0207645_10160586 3300025907 Bacteria 1470
574 Ga0207643_10000128 3300025908 Bacteria 51191
575 Ga0207684_10081199 3300025910 Bacteria 2759
576 Ga0207654_10001559 3300025911 Bacteria 12036
577 Ga0207654_10022636 3300025911 Bacteria 3355
578 Ga0207654_10073229 3300025911 Bacteria 2041
579 Ga0207707_10004600 3300025912 Bacteria 12117
580 Ga0207707_10154688 3300025912 Bacteria 2005
581 Ga0207707_10165913 3300025912 Bacteria 1930
582 Ga0207707_10352748 3300025912 Bacteria 1267
583 Ga0207707_10354102 3300025912 Bacteria 1264
584 Ga0207695_10074493 3300025913 Bacteria 3457
585 Ga0207695_10302312 3300025913 Bacteria 1491
586 Ga0207695_10496752 3300025913 Bacteria 1102
587 Ga0207695_10784858 3300025913 Bacteria 833
588 Ga0207671_10013743 3300025914 Bacteria 6427
589 Ga0207671_10097503 3300025914 Bacteria 2223
590 Ga0207671_10151757 3300025914 Bacteria 1790
591 Ga0207671_10563248 3300025914 Bacteria 908
592 Ga0207693_10000529 3300025915 Bacteria 34501
593 Ga0207693_10008254 3300025915 Bacteria 8526
594 Ga0207693_10012476 3300025915 Bacteria 6864
595 Ga0207693_10013222 3300025915 Bacteria 6660
596 Ga0207693_10022622 3300025915 Bacteria 4994
597 Ga0207693_10116477 3300025915 Bacteria 2098
598 Ga0207693_10122173 3300025915 Bacteria 2045
599 Ga0207693_10137404 3300025915 Bacteria 1922
600 Ga0207693_10208215 3300025915 Bacteria 1537
601 Ga0207663_10009148 3300025916 Bacteria 5224
602 Ga0207663_10016239 3300025916 Bacteria 4123
603 Ga0207663_10019053 3300025916 Bacteria 3857
604 Ga0207663_10079527 3300025916 Bacteria 2141
605 Ga0207663_10396746 3300025916 Bacteria 1054
606 Ga0207660_10001486 3300025917 Bacteria 15770
607 Ga0207660_10019957 3300025917 Bacteria 4491
608 Ga0207660_10058413 3300025917 Bacteria 2766
609 Ga0207660_10317464 3300025917 Bacteria 1243
610 Ga0207662_10000301 3300025918 Bacteria 22744
611 Ga0207662_10017285 3300025918 Bacteria 4078
612 Ga0207662_10034661 3300025918 Bacteria 2945
613 Ga0207662_10347895 3300025918 Bacteria 995
614 Ga0207657_10000034 3300025919 Bacteria 127192
615 Ga0207657_10001859 3300025919 Bacteria 22810
616 Ga0207657_10047359 3300025919 Bacteria 3760
617 Ga0207657_10107787 3300025919 Bacteria 2304
618 Ga0207657_10126814 3300025919 Bacteria 2096
619 Ga0207657_10210978 3300025919 Bacteria 1559
620 Ga0207657_10554621 3300025919 Bacteria 898
621 Ga0207649_10003562 3300025920 Bacteria 8508
622 Ga0207649_10046661 3300025920 Bacteria 2663
623 Ga0207649_10579136 3300025920 Bacteria 861
624 Ga0207652_10016674 3300025921 Bacteria 6003
625 Ga0207652_10016935 3300025921 Bacteria 5960
626 Ga0207652_10028837 3300025921 Bacteria 4633
627 Ga0207652_10153811 3300025921 Bacteria 2060
628 Ga0207652_10259840 3300025921 Bacteria 1566
629 Ga0207652_10425761 3300025921 Bacteria 1197
630 Ga0207652_10667733 3300025921 Bacteria 929
631 Ga0207681_10004864 3300025923 Bacteria 8251
632 Ga0207681_10074552 3300025923 Bacteria 2377
633 Ga0207681_10184177 3300025923 Bacteria 1593
634 Ga0207694_10076101 3300025924 Bacteria 2628
635 Ga0207694_10430842 3300025924 Bacteria 1099
636 Ga0207694_11039257 3300025924 Bacteria 693
637 Ga0207650_10019558 3300025925 Bacteria 4761
638 Ga0207650_10227170 3300025925 Bacteria 1504
639 Ga0207659_10000411 3300025926 Bacteria 25858
640 Ga0207659_10079974 3300025926 Bacteria 2413
641 Ga0207659_10508788 3300025926 Bacteria 1020
642 Ga0207687_10000667 3300025927 Bacteria 23099
643 Ga0207687_10018650 3300025927 Bacteria 4584
644 Ga0207687_10259128 3300025927 Bacteria 1386
645 Ga0207687_10371082 3300025927 Bacteria 1170
646 Ga0207687_10626340 3300025927 Bacteria 909
647 Ga0207687_10713498 3300025927 Bacteria 852
648 Ga0207700_10000412 3300025928 Bacteria 25028
649 Ga0207700_10040508 3300025928 Bacteria 3401
650 Ga0207700_10127157 3300025928 Bacteria 2075
651 Ga0207700_10189586 3300025928 Bacteria 1727
652 Ga0207700_10442670 3300025928 Bacteria 1144
653 Ga0207664_10050429 3300025929 Bacteria 3282
654 Ga0207664_10107056 3300025929 Bacteria 2319
655 Ga0207664_10146170 3300025929 Bacteria 2005
656 Ga0207664_10571302 3300025929 Bacteria 1015
657 Ga0207664_10663317 3300025929 Bacteria 938
658 Ga0207644_10005279 3300025931 Bacteria 8432
659 Ga0207644_10009684 3300025931 Bacteria 6334
660 Ga0207644_10100107 3300025931 Bacteria 2176
661 Ga0207690_10002854 3300025932 Bacteria 10412
662 Ga0207690_10009329 3300025932 Bacteria 5830
663 Ga0207690_10015321 3300025932 Bacteria 4644
664 Ga0207690_10255426 3300025932 Bacteria 1356
665 Ga0207690_10632295 3300025932 Bacteria 876
666 Ga0207706_10000076 3300025933 Bacteria 102376
667 Ga0207706_10004082 3300025933 Bacteria 13792
668 Ga0207706_10031063 3300025933 Bacteria 4760
669 Ga0207706_10581919 3300025933 Bacteria 962
670 Ga0207686_10000579 3300025934 Bacteria 22963
671 Ga0207686_10006100 3300025934 Bacteria 6474
672 Ga0207686_10028646 3300025934 Bacteria 3277
673 Ga0207686_10033530 3300025934 Bacteria 3066
674 Ga0207709_10000551 3300025935 Bacteria 32038
675 Ga0207709_10183425 3300025935 Bacteria 1480
676 Ga0207670_10000556 3300025936 Bacteria 20667
677 Ga0207670_10087654 3300025936 Bacteria 2193
678 Ga0207670_10503842 3300025936 Bacteria 983
679 Ga0207669_10000675 3300025937 Bacteria 14703
680 Ga0207669_10005589 3300025937 Bacteria 5659
681 Ga0207669_10015571 3300025937 Bacteria 3838
682 Ga0207704_10002887 3300025938 Bacteria 7772
683 Ga0207704_10052578 3300025938 Bacteria 2470
684 Ga0207704_10109694 3300025938 Bacteria 1862
685 Ga0207704_10147674 3300025938 Bacteria 1654
686 Ga0207665_10004186 3300025939 Bacteria 9597
687 Ga0207665_10014619 3300025939 Bacteria 5167
688 Ga0207665_10628799 3300025939 Bacteria 840
689 Ga0207691_10000599 3300025940 Bacteria 35997
690 Ga0207691_10001503 3300025940 Bacteria 23199
691 Ga0207691_10063150 3300025940 Bacteria 3360
692 Ga0207691_10118905 3300025940 Bacteria 2344
693 Ga0207691_10191152 3300025940 Bacteria 1785
694 Ga0207711_10010308 3300025941 Bacteria 7762
695 Ga0207711_10073399 3300025941 Bacteria 2973
696 Ga0207711_10102849 3300025941 Bacteria 2529
697 Ga0207711_10312423 3300025941 Bacteria 1451
698 Ga0207711_10597243 3300025941 Bacteria 1030
699 Ga0207711_10612320 3300025941 Bacteria 1016
700 Ga0207689_10000165 3300025942 Bacteria 57494
701 Ga0207689_10510297 3300025942 Bacteria 1008
702 Ga0207661_10008897 3300025944 Bacteria 7188
703 Ga0207661_10390719 3300025944 Bacteria 1260
704 Ga0207661_10445194 3300025944 Bacteria 1179
705 Ga0207661_10573814 3300025944 Bacteria 1034
706 Ga0207679_10000112 3300025945 Bacteria 65716
707 Ga0207679_10022367 3300025945 Bacteria 4304
708 Ga0207679_10044874 3300025945 Bacteria 3193
709 Ga0207679_10235269 3300025945 Bacteria 1549
710 Ga0207679_10508258 3300025945 Bacteria 1076
711 Ga0207679_10593120 3300025945 Bacteria 998
712 Ga0207667_10017788 3300025949 Bacteria 7992
713 Ga0207667_10038289 3300025949 Bacteria 5123
714 Ga0207667_10039284 3300025949 Bacteria 5045
715 Ga0207651_10000099 3300025960 Bacteria 38059
716 Ga0207651_10006660 3300025960 Bacteria 6078
717 Ga0207651_10938824 3300025960 Bacteria 771
718 Ga0207712_10001637 3300025961 Bacteria 15094
719 Ga0207712_10019595 3300025961 Bacteria 4422
720 Ga0207712_10267370 3300025961 Bacteria 1389
721 Ga0207712_10548364 3300025961 Bacteria 994
722 Ga0207668_10000608 3300025972 Bacteria 22267
723 Ga0207668_10000713 3300025972 Bacteria 20303
724 Ga0207668_10105270 3300025972 Bacteria 2105
725 Ga0207668_10239295 3300025972 Bacteria 1468
726 Ga0207668_10339214 3300025972 Bacteria 1253
727 Ga0207668_10684886 3300025972 Bacteria 900
728 Ga0207668_10757489 3300025972 Bacteria 857
729 Ga0207640_10002957 3300025981 Bacteria 9147
730 Ga0207640_10015077 3300025981 Bacteria 4466
731 Ga0207640_10119188 3300025981 Bacteria 1887
732 Ga0207640_11345309 3300025981 Bacteria 639
733 Ga0207658_10003702 3300025986 Bacteria 10772
734 Ga0207658_10007098 3300025986 Bacteria 7628
735 Ga0207658_10067675 3300025986 Bacteria 2691
736 Ga0207658_10441690 3300025986 Bacteria 1150
737 Ga0207677_10010465 3300026023 Bacteria 5249
738 Ga0207677_10189705 3300026023 Bacteria 1624
739 Ga0207703_10018016 3300026035 Bacteria 5515
740 Ga0207703_10058062 3300026035 Bacteria 3157
741 Ga0207703_10177919 3300026035 Bacteria 1875
742 Ga0207639_10002883 3300026041 Bacteria 11555
743 Ga0207639_10040112 3300026041 Bacteria 3493
744 Ga0207639_10054896 3300026041 Bacteria 3047
745 Ga0207639_11049938 3300026041 Bacteria 764
746 Ga0207678_10000036 3300026067 Bacteria 104164
747 Ga0207678_10001329 3300026067 Bacteria 22814
748 Ga0207678_10029433 3300026067 Bacteria 4793
749 Ga0207678_10036192 3300026067 Bacteria 4297
750 Ga0207708_10000862 3300026075 Bacteria 22870
751 Ga0207708_10002574 3300026075 Bacteria 13351
752 Ga0207708_10019839 3300026075 Bacteria 5069
753 Ga0207702_10007796 3300026078 Bacteria 9086
754 Ga0207702_10014330 3300026078 Bacteria 6583
755 Ga0207702_10148575 3300026078 Bacteria 2129
756 Ga0207702_10307944 3300026078 Bacteria 1505
757 Ga0207641_10001462 3300026088 Bacteria 23160
758 Ga0207648_10001891 3300026089 Bacteria 22870
759 Ga0207648_10071963 3300026089 Bacteria 3013
760 Ga0207648_10081422 3300026089 Bacteria 2824
761 Ga0207648_10287023 3300026089 Bacteria 1473
762 Ga0207648_10288236 3300026089 Bacteria 1469
763 Ga0207676_10001459 3300026095 Bacteria 17574
764 Ga0207676_10051116 3300026095 Bacteria 3225
765 Ga0207676_10136555 3300026095 Bacteria 2093
766 Ga0207674_10006899 3300026116 Bacteria 13310
767 Ga0207674_10010119 3300026116 Bacteria 10722
768 Ga0207674_10212794 3300026116 Bacteria 1882
769 Ga0207675_100000970 3300026118 Bacteria 28501
770 Ga0207675_100001575 3300026118 Bacteria 22801
771 Ga0207675_100040944 3300026118 Bacteria 4328
772 Ga0207675_100111099 3300026118 Bacteria 2586
773 Ga0207675_100171943 3300026118 Bacteria 2071
774 Ga0207683_10000015 3300026121 Bacteria 125989
775 Ga0207683_10001273 3300026121 Bacteria 22829
776 Ga0207683_10004182 3300026121 Bacteria 12489
777 Ga0207683_10026331 3300026121 Bacteria 5020
778 Ga0207698_10006111 3300026142 Bacteria 7493
779 Ga0207698_10133389 3300026142 Bacteria 2126
780 Ga0207698_10428258 3300026142 Bacteria 1271
781 Ga0209967_1010797 3300027364 Bacteria 1276
782 Ga0210002_1002548 3300027617 Bacteria 2635
783 Ga0209966_1007471 3300027695 Bacteria 1917
784 Ga0209998_10008713 3300027717 Bacteria 2102
785 Ga0209998_10009907 3300027717 Bacteria 1975
786 Ga0209998_10012414 3300027717 Bacteria 1768
787 Ga0209813_10091554 3300027866 Bacteria 1021
788 Ga0209974_10020171 3300027876 Bacteria 2210
789 Ga0209974_10037821 3300027876 Bacteria 1603
790 Ga0209974_10101701 3300027876 Bacteria 1005
791 Ga0209974_10183133 3300027876 Bacteria 768
792 Ga0207428_10000064 3300027907 Bacteria 151185
793 Ga0207428_10000242 3300027907 Bacteria 74839
794 Ga0207428_10003078 3300027907 Bacteria 16410
795 Ga0207428_10006523 3300027907 Bacteria 10765
796 Ga0207428_10018880 3300027907 Bacteria 5882
797 Ga0207428_10116694 3300027907 Bacteria 2050
798 Ga0207428_10393931 3300027907 Bacteria 1015
799 Ga0268266_10010320 3300028379 Bacteria 8170
800 Ga0268266_10052520 3300028379 Bacteria 3500
801 Ga0268266_10279011 3300028379 Bacteria 1553
802 Ga0268266_10366594 3300028379 Bacteria 1356
803 Ga0268265_10003386 3300028380 Bacteria 11479
804 Ga0268265_10017919 3300028380 Bacteria 4898
805 Ga0268265_10064227 3300028380 Bacteria 2827
806 Ga0268265_10149253 3300028380 Bacteria 1969
807 Ga0268265_10312259 3300028380 Bacteria 1420
808 Ga0268265_10540866 3300028380 Bacteria 1104
809 Ga0268264_10003086 3300028381 Bacteria 14418
810 Ga0268264_10029045 3300028381 Bacteria 4528
811 Ga0268264_10385373 3300028381 Bacteria 1343
812 Ga0265337_1001177 3300028556 Bacteria 13325
813 Ga0307517_10170521 3300028786 Bacteria 1432
814 Ga0307515_10399551 3300028794 Bacteria 1000
815 Ga0265338_10258059 3300028800 Bacteria 1283
816 Ga0265338_10495578 3300028800 Bacteria 860
817 Ga0307512_10153748 3300030522 Bacteria 1368
818 Ga0265332_10121148 3300031238 Bacteria 1099
819 Ga0265325_10000006 3300031241 Bacteria 255758
820 Ga0265325_10004786 3300031241 Bacteria 8480
821 Ga0265325_10046663 3300031241 Bacteria 2246
822 Ga0265340_10125513 3300031247 Bacteria 1179
823 Ga0265339_10004854 3300031249 Bacteria 9086
824 Ga0265339_10120475 3300031249 Bacteria 1349
825 Ga0265331_10001499 3300031250 Bacteria 17228
826 Ga0265331_10028325 3300031250 Bacteria 2802
827 Ga0265331_10115002 3300031250 Bacteria 1232
828 Ga0265316_10085349 3300031344 Bacteria 2416
829 Ga0265316_10238217 3300031344 Bacteria 1338
830 Ga0307513_10110818 3300031456 Bacteria 2739
831 Ga0307513_10377135 3300031456 Bacteria 1159
832 Ga0265313_10000607 3300031595 Bacteria 37291
833 Ga0265313_10001122 3300031595 Bacteria 25603
834 Ga0265313_10004369 3300031595 Bacteria 10912
835 Ga0265313_10004848 3300031595 Bacteria 10112
836 Ga0265313_10005418 3300031595 Bacteria 9399
837 Ga0265313_10009773 3300031595 Bacteria 6181
838 Ga0265313_10018409 3300031595 Bacteria 3922
839 Ga0265313_10031666 3300031595 Bacteria 2709
840 Ga0265313_10139042 3300031595 Bacteria 1046
841 Ga0307508_10416473 3300031616 Bacteria 935
842 Ga0316579_10058416 3300031691 Bacteria 1812
843 Ga0265314_10001736 3300031711 Bacteria 23585
844 Ga0265314_10017596 3300031711 Bacteria 5604
845 Ga0265314_10276337 3300031711 Bacteria 952
846 Ga0265342_10001631 3300031712 Bacteria 20687
847 Ga0307516_10105803 3300031730 Bacteria 2624
848 Ga0307405_10118164 3300031731 Bacteria 1809
849 Ga0307405_10121183 3300031731 Bacteria 1790
850 Ga0307413_10009874 3300031824 Bacteria 4593
851 Ga0307413_10009990 3300031824 Bacteria 4575
852 Ga0307410_10043510 3300031852 Bacteria 2977
853 Ga0307410_10242584 3300031852 Bacteria 1397
854 Ga0307409_100061798 3300031995 Bacteria 2929
855 Ga0307409_100240162 3300031995 Bacteria 1649
856 Ga0307416_100294688 3300032002 Bacteria 1608
857 Ga0307414_10015861 3300032004 Bacteria 4561
858 Ga0307414_10249203 3300032004 Bacteria 1475
859 Ga0316583_10027901 3300032133 Bacteria 2015
860 Ga0373930_0065650 3300034816 Bacteria 817
861 Ga0373948_0002551 3300034817 Bacteria 2707
862 Ga0373948_0008375 3300034817 Bacteria 1759
863 Ga0373950_0000575 3300034818 Bacteria 4508
864 Ga0373950_0032149 3300034818 Bacteria 976
865 Ga0373958_0002130 3300034819 Bacteria 2742
866 Ga0373958_0002762 3300034819 Bacteria 2489
867 Ga0373958_0005151 3300034819 Bacteria 1972
868 Ga0373958_0050053 3300034819 Bacteria 880
869 Ga0373959_0001506 3300034820 Bacteria 3726
870 Ga0373959_0014183 3300034820 Bacteria 1447
871 Ga0373938_0000276 3300034957 Bacteria 8189
872 Ga0373938_0027355 3300034957 Bacteria 1199
873 Ga0373926_0010141 3300035083 Bacteria 3153
874 Ga0373928_0000820 3300035084 Bacteria 6070
875 Ga0373929_0000359 3300035085 Bacteria 8495
876 Ga0373934_0023173 3300035086 Bacteria 2398
877 Ga0373934_0179501 3300035086 Bacteria 870
878 Ga0373940_0000049 3300035088 Bacteria 13501
879 Ga0373944_0006580 3300035089 Bacteria 3087
880 Ga0373949_0001191 3300035090 Bacteria 7712
881 Ga0373949_0002203 3300035090 Bacteria 5099
882 Ga0373949_0007218 3300035090 Bacteria 2435
883 Ga0373949_0013764 3300035090 Bacteria 1797
884 Ga0373949_0037096 3300035090 Bacteria 1184
885 Ga0373951_0000518 3300035091 Bacteria 10973
886 Ga0373951_0022569 3300035091 Bacteria 1449
887 Ga0373951_0039210 3300035091 Bacteria 1138
888 Ga0373952_0000453 3300035092 Bacteria 7153
889 Ga0373952_0000483 3300035092 Bacteria 6949
890 Ga0373923_0001175 3300035111 Bacteria 7302
891 Ga0373923_0068057 3300035111 Bacteria 1524
892 Ga0373923_0071871 3300035111 Bacteria 1487
893 Ga0373923_0215839 3300035111 Bacteria 890
894 Ga0373932_0000462 3300035112 Bacteria 12458
895 Ga0373932_0002820 3300035112 Bacteria 4300
896 Ga0373932_0027182 3300035112 Bacteria 1563
897 Ga0373936_0000328 3300035113 Bacteria 16031
898 Ga0373939_0001076 3300035114 Bacteria 6716
899 Ga0373939_0003300 3300035114 Bacteria 3787
900 Ga0373939_0071596 3300035114 Bacteria 1130
901 Ga0373941_0000219 3300035115 Bacteria 11007
902 Ga0373941_0001129 3300035115 Bacteria 5569
903 Ga0373941_0048238 3300035115 Bacteria 1344
904 Ga0373945_0000123 3300035116 Bacteria 19133
905 Ga0373954_0012572 3300035118 Bacteria 3765
906 Ga0373954_0026139 3300035118 Bacteria 2674
907 Ga0373954_0161299 3300035118 Bacteria 1097
908 Ga0373956_0045117 3300035119 Bacteria 1966
909 Ga0373956_0048847 3300035119 Bacteria 1896
910 Ga0373956_0094785 3300035119 Bacteria 1380
911 Ga0373957_0002486 3300035120 Bacteria 5276
912 Ga0373957_0004774 3300035120 Bacteria 4152
913 Ga0373957_0032381 3300035120 Bacteria 1925
914 Ga0373957_0047990 3300035120 Bacteria 1626
915 Ga0373957_0124575 3300035120 Bacteria 1045
916 Ga0373960_0001504 3300035121 Bacteria 5184
917 Ga0373960_0013304 3300035121 Bacteria 2062
918 Ga0373960_0046765 3300035121 Bacteria 1271
919 Ga0373943_0001821 3300035170 Bacteria 9632
920 Ga0373943_0028120 3300035170 Bacteria 2648
921 Ga0373946_0003579 3300035171 Bacteria 5512
922 Ga0373946_0006894 3300035171 Bacteria 4135
923 Ga0373946_0018373 3300035171 Bacteria 2685
924 Ga0373946_0029864 3300035171 Bacteria 2173
925 Ga0373955_0001781 3300035172 Bacteria 9242
926 Ga0373955_0003764 3300035172 Bacteria 6683
927 Ga0373955_0053359 3300035172 Bacteria 2207
928 Ga0373955_0140688 3300035172 Bacteria 1415
929 Ga0373942_0004252 3300035207 Bacteria 3335
930 Ga0373942_0012705 3300035207 Bacteria 2016
931 Ga0373942_0023528 3300035207 Bacteria 1573
932 Ga0373961_0013321 3300035241 Bacteria 2072
933 Ga0373961_0019442 3300035241 Bacteria 1784
934 Ga0373962_0000215 3300035242 Bacteria 12190
935 Ga0373962_0001429 3300035242 Bacteria 5635
936 Ga0373962_0002252 3300035242 Bacteria 4611
937 Ga0373962_0006643 3300035242 Bacteria 2805
938 Ga0373962_0041030 3300035242 Bacteria 1303
939 Ga0316574_0536579 3300035398 Bacteria 727
940 Ga0373924_0005980 3300035410 Bacteria 4339
941 Ga0373924_0024323 3300035410 Bacteria 2386
942 Ga0373931_0004700 3300035691 Bacteria 6252
943 Ga0373931_0006133 3300035691 Bacteria 5601
944 Ga0373931_0006569 3300035691 Bacteria 5441
945 Ga0373931_0014856 3300035691 Bacteria 3813
946 Ga0373931_0021068 3300035691 Bacteria 3268
947 Ga0373931_0047512 3300035691 Bacteria 2272
948 Ga0373931_0047908 3300035691 Bacteria 2263
949 Ga0373931_0118356 3300035691 Bacteria 1511
950 Ga0373931_0149622 3300035691 Bacteria 1359
951 Ga0373935_0008365 3300035692 Bacteria 6190
952 Ga0373935_0010930 3300035692 Bacteria 5449
953 Ga0373935_0136849 3300035692 Bacteria 1651
954 Ga0373935_0243858 3300035692 Bacteria 1255
955 Ga0373927_0002377 3300035695 Bacteria 13712
956 Ga0373927_0009145 3300035695 Bacteria 6651
957 Ga0373927_0059332 3300035695 Bacteria 2474
958 Ga0373927_0159507 3300035695 Bacteria 1478
959 Ga0373927_0303532 3300035695 Bacteria 1051
960 Ga0373933_0003512 3300035724 Bacteria 8728
961 Ga0373933_0005999 3300035724 Bacteria 6610
962 Ga0373933_0014137 3300035724 Bacteria 4433
963 Ga0373933_0133774 3300035724 Bacteria 1561
964 Ga0373933_0436573 3300035724 Bacteria 856
965 Ga0373947_0002454 3300035725 Bacteria 11164
966 Ga0373947_0003283 3300035725 Bacteria 9588
967 Ga0373947_0005390 3300035725 Bacteria 7462
968 Ga0373947_0028558 3300035725 Bacteria 3271
969 Ga0373947_0155628 3300035725 Bacteria 1475
970 Ga0373937_0000977 3300036401 Bacteria 24260
971 Ga0373937_0000998 3300036401 Bacteria 23980
972 Ga0373937_0011819 3300036401 Bacteria 7666
973 Ga0373937_0013390 3300036401 Bacteria 7226
974 Ga0373937_0067460 3300036401 Bacteria 3296
975 Ga0373937_0076111 3300036401 Bacteria 3099
976 Ga0373937_0090816 3300036401 Bacteria 2829
977 Ga0373937_0145830 3300036401 Bacteria 2216
978 Ga0373937_0204092 3300036401 Bacteria 1859
979 Ga0373937_0512692 3300036401 Bacteria 1139
980 Ga0373937_0612640 3300036401 Bacteria 1033
981 Ga0373937_0686032 3300036401 Bacteria 970
982 Ga0373925_0002457 3300037068 Bacteria 14848
983 Ga0373925_0005022 3300037068 Bacteria 9926
984 Ga0373925_0027418 3300037068 Bacteria 4169
985 Ga0373925_0109865 3300037068 Bacteria 2128
986 Ga0373925_0240585 3300037068 Bacteria 1449
987 Ga0395899_0057420 3300037312 Bacteria 2873
988 Ga0395899_0146243 3300037312 Bacteria 1678
989 Ga0395900_0017768 3300037418 Bacteria 7260
990 Ga0395900_0019767 3300037418 Bacteria 6864
991 Ga0395900_0086905 3300037418 Bacteria 3213
992 Ga0395900_0634675 3300037418 Bacteria 1006
993 Ga0395898_0019586 3300037466 Bacteria 6884
994 Ga0395898_0047491 3300037466 Bacteria 4213
995 Ga0395898_0054044 3300037466 Bacteria 3920
996 Ga0395898_0081580 3300037466 Bacteria 3118
997 Ga0395905_0002014 3300037471 Bacteria 23216
998 Ga0436364_1021069 3300037853 Bacteria 939
999 Ga0395901_0003370 3300038443 Bacteria 16101
1000 Ga0395901_0029286 3300038443 Bacteria 5667
1001 Ga0395901_0145242 3300038443 Bacteria 2493
1002 Ga0395901_1384808 3300038443 Bacteria 662
1003 Ga0242420_022331 3300038996 Bacteria 1137
1004 Ga0436365_0648744 3300039437 Bacteria 945
1005 Ga0436365_1068563 3300039437 Bacteria 2089
1006 Ga0436365_1158499 3300039437 Bacteria 974
1007 Ga0436361_0024076 3300039447 Bacteria 2029
1008 Ga0436361_0120642 3300039447 Bacteria 705
1009 Ga0436361_0125156 3300039447 Bacteria 2105
1010 Ga0436361_0244861 3300039447 Bacteria 1278
1011 Ga0436361_0294175 3300039447 Bacteria 1021
1012 Ga0436361_0407501 3300039447 Bacteria 2303
1013 Ga0436361_0484050 3300039447 Bacteria 861
1014 Ga0436361_0724345 3300039447 Bacteria 3516
1015 Ga0436361_0795199 3300039447 Bacteria 71391
1016 Ga0436361_1098427 3300039447 Bacteria 1495
1017 Ga0436363_0925274 3300039450 Bacteria 1572
1018 Ga0436363_1200294 3300039450 Bacteria 1415
1019 Ga0436362_1126626 3300039453 Bacteria 1166
1020 Ga0439443_016357 3300042003 Bacteria 1133
1021 Ga0439448_0056871 3300042005 Bacteria 1288
1022 Ga0451577_0110442 3300042876 Bacteria 2460
1023 Ga0451577_0614127 3300042876 Bacteria 986
1024 Ga0466969_0000193 3300044656 Bacteria 32883
1025 Ga0466966_0009486 3300044684 Bacteria 6444
1026 Ga0466966_0069666 3300044684 Bacteria 2206
1027 Ga0466961_0009053 3300044693 Bacteria 6349
1028 Ga0466963_0025049 3300044694 Bacteria 3801
1029 Ga0466963_0244355 3300044694 Bacteria 1259
1030 Ga0466964_0163124 3300044706 Bacteria 1043
1031 Ga0453684_0010839 3300044712 Bacteria 15449
1032 Ga0453684_0198644 3300044712 Bacteria 2339
1033 Ga0453684_0469786 3300044712 Bacteria 1397
1034 Ga0466971_0092771 3300044719 Bacteria 1383
1035 Ga0466968_0369160 3300044735 Bacteria 699
1036 Ga0466970_0004501 3300044765 Bacteria 6872
1037 Ga0466957_0118503 3300044842 Bacteria 1686
1038 Ga0466957_0455909 3300044842 Bacteria 882
1039 Ga0466959_0000118 3300045049 Bacteria 51145
1040 Ga0451576_0105771 3300045051 Bacteria 2928
1041 Ga0451576_1698745 3300045051 Bacteria 654
1042 Ga0466958_0000804 3300045836 Bacteria 13846
1043 Ga0466958_0049465 3300045836 Bacteria 2543
1044 Ga0466958_0407568 3300045836 Bacteria 878
1045 Ga0466958_0532629 3300045836 Bacteria 763
1046 Ga0466967_0002046 3300045976 Bacteria 12320
1047 Ga0466967_0071094 3300045976 Bacteria 3115
1048 Ga0466967_0534660 3300045976 Bacteria 1153
1049 Ga0466967_0617482 3300045976 Bacteria 1071
1050 Ga0495617_119755 3300046452 Bacteria 848
1051 Ga0495592_0002187 3300046454 Bacteria 13770
1052 Ga0495592_0003145 3300046454 Bacteria 11808
1053 Ga0495592_0011852 3300046454 Bacteria 6605
1054 Ga0495592_0153609 3300046454 Bacteria 1589
1055 Ga0495603_0000127 3300046455 Bacteria 37048
1056 Ga0495603_0006157 3300046455 Bacteria 7172
1057 Ga0495603_0010152 3300046455 Bacteria 5698
1058 Ga0495603_0011477 3300046455 Bacteria 5362
1059 Ga0495629_0000474 3300046459 Bacteria 33674
1060 Ga0495629_0001081 3300046459 Bacteria 21648
1061 Ga0495629_0001491 3300046459 Bacteria 18414
1062 Ga0495629_0037772 3300046459 Bacteria 3403
1063 Ga0495629_0095292 3300046459 Bacteria 2076
1064 Ga0495638_0252564 3300046460 Bacteria 971
1065 Ga0495641_0000716 3300046461 Bacteria 28072
1066 Ga0495641_0069602 3300046461 Bacteria 1581
1067 Ga0495651_0001830 3300046462 Bacteria 16422
1068 Ga0495651_0063498 3300046462 Bacteria 2822
1069 Ga0495651_0206807 3300046462 Bacteria 1369
1070 Ga0495653_0001477 3300046463 Bacteria 18333
1071 Ga0495653_0002011 3300046463 Bacteria 16000
1072 Ga0495653_0101812 3300046463 Bacteria 2080
1073 Ga0495653_0277799 3300046463 Bacteria 1100
1074 Ga0495580_0000533 3300046472 Bacteria 32237
1075 Ga0495580_0001373 3300046472 Bacteria 21360
1076 Ga0495580_0029341 3300046472 Bacteria 3993
1077 Ga0495582_0000310 3300046473 Bacteria 26965
1078 Ga0495582_0001241 3300046473 Bacteria 14349
1079 Ga0495582_0131370 3300046473 Bacteria 1415
1080 Ga0495605_0061919 3300046474 Bacteria 1789
1081 Ga0495605_0133320 3300046474 Bacteria 1119
1082 Ga0495639_0000593 3300046475 Bacteria 16896
1083 Ga0495639_0000991 3300046475 Bacteria 12814
1084 Ga0495639_0005266 3300046475 Bacteria 5562
1085 Ga0495662_0000599 3300046476 Bacteria 16654
1086 Ga0495664_0001780 3300046477 Bacteria 11436
1087 Ga0495664_0008385 3300046477 Bacteria 5765
1088 Ga0495664_0089917 3300046477 Bacteria 1846
1089 Ga0495664_0120397 3300046477 Bacteria 1587
1090 Ga0495584_0019476 3300046491 Bacteria 3447
1091 Ga0495585_0012307 3300046492 Bacteria 5040
1092 Ga0495594_0000972 3300046499 Bacteria 14868
1093 Ga0495594_0004519 3300046499 Bacteria 7157
1094 Ga0495594_0023664 3300046499 Bacteria 3293
1095 Ga0495594_0282116 3300046499 Bacteria 946
1096 Ga0495608_0000844 3300046511 Bacteria 21431
1097 Ga0495608_0029605 3300046511 Bacteria 3712
1098 Ga0495608_0035340 3300046511 Bacteria 3371
1099 Ga0495618_0003351 3300046514 Bacteria 9989
1100 Ga0495618_0006349 3300046514 Bacteria 7176
1101 Ga0495618_0010591 3300046514 Bacteria 5579
1102 Ga0495618_0112356 3300046514 Bacteria 1744
1103 Ga0495628_0017046 3300046516 Bacteria 6053
1104 Ga0495628_0022156 3300046516 Bacteria 5221
1105 Ga0495628_0079335 3300046516 Bacteria 2552
1106 Ga0495628_0201198 3300046516 Bacteria 1501
1107 Ga0495630_0031825 3300046517 Bacteria 3928
1108 Ga0495637_0131902 3300046520 Bacteria 954
1109 Ga0495644_0001924 3300046523 Bacteria 8344
1110 Ga0495666_0005432 3300046526 Bacteria 6419
1111 Ga0495666_0020312 3300046526 Bacteria 3292
1112 Ga0495666_0164387 3300046526 Bacteria 1028
1113 Ga0495652_0001947 3300046529 Bacteria 21945
1114 Ga0495652_0003249 3300046529 Bacteria 16200
1115 Ga0495652_0012241 3300046529 Bacteria 7747
1116 Ga0495652_0026434 3300046529 Bacteria 5129
1117 Ga0495665_0000185 3300046531 Bacteria 31863
1118 Ga0495665_0007528 3300046531 Bacteria 5894
1119 Ga0495665_0009023 3300046531 Bacteria 5410
1120 Ga0495640_0006612 3300046533 Bacteria 9144
1121 Ga0495640_0006875 3300046533 Bacteria 8963
1122 Ga0495640_0149666 3300046533 Bacteria 1500
1123 Ga0495640_0207370 3300046533 Bacteria 1240
1124 Ga0495640_0404409 3300046533 Bacteria 838
1125 Ga0495586_0003393 3300046535 Bacteria 8540
1126 Ga0495586_0028093 3300046535 Bacteria 3010
1127 Ga0495587_0000732 3300046536 Bacteria 21969
1128 Ga0495587_0011211 3300046536 Bacteria 5683
1129 Ga0495587_0017113 3300046536 Bacteria 4507
1130 Ga0495609_0106058 3300046538 Bacteria 1215
1131 Ga0495621_0033590 3300046539 Bacteria 1769
1132 Ga0495645_0003961 3300046543 Bacteria 10097
1133 Ga0495622_0001379 3300046557 Bacteria 12379
1134 Ga0495622_0028177 3300046557 Bacteria 2622
1135 Ga0495622_0155688 3300046557 Bacteria 1032
1136 Ga0495633_0004731 3300046558 Bacteria 8549
1137 Ga0495633_0253866 3300046558 Bacteria 802
1138 Ga0495633_0254472 3300046558 Bacteria 801
1139 Ga0495667_0002039 3300046559 Bacteria 13390
1140 Ga0495667_0002260 3300046559 Bacteria 12888
1141 Ga0495667_0007395 3300046559 Bacteria 7447
1142 Ga0495667_0008839 3300046559 Bacteria 6849
1143 Ga0495667_0076054 3300046559 Bacteria 2184
1144 Ga0495667_0403086 3300046559 Bacteria 861
1145 Ga0495656_0000505 3300046615 Bacteria 12799
1146 Ga0495656_0104372 3300046615 Bacteria 1316
1147 Ga0495634_0005916 3300046642 Bacteria 9344
1148 Ga0495634_0006195 3300046642 Bacteria 9115
1149 Ga0495634_0027885 3300046642 Bacteria 3925
1150 Ga0495634_0047227 3300046642 Bacteria 2902
1151 Ga0495634_0136594 3300046642 Bacteria 1559
1152 Ga0495611_0018877 3300046648 Bacteria 2959
1153 Ga0495625_0308326 3300046660 Bacteria 1011
1154 Ga0495635_0002667 3300046663 Bacteria 12193
1155 Ga0495635_0008996 3300046663 Bacteria 6966
1156 Ga0495635_0018383 3300046663 Bacteria 4878
1157 Ga0495635_0035752 3300046663 Bacteria 3444
1158 Ga0495659_0000862 3300046664 Bacteria 10792
1159 Ga0495659_0114240 3300046664 Bacteria 1057
1160 Ga0495588_0000855 3300046674 Bacteria 13493
1161 Ga0495588_0006169 3300046674 Bacteria 5383
1162 Ga0495588_0042747 3300046674 Bacteria 2317
1163 Ga0495657_0019080 3300046675 Bacteria 4953
1164 Ga0495657_0061658 3300046675 Bacteria 2480
1165 Ga0495599_0013241 3300046678 Bacteria 5096
1166 Ga0495599_0037130 3300046678 Bacteria 3060
1167 Ga0495599_0052645 3300046678 Bacteria 2550
1168 Ga0495599_0114342 3300046678 Bacteria 1679
1169 Ga0495623_0003160 3300046679 Bacteria 10870
1170 Ga0495623_0040188 3300046679 Bacteria 2987
1171 Ga0495623_0078630 3300046679 Bacteria 2044
1172 Ga0495646_0000681 3300046680 Bacteria 18660
1173 Ga0495646_0009918 3300046680 Bacteria 6052
1174 Ga0495646_0109730 3300046680 Bacteria 1572
1175 Ga0495647_0006977 3300046681 Bacteria 3765
1176 Ga0495647_0010913 3300046681 Bacteria 3103
1177 Ga0495647_0016276 3300046681 Bacteria 2615
1178 Ga0495658_0000453 3300046683 Bacteria 22768
1179 Ga0495658_0000640 3300046683 Bacteria 18972
1180 Ga0495658_0003124 3300046683 Bacteria 8268
1181 Ga0495658_0011916 3300046683 Bacteria 4387
1182 Ga0495658_0146918 3300046683 Bacteria 1446
1183 Ga0495669_0000388 3300046684 Bacteria 21895
1184 Ga0495613_0000450 3300046689 Bacteria 35062
1185 Ga0495613_0005450 3300046689 Bacteria 9558
1186 Ga0495613_0010177 3300046689 Bacteria 6988
1187 Ga0495613_0059445 3300046689 Bacteria 2802
1188 Ga0495624_0000990 3300046690 Bacteria 22455
1189 Ga0495624_0285763 3300046690 Bacteria 996
1190 Ga0495670_0014504 3300046691 Bacteria 3873
1191 Ga0495649_0168837 3300046694 Bacteria 1146
1192 Ga0495600_0000326 3300046809 Bacteria 25282
1193 Ga0495600_0055531 3300046809 Bacteria 2586
1194 Ga0495600_0058587 3300046809 Bacteria 2516
1195 Ga0495600_0088439 3300046809 Bacteria 2021
1196 Ga0495581_0000462 3300047315 Bacteria 20789
1197 Ga0495581_0010642 3300047315 Bacteria 5317
1198 Ga0495604_0000643 3300047317 Bacteria 29876
1199 Ga0495604_0002511 3300047317 Bacteria 14648
1200 Ga0495604_0009753 3300047317 Bacteria 7596
1201 Ga0495604_0050376 3300047317 Bacteria 3234
1202 Ga0495604_0310948 3300047317 Bacteria 1056
1203 Ga0495604_0321008 3300047317 Bacteria 1035
1204 Ga0495674_0003479 3300047319 Bacteria 15302
1205 Ga0495674_0008425 3300047319 Bacteria 9822
1206 Ga0495674_0027234 3300047319 Bacteria 5224
1207 Ga0495674_0039411 3300047319 Bacteria 4235
1208 Ga0495674_0064848 3300047319 Bacteria 3174
1209 Ga0495674_0231509 3300047319 Bacteria 1525
1210 Ga0495674_0358057 3300047319 Bacteria 1184
1211 Ga0495676_0003716 3300047321 Bacteria 13857
1212 Ga0495676_0017497 3300047321 Bacteria 6337
1213 Ga0495676_0054793 3300047321 Bacteria 3167
1214 Ga0495680_0001401 3300047322 Bacteria 26002
1215 Ga0495680_0006685 3300047322 Bacteria 10678
1216 Ga0495680_0006889 3300047322 Bacteria 10490
1217 Ga0495680_0012123 3300047322 Bacteria 7605
1218 Ga0495680_0012637 3300047322 Bacteria 7417
1219 Ga0495680_0086555 3300047322 Bacteria 2357
1220 Ga0495680_0286359 3300047322 Bacteria 1160
1221 Ga0495680_0350701 3300047322 Bacteria 1028
1222 Ga0495675_0005017 3300047444 Bacteria 8053
1223 Ga0495675_0033575 3300047444 Bacteria 3275
1224 Ga0495679_013128 3300047446 Bacteria 3123
1225 Ga0495684_0020107 3300047471 Bacteria 5142
1226 Ga0495684_0042671 3300047471 Bacteria 3473
1227 Ga0495684_0052577 3300047471 Bacteria 3109
1228 Ga0495593_0000730 3300047673 Bacteria 19058
1229 Ga0495593_0002845 3300047673 Bacteria 10425
1230 Ga0495593_0010817 3300047673 Bacteria 5260
1231 Ga0495593_0191604 3300047673 Bacteria 1028
1232 Ga0495602_0003673 3300048088 Bacteria 15906
1233 Ga0495602_0005637 3300048088 Bacteria 13125
1234 Ga0495602_0010516 3300048088 Bacteria 9605
1235 Ga0495602_0075932 3300048088 Bacteria 2850
1236 Ga0495602_0175882 3300048088 Bacteria 1656
1237 Ga0495614_0021658 3300048089 Bacteria 2775
1238 Ga0495614_0131372 3300048089 Bacteria 1108
1239 Ga0496100_0001758 3300048903 Bacteria 10807
1240 Ga0496100_0003708 3300048903 Bacteria 8002
1241 Ga0496100_0076198 3300048903 Bacteria 2251
1242 Ga0496100_0158496 3300048903 Bacteria 1621
1243 Ga0496100_0569101 3300048903 Bacteria 878
1244 Ga0496100_0579935 3300048903 Bacteria 869
1245 Ga0496101_0012951 3300048904 Bacteria 5577
1246 Ga0496101_0074915 3300048904 Bacteria 2490
1247 Ga0496101_0310860 3300048904 Bacteria 1235
1248 Ga0496102_0002938 3300048905 Bacteria 14454
1249 Ga0496102_0011898 3300048905 Bacteria 7511
1250 Ga0496102_0060150 3300048905 Bacteria 3475
1251 Ga0496102_0284822 3300048905 Bacteria 1557
1252 Ga0496102_0332539 3300048905 Bacteria 1431
1253 Ga0496102_0503010 3300048905 Bacteria 1134
1254 Ga0496102_0641472 3300048905 Bacteria 985
1255 Ga0496102_0750684 3300048905 Bacteria 898
1256 Ga0496102_0750689 3300048905 Bacteria 898
1257 Ga0496102_0890921 3300048905 Bacteria 811
1258 Ga0496103_0003026 3300048906 Bacteria 10356
1259 Ga0496103_0013998 3300048906 Bacteria 4762
1260 Ga0496103_0040060 3300048906 Bacteria 2879
1261 Ga0496103_0042071 3300048906 Bacteria 2810
1262 Ga0496103_0163846 3300048906 Bacteria 1426
1263 Ga0496104_0000146 3300048907 Bacteria 65212
1264 Ga0496104_0000741 3300048907 Bacteria 27998
1265 Ga0496104_0002220 3300048907 Bacteria 16765
1266 Ga0496104_0003698 3300048907 Bacteria 13197
1267 Ga0496104_0079305 3300048907 Bacteria 3129
1268 Ga0496104_0150014 3300048907 Bacteria 2238
1269 Ga0496104_0159085 3300048907 Bacteria 2167
1270 Ga0496104_0194289 3300048907 Bacteria 1941
1271 Ga0496104_0342230 3300048907 Bacteria 1408
1272 Ga0496104_0424694 3300048907 Bacteria 1241
1273 Ga0496104_0747876 3300048907 Bacteria 885
1274 Ga0496105_0000025 3300048908 Bacteria 150594
1275 Ga0496105_0011046 3300048908 Bacteria 7119
1276 Ga0496105_0011482 3300048908 Bacteria 6999
1277 Ga0496105_0019370 3300048908 Bacteria 5488
1278 Ga0496105_0033779 3300048908 Bacteria 4203
1279 Ga0496105_0096191 3300048908 Bacteria 2445
1280 Ga0496105_0116549 3300048908 Bacteria 2203
1281 Ga0496105_0195977 3300048908 Bacteria 1650
1282 Ga0496105_0505203 3300048908 Bacteria 948
1283 Ga0496106_0009990 3300048909 Bacteria 7008
1284 Ga0496106_0012004 3300048909 Bacteria 6393
1285 Ga0496106_0037988 3300048909 Bacteria 3602
1286 Ga0496106_0042813 3300048909 Bacteria 3396
1287 Ga0496106_0062646 3300048909 Bacteria 2824
1288 Ga0496106_0088279 3300048909 Bacteria 2390
1289 Ga0496106_0184538 3300048909 Bacteria 1657
1290 Ga0496106_0195793 3300048909 Bacteria 1608
1291 Ga0496107_0014021 3300048910 Bacteria 5610
1292 Ga0496107_0015547 3300048910 Bacteria 5336
1293 Ga0496107_0039322 3300048910 Bacteria 3393
1294 Ga0496107_0054442 3300048910 Bacteria 2887
1295 Ga0496107_0071713 3300048910 Bacteria 2517
1296 Ga0496107_0104657 3300048910 Bacteria 2077
1297 Ga0496107_0509455 3300048910 Bacteria 892
1298 Ga0496108_0007653 3300048911 Bacteria 8745
1299 Ga0496108_0023258 3300048911 Bacteria 5097
1300 Ga0496108_0078821 3300048911 Bacteria 2788
1301 Ga0496108_0092967 3300048911 Bacteria 2565
1302 Ga0496108_0241538 3300048911 Bacteria 1571
1303 Ga0496108_0322150 3300048911 Bacteria 1347
1304 Ga0496108_0426455 3300048911 Bacteria 1158
1305 Ga0496109_0000526 3300048912 Bacteria 32410
1306 Ga0496109_0064201 3300048912 Bacteria 3359
1307 Ga0496109_0079373 3300048912 Bacteria 3023
1308 Ga0496109_0264545 3300048912 Bacteria 1620
1309 Ga0496109_0288539 3300048912 Bacteria 1547
1310 Ga0496109_0421351 3300048912 Bacteria 1261
1311 Ga0496109_0845297 3300048912 Bacteria 853
1312 Ga0496110_0011465 3300048913 Bacteria 7255
1313 Ga0496110_0079401 3300048913 Bacteria 2922
1314 Ga0496110_0080027 3300048913 Bacteria 2910
1315 Ga0496110_0283477 3300048913 Bacteria 1509
1316 Ga0496110_0416662 3300048913 Bacteria 1224
1317 Ga0496110_0843190 3300048913 Bacteria 822
1318 Ga0496111_0010814 3300048914 Bacteria 6135
1319 Ga0496111_0030122 3300048914 Bacteria 3858
1320 Ga0496111_0033387 3300048914 Bacteria 3670
1321 Ga0496111_0049275 3300048914 Bacteria 3036
1322 Ga0496111_0114400 3300048914 Bacteria 1989
1323 Ga0496111_0199372 3300048914 Bacteria 1488
1324 Ga0496111_0356989 3300048914 Bacteria 1082
1325 Ga0496112_0001549 3300048915 Bacteria 17768
1326 Ga0496112_0005706 3300048915 Bacteria 10813
1327 Ga0496112_0084195 3300048915 Bacteria 3145
1328 Ga0496112_0200372 3300048915 Bacteria 1955
1329 Ga0496112_0209448 3300048915 Bacteria 1907
1330 Ga0496112_0250174 3300048915 Bacteria 1724
1331 Ga0496112_0382401 3300048915 Bacteria 1348
1332 Ga0496112_0777462 3300048915 Bacteria 883
1333 Ga0496112_0868395 3300048915 Bacteria 825
1334 Ga0496113_0001026 3300048916 Bacteria 15018
1335 Ga0496113_0005648 3300048916 Bacteria 7828
1336 Ga0496113_0008212 3300048916 Bacteria 6782
1337 Ga0496113_0041681 3300048916 Bacteria 3389
1338 Ga0496113_0075727 3300048916 Bacteria 2569
1339 Ga0496113_0088268 3300048916 Bacteria 2385
1340 Ga0496113_0130021 3300048916 Bacteria 1975
1341 Ga0496113_0184655 3300048916 Bacteria 1653
1342 Ga0496113_0294641 3300048916 Bacteria 1298
1343 Ga0496114_0018559 3300048917 Bacteria 5626
1344 Ga0496114_0019225 3300048917 Bacteria 5535
1345 Ga0496114_0023712 3300048917 Bacteria 5008
1346 Ga0496114_0027954 3300048917 Bacteria 4624
1347 Ga0496114_0034001 3300048917 Bacteria 4203
1348 Ga0496114_0060267 3300048917 Bacteria 3172
1349 Ga0496114_0281421 3300048917 Bacteria 1466
1350 Ga0496114_0611005 3300048917 Bacteria 961
1351 Ga0496115_0008590 3300048918 Bacteria 7560
1352 Ga0496115_0019401 3300048918 Bacteria 5231
1353 Ga0496115_0080857 3300048918 Bacteria 2646
1354 Ga0496115_0205546 3300048918 Bacteria 1626
1355 Ga0496115_0258376 3300048918 Bacteria 1433
1356 Ga0496115_0267331 3300048918 Bacteria 1405
1357 Ga0496115_0470901 3300048918 Bacteria 1012
1358 Ga0496115_0599936 3300048918 Bacteria 875
1359 Ga0496119_0003812 3300048922 Bacteria 15411
1360 Ga0496119_0312295 3300048922 Bacteria 772
1361 Ga0496124_0417189 3300048927 Bacteria 926
1362 Ga0496125_0003219 3300048928 Bacteria 20151
1363 Ga0496125_0152138 3300048928 Bacteria 1587
1364 Ga0501031_0068303 3300049568 Bacteria 2315
1365 Ga0501031_0147447 3300049568 Bacteria 1537
1366 Ga0501031_0173204 3300049568 Bacteria 1410
1367 Ga0501031_0186891 3300049568 Bacteria 1353
1368 Ga0501032_0000951 3300049569 Bacteria 23376
1369 Ga0501032_0416689 3300049569 Bacteria 862
1370 Ga0501033_0007292 3300049570 Bacteria 8626
1371 Ga0501033_0144107 3300049570 Bacteria 1722
1372 Ga0501033_0467263 3300049570 Bacteria 875
1373 Ga0501034_0014184 3300049571 Bacteria 8213
1374 Ga0501034_0093404 3300049571 Bacteria 3005
1375 Ga0501034_0154152 3300049571 Bacteria 2272
1376 Ga0501034_0161437 3300049571 Bacteria 2212
1377 Ga0501034_0328195 3300049571 Bacteria 1462
1378 Ga0501034_0487547 3300049571 Bacteria 1147
1379 Ga0501036_0002920 3300049572 Bacteria 13573
1380 Ga0501036_0067554 3300049572 Bacteria 3025
1381 Ga0501036_0596101 3300049572 Bacteria 917
1382 Ga0501036_1012189 3300049572 Bacteria 680
1383 Ga0501037_0037819 3300049573 Bacteria 3558
1384 Ga0501037_0083705 3300049573 Bacteria 2311
1385 Ga0501037_0121788 3300049573 Bacteria 1875
1386 Ga0501038_0000730 3300049574 Bacteria 29345
1387 Ga0501038_0053534 3300049574 Bacteria 3474
1388 Ga0501038_0265785 3300049574 Bacteria 1354
1389 Ga0501038_0456075 3300049574 Bacteria 982
1390 Ga0501039_0027260 3300049575 Bacteria 4392
1391 Ga0501039_0034671 3300049575 Bacteria 3894
1392 Ga0501039_0114603 3300049575 Bacteria 2109
1393 Ga0501039_0179388 3300049575 Bacteria 1666
1394 Ga0501039_0509014 3300049575 Bacteria 945
1395 Ga0501040_0006194 3300049576 Bacteria 7759
1396 Ga0501040_0012426 3300049576 Bacteria 5579
1397 Ga0501040_0020813 3300049576 Bacteria 4374
1398 Ga0501040_0186223 3300049576 Bacteria 1472
1399 Ga0501040_0318711 3300049576 Bacteria 1112
1400 Ga0501041_0049033 3300049577 Bacteria 2572
1401 Ga0501041_0185798 3300049577 Bacteria 1301
1402 Ga0501041_0213212 3300049577 Bacteria 1211
1403 Ga0501041_0517895 3300049577 Bacteria 759
1404 Ga0501042_0104841 3300049578 Bacteria 2034
1405 Ga0501042_0377546 3300049578 Bacteria 1026
1406 Ga0501042_0517420 3300049578 Bacteria 867
1407 Ga0501043_0002840 3300049579 Bacteria 14469
1408 Ga0501043_0029899 3300049579 Bacteria 4280
1409 Ga0501043_0047395 3300049579 Bacteria 3379
1410 Ga0501043_0093205 3300049579 Bacteria 2368
1411 Ga0501043_0328648 3300049579 Bacteria 1165
1412 Ga0501043_0473058 3300049579 Bacteria 939
1413 Ga0501046_0008883 3300049580 Bacteria 8727
1414 Ga0501046_0071471 3300049580 Bacteria 2696
1415 Ga0501046_0214783 3300049580 Bacteria 1426
1416 Ga0501047_0004007 3300049581 Bacteria 13845
1417 Ga0501047_0005283 3300049581 Bacteria 12137
1418 Ga0501047_0138641 3300049581 Bacteria 2311
1419 Ga0501047_0211652 3300049581 Bacteria 1797
1420 Ga0501048_0009382 3300049582 Bacteria 7348
1421 Ga0501048_0010281 3300049582 Bacteria 6996
1422 Ga0501048_0053832 3300049582 Bacteria 2860
1423 Ga0501048_0058804 3300049582 Bacteria 2724
1424 Ga0501048_0084754 3300049582 Bacteria 2235
1425 Ga0501048_0444557 3300049582 Bacteria 928
1426 Ga0501048_0718619 3300049582 Bacteria 717
1427 Ga0501067_0007181 3300049583 Bacteria 6191
1428 Ga0501068_0013567 3300049584 Bacteria 4639
1429 Ga0501068_0049923 3300049584 Bacteria 2528
1430 Ga0501068_0135268 3300049584 Bacteria 1543
1431 Ga0501068_0141110 3300049584 Bacteria 1510
1432 Ga0501069_0000066 3300049585 Bacteria 55164
1433 Ga0501069_0175876 3300049585 Bacteria 1236
1434 Ga0501070_0003216 3300049586 Bacteria 14207
1435 Ga0501070_0409669 3300049586 Bacteria 1096
1436 Ga0501070_0547120 3300049586 Bacteria 927
1437 Ga0501071_0027265 3300049587 Bacteria 4018
1438 Ga0501071_0144258 3300049587 Bacteria 1774
1439 Ga0501072_0053327 3300049588 Bacteria 3185
1440 Ga0501072_0065168 3300049588 Bacteria 2872
1441 Ga0501072_0107586 3300049588 Bacteria 2218
1442 Ga0501072_0454009 3300049588 Bacteria 1015
1443 Ga0501072_0508653 3300049588 Bacteria 952
1444 Ga0501072_0631102 3300049588 Bacteria 844
1445 Ga0501073_0000746 3300049589 Bacteria 23011
1446 Ga0501073_0005526 3300049589 Bacteria 9465
1447 Ga0501073_0115761 3300049589 Bacteria 1858
1448 Ga0501073_0239647 3300049589 Bacteria 1253
1449 Ga0501073_0367453 3300049589 Bacteria 994
1450 Ga0501074_0018931 3300049590 Bacteria 5001
1451 Ga0501074_0076835 3300049590 Bacteria 2396
1452 Ga0501074_0080978 3300049590 Bacteria 2328
1453 Ga0501074_0107336 3300049590 Bacteria 1999
1454 Ga0501074_0175972 3300049590 Bacteria 1527
1455 Ga0501074_0502727 3300049590 Bacteria 859
1456 Ga0501075_0016547 3300049591 Bacteria 5315
1457 Ga0501075_0024884 3300049591 Bacteria 4395
1458 Ga0501075_0133121 3300049591 Bacteria 1894
1459 Ga0501075_0211054 3300049591 Bacteria 1481
1460 Ga0501075_0219629 3300049591 Bacteria 1450
1461 Ga0501075_0586129 3300049591 Bacteria 851
1462 Ga0501076_0004802 3300049592 Bacteria 9646
1463 Ga0501076_0026917 3300049592 Bacteria 4458
1464 Ga0501076_0110472 3300049592 Bacteria 2222
1465 Ga0501076_0357888 3300049592 Bacteria 1199
1466 Ga0501077_0021468 3300049593 Bacteria 4085
1467 Ga0501077_0055271 3300049593 Bacteria 2520
1468 Ga0501077_0362397 3300049593 Bacteria 925
1469 Ga0501079_0052649 3300049741 Bacteria 3141
1470 Ga0501079_0084440 3300049741 Bacteria 2456
1471 Ga0501079_0480961 3300049741 Bacteria 976
1472 Ga0501080_0001309 3300049742 Bacteria 20742
1473 Ga0501080_0072402 3300049742 Bacteria 3206
1474 Ga0501080_0340580 3300049742 Bacteria 1355
1475 Ga0501080_0440647 3300049742 Bacteria 1169
1476 Ga0501080_0635065 3300049742 Bacteria 946
1477 Ga0501080_0767860 3300049742 Bacteria 847
1478 Ga0501081_0015652 3300049743 Bacteria 5005
1479 Ga0501081_0018032 3300049743 Bacteria 4685
1480 Ga0501081_0079452 3300049743 Bacteria 2294
1481 Ga0501081_0086674 3300049743 Bacteria 2198
1482 Ga0501081_0267643 3300049743 Bacteria 1250
1483 Ga0501083_0006526 3300049744 Bacteria 8272
1484 Ga0501083_0593685 3300049744 Bacteria 721
1485 Ga0501035_0008196 3300049822 Bacteria 9738
1486 Ga0501035_0203673 3300049822 Bacteria 1696
1487 Ga0501035_0350421 3300049822 Bacteria 1235
1488 Ga0501035_0519590 3300049822 Bacteria 978
1489 Ga0501044_0006024 3300049823 Bacteria 13394
1490 Ga0501044_0006624 3300049823 Bacteria 12776
1491 Ga0501044_0012740 3300049823 Bacteria 9106
1492 Ga0501044_0071868 3300049823 Bacteria 3518
1493 Ga0501044_0130005 3300049823 Bacteria 2513
1494 Ga0501044_0137076 3300049823 Bacteria 2438
1495 Ga0501044_0493016 3300049823 Bacteria 1127
1496 Ga0501044_0577928 3300049823 Bacteria 1018
1497 Ga0501045_0025666 3300049824 Bacteria 4237
1498 Ga0501045_0144854 3300049824 Bacteria 1767
1499 Ga0501045_0236887 3300049824 Bacteria 1359
1500 Ga0501045_0686297 3300049824 Bacteria 756
1501 nmdc:mga0k408_53973_c1 3300050493 Bacteria 2329
1502 nmdc:mga06z11_407115_c1 3300050494 Bacteria 819
1503 nmdc:mga04h51_108206_c1 3300050495 Bacteria 1021
1504 nmdc:mga05p37_13983_c1 3300050507 Bacteria 9625
1505 nmdc:mga05p37_263414_c1 3300050507 Bacteria 2062
1506 nmdc:mga05p37_30534_c1 3300050507 Bacteria 6575
1507 nmdc:mga05p37_71264_c1 3300050507 Bacteria 4275
1508 nmdc:mga05p37_96945_c1 3300050507 Bacteria 3633
1509 nmdc:mga09592_5091_c1 3300050508 Bacteria 10670
1510 nmdc:mga09592_70531_c1 3300050508 Bacteria 2965
1511 nmdc:mga0qj67_15114_c1 3300050509 Bacteria 5842
1512 nmdc:mga0qj67_539406_c1 3300050509 Bacteria 936
1513 nmdc:mga06r32_111538_c1 3300050510 Bacteria 2691
1514 nmdc:mga06r32_14111_c1 3300050510 Bacteria 7248
1515 nmdc:mga06r32_177830_c1 3300050510 Bacteria 2113
1516 nmdc:mga08y16_15444_c1 3300050511 Bacteria 8031
1517 nmdc:mga08y16_216415_c1 3300050511 Bacteria 1984
1518 nmdc:mga08y16_232785_c1 3300050511 Bacteria 1905
1519 nmdc:mga08y16_27362_c1 3300050511 Bacteria 6008
1520 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
1521 nmdc:mga08y16_56956_c1 3300050511 Bacteria 4085
1522 nmdc:mga0n895_14103_c1 3300050512 Bacteria 7245
1523 nmdc:mga0n895_18419_c1 3300050512 Bacteria 6462
1524 nmdc:mga0n895_221760_c1 3300050512 Bacteria 1920
1525 nmdc:mga0n895_272211_c1 3300050512 Bacteria 1718
1526 nmdc:mga0n895_27429_c1 3300050512 Bacteria 5411
1527 nmdc:mga0n895_339682_c1 3300050512 Bacteria 1521
1528 nmdc:mga0n895_341278_c1 3300050512 Bacteria 1517
1529 nmdc:mga0n895_384110_c1 3300050512 Bacteria 1421
1530 nmdc:mga0n895_560757_c1 3300050512 Bacteria 1147
1531 nmdc:mga0n895_88587_c1 3300050512 Bacteria 3095
1532 nmdc:mga0rr50_106723_c1 3300050513 Bacteria 2210
1533 nmdc:mga0rr50_43412_c1 3300050513 Bacteria 3290
1534 nmdc:mga0rr50_5086_c1 3300050513 Bacteria 7801
1535 nmdc:mga0rr50_52572_c1 3300050513 Bacteria 3028
1536 nmdc:mga0rr50_55233_c1 3300050513 Bacteria 2962
1537 nmdc:mga0rr50_7345_c1 3300050513 Bacteria 6788
1538 nmdc:mga08x19_178479_c1 3300050514 Bacteria 1449
1539 nmdc:mga08x19_636687_c1 3300050514 Bacteria 756
1540 nmdc:mga0a205_288258_c1 3300050515 Bacteria 1517
1541 nmdc:mga0a205_38013_c1 3300050515 Bacteria 1119
1542 nmdc:mga0a205_4498_c1 3300050515 Bacteria 12508
1543 nmdc:mga0a205_490233_c1 3300050515 Bacteria 1086
1544 nmdc:mga0a205_51984_c1 3300050515 Bacteria 3955
1545 nmdc:mga0a205_595661_c1 3300050515 Bacteria 959
1546 nmdc:mga0a205_94481_c1 3300050515 Bacteria 2889
1547 Ga0495601_0001598 3300053077 Bacteria 12496
1548 Ga0495601_0003108 3300053077 Bacteria 9482
1549 Ga0495601_0004088 3300053077 Bacteria 8413
1550 Ga0495601_0007203 3300053077 Bacteria 6526
1551 Ga0495601_0016195 3300053077 Bacteria 4515
1552 Ga0495601_0016516 3300053077 Bacteria 4474
1553 Ga0495601_0021870 3300053077 Bacteria 3921
1554 Ga0495601_0354545 3300053077 Bacteria 953
1555 Ga0495601_0546898 3300053077 Bacteria 745
1556 Ga0495612_0000389 3300053078 Bacteria 17611
1557 Ga0495612_0001478 3300053078 Bacteria 9675
1558 Ga0495612_0001959 3300053078 Bacteria 8479
1559 Ga0495612_0002008 3300053078 Bacteria 8382
1560 Ga0495612_0011538 3300053078 Bacteria 3560
1561 Ga0495612_0055753 3300053078 Bacteria 1630
1562 Ga0495655_0002844 3300053083 Bacteria 2786
1563 Ga0495595_0000245 3300053084 Bacteria 21413
1564 Ga0495595_0000948 3300053084 Bacteria 11166
1565 Ga0495595_0001617 3300053084 Bacteria 8798
1566 Ga0495595_0003200 3300053084 Bacteria 6495
1567 Ga0495595_0012754 3300053084 Bacteria 3540
1568 Ga0495595_0055601 3300053084 Bacteria 1842
1569 Ga0495595_0056082 3300053084 Bacteria 1835
1570 Ga0495619_0000097 3300053085 Bacteria 65411
1571 Ga0495619_0000374 3300053085 Bacteria 30825
1572 Ga0495619_0000478 3300053085 Bacteria 26805
1573 Ga0495619_0003878 3300053085 Bacteria 9612
1574 Ga0495619_0004827 3300053085 Bacteria 8559
1575 Ga0495619_0004978 3300053085 Bacteria 8438
1576 Ga0495619_0012506 3300053085 Bacteria 5346
1577 Ga0495619_0022784 3300053085 Bacteria 4010
1578 Ga0495619_0034703 3300053085 Bacteria 3280
1579 Ga0495619_0091923 3300053085 Bacteria 2055
1580 Ga0495619_0128208 3300053085 Bacteria 1742
1581 Ga0495619_0239609 3300053085 Bacteria 1257
1582 Ga0500578_0116573 3300053086 Bacteria 1681
1583 Ga0500644_0045361 3300053088 Bacteria 1480
1584 Ga0500651_0077124 3300053093 Bacteria 2068
1585 Ga0500566_0066894 3300053094 Bacteria 2024
1586 Ga0500566_0150400 3300053094 Bacteria 1225
1587 Ga0500641_0009368 3300053096 Bacteria 3522
1588 Ga0500556_0057515 3300053104 Bacteria 1423
1589 Ga0500595_000002 3300053119 Bacteria 1074388
1590 Ga0500595_004561 3300053119 Bacteria 6185
1591 Ga0500595_009773 3300053119 Bacteria 3854
1592 Ga0500608_227735 3300053122 Bacteria 747
1593 Ga0500614_054725 3300053123 Bacteria 1058
1594 Ga0500642_0186617 3300053130 Bacteria 968
1595 Ga0500652_000002 3300053131 Bacteria 273315
1596 Ga0500652_000573 3300053131 Bacteria 12839
1597 Ga0500658_0158250 3300053134 Bacteria 1024
1598 Ga0500559_0004376 3300053136 Bacteria 6725
1599 Ga0500568_0064881 3300053139 Bacteria 1406
1600 Ga0500577_0111117 3300053142 Bacteria 1131
1601 Ga0500588_0125125 3300053146 Bacteria 910
1602 Ga0500604_0000195 3300053151 Bacteria 17351
1603 Ga0500616_0000002 3300053153 Bacteria 1611257
1604 Ga0500616_0001203 3300053153 Bacteria 26255
1605 Ga0500616_0151567 3300053153 Bacteria 1072
1606 Ga0500624_051645 3300053157 Bacteria 766
1607 Ga0500634_0000044 3300053161 Bacteria 56580
1608 Ga0500645_000754 3300053730 Bacteria 19812
1609 Ga0500609_002739 3300053731 Bacteria 2512
1610 Ga0500599_011949 3300053736 Bacteria 1162
1611 Ga0501084_0023104 3300054114 Bacteria 5191
1612 Ga0501084_0044964 3300054114 Bacteria 3697
1613 Ga0501084_0084758 3300054114 Bacteria 2660
1614 Ga0501084_0271606 3300054114 Bacteria 1431
1615 Ga0501084_0412750 3300054114 Bacteria 1141
1616 Ga0501084_0416655 3300054114 Bacteria 1135
1617 Ga0501084_0457806 3300054114 Bacteria 1078
1618 Ga0501082_0006052 3300060353 Bacteria 10500
1619 Ga0501082_0011230 3300060353 Bacteria 7695
1620 Ga0501082_0049211 3300060353 Bacteria 3634
1621 Ga0501082_0227781 3300060353 Bacteria 1622
1622 Ga0501082_0544200 3300060353 Bacteria 1015
1623 Ga0501082_0698736 3300060353 Bacteria 888
1624 Ga0466962_0157991 3300061719 Bacteria 1101
1625 Ga0530510_0009437 3300061734 Bacteria 6843
1626 Ga0530510_0123555 3300061734 Bacteria 1901
1627 Ga0530510_0126443 3300061734 Bacteria 1879
1628 Ga0530510_0779242 3300061734 Bacteria 729
1629 2643756254 2643221547 Bacteria 4740017
1630 2643912273 2643221580 Bacteria 3816678
1631 2643963466 2643221591 Bacteria 4397626
1632 2644410585 2643221674 Bacteria 3919126
1633 2644735972 2643221734 Bacteria 5365412
1634 2738946401 2738541317 Bacteria 5340176
1635 2739791261 2739367756 Bacteria 4553612
1636 2821124470 2821123053 Bacteria 7836056
1637 2838741035 2838736955 Bacteria 5760694
1638 2840883833 2840878972 Bacteria 5483153
1639 2841845068 2841840854 Bacteria 5761912
1640 2842144791 2842140634 Bacteria 5759631
1641 2857532051 2857531043 Bacteria 6754041
1642 2891050945 2891048133 Bacteria 4447501
1643 2913310814 2913308742 Bacteria 5350706
1644 2919680980 2919679072 Bacteria 4629602
1645 2932403294 2932401849 Bacteria 4262978
1646 2995393147 2995392953 Bacteria 4539380
1647 3000409126 3000405567 Bacteria 3779330
1648 8045865187 8045864390 Bacteria 5043873
1649 Ga0500641_0002272
1650 SwRhRL2b_contig_309045
1651 2214755772
1652 2214770210
1653 ARcpr5oldR_c000101
1654 ARSoilYngRDRAFT_c00241
1655 ARcpr5yngRDRAFT_c000102
1656 ARSoilOldRDRAFT_c000134
1657 ARCol0oldRDRAFT_c00121
1658 ARCol0yngRDRAFT_1000058
1659 JGI24032J14994_100156
1660 JGI24752J21851_1000685
1661 JGI24746J21847_1000232
1662 JGI24747J21853_1015233
1663 JGI24739J22299_10000103
1664 JGI24739J22299_10035598
1665 JGI24737J22298_10001448
1666 JGI24737J22298_10008010
1667 JGI24737J22298_10029151
1668 JGI24743J22301_10004796
1669 JGI24750J21931_1000146
1670 JGI24750J21931_1001748
1671 JGI24745J21846_1000381
1672 JGI24745J21846_1029319
1673 JGI24748J21848_1000880
1674 JGI24738J21930_10000080
1675 JGI24035J26624_1000077
1676 JGI24033J26618_1000650
1677 JGI24034J26672_10000241
1678 JGI24034J26672_10009334
1679 JGI24742J22300_10000066
1680 JGI24742J22300_10010687
1681 JGI24751J29686_10003146
1682 JGI24751J29686_10004621
1683 JGI25153J46596_10000012
1684 rootH2_10024840
1685 rootH1_10138961
1686 Ga0055531_10017501
1687 JGI25405J52794_10007814
1688 Ga0065717_1002263
1689 Ga0065716_1001748
1690 Ga0065704_10073258
1691 Ga0065704_10297603
1692 Ga0065712_10006326
1693 Ga0065712_10077314
1694 Ga0065712_10082297
1695 Ga0065712_10119729
1696 Ga0065715_10089784
1697 Ga0065715_10119480
1698 Ga0065707_10169025
1699 Ga0070658_10041006
1700 Ga0070658_10054057
1701 Ga0070658_10216384
1702 Ga0070676_10010179
1703 Ga0070676_10025524
1704 Ga0070676_10469042
1705 Ga0070683_100001199
1706 Ga0070683_100102147
1707 Ga0070683_100216813
1708 Ga0070683_100304765
1709 Ga0070690_100001740
1710 Ga0070690_100034038
1711 Ga0070690_100041801
1712 Ga0070670_100019604
1713 Ga0070670_100037807
1714 Ga0070670_100057926
1715 Ga0070670_100179979
1716 Ga0070677_10000497
1717 Ga0068869_100000236
1718 Ga0068869_100076887
1719 Ga0068869_100737423
1720 Ga0070666_10002453
1721 Ga0070666_10008751
1722 Ga0070680_100007477
1723 Ga0070680_100017862
1724 Ga0070680_100031380
1725 Ga0070680_100076653
1726 Ga0070680_100236345
1727 Ga0070680_100555056
1728 Ga0070682_100001100
1729 Ga0070682_100002602
1730 Ga0068868_100013245
1731 Ga0068868_100098536
1732 Ga0070660_100003492
1733 Ga0070660_100042365
1734 Ga0070660_100101864
1735 Ga0070660_100281957
1736 Ga0070689_100000466
1737 Ga0070689_100001040
1738 Ga0070689_100345745
1739 Ga0070689_100480293
1740 Ga0070691_10002256
1741 Ga0070691_10013301
1742 Ga0070691_10022786
1743 Ga0070687_100000277
1744 Ga0070687_100005651
1745 Ga0070687_100165924
1746 Ga0070661_100000444
1747 Ga0070661_100000827
1748 Ga0070661_100252817
1749 Ga0070661_100818290
1750 Ga0070692_10002292
1751 Ga0070692_10022458
1752 Ga0070692_10142335
1753 Ga0070668_100000073
1754 Ga0070668_100010921
1755 Ga0070668_100178834
1756 Ga0070668_100282898
1757 Ga0070668_100353187
1758 Ga0070668_100628320
1759 Ga0070668_100783763
1760 Ga0070668_101173540
1761 Ga0070669_100002399
1762 Ga0070669_100005353
1763 Ga0070675_100005703
1764 Ga0070675_100354821
1765 Ga0070675_100796216
1766 Ga0070671_100000736
1767 Ga0070671_100007103
1768 Ga0070671_100119314
1769 Ga0070671_100164568
1770 Ga0070674_100010959
1771 Ga0070674_100024433
1772 Ga0070674_100407318
1773 Ga0070673_100000302
1774 Ga0070673_100000548
1775 Ga0070673_100663916
1776 Ga0070688_100000195
1777 Ga0070688_100004878
1778 Ga0070688_100012314
1779 Ga0070659_100000822
1780 Ga0070659_100001555
1781 Ga0070659_100054692
1782 Ga0070659_100323925
1783 Ga0070659_100637490
1784 Ga0070667_100002225
1785 Ga0070667_100002272
1786 Ga0070667_100065449
1787 Ga0070667_100120120
1788 Ga0070667_100433302
1789 Ga0070703_10001123
1790 Ga0070703_10009774
1791 Ga0070709_10007205
1792 Ga0070709_10016552
1793 Ga0070709_10018980
1794 Ga0070709_10052725
1795 Ga0070709_10190331
1796 Ga0070714_100002308
1797 Ga0070714_100031420
1798 Ga0070714_100043457
1799 Ga0070714_100072813
1800 Ga0070714_100080604
1801 Ga0070714_100132687
1802 Ga0070714_101061404
1803 Ga0070713_100004212
1804 Ga0070713_100222693
1805 Ga0070710_10007408
1806 Ga0070710_10014126
1807 Ga0070710_10016794
1808 Ga0070710_10588971
1809 Ga0070701_10000864
1810 Ga0070701_10006785
1811 Ga0070701_10302493
1812 Ga0070711_100000336
1813 Ga0070711_100050762
1814 Ga0070711_100080319
1815 Ga0070711_100103656
1816 Ga0070711_100115857
1817 Ga0070711_100157542
1818 Ga0070711_100380264
1819 Ga0070705_100001041
1820 Ga0070705_100001212
1821 Ga0070705_100100465
1822 Ga0070700_100000209
1823 Ga0070700_100001313
1824 Ga0070700_100028154
1825 Ga0070694_100000343
1826 Ga0070694_100003865
1827 Ga0070694_100071827
1828 Ga0070694_100148829
1829 Ga0070694_100175963
1830 Ga0070694_100407296
1831 Ga0070708_100499273
1832 Ga0070663_100018174
1833 Ga0070663_100021939
1834 Ga0070663_100402824
1835 Ga0070663_100553294
1836 Ga0070678_100000082
1837 Ga0070678_100005062
1838 Ga0070678_100133772
1839 Ga0070662_100004072
1840 Ga0070662_100019074
1841 Ga0070662_100086416
1842 Ga0070662_100141427
1843 Ga0070681_10058442
1844 Ga0070681_10169297
1845 Ga0070681_10342265
1846 Ga0070681_10391767
1847 Ga0070681_10831937
1848 Ga0070681_10933106
1849 Ga0068867_100001495
1850 Ga0068867_100069902
1851 Ga0070685_10005500
1852 Ga0070685_10005707
1853 Ga0070685_10071039
1854 Ga0070706_100085616
1855 Ga0070698_100002489
1856 Ga0070699_100060595
1857 Ga0070699_100541878
1858 Ga0070679_100003133
1859 Ga0070679_100021336
1860 Ga0070679_100027099
1861 Ga0070679_100095625
1862 Ga0070679_100179346
1863 Ga0070679_100429212
1864 Ga0070684_100005932
1865 Ga0070684_100009801
1866 Ga0070684_100079817
1867 Ga0070684_100452692
1868 Ga0070697_100007418
1869 Ga0070697_100323743
1870 Ga0070697_100392305
1871 Ga0068853_100000919
1872 Ga0068853_100001418
1873 Ga0068853_100237770
1874 Ga0068853_100537083
1875 Ga0070672_100004500
1876 Ga0070672_100012678
1877 Ga0070672_100278007
1878 Ga0070672_100558303
1879 Ga0070686_100000488
1880 Ga0070686_100016109
1881 Ga0070686_100019659
1882 Ga0070686_100026543
1883 Ga0070695_100000199
1884 Ga0070695_100002834
1885 Ga0070696_100025653
1886 Ga0070696_100038159
1887 Ga0070696_100039045
1888 Ga0070696_100134549
1889 Ga0070696_100263134
1890 Ga0070693_100001088
1891 Ga0070693_100002155
1892 Ga0070693_100604826
1893 Ga0070665_100036419
1894 Ga0070665_100539115
1895 Ga0070665_100604063
1896 Ga0070704_100002291
1897 Ga0070704_100009996
1898 Ga0070704_100016677
1899 Ga0070704_100674305
1900 Ga0068855_100007603
1901 Ga0068855_100087832
1902 Ga0068855_100104984
1903 Ga0068855_100210414
1904 Ga0070664_100002753
1905 Ga0070664_100008587
1906 Ga0070664_100059778
1907 Ga0070664_100384799
1908 Ga0068857_100001539
1909 Ga0068857_100014667
1910 Ga0068857_100317658
1911 Ga0068857_100322633
1912 Ga0068854_100000611
1913 Ga0068854_100002718
1914 Ga0068856_100001722
1915 Ga0068856_100004058
1916 Ga0068856_100472386
1917 Ga0068856_100637316
1918 Ga0068856_101434292
1919 Ga0070702_100000629
1920 Ga0070702_100007674
1921 Ga0068852_100001817
1922 Ga0068852_100019347
1923 Ga0068852_100345453
1924 Ga0068859_100010286
1925 Ga0068859_100028582
1926 Ga0068859_100067731
1927 Ga0068859_100445196
1928 Ga0068859_100631253
1929 Ga0068864_100001077
1930 Ga0068864_100002498
1931 Ga0068866_10003421
1932 Ga0068866_10004287
1933 Ga0068866_10079424
1934 Ga0068866_10461815
1935 Ga0068866_10471624
1936 Ga0068861_100000276
1937 Ga0068861_100000668
1938 Ga0068861_100746055
1939 Ga0068861_101141037
1940 Ga0068851_10088430
1941 Ga0068870_10000676
1942 Ga0068863_100004649
1943 Ga0068863_100079646
1944 Ga0068863_100149658
1945 Ga0068858_100008130
1946 Ga0068858_100040605
1947 Ga0068858_100049152
1948 Ga0068858_100266723
1949 Ga0068860_100001413
1950 Ga0068860_100007431
1951 Ga0068860_100055702
1952 Ga0068860_100580770
1953 Ga0068860_100693620
1954 Ga0068862_100003455
1955 Ga0068862_100008906
1956 Ga0068862_100043721
1957 Ga0068862_100317644
1958 Ga0068862_101205480
1959 Ga0081455_10000327
1960 Ga0081455_10001182
1961 Ga0081455_10021675
1962 Ga0081455_10517411
1963 Ga0081540_1000205
1964 Ga0081540_1002248
1965 Ga0070717_10000258
1966 Ga0070717_10001681
1967 Ga0070717_10186052
1968 Ga0070717_10261035
1969 Ga0075365_10363787
1970 Ga0075363_100107412
1971 Ga0075432_10008052
1972 Ga0075432_10037257
1973 Ga0070715_10016112
1974 Ga0070716_100003087
1975 Ga0070716_100007734
1976 Ga0070712_100004644
1977 Ga0070712_100006392
1978 Ga0070712_100150712
1979 Ga0070712_100160167
1980 Ga0070712_100412959
1981 Ga0070712_100481331
1982 Ga0070712_100662480
1983 Ga0075367_10217734
1984 Ga0075367_10244842
1985 Ga0097621_100000892
1986 Ga0097621_100097765
1987 Ga0097621_100345971
1988 Ga0075370_10014898
1989 Ga0068871_100010466
1990 Ga0068871_100034066
1991 Ga0068871_100061166
1992 Ga0068871_100157416
1993 Ga0075428_100035887
1994 Ga0075428_100098461
1995 Ga0075428_100221947
1996 Ga0075428_100286031
1997 Ga0075430_100007678
1998 Ga0075431_100007378
1999 Ga0075431_100047137
2000 Ga0075433_10002306
2001 Ga0075433_10003286
2002 Ga0075433_10006637
2003 Ga0075433_10370612
2004 Ga0075434_100000110
2005 Ga0075434_100001583
2006 Ga0075434_100023586
2007 Ga0075434_100023964
2008 Ga0075434_100424611
2009 Ga0075434_100441836
2010 Ga0075434_100520746
2011 Ga0075429_100006496
2012 Ga0075429_100051597
2013 Ga0068865_100000452
2014 Ga0068865_100059223
2015 Ga0068865_100127075
2016 Ga0075436_100009283
2017 Ga0075436_100082624
2018 Ga0075436_100251899
2019 Ga0097620_100010289
2020 Ga0097620_100028581
2021 Ga0097620_100067730
2022 Ga0097620_100445196
2023 Ga0097620_100631251
2024 Ga0075435_100026293
2025 Ga0075435_100066443
2026 Ga0075435_100069762
2027 Ga0075435_100086971
2028 Ga0075435_100459165
2029 Ga0099795_10003149
2030 Ga0105251_10032957
2031 Ga0105250_10092556
2032 Ga0105240_10215689
2033 Ga0105240_10230619
2034 Ga0105240_10377979
2035 Ga0105240_10605736
2036 Ga0105240_10911785
2037 Ga0111539_10002712
2038 Ga0111539_10011154
2039 Ga0111539_10016303
2040 Ga0111539_10126058
2041 Ga0111539_10379568
2042 Ga0111539_10747682
2043 Ga0111539_11156871
2044 Ga0105245_10000380
2045 Ga0105245_10006135
2046 Ga0105245_10175950
2047 Ga0105245_10501778
2048 Ga0105247_10000149
2049 Ga0105247_10065522
2050 Ga0105247_10095025
2051 Ga0105247_10095195
2052 Ga0105247_10260251
2053 Ga0105247_10494361
2054 Ga0114129_10058215
2055 Ga0114129_10086721
2056 Ga0114129_10624243
2057 Ga0114129_10900172
2058 Ga0105243_10002254
2059 Ga0105243_10010900
2060 Ga0105243_10020668
2061 Ga0105243_10109431
2062 Ga0105241_10000342
2063 Ga0105241_10028423
2064 Ga0105241_10049537
2065 Ga0105242_10000855
2066 Ga0105242_10010407
2067 Ga0105242_10114826
2068 Ga0105242_10678911
2069 Ga0105248_10012394
2070 Ga0105248_10020318
2071 Ga0105248_10027173
2072 Ga0105248_10197918
2073 Ga0105248_10227162
2074 Ga0105248_10530630
2075 Ga0105248_10542817
2076 Ga0105248_10566771
2077 Ga0105237_10007867
2078 Ga0105237_10165865
2079 Ga0105237_10350105
2080 Ga0105237_10350974
2081 Ga0105237_10677464
2082 Ga0105238_10034607
2083 Ga0105238_10053194
2084 Ga0105238_10123478
2085 Ga0105238_10161315
2086 Ga0105238_10282017
2087 Ga0105249_10001149
2088 Ga0105249_10001982
2089 Ga0105249_10019413
2090 Ga0105249_10089178
2091 Ga0105249_10492087
2092 Ga0105249_10655476
2093 Ga0105239_10009977
2094 Ga0105239_10012830
2095 Ga0105239_10016747
2096 Ga0105239_10042492
2097 Ga0105239_10128052
2098 Ga0105239_10172256
2099 Ga0105239_10366397
2100 Ga0105239_10489591
2101 Ga0105246_10000185
2102 Ga0105246_10000551
2103 Ga0105246_10181057
2104 Ga0105246_10231406
2105 Ga0157316_1005628
2106 Ga0157326_1002949
2107 Ga0157373_10003537
2108 Ga0157373_10162794
2109 Ga0157371_10003492
2110 Ga0157371_10290611
2111 Ga0157371_10503394
2112 Ga0157370_10017515
2113 Ga0157370_10156140
2114 Ga0157370_10347936
2115 Ga0157369_10009077
2116 Ga0157369_10323622
2117 Ga0157369_10433702
2118 Ga0157369_11153545
2119 Ga0157374_10001986
2120 Ga0157374_10033399
2121 Ga0157374_10393963
2122 Ga0157378_10000562
2123 Ga0157378_10001729
2124 Ga0157378_10354418
2125 Ga0157378_10645780
2126 Ga0163162_10002599
2127 Ga0163162_10012026
2128 Ga0163162_10026532
2129 Ga0163162_10057878
2130 Ga0163162_11109611
2131 Ga0163162_11176548
2132 Ga0157372_10013072
2133 Ga0157372_10024601
2134 Ga0157372_10469662
2135 Ga0157372_10704144
2136 Ga0157372_11055238
2137 Ga0157372_11545538
2138 Ga0157372_11829562
2139 Ga0157375_10001883
2140 Ga0157375_10009804
2141 Ga0157375_10735558
2142 Ga0163163_10010785
2143 Ga0163163_10052955
2144 Ga0163163_10295679
2145 Ga0163163_11087474
2146 Ga0157380_10007676
2147 Ga0157380_10044469
2148 Ga0157380_10604439
2149 Ga0182008_10339647
2150 Ga0157377_10000643
2151 Ga0157377_10000976
2152 Ga0157377_10251475
2153 Ga0157379_10001319
2154 Ga0157379_10010633
2155 Ga0157379_10026543
2156 Ga0157379_10542342
2157 Ga0157379_10721946
2158 Ga0157379_10836867
2159 Ga0157376_10000920
2160 Ga0157376_10331481
2161 Ga0157376_10821294
2162 Ga0163161_10000379
2163 Ga0163161_10050582
2164 Ga0213872_10005036
2165 Ga0213872_10019936
2166 Ga0213872_10044651
2167 Ga0213872_10052410
2168 Ga0213872_10064084
2169 Ga0213872_10191674
2170 Ga0213872_10198763
2171 Ga0213872_10251927
2172 Ga0213876_10056342
2173 Ga0213876_10235051
2174 Ga0224712_10226411
2175 Ga0228598_1010359
2176 Ga0207666_1000046
2177 Ga0207673_1000461
2178 Ga0209675_1000815
2179 Ga0209758_1000059
2180 Ga0209050_1007717
2181 Ga0209257_1002470
2182 Ga0207697_10000714
2183 Ga0207697_10080072
2184 Ga0207697_10097630
2185 Ga0207656_10152083
2186 Ga0207713_1076792
2187 Ga0207653_10004733
2188 Ga0207653_10024086
2189 Ga0207682_10000043
2190 Ga0207692_10007751
2191 Ga0207692_10031679
2192 Ga0207692_10055266
2193 Ga0207692_10109043
2194 Ga0207692_10243538
2195 Ga0207692_10416306
2196 Ga0207642_10002212
2197 Ga0207642_10179129
2198 Ga0207710_10001577
2199 Ga0207710_10002657
2200 Ga0207710_10004284
2201 Ga0207710_10019470
2202 Ga0207710_10079101
2203 Ga0207688_10000083
2204 Ga0207688_10010182
2205 Ga0207688_10036653
2206 Ga0207680_10005187
2207 Ga0207680_10056824
2208 Ga0207647_10000860
2209 Ga0207647_10025829
2210 Ga0207647_10147142
2211 Ga0207647_10165868
2212 Ga0207685_10000556
2213 Ga0207685_10015976
2214 Ga0207699_10009985
2215 Ga0207699_10035800
2216 Ga0207699_10065818
2217 Ga0207699_10335319
2218 Ga0207645_10002954
2219 Ga0207645_10012797
2220 Ga0207645_10015101
2221 Ga0207645_10160586
2222 Ga0207643_10000128
2223 Ga0207684_10081199
2224 Ga0207654_10001559
2225 Ga0207654_10022636
2226 Ga0207654_10073229
2227 Ga0207707_10004600
2228 Ga0207707_10154688
2229 Ga0207707_10165913
2230 Ga0207707_10352748
2231 Ga0207707_10354102
2232 Ga0207695_10074493
2233 Ga0207695_10302312
2234 Ga0207695_10496752
2235 Ga0207695_10784858
2236 Ga0207671_10013743
2237 Ga0207671_10097503
2238 Ga0207671_10151757
2239 Ga0207671_10563248
2240 Ga0207693_10000529
2241 Ga0207693_10008254
2242 Ga0207693_10012476
2243 Ga0207693_10013222
2244 Ga0207693_10022622
2245 Ga0207693_10116477
2246 Ga0207693_10122173
2247 Ga0207693_10137404
2248 Ga0207693_10208215
2249 Ga0207663_10009148
2250 Ga0207663_10016239
2251 Ga0207663_10019053
2252 Ga0207663_10079527
2253 Ga0207663_10396746
2254 Ga0207660_10001486
2255 Ga0207660_10019957
2256 Ga0207660_10058413
2257 Ga0207660_10317464
2258 Ga0207662_10000301
2259 Ga0207662_10017285
2260 Ga0207662_10034661
2261 Ga0207662_10347895
2262 Ga0207657_10000034
2263 Ga0207657_10001859
2264 Ga0207657_10047359
2265 Ga0207657_10107787
2266 Ga0207657_10126814
2267 Ga0207657_10210978
2268 Ga0207657_10554621
2269 Ga0207649_10003562
2270 Ga0207649_10046661
2271 Ga0207649_10579136
2272 Ga0207652_10016674
2273 Ga0207652_10016935
2274 Ga0207652_10028837
2275 Ga0207652_10153811
2276 Ga0207652_10259840
2277 Ga0207652_10425761
2278 Ga0207652_10667733
2279 Ga0207681_10004864
2280 Ga0207681_10074552
2281 Ga0207681_10184177
2282 Ga0207694_10076101
2283 Ga0207694_10430842
2284 Ga0207694_11039257
2285 Ga0207650_10019558
2286 Ga0207650_10227170
2287 Ga0207659_10000411
2288 Ga0207659_10079974
2289 Ga0207659_10508788
2290 Ga0207687_10000667
2291 Ga0207687_10018650
2292 Ga0207687_10259128
2293 Ga0207687_10371082
2294 Ga0207687_10626340
2295 Ga0207687_10713498
2296 Ga0207700_10000412
2297 Ga0207700_10040508
2298 Ga0207700_10127157
2299 Ga0207700_10189586
2300 Ga0207700_10442670
2301 Ga0207664_10050429
2302 Ga0207664_10107056
2303 Ga0207664_10146170
2304 Ga0207664_10571302
2305 Ga0207664_10663317
2306 Ga0207644_10005279
2307 Ga0207644_10009684
2308 Ga0207644_10100107
2309 Ga0207690_10002854
2310 Ga0207690_10009329
2311 Ga0207690_10015321
2312 Ga0207690_10255426
2313 Ga0207690_10632295
2314 Ga0207706_10000076
2315 Ga0207706_10004082
2316 Ga0207706_10031063
2317 Ga0207706_10581919
2318 Ga0207686_10000579
2319 Ga0207686_10006100
2320 Ga0207686_10028646
2321 Ga0207686_10033530
2322 Ga0207709_10000551
2323 Ga0207709_10183425
2324 Ga0207670_10000556
2325 Ga0207670_10087654
2326 Ga0207670_10503842
2327 Ga0207669_10000675
2328 Ga0207669_10005589
2329 Ga0207669_10015571
2330 Ga0207704_10002887
2331 Ga0207704_10052578
2332 Ga0207704_10109694
2333 Ga0207704_10147674
2334 Ga0207665_10004186
2335 Ga0207665_10014619
2336 Ga0207665_10628799
2337 Ga0207691_10000599
2338 Ga0207691_10001503
2339 Ga0207691_10063150
2340 Ga0207691_10118905
2341 Ga0207691_10191152
2342 Ga0207711_10010308
2343 Ga0207711_10073399
2344 Ga0207711_10102849
2345 Ga0207711_10312423
2346 Ga0207711_10597243
2347 Ga0207711_10612320
2348 Ga0207689_10000165
2349 Ga0207689_10510297
2350 Ga0207661_10008897
2351 Ga0207661_10390719
2352 Ga0207661_10445194
2353 Ga0207661_10573814
2354 Ga0207679_10000112
2355 Ga0207679_10022367
2356 Ga0207679_10044874
2357 Ga0207679_10235269
2358 Ga0207679_10508258
2359 Ga0207679_10593120
2360 Ga0207667_10017788
2361 Ga0207667_10038289
2362 Ga0207667_10039284
2363 Ga0207651_10000099
2364 Ga0207651_10006660
2365 Ga0207651_10938824
2366 Ga0207712_10001637
2367 Ga0207712_10019595
2368 Ga0207712_10267370
2369 Ga0207712_10548364
2370 Ga0207668_10000608
2371 Ga0207668_10000713
2372 Ga0207668_10105270
2373 Ga0207668_10239295
2374 Ga0207668_10339214
2375 Ga0207668_10684886
2376 Ga0207668_10757489
2377 Ga0207640_10002957
2378 Ga0207640_10015077
2379 Ga0207640_10119188
2380 Ga0207640_11345309
2381 Ga0207658_10003702
2382 Ga0207658_10007098
2383 Ga0207658_10067675
2384 Ga0207658_10441690
2385 Ga0207677_10010465
2386 Ga0207677_10189705
2387 Ga0207703_10018016
2388 Ga0207703_10058062
2389 Ga0207703_10177919
2390 Ga0207639_10002883
2391 Ga0207639_10040112
2392 Ga0207639_10054896
2393 Ga0207639_11049938
2394 Ga0207678_10000036
2395 Ga0207678_10001329
2396 Ga0207678_10029433
2397 Ga0207678_10036192
2398 Ga0207708_10000862
2399 Ga0207708_10002574
2400 Ga0207708_10019839
2401 Ga0207702_10007796
2402 Ga0207702_10014330
2403 Ga0207702_10148575
2404 Ga0207702_10307944
2405 Ga0207641_10001462
2406 Ga0207648_10001891
2407 Ga0207648_10071963
2408 Ga0207648_10081422
2409 Ga0207648_10287023
2410 Ga0207648_10288236
2411 Ga0207676_10001459
2412 Ga0207676_10051116
2413 Ga0207676_10136555
2414 Ga0207674_10006899
2415 Ga0207674_10010119
2416 Ga0207674_10212794
2417 Ga0207675_100000970
2418 Ga0207675_100001575
2419 Ga0207675_100040944
2420 Ga0207675_100111099
2421 Ga0207675_100171943
2422 Ga0207683_10000015
2423 Ga0207683_10001273
2424 Ga0207683_10004182
2425 Ga0207683_10026331
2426 Ga0207698_10006111
2427 Ga0207698_10133389
2428 Ga0207698_10428258
2429 Ga0209967_1010797
2430 Ga0210002_1002548
2431 Ga0209966_1007471
2432 Ga0209998_10008713
2433 Ga0209998_10009907
2434 Ga0209998_10012414
2435 Ga0209813_10091554
2436 Ga0209974_10020171
2437 Ga0209974_10037821
2438 Ga0209974_10101701
2439 Ga0209974_10183133
2440 Ga0207428_10000064
2441 Ga0207428_10000242
2442 Ga0207428_10003078
2443 Ga0207428_10006523
2444 Ga0207428_10018880
2445 Ga0207428_10116694
2446 Ga0207428_10393931
2447 Ga0268266_10010320
2448 Ga0268266_10052520
2449 Ga0268266_10279011
2450 Ga0268266_10366594
2451 Ga0268265_10003386
2452 Ga0268265_10017919
2453 Ga0268265_10064227
2454 Ga0268265_10149253
2455 Ga0268265_10312259
2456 Ga0268265_10540866
2457 Ga0268264_10003086
2458 Ga0268264_10029045
2459 Ga0268264_10385373
2460 Ga0265337_1001177
2461 Ga0307517_10170521
2462 Ga0307515_10399551
2463 Ga0265338_10258059
2464 Ga0265338_10495578
2465 Ga0307512_10153748
2466 Ga0265332_10121148
2467 Ga0265325_10000006
2468 Ga0265325_10004786
2469 Ga0265325_10046663
2470 Ga0265340_10125513
2471 Ga0265339_10004854
2472 Ga0265339_10120475
2473 Ga0265331_10001499
2474 Ga0265331_10028325
2475 Ga0265331_10115002
2476 Ga0265316_10085349
2477 Ga0265316_10238217
2478 Ga0307513_10110818
2479 Ga0307513_10377135
2480 Ga0265313_10000607
2481 Ga0265313_10001122
2482 Ga0265313_10004369
2483 Ga0265313_10004848
2484 Ga0265313_10005418
2485 Ga0265313_10009773
2486 Ga0265313_10018409
2487 Ga0265313_10031666
2488 Ga0265313_10139042
2489 Ga0307508_10416473
2490 Ga0316579_10058416
2491 Ga0265314_10001736
2492 Ga0265314_10017596
2493 Ga0265314_10276337
2494 Ga0265342_10001631
2495 Ga0307516_10105803
2496 Ga0307405_10118164
2497 Ga0307405_10121183
2498 Ga0307413_10009874
2499 Ga0307413_10009990
2500 Ga0307410_10043510
2501 Ga0307410_10242584
2502 Ga0307409_100061798
2503 Ga0307409_100240162
2504 Ga0307416_100294688
2505 Ga0307414_10015861
2506 Ga0307414_10249203
2507 Ga0316583_10027901
2508 Ga0373930_0065650
2509 Ga0373948_0002551
2510 Ga0373948_0008375
2511 Ga0373950_0000575
2512 Ga0373950_0032149
2513 Ga0373958_0002130
2514 Ga0373958_0002762
2515 Ga0373958_0005151
2516 Ga0373958_0050053
2517 Ga0373959_0001506
2518 Ga0373959_0014183
2519 Ga0373938_0000276
2520 Ga0373938_0027355
2521 Ga0373926_0010141
2522 Ga0373928_0000820
2523 Ga0373929_0000359
2524 Ga0373934_0023173
2525 Ga0373934_0179501
2526 Ga0373940_0000049
2527 Ga0373944_0006580
2528 Ga0373949_0001191
2529 Ga0373949_0002203
2530 Ga0373949_0007218
2531 Ga0373949_0013764
2532 Ga0373949_0037096
2533 Ga0373951_0000518
2534 Ga0373951_0022569
2535 Ga0373951_0039210
2536 Ga0373952_0000453
2537 Ga0373952_0000483
2538 Ga0373923_0001175
2539 Ga0373923_0068057
2540 Ga0373923_0071871
2541 Ga0373923_0215839
2542 Ga0373932_0000462
2543 Ga0373932_0002820
2544 Ga0373932_0027182
2545 Ga0373936_0000328
2546 Ga0373939_0001076
2547 Ga0373939_0003300
2548 Ga0373939_0071596
2549 Ga0373941_0000219
2550 Ga0373941_0001129
2551 Ga0373941_0048238
2552 Ga0373945_0000123
2553 Ga0373954_0012572
2554 Ga0373954_0026139
2555 Ga0373954_0161299
2556 Ga0373956_0045117
2557 Ga0373956_0048847
2558 Ga0373956_0094785
2559 Ga0373957_0002486
2560 Ga0373957_0004774
2561 Ga0373957_0032381
2562 Ga0373957_0047990
2563 Ga0373957_0124575
2564 Ga0373960_0001504
2565 Ga0373960_0013304
2566 Ga0373960_0046765
2567 Ga0373943_0001821
2568 Ga0373943_0028120
2569 Ga0373946_0003579
2570 Ga0373946_0006894
2571 Ga0373946_0018373
2572 Ga0373946_0029864
2573 Ga0373955_0001781
2574 Ga0373955_0003764
2575 Ga0373955_0053359
2576 Ga0373955_0140688
2577 Ga0373942_0004252
2578 Ga0373942_0012705
2579 Ga0373942_0023528
2580 Ga0373961_0013321
2581 Ga0373961_0019442
2582 Ga0373962_0000215
2583 Ga0373962_0001429
2584 Ga0373962_0002252
2585 Ga0373962_0006643
2586 Ga0373962_0041030
2587 Ga0316574_0536579
2588 Ga0373924_0005980
2589 Ga0373924_0024323
2590 Ga0373931_0004700
2591 Ga0373931_0006133
2592 Ga0373931_0006569
2593 Ga0373931_0014856
2594 Ga0373931_0021068
2595 Ga0373931_0047512
2596 Ga0373931_0047908
2597 Ga0373931_0118356
2598 Ga0373931_0149622
2599 Ga0373935_0008365
2600 Ga0373935_0010930
2601 Ga0373935_0136849
2602 Ga0373935_0243858
2603 Ga0373927_0002377
2604 Ga0373927_0009145
2605 Ga0373927_0059332
2606 Ga0373927_0159507
2607 Ga0373927_0303532
2608 Ga0373933_0003512
2609 Ga0373933_0005999
2610 Ga0373933_0014137
2611 Ga0373933_0133774
2612 Ga0373933_0436573
2613 Ga0373947_0002454
2614 Ga0373947_0003283
2615 Ga0373947_0005390
2616 Ga0373947_0028558
2617 Ga0373947_0155628
2618 Ga0373937_0000977
2619 Ga0373937_0000998
2620 Ga0373937_0011819
2621 Ga0373937_0013390
2622 Ga0373937_0067460
2623 Ga0373937_0076111
2624 Ga0373937_0090816
2625 Ga0373937_0145830
2626 Ga0373937_0204092
2627 Ga0373937_0512692
2628 Ga0373937_0612640
2629 Ga0373937_0686032
2630 Ga0373925_0002457
2631 Ga0373925_0005022
2632 Ga0373925_0027418
2633 Ga0373925_0109865
2634 Ga0373925_0240585
2635 Ga0395899_0057420
2636 Ga0395899_0146243
2637 Ga0395900_0017768
2638 Ga0395900_0019767
2639 Ga0395900_0086905
2640 Ga0395900_0634675
2641 Ga0395898_0019586
2642 Ga0395898_0047491
2643 Ga0395898_0054044
2644 Ga0395898_0081580
2645 Ga0395905_0002014
2646 Ga0436364_1021069
2647 Ga0395901_0003370
2648 Ga0395901_0029286
2649 Ga0395901_0145242
2650 Ga0395901_1384808
2651 Ga0242420_022331
2652 Ga0436365_0648744
2653 Ga0436365_1068563
2654 Ga0436365_1158499
2655 Ga0436361_0024076
2656 Ga0436361_0120642
2657 Ga0436361_0125156
2658 Ga0436361_0244861
2659 Ga0436361_0294175
2660 Ga0436361_0407501
2661 Ga0436361_0484050
2662 Ga0436361_0724345
2663 Ga0436361_0795199
2664 Ga0436361_1098427
2665 Ga0436363_0925274
2666 Ga0436363_1200294
2667 Ga0436362_1126626
2668 Ga0439443_016357
2669 Ga0439448_0056871
2670 Ga0451577_0110442
2671 Ga0451577_0614127
2672 Ga0466969_0000193
2673 Ga0466966_0009486
2674 Ga0466966_0069666
2675 Ga0466961_0009053
2676 Ga0466963_0025049
2677 Ga0466963_0244355
2678 Ga0466964_0163124
2679 Ga0453684_0010839
2680 Ga0453684_0198644
2681 Ga0453684_0469786
2682 Ga0466971_0092771
2683 Ga0466968_0369160
2684 Ga0466970_0004501
2685 Ga0466957_0118503
2686 Ga0466957_0455909
2687 Ga0466959_0000118
2688 Ga0451576_0105771
2689 Ga0451576_1698745
2690 Ga0466958_0000804
2691 Ga0466958_0049465
2692 Ga0466958_0407568
2693 Ga0466958_0532629
2694 Ga0466967_0002046
2695 Ga0466967_0071094
2696 Ga0466967_0534660
2697 Ga0466967_0617482
2698 Ga0495617_119755
2699 Ga0495592_0002187
2700 Ga0495592_0003145
2701 Ga0495592_0011852
2702 Ga0495592_0153609
2703 Ga0495603_0000127
2704 Ga0495603_0006157
2705 Ga0495603_0010152
2706 Ga0495603_0011477
2707 Ga0495629_0000474
2708 Ga0495629_0001081
2709 Ga0495629_0001491
2710 Ga0495629_0037772
2711 Ga0495629_0095292
2712 Ga0495638_0252564
2713 Ga0495641_0000716
2714 Ga0495641_0069602
2715 Ga0495651_0001830
2716 Ga0495651_0063498
2717 Ga0495651_0206807
2718 Ga0495653_0001477
2719 Ga0495653_0002011
2720 Ga0495653_0101812
2721 Ga0495653_0277799
2722 Ga0495580_0000533
2723 Ga0495580_0001373
2724 Ga0495580_0029341
2725 Ga0495582_0000310
2726 Ga0495582_0001241
2727 Ga0495582_0131370
2728 Ga0495605_0061919
2729 Ga0495605_0133320
2730 Ga0495639_0000593
2731 Ga0495639_0000991
2732 Ga0495639_0005266
2733 Ga0495662_0000599
2734 Ga0495664_0001780
2735 Ga0495664_0008385
2736 Ga0495664_0089917
2737 Ga0495664_0120397
2738 Ga0495584_0019476
2739 Ga0495585_0012307
2740 Ga0495594_0000972
2741 Ga0495594_0004519
2742 Ga0495594_0023664
2743 Ga0495594_0282116
2744 Ga0495608_0000844
2745 Ga0495608_0029605
2746 Ga0495608_0035340
2747 Ga0495618_0003351
2748 Ga0495618_0006349
2749 Ga0495618_0010591
2750 Ga0495618_0112356
2751 Ga0495628_0017046
2752 Ga0495628_0022156
2753 Ga0495628_0079335
2754 Ga0495628_0201198
2755 Ga0495630_0031825
2756 Ga0495637_0131902
2757 Ga0495644_0001924
2758 Ga0495666_0005432
2759 Ga0495666_0020312
2760 Ga0495666_0164387
2761 Ga0495652_0001947
2762 Ga0495652_0003249
2763 Ga0495652_0012241
2764 Ga0495652_0026434
2765 Ga0495665_0000185
2766 Ga0495665_0007528
2767 Ga0495665_0009023
2768 Ga0495640_0006612
2769 Ga0495640_0006875
2770 Ga0495640_0149666
2771 Ga0495640_0207370
2772 Ga0495640_0404409
2773 Ga0495586_0003393
2774 Ga0495586_0028093
2775 Ga0495587_0000732
2776 Ga0495587_0011211
2777 Ga0495587_0017113
2778 Ga0495609_0106058
2779 Ga0495621_0033590
2780 Ga0495645_0003961
2781 Ga0495622_0001379
2782 Ga0495622_0028177
2783 Ga0495622_0155688
2784 Ga0495633_0004731
2785 Ga0495633_0253866
2786 Ga0495633_0254472
2787 Ga0495667_0002039
2788 Ga0495667_0002260
2789 Ga0495667_0007395
2790 Ga0495667_0008839
2791 Ga0495667_0076054
2792 Ga0495667_0403086
2793 Ga0495656_0000505
2794 Ga0495656_0104372
2795 Ga0495634_0005916
2796 Ga0495634_0006195
2797 Ga0495634_0027885
2798 Ga0495634_0047227
2799 Ga0495634_0136594
2800 Ga0495611_0018877
2801 Ga0495625_0308326
2802 Ga0495635_0002667
2803 Ga0495635_0008996
2804 Ga0495635_0018383
2805 Ga0495635_0035752
2806 Ga0495659_0000862
2807 Ga0495659_0114240
2808 Ga0495588_0000855
2809 Ga0495588_0006169
2810 Ga0495588_0042747
2811 Ga0495657_0019080
2812 Ga0495657_0061658
2813 Ga0495599_0013241
2814 Ga0495599_0037130
2815 Ga0495599_0052645
2816 Ga0495599_0114342
2817 Ga0495623_0003160
2818 Ga0495623_0040188
2819 Ga0495623_0078630
2820 Ga0495646_0000681
2821 Ga0495646_0009918
2822 Ga0495646_0109730
2823 Ga0495647_0006977
2824 Ga0495647_0010913
2825 Ga0495647_0016276
2826 Ga0495658_0000453
2827 Ga0495658_0000640
2828 Ga0495658_0003124
2829 Ga0495658_0011916
2830 Ga0495658_0146918
2831 Ga0495669_0000388
2832 Ga0495613_0000450
2833 Ga0495613_0005450
2834 Ga0495613_0010177
2835 Ga0495613_0059445
2836 Ga0495624_0000990
2837 Ga0495624_0285763
2838 Ga0495670_0014504
2839 Ga0495649_0168837
2840 Ga0495600_0000326
2841 Ga0495600_0055531
2842 Ga0495600_0058587
2843 Ga0495600_0088439
2844 Ga0495581_0000462
2845 Ga0495581_0010642
2846 Ga0495604_0000643
2847 Ga0495604_0002511
2848 Ga0495604_0009753
2849 Ga0495604_0050376
2850 Ga0495604_0310948
2851 Ga0495604_0321008
2852 Ga0495674_0003479
2853 Ga0495674_0008425
2854 Ga0495674_0027234
2855 Ga0495674_0039411
2856 Ga0495674_0064848
2857 Ga0495674_0231509
2858 Ga0495674_0358057
2859 Ga0495676_0003716
2860 Ga0495676_0017497
2861 Ga0495676_0054793
2862 Ga0495680_0001401
2863 Ga0495680_0006685
2864 Ga0495680_0006889
2865 Ga0495680_0012123
2866 Ga0495680_0012637
2867 Ga0495680_0086555
2868 Ga0495680_0286359
2869 Ga0495680_0350701
2870 Ga0495675_0005017
2871 Ga0495675_0033575
2872 Ga0495679_013128
2873 Ga0495684_0020107
2874 Ga0495684_0042671
2875 Ga0495684_0052577
2876 Ga0495593_0000730
2877 Ga0495593_0002845
2878 Ga0495593_0010817
2879 Ga0495593_0191604
2880 Ga0495602_0003673
2881 Ga0495602_0005637
2882 Ga0495602_0010516
2883 Ga0495602_0075932
2884 Ga0495602_0175882
2885 Ga0495614_0021658
2886 Ga0495614_0131372
2887 Ga0496100_0001758
2888 Ga0496100_0003708
2889 Ga0496100_0076198
2890 Ga0496100_0158496
2891 Ga0496100_0569101
2892 Ga0496100_0579935
2893 Ga0496101_0012951
2894 Ga0496101_0074915
2895 Ga0496101_0310860
2896 Ga0496102_0002938
2897 Ga0496102_0011898
2898 Ga0496102_0060150
2899 Ga0496102_0284822
2900 Ga0496102_0332539
2901 Ga0496102_0503010
2902 Ga0496102_0641472
2903 Ga0496102_0750684
2904 Ga0496102_0750689
2905 Ga0496102_0890921
2906 Ga0496103_0003026
2907 Ga0496103_0013998
2908 Ga0496103_0040060
2909 Ga0496103_0042071
2910 Ga0496103_0163846
2911 Ga0496104_0000146
2912 Ga0496104_0000741
2913 Ga0496104_0002220
2914 Ga0496104_0003698
2915 Ga0496104_0079305
2916 Ga0496104_0150014
2917 Ga0496104_0159085
2918 Ga0496104_0194289
2919 Ga0496104_0342230
2920 Ga0496104_0424694
2921 Ga0496104_0747876
2922 Ga0496105_0000025
2923 Ga0496105_0011046
2924 Ga0496105_0011482
2925 Ga0496105_0019370
2926 Ga0496105_0033779
2927 Ga0496105_0096191
2928 Ga0496105_0116549
2929 Ga0496105_0195977
2930 Ga0496105_0505203
2931 Ga0496106_0009990
2932 Ga0496106_0012004
2933 Ga0496106_0037988
2934 Ga0496106_0042813
2935 Ga0496106_0062646
2936 Ga0496106_0088279
2937 Ga0496106_0184538
2938 Ga0496106_0195793
2939 Ga0496107_0014021
2940 Ga0496107_0015547
2941 Ga0496107_0039322
2942 Ga0496107_0054442
2943 Ga0496107_0071713
2944 Ga0496107_0104657
2945 Ga0496107_0509455
2946 Ga0496108_0007653
2947 Ga0496108_0023258
2948 Ga0496108_0078821
2949 Ga0496108_0092967
2950 Ga0496108_0241538
2951 Ga0496108_0322150
2952 Ga0496108_0426455
2953 Ga0496109_0000526
2954 Ga0496109_0064201
2955 Ga0496109_0079373
2956 Ga0496109_0264545
2957 Ga0496109_0288539
2958 Ga0496109_0421351
2959 Ga0496109_0845297
2960 Ga0496110_0011465
2961 Ga0496110_0079401
2962 Ga0496110_0080027
2963 Ga0496110_0283477
2964 Ga0496110_0416662
2965 Ga0496110_0843190
2966 Ga0496111_0010814
2967 Ga0496111_0030122
2968 Ga0496111_0033387
2969 Ga0496111_0049275
2970 Ga0496111_0114400
2971 Ga0496111_0199372
2972 Ga0496111_0356989
2973 Ga0496112_0001549
2974 Ga0496112_0005706
2975 Ga0496112_0084195
2976 Ga0496112_0200372
2977 Ga0496112_0209448
2978 Ga0496112_0250174
2979 Ga0496112_0382401
2980 Ga0496112_0777462
2981 Ga0496112_0868395
2982 Ga0496113_0001026
2983 Ga0496113_0005648
2984 Ga0496113_0008212
2985 Ga0496113_0041681
2986 Ga0496113_0075727
2987 Ga0496113_0088268
2988 Ga0496113_0130021
2989 Ga0496113_0184655
2990 Ga0496113_0294641
2991 Ga0496114_0018559
2992 Ga0496114_0019225
2993 Ga0496114_0023712
2994 Ga0496114_0027954
2995 Ga0496114_0034001
2996 Ga0496114_0060267
2997 Ga0496114_0281421
2998 Ga0496114_0611005
2999 Ga0496115_0008590
3000 Ga0496115_0019401
3001 Ga0496115_0080857
3002 Ga0496115_0205546
3003 Ga0496115_0258376
3004 Ga0496115_0267331
3005 Ga0496115_0470901
3006 Ga0496115_0599936
3007 Ga0496119_0003812
3008 Ga0496119_0312295
3009 Ga0496124_0417189
3010 Ga0496125_0003219
3011 Ga0496125_0152138
3012 Ga0501031_0068303
3013 Ga0501031_0147447
3014 Ga0501031_0173204
3015 Ga0501031_0186891
3016 Ga0501032_0000951
3017 Ga0501032_0416689
3018 Ga0501033_0007292
3019 Ga0501033_0144107
3020 Ga0501033_0467263
3021 Ga0501034_0014184
3022 Ga0501034_0093404
3023 Ga0501034_0154152
3024 Ga0501034_0161437
3025 Ga0501034_0328195
3026 Ga0501034_0487547
3027 Ga0501036_0002920
3028 Ga0501036_0067554
3029 Ga0501036_0596101
3030 Ga0501036_1012189
3031 Ga0501037_0037819
3032 Ga0501037_0083705
3033 Ga0501037_0121788
3034 Ga0501038_0000730
3035 Ga0501038_0053534
3036 Ga0501038_0265785
3037 Ga0501038_0456075
3038 Ga0501039_0027260
3039 Ga0501039_0034671
3040 Ga0501039_0114603
3041 Ga0501039_0179388
3042 Ga0501039_0509014
3043 Ga0501040_0006194
3044 Ga0501040_0012426
3045 Ga0501040_0020813
3046 Ga0501040_0186223
3047 Ga0501040_0318711
3048 Ga0501041_0049033
3049 Ga0501041_0185798
3050 Ga0501041_0213212
3051 Ga0501041_0517895
3052 Ga0501042_0104841
3053 Ga0501042_0377546
3054 Ga0501042_0517420
3055 Ga0501043_0002840
3056 Ga0501043_0029899
3057 Ga0501043_0047395
3058 Ga0501043_0093205
3059 Ga0501043_0328648
3060 Ga0501043_0473058
3061 Ga0501046_0008883
3062 Ga0501046_0071471
3063 Ga0501046_0214783
3064 Ga0501047_0004007
3065 Ga0501047_0005283
3066 Ga0501047_0138641
3067 Ga0501047_0211652
3068 Ga0501048_0009382
3069 Ga0501048_0010281
3070 Ga0501048_0053832
3071 Ga0501048_0058804
3072 Ga0501048_0084754
3073 Ga0501048_0444557
3074 Ga0501048_0718619
3075 Ga0501067_0007181
3076 Ga0501068_0013567
3077 Ga0501068_0049923
3078 Ga0501068_0135268
3079 Ga0501068_0141110
3080 Ga0501069_0000066
3081 Ga0501069_0175876
3082 Ga0501070_0003216
3083 Ga0501070_0409669
3084 Ga0501070_0547120
3085 Ga0501071_0027265
3086 Ga0501071_0144258
3087 Ga0501072_0053327
3088 Ga0501072_0065168
3089 Ga0501072_0107586
3090 Ga0501072_0454009
3091 Ga0501072_0508653
3092 Ga0501072_0631102
3093 Ga0501073_0000746
3094 Ga0501073_0005526
3095 Ga0501073_0115761
3096 Ga0501073_0239647
3097 Ga0501073_0367453
3098 Ga0501074_0018931
3099 Ga0501074_0076835
3100 Ga0501074_0080978
3101 Ga0501074_0107336
3102 Ga0501074_0175972
3103 Ga0501074_0502727
3104 Ga0501075_0016547
3105 Ga0501075_0024884
3106 Ga0501075_0133121
3107 Ga0501075_0211054
3108 Ga0501075_0219629
3109 Ga0501075_0586129
3110 Ga0501076_0004802
3111 Ga0501076_0026917
3112 Ga0501076_0110472
3113 Ga0501076_0357888
3114 Ga0501077_0021468
3115 Ga0501077_0055271
3116 Ga0501077_0362397
3117 Ga0501079_0052649
3118 Ga0501079_0084440
3119 Ga0501079_0480961
3120 Ga0501080_0001309
3121 Ga0501080_0072402
3122 Ga0501080_0340580
3123 Ga0501080_0440647
3124 Ga0501080_0635065
3125 Ga0501080_0767860
3126 Ga0501081_0015652
3127 Ga0501081_0018032
3128 Ga0501081_0079452
3129 Ga0501081_0086674
3130 Ga0501081_0267643
3131 Ga0501083_0006526
3132 Ga0501083_0593685
3133 Ga0501035_0008196
3134 Ga0501035_0203673
3135 Ga0501035_0350421
3136 Ga0501035_0519590
3137 Ga0501044_0006024
3138 Ga0501044_0006624
3139 Ga0501044_0012740
3140 Ga0501044_0071868
3141 Ga0501044_0130005
3142 Ga0501044_0137076
3143 Ga0501044_0493016
3144 Ga0501044_0577928
3145 Ga0501045_0025666
3146 Ga0501045_0144854
3147 Ga0501045_0236887
3148 Ga0501045_0686297
3149 nmdc:mga0k408_53973_c1
3150 nmdc:mga06z11_407115_c1
3151 nmdc:mga04h51_108206_c1
3152 nmdc:mga05p37_13983_c1
3153 nmdc:mga05p37_263414_c1
3154 nmdc:mga05p37_30534_c1
3155 nmdc:mga05p37_71264_c1
3156 nmdc:mga05p37_96945_c1
3157 nmdc:mga09592_5091_c1
3158 nmdc:mga09592_70531_c1
3159 nmdc:mga0qj67_15114_c1
3160 nmdc:mga0qj67_539406_c1
3161 nmdc:mga06r32_111538_c1
3162 nmdc:mga06r32_14111_c1
3163 nmdc:mga06r32_177830_c1
3164 nmdc:mga08y16_15444_c1
3165 nmdc:mga08y16_216415_c1
3166 nmdc:mga08y16_232785_c1
3167 nmdc:mga08y16_27362_c1
3168 nmdc:mga08y16_35_c1
3169 nmdc:mga08y16_56956_c1
3170 nmdc:mga0n895_14103_c1
3171 nmdc:mga0n895_18419_c1
3172 nmdc:mga0n895_221760_c1
3173 nmdc:mga0n895_272211_c1
3174 nmdc:mga0n895_27429_c1
3175 nmdc:mga0n895_339682_c1
3176 nmdc:mga0n895_341278_c1
3177 nmdc:mga0n895_384110_c1
3178 nmdc:mga0n895_560757_c1
3179 nmdc:mga0n895_88587_c1
3180 nmdc:mga0rr50_106723_c1
3181 nmdc:mga0rr50_43412_c1
3182 nmdc:mga0rr50_5086_c1
3183 nmdc:mga0rr50_52572_c1
3184 nmdc:mga0rr50_55233_c1
3185 nmdc:mga0rr50_7345_c1
3186 nmdc:mga08x19_178479_c1
3187 nmdc:mga08x19_636687_c1
3188 nmdc:mga0a205_288258_c1
3189 nmdc:mga0a205_38013_c1
3190 nmdc:mga0a205_4498_c1
3191 nmdc:mga0a205_490233_c1
3192 nmdc:mga0a205_51984_c1
3193 nmdc:mga0a205_595661_c1
3194 nmdc:mga0a205_94481_c1
3195 Ga0495601_0001598
3196 Ga0495601_0003108
3197 Ga0495601_0004088
3198 Ga0495601_0007203
3199 Ga0495601_0016195
3200 Ga0495601_0016516
3201 Ga0495601_0021870
3202 Ga0495601_0354545
3203 Ga0495601_0546898
3204 Ga0495612_0000389
3205 Ga0495612_0001478
3206 Ga0495612_0001959
3207 Ga0495612_0002008
3208 Ga0495612_0011538
3209 Ga0495612_0055753
3210 Ga0495655_0002844
3211 Ga0495595_0000245
3212 Ga0495595_0000948
3213 Ga0495595_0001617
3214 Ga0495595_0003200
3215 Ga0495595_0012754
3216 Ga0495595_0055601
3217 Ga0495595_0056082
3218 Ga0495619_0000097
3219 Ga0495619_0000374
3220 Ga0495619_0000478
3221 Ga0495619_0003878
3222 Ga0495619_0004827
3223 Ga0495619_0004978
3224 Ga0495619_0012506
3225 Ga0495619_0022784
3226 Ga0495619_0034703
3227 Ga0495619_0091923
3228 Ga0495619_0128208
3229 Ga0495619_0239609
3230 Ga0500578_0116573
3231 Ga0500644_0045361
3232 Ga0500651_0077124
3233 Ga0500566_0066894
3234 Ga0500566_0150400
3235 Ga0500641_0009368
3236 Ga0500556_0057515
3237 Ga0500595_000002
3238 Ga0500595_004561
3239 Ga0500595_009773
3240 Ga0500608_227735
3241 Ga0500614_054725
3242 Ga0500642_0186617
3243 Ga0500652_000002
3244 Ga0500652_000573
3245 Ga0500658_0158250
3246 Ga0500559_0004376
3247 Ga0500568_0064881
3248 Ga0500577_0111117
3249 Ga0500588_0125125
3250 Ga0500604_0000195
3251 Ga0500616_0000002
3252 Ga0500616_0001203
3253 Ga0500616_0151567
3254 Ga0500624_051645
3255 Ga0500634_0000044
3256 Ga0500645_000754
3257 Ga0500609_002739
3258 Ga0500599_011949
3259 Ga0501084_0023104
3260 Ga0501084_0044964
3261 Ga0501084_0084758
3262 Ga0501084_0271606
3263 Ga0501084_0412750
3264 Ga0501084_0416655
3265 Ga0501084_0457806
3266 Ga0501082_0006052
3267 Ga0501082_0011230
3268 Ga0501082_0049211
3269 Ga0501082_0227781
3270 Ga0501082_0544200
3271 Ga0501082_0698736
3272 Ga0466962_0157991
3273 Ga0530510_0009437
3274 Ga0530510_0123555
3275 Ga0530510_0126443
3276 Ga0530510_0779242
3277 2643756254
3278 2643912273
3279 2643963466
3280 2644410585
3281 2644735972
3282 2738946401
3283 2739791261
3284 2821124470
3285 2838741035
3286 2840883833
3287 2841845068
3288 2842144791
3289 2857532051
3290 2891050945
3291 2913310814
3292 2919680980
3293 2932403294
3294 2995393147
3295 3000409126
3296 8045865187

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

32

154

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.8818 3 128
6h8k-assembly1.cif.gz_G crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.8333 5 143
4wz7-assembly1.cif.gz_G crystal structure of mitochondrial nadh:ubiquinone oxidoreductase from yarrowia lipolytica. 0.829 5 143
6h8k-assembly1.cif.gz_G crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.8161 5 143
7z84-assembly1.cif.gz_C complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, open-ready state 0.8138 1 151
ID Description Score Start End Superfamily
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9883 2 132 3.30.460.80
af_Q9VZU4_36_188_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9837 2 132 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9591 10 132 3.30.460.80
af_P22237_2_142_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9508 2 132 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9298 10 132 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A3D5PJ69-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9954 1 111 GO:0008137
AF-A0A5N7YEC3-F1-model_v4 deleted 0.9945 1 93
AF-A0A1S3JCK3-F1-model_v4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 0.9895 2 114 GO:0008137
AF-A0A820PU55-F1-model_v4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 0.9886 2 109 GO:0008137
AF-A0A7R9MNB3-F1-model_v4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 0.988 2 99 GO:0008137

Map