F495024
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1606 | 597 | 1606 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10216368|Ga0065712_102163682 |
| Length | 129 |
| Sequence | LCGEQADPINEAKAKDGLKAVAKDKDREIGQGGFDLAVEEAQPKLRKPPLYQVVLLNDDYTPMEFVVDVLERIFSLDRLRATRVMLEVHTKGKGVCGVFTFEIAETKVAQVMTYSRQHQHPLLCTMEET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 147 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 235 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 236 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 237 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 248 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 258 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 266 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 267 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 268 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 269 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 270 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 274 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 275 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 276 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 278 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 279 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 282 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 283 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 284 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 285 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 286 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 287 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 288 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 289 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 290 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 291 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 292 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 293 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 294 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 295 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 297 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 305 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 309 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 312 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 313 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 316 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 318 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 320 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 323 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 324 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 325 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 326 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 327 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 328 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 329 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 330 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 331 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 332 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 333 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 334 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 335 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 338 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 342 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 343 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 344 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 345 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 346 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 347 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 348 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 349 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 350 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 351 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 352 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 353 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 354 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 355 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 356 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 357 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 358 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 359 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 360 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 361 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 362 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 363 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 364 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 365 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 366 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 367 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 368 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 369 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 370 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 371 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 372 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 373 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 374 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 375 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 376 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 377 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 378 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 379 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 380 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 381 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 382 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 383 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 384 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 385 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 386 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 387 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 388 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 389 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 390 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 391 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 392 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 393 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 394 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 395 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 396 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 397 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 398 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 399 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 400 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 401 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 402 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 403 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 404 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 405 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 406 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 407 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 408 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 409 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 410 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 453 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 455 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 456 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 457 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 458 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 459 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 460 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 463 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 464 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 465 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 466 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 467 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 468 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 469 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 470 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 471 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 472 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 473 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 474 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 475 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 476 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 477 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 478 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 481 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 482 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 483 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 484 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 485 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 486 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 487 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 514 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 515 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 516 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 517 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 518 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 519 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 520 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 521 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 526 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 527 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 528 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 529 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 532 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 533 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 534 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 546 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 548 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 549 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 550 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 551 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 552 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 553 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 554 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 555 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 556 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 557 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 558 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 559 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 560 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 561 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 562 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 563 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 564 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 565 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 566 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 567 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 568 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 569 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 570 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 571 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 572 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 573 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 574 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 575 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 576 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 577 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 578 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 579 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 580 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 581 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 597 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.64 |
| Metatranscriptomes | 3.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.79 |
| Nodule | 0.12 |
| Rhizoplane | 3.92 |
| Rhizosphere | 87.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1005235 | 3300000546 | Bacteria | 1419 |
| 2 | JGI24746J21847_1038090 | 3300001977 | Bacteria | 666 |
| 3 | JGI24744J21845_10074202 | 3300002077 | Bacteria | 621 |
| 4 | JGI24034J26672_10044462 | 3300002239 | Bacteria | 752 |
| 5 | rootH1_10026435 | 3300003323 | Bacteria | 5436 |
| 6 | rootH1_10211908 | 3300003323 | Bacteria | 2103 |
| 7 | Ga0058859_11646593 | 3300004798 | Bacteria | 813 |
| 8 | Ga0058861_11861260 | 3300004800 | Bacteria | 571 |
| 9 | Ga0058860_11393278 | 3300004801 | Bacteria | 1230 |
| 10 | Ga0058862_10012401 | 3300004803 | Bacteria | 3578 |
| 11 | Ga0058862_10022746 | 3300004803 | Bacteria | 1771 |
| 12 | Ga0058862_12010366 | 3300004803 | Bacteria | 568 |
| 13 | Ga0065714_10207824 | 3300005288 | Bacteria | 875 |
| 14 | Ga0065704_10098711 | 3300005289 | Bacteria | 2342 |
| 15 | Ga0065704_10802156 | 3300005289 | Bacteria | 524 |
| 16 | Ga0065712_10072478 | 3300005290 | Bacteria | 4735 |
| 17 | Ga0065712_10216368 | 3300005290 | Bacteria | 1055 |
| 18 | Ga0065712_10247271 | 3300005290 | Bacteria | 968 |
| 19 | Ga0065712_10311057 | 3300005290 | Bacteria | 844 |
| 20 | Ga0065715_10001498 | 3300005293 | Bacteria | 6981 |
| 21 | Ga0065715_10358651 | 3300005293 | Bacteria | 939 |
| 22 | Ga0065707_10067934 | 3300005295 | Bacteria | 632 |
| 23 | Ga0065707_10083865 | 3300005295 | Bacteria | 8082 |
| 24 | Ga0065707_10085991 | 3300005295 | Bacteria | 5737 |
| 25 | Ga0065707_10305113 | 3300005295 | Bacteria | 996 |
| 26 | Ga0070658_10830157 | 3300005327 | Bacteria | 803 |
| 27 | Ga0070676_11540199 | 3300005328 | Bacteria | 513 |
| 28 | Ga0070683_100026113 | 3300005329 | Bacteria | 5254 |
| 29 | Ga0070683_100113854 | 3300005329 | Bacteria | 2553 |
| 30 | Ga0070690_100003822 | 3300005330 | Bacteria | 8290 |
| 31 | Ga0070690_100035384 | 3300005330 | Bacteria | 3134 |
| 32 | Ga0070690_100434119 | 3300005330 | Bacteria | 971 |
| 33 | Ga0070690_100554207 | 3300005330 | Bacteria | 867 |
| 34 | Ga0070690_101639687 | 3300005330 | Bacteria | 522 |
| 35 | Ga0070670_100019825 | 3300005331 | Bacteria | 5773 |
| 36 | Ga0070670_100027123 | 3300005331 | Bacteria | 4926 |
| 37 | Ga0070670_100118934 | 3300005331 | Bacteria | 2279 |
| 38 | Ga0070670_100632259 | 3300005331 | Bacteria | 959 |
| 39 | Ga0070670_101388768 | 3300005331 | Bacteria | 644 |
| 40 | Ga0068869_100069124 | 3300005334 | Bacteria | 2610 |
| 41 | Ga0068869_100129027 | 3300005334 | Bacteria | 1942 |
| 42 | Ga0068869_100194144 | 3300005334 | Bacteria | 1598 |
| 43 | Ga0068869_100494367 | 3300005334 | Bacteria | 1020 |
| 44 | Ga0068869_100572915 | 3300005334 | Bacteria | 951 |
| 45 | Ga0068869_100610042 | 3300005334 | Bacteria | 923 |
| 46 | Ga0068869_100691338 | 3300005334 | Bacteria | 869 |
| 47 | Ga0068869_100992031 | 3300005334 | Bacteria | 731 |
| 48 | Ga0070666_10002682 | 3300005335 | Bacteria | 10736 |
| 49 | Ga0070666_10146958 | 3300005335 | Bacteria | 1643 |
| 50 | Ga0070666_10169623 | 3300005335 | Bacteria | 1528 |
| 51 | Ga0070666_10391354 | 3300005335 | Bacteria | 998 |
| 52 | Ga0070666_10433450 | 3300005335 | Bacteria | 948 |
| 53 | Ga0070680_100254672 | 3300005336 | Bacteria | 1485 |
| 54 | Ga0070680_100260024 | 3300005336 | Bacteria | 1468 |
| 55 | Ga0070682_100020490 | 3300005337 | Bacteria | 3890 |
| 56 | Ga0070682_100233148 | 3300005337 | Bacteria | 1317 |
| 57 | Ga0070682_100339416 | 3300005337 | Bacteria | 1116 |
| 58 | Ga0070682_100364321 | 3300005337 | Bacteria | 1082 |
| 59 | Ga0070682_100884905 | 3300005337 | Bacteria | 733 |
| 60 | Ga0070682_101291725 | 3300005337 | Bacteria | 620 |
| 61 | Ga0068868_100004850 | 3300005338 | Bacteria | 9444 |
| 62 | Ga0068868_100070972 | 3300005338 | Bacteria | 2777 |
| 63 | Ga0068868_100094689 | 3300005338 | Bacteria | 2409 |
| 64 | Ga0068868_100183314 | 3300005338 | Bacteria | 1738 |
| 65 | Ga0070689_100001596 | 3300005340 | Bacteria | 14466 |
| 66 | Ga0070689_100004882 | 3300005340 | Bacteria | 9103 |
| 67 | Ga0070689_100547261 | 3300005340 | Bacteria | 997 |
| 68 | Ga0070689_100614267 | 3300005340 | Bacteria | 943 |
| 69 | Ga0070689_102111929 | 3300005340 | Bacteria | 516 |
| 70 | Ga0070691_10347532 | 3300005341 | Bacteria | 823 |
| 71 | Ga0070691_10516887 | 3300005341 | Bacteria | 692 |
| 72 | Ga0070687_100022560 | 3300005343 | Bacteria | 2978 |
| 73 | Ga0070687_100302740 | 3300005343 | Bacteria | 1015 |
| 74 | Ga0070661_100035493 | 3300005344 | Bacteria | 3621 |
| 75 | Ga0070661_100052662 | 3300005344 | Bacteria | 2979 |
| 76 | Ga0070661_100114542 | 3300005344 | Bacteria | 2016 |
| 77 | Ga0070661_101007634 | 3300005344 | Bacteria | 691 |
| 78 | Ga0070692_10031760 | 3300005345 | Bacteria | 2649 |
| 79 | Ga0070692_10115429 | 3300005345 | Bacteria | 1491 |
| 80 | Ga0070692_10556486 | 3300005345 | Bacteria | 752 |
| 81 | Ga0070668_100149836 | 3300005347 | Bacteria | 1885 |
| 82 | Ga0070668_101163669 | 3300005347 | Bacteria | 698 |
| 83 | Ga0070668_101364736 | 3300005347 | Bacteria | 645 |
| 84 | Ga0070669_100049479 | 3300005353 | Bacteria | 3068 |
| 85 | Ga0070669_100293528 | 3300005353 | Bacteria | 1306 |
| 86 | Ga0070669_100548820 | 3300005353 | Bacteria | 963 |
| 87 | Ga0070675_100003779 | 3300005354 | Bacteria | 11497 |
| 88 | Ga0070675_100107242 | 3300005354 | Bacteria | 2359 |
| 89 | Ga0070675_102257557 | 3300005354 | Bacteria | 501 |
| 90 | Ga0070671_100002194 | 3300005355 | Bacteria | 15085 |
| 91 | Ga0070671_100098944 | 3300005355 | Bacteria | 2446 |
| 92 | Ga0070671_100099731 | 3300005355 | Bacteria | 2436 |
| 93 | Ga0070671_100253518 | 3300005355 | Bacteria | 1495 |
| 94 | Ga0070674_100052489 | 3300005356 | Bacteria | 2813 |
| 95 | Ga0070673_100016500 | 3300005364 | Bacteria | 5224 |
| 96 | Ga0070673_100112326 | 3300005364 | Bacteria | 2261 |
| 97 | Ga0070673_100544164 | 3300005364 | Bacteria | 1054 |
| 98 | Ga0070673_100921735 | 3300005364 | Bacteria | 811 |
| 99 | Ga0070673_101655195 | 3300005364 | Bacteria | 605 |
| 100 | Ga0070688_100082218 | 3300005365 | Bacteria | 2087 |
| 101 | Ga0070688_100224277 | 3300005365 | Bacteria | 1326 |
| 102 | Ga0070659_100450430 | 3300005366 | Bacteria | 1092 |
| 103 | Ga0070659_100714999 | 3300005366 | Bacteria | 867 |
| 104 | Ga0070659_100804647 | 3300005366 | Bacteria | 817 |
| 105 | Ga0070667_100000225 | 3300005367 | Bacteria | 65088 |
| 106 | Ga0070667_100014966 | 3300005367 | Bacteria | 6408 |
| 107 | Ga0070667_100021572 | 3300005367 | Bacteria | 5346 |
| 108 | Ga0070667_100029388 | 3300005367 | Bacteria | 4578 |
| 109 | Ga0070667_100167130 | 3300005367 | Bacteria | 1940 |
| 110 | Ga0070667_100301923 | 3300005367 | Bacteria | 1442 |
| 111 | Ga0070667_100553473 | 3300005367 | Bacteria | 1057 |
| 112 | Ga0070667_101023584 | 3300005367 | Bacteria | 771 |
| 113 | Ga0070667_101221502 | 3300005367 | Bacteria | 704 |
| 114 | Ga0070667_102125483 | 3300005367 | Bacteria | 529 |
| 115 | Ga0070709_10010490 | 3300005434 | Bacteria | 5134 |
| 116 | Ga0070709_10034850 | 3300005434 | Bacteria | 3055 |
| 117 | Ga0070709_10205906 | 3300005434 | Bacteria | 1396 |
| 118 | Ga0070714_100010659 | 3300005435 | Bacteria | 7272 |
| 119 | Ga0070714_102074806 | 3300005435 | Bacteria | 554 |
| 120 | Ga0070713_100014651 | 3300005436 | Bacteria | 5830 |
| 121 | Ga0070713_100018884 | 3300005436 | Bacteria | 5249 |
| 122 | Ga0070713_100025052 | 3300005436 | Bacteria | 4659 |
| 123 | Ga0070713_100443918 | 3300005436 | Bacteria | 1217 |
| 124 | Ga0070713_100519955 | 3300005436 | Bacteria | 1124 |
| 125 | Ga0070710_10050466 | 3300005437 | Bacteria | 2333 |
| 126 | Ga0070710_10204649 | 3300005437 | Bacteria | 1248 |
| 127 | Ga0070710_10786270 | 3300005437 | Bacteria | 679 |
| 128 | Ga0070701_10054505 | 3300005438 | Bacteria | 2085 |
| 129 | Ga0070711_100001783 | 3300005439 | Bacteria | 11983 |
| 130 | Ga0070711_100046563 | 3300005439 | Bacteria | 2955 |
| 131 | Ga0070711_100056066 | 3300005439 | Bacteria | 2724 |
| 132 | Ga0070711_100160105 | 3300005439 | Bacteria | 1706 |
| 133 | Ga0070711_100437871 | 3300005439 | Bacteria | 1068 |
| 134 | Ga0070711_100460678 | 3300005439 | Bacteria | 1042 |
| 135 | Ga0070705_100088221 | 3300005440 | Bacteria | 1925 |
| 136 | Ga0070705_100108171 | 3300005440 | Bacteria | 1770 |
| 137 | Ga0070705_100116100 | 3300005440 | Bacteria | 1720 |
| 138 | Ga0070705_100347593 | 3300005440 | Bacteria | 1080 |
| 139 | Ga0070705_100636152 | 3300005440 | Bacteria | 830 |
| 140 | Ga0070700_100069722 | 3300005441 | Bacteria | 2239 |
| 141 | Ga0070700_100231657 | 3300005441 | Bacteria | 1315 |
| 142 | Ga0070700_100269903 | 3300005441 | Bacteria | 1229 |
| 143 | Ga0070700_101723147 | 3300005441 | Bacteria | 538 |
| 144 | Ga0070694_100052311 | 3300005444 | Bacteria | 2760 |
| 145 | Ga0070694_100140533 | 3300005444 | Bacteria | 1753 |
| 146 | Ga0070694_100181515 | 3300005444 | Bacteria | 1557 |
| 147 | Ga0070694_100442600 | 3300005444 | Bacteria | 1024 |
| 148 | Ga0070694_100456922 | 3300005444 | Bacteria | 1009 |
| 149 | Ga0070694_101042895 | 3300005444 | Bacteria | 680 |
| 150 | Ga0070663_100147002 | 3300005455 | Bacteria | 1804 |
| 151 | Ga0070663_100391485 | 3300005455 | Bacteria | 1134 |
| 152 | Ga0070663_100538279 | 3300005455 | Bacteria | 974 |
| 153 | Ga0070663_100538900 | 3300005455 | Bacteria | 974 |
| 154 | Ga0070663_100610075 | 3300005455 | Bacteria | 919 |
| 155 | Ga0070663_100883831 | 3300005455 | Bacteria | 771 |
| 156 | Ga0070678_100346570 | 3300005456 | Bacteria | 1276 |
| 157 | Ga0070678_100843082 | 3300005456 | Bacteria | 835 |
| 158 | Ga0070662_100383507 | 3300005457 | Bacteria | 1157 |
| 159 | Ga0070662_100867757 | 3300005457 | Bacteria | 769 |
| 160 | Ga0070662_101370415 | 3300005457 | Bacteria | 609 |
| 161 | Ga0070681_10001003 | 3300005458 | Bacteria | 23931 |
| 162 | Ga0070681_10003796 | 3300005458 | Bacteria | 14193 |
| 163 | Ga0070681_10013362 | 3300005458 | Bacteria | 8159 |
| 164 | Ga0070681_10015831 | 3300005458 | Bacteria | 7517 |
| 165 | Ga0070681_10101137 | 3300005458 | Bacteria | 2828 |
| 166 | Ga0070681_10421308 | 3300005458 | Bacteria | 1247 |
| 167 | Ga0070681_10509537 | 3300005458 | Bacteria | 1117 |
| 168 | Ga0068867_100008080 | 3300005459 | Bacteria | 7435 |
| 169 | Ga0068867_100197722 | 3300005459 | Bacteria | 1608 |
| 170 | Ga0070685_10063412 | 3300005466 | Bacteria | 2170 |
| 171 | Ga0070685_10127754 | 3300005466 | Bacteria | 1586 |
| 172 | Ga0070685_10680674 | 3300005466 | Bacteria | 748 |
| 173 | Ga0070706_102093621 | 3300005467 | Bacteria | 512 |
| 174 | Ga0070698_101001791 | 3300005471 | Bacteria | 783 |
| 175 | Ga0070698_101583276 | 3300005471 | Bacteria | 607 |
| 176 | Ga0070699_100011119 | 3300005518 | Bacteria | 7779 |
| 177 | Ga0070679_100030496 | 3300005530 | Bacteria | 5324 |
| 178 | Ga0070679_100065404 | 3300005530 | Bacteria | 3624 |
| 179 | Ga0070679_100113205 | 3300005530 | Bacteria | 2699 |
| 180 | Ga0070679_100177510 | 3300005530 | Bacteria | 2103 |
| 181 | Ga0070679_100261024 | 3300005530 | Bacteria | 1687 |
| 182 | Ga0070679_101203238 | 3300005530 | Bacteria | 703 |
| 183 | Ga0070684_100003660 | 3300005535 | Bacteria | 11596 |
| 184 | Ga0070684_100006012 | 3300005535 | Bacteria | 9348 |
| 185 | Ga0070684_100033066 | 3300005535 | Bacteria | 4413 |
| 186 | Ga0070684_100107929 | 3300005535 | Bacteria | 2494 |
| 187 | Ga0070684_102067403 | 3300005535 | Bacteria | 538 |
| 188 | Ga0070684_102091128 | 3300005535 | Bacteria | 534 |
| 189 | Ga0070697_101870661 | 3300005536 | Bacteria | 537 |
| 190 | Ga0068853_100635146 | 3300005539 | Bacteria | 1015 |
| 191 | Ga0068853_101181577 | 3300005539 | Bacteria | 738 |
| 192 | Ga0070672_100049906 | 3300005543 | Bacteria | 3258 |
| 193 | Ga0070672_100115740 | 3300005543 | Bacteria | 2190 |
| 194 | Ga0070672_100204218 | 3300005543 | Bacteria | 1653 |
| 195 | Ga0070672_100262365 | 3300005543 | Bacteria | 1457 |
| 196 | Ga0070686_100061083 | 3300005544 | Bacteria | 2434 |
| 197 | Ga0070686_100205214 | 3300005544 | Bacteria | 1415 |
| 198 | Ga0070686_100491627 | 3300005544 | Bacteria | 950 |
| 199 | Ga0070686_100806619 | 3300005544 | Bacteria | 757 |
| 200 | Ga0070686_101488093 | 3300005544 | Bacteria | 570 |
| 201 | Ga0070695_100058416 | 3300005545 | Bacteria | 2494 |
| 202 | Ga0070695_100756361 | 3300005545 | Bacteria | 775 |
| 203 | Ga0070695_100821432 | 3300005545 | Bacteria | 746 |
| 204 | Ga0070695_100833517 | 3300005545 | Bacteria | 741 |
| 205 | Ga0070696_100000793 | 3300005546 | Bacteria | 20343 |
| 206 | Ga0070696_100768358 | 3300005546 | Bacteria | 791 |
| 207 | Ga0070696_100888401 | 3300005546 | Bacteria | 738 |
| 208 | Ga0070693_100060935 | 3300005547 | Bacteria | 2192 |
| 209 | Ga0070693_100063788 | 3300005547 | Bacteria | 2148 |
| 210 | Ga0070693_100098453 | 3300005547 | Bacteria | 1777 |
| 211 | Ga0070693_100361855 | 3300005547 | Bacteria | 996 |
| 212 | Ga0070665_100000709 | 3300005548 | Bacteria | 44346 |
| 213 | Ga0070665_100008098 | 3300005548 | Bacteria | 10638 |
| 214 | Ga0070665_100026875 | 3300005548 | Bacteria | 5797 |
| 215 | Ga0070665_100029156 | 3300005548 | Bacteria | 5554 |
| 216 | Ga0070665_100048772 | 3300005548 | Bacteria | 4251 |
| 217 | Ga0070665_100071765 | 3300005548 | Bacteria | 3469 |
| 218 | Ga0070665_100182905 | 3300005548 | Bacteria | 2097 |
| 219 | Ga0070665_100210433 | 3300005548 | Bacteria | 1945 |
| 220 | Ga0070665_100459624 | 3300005548 | Bacteria | 1283 |
| 221 | Ga0070665_101412298 | 3300005548 | Bacteria | 705 |
| 222 | Ga0070665_101554237 | 3300005548 | Bacteria | 670 |
| 223 | Ga0070665_102298984 | 3300005548 | Bacteria | 542 |
| 224 | Ga0070704_100016184 | 3300005549 | Bacteria | 4707 |
| 225 | Ga0070704_100018874 | 3300005549 | Bacteria | 4420 |
| 226 | Ga0070704_100138110 | 3300005549 | Bacteria | 1899 |
| 227 | Ga0070704_100326746 | 3300005549 | Bacteria | 1287 |
| 228 | Ga0070704_100889236 | 3300005549 | Bacteria | 800 |
| 229 | Ga0068855_100000869 | 3300005563 | Bacteria | 37546 |
| 230 | Ga0068855_100013822 | 3300005563 | Bacteria | 9733 |
| 231 | Ga0068855_100184350 | 3300005563 | Bacteria | 2358 |
| 232 | Ga0068855_100308078 | 3300005563 | Bacteria | 1753 |
| 233 | Ga0068855_100485179 | 3300005563 | Bacteria | 1345 |
| 234 | Ga0068855_101007972 | 3300005563 | Bacteria | 875 |
| 235 | Ga0068855_101366358 | 3300005563 | Bacteria | 731 |
| 236 | Ga0070664_100001245 | 3300005564 | Bacteria | 20363 |
| 237 | Ga0070664_100042866 | 3300005564 | Bacteria | 3818 |
| 238 | Ga0070664_100265154 | 3300005564 | Bacteria | 1546 |
| 239 | Ga0068857_100113288 | 3300005577 | Bacteria | 2438 |
| 240 | Ga0068857_100156726 | 3300005577 | Bacteria | 2065 |
| 241 | Ga0068857_100567710 | 3300005577 | Bacteria | 1070 |
| 242 | Ga0068857_100918134 | 3300005577 | Bacteria | 840 |
| 243 | Ga0068857_102068997 | 3300005577 | Bacteria | 559 |
| 244 | Ga0068854_100053916 | 3300005578 | Bacteria | 2890 |
| 245 | Ga0068854_100359733 | 3300005578 | Bacteria | 1194 |
| 246 | Ga0068856_100007934 | 3300005614 | Bacteria | 10369 |
| 247 | Ga0068856_100009532 | 3300005614 | Bacteria | 9433 |
| 248 | Ga0068856_100015998 | 3300005614 | Bacteria | 7251 |
| 249 | Ga0068856_100155520 | 3300005614 | Bacteria | 2296 |
| 250 | Ga0068856_100339780 | 3300005614 | Bacteria | 1519 |
| 251 | Ga0068856_100341147 | 3300005614 | Bacteria | 1516 |
| 252 | Ga0070702_100010658 | 3300005615 | Bacteria | 4539 |
| 253 | Ga0070702_100011767 | 3300005615 | Bacteria | 4363 |
| 254 | Ga0070702_101035006 | 3300005615 | Bacteria | 652 |
| 255 | Ga0070702_101740670 | 3300005615 | Bacteria | 519 |
| 256 | Ga0068852_100058878 | 3300005616 | Bacteria | 3329 |
| 257 | Ga0068852_101625101 | 3300005616 | Bacteria | 669 |
| 258 | Ga0068852_101892213 | 3300005616 | Bacteria | 619 |
| 259 | Ga0068859_100003949 | 3300005617 | Bacteria | 15134 |
| 260 | Ga0068859_100006748 | 3300005617 | Bacteria | 11662 |
| 261 | Ga0068859_100334671 | 3300005617 | Bacteria | 1608 |
| 262 | Ga0068859_100383959 | 3300005617 | Bacteria | 1500 |
| 263 | Ga0068859_100385650 | 3300005617 | Bacteria | 1497 |
| 264 | Ga0068859_100456600 | 3300005617 | Bacteria | 1374 |
| 265 | Ga0068859_102050216 | 3300005617 | Bacteria | 632 |
| 266 | Ga0068864_100004196 | 3300005618 | Bacteria | 11848 |
| 267 | Ga0068864_100005110 | 3300005618 | Bacteria | 10753 |
| 268 | Ga0068864_100046025 | 3300005618 | Bacteria | 3743 |
| 269 | Ga0068866_10014160 | 3300005718 | Bacteria | 3515 |
| 270 | Ga0068866_10091482 | 3300005718 | Bacteria | 1658 |
| 271 | Ga0068861_100008139 | 3300005719 | Bacteria | 7214 |
| 272 | Ga0068861_100071052 | 3300005719 | Bacteria | 2697 |
| 273 | Ga0068861_100082512 | 3300005719 | Bacteria | 2519 |
| 274 | Ga0068861_100186356 | 3300005719 | Bacteria | 1731 |
| 275 | Ga0068861_100274311 | 3300005719 | Bacteria | 1449 |
| 276 | Ga0068861_100485387 | 3300005719 | Bacteria | 1114 |
| 277 | Ga0068861_100508673 | 3300005719 | Bacteria | 1090 |
| 278 | Ga0068851_10079150 | 3300005834 | Bacteria | 1713 |
| 279 | Ga0068870_10016521 | 3300005840 | Bacteria | 3528 |
| 280 | Ga0068863_100007487 | 3300005841 | Bacteria | 10679 |
| 281 | Ga0068863_100029303 | 3300005841 | Bacteria | 5254 |
| 282 | Ga0068863_100102119 | 3300005841 | Bacteria | 2726 |
| 283 | Ga0068863_100712039 | 3300005841 | Bacteria | 998 |
| 284 | Ga0068858_100011250 | 3300005842 | Bacteria | 8455 |
| 285 | Ga0068858_100230532 | 3300005842 | Bacteria | 1756 |
| 286 | Ga0068858_100717037 | 3300005842 | Bacteria | 974 |
| 287 | Ga0068860_100000219 | 3300005843 | Bacteria | 89810 |
| 288 | Ga0068860_100004920 | 3300005843 | Bacteria | 13614 |
| 289 | Ga0068860_100014216 | 3300005843 | Bacteria | 7805 |
| 290 | Ga0068860_100014788 | 3300005843 | Bacteria | 7632 |
| 291 | Ga0068860_100312784 | 3300005843 | Bacteria | 1540 |
| 292 | Ga0068860_100483832 | 3300005843 | Bacteria | 1234 |
| 293 | Ga0068860_101016986 | 3300005843 | Bacteria | 847 |
| 294 | Ga0068862_100076918 | 3300005844 | Bacteria | 2889 |
| 295 | Ga0068862_100121504 | 3300005844 | Bacteria | 2303 |
| 296 | Ga0068862_100381362 | 3300005844 | Bacteria | 1315 |
| 297 | Ga0068862_100418427 | 3300005844 | Bacteria | 1257 |
| 298 | Ga0068862_100585066 | 3300005844 | Bacteria | 1070 |
| 299 | Ga0068862_100823930 | 3300005844 | Bacteria | 908 |
| 300 | Ga0081455_10000099 | 3300005937 | Bacteria | 95044 |
| 301 | Ga0081455_10436627 | 3300005937 | Bacteria | 898 |
| 302 | Ga0081455_10463888 | 3300005937 | Bacteria | 862 |
| 303 | Ga0081455_10505365 | 3300005937 | Bacteria | 811 |
| 304 | Ga0081538_10088879 | 3300005981 | Bacteria | 1606 |
| 305 | Ga0081540_1130441 | 3300005983 | Bacteria | 1027 |
| 306 | Ga0081540_1186417 | 3300005983 | Bacteria | 770 |
| 307 | Ga0081539_10059565 | 3300005985 | Bacteria | 2101 |
| 308 | Ga0070717_10002768 | 3300006028 | Bacteria | 12402 |
| 309 | Ga0070717_11706155 | 3300006028 | Bacteria | 570 |
| 310 | Ga0075364_11034013 | 3300006051 | Bacteria | 558 |
| 311 | Ga0070715_10000150 | 3300006163 | Bacteria | 16297 |
| 312 | Ga0070715_10019225 | 3300006163 | Bacteria | 2616 |
| 313 | Ga0070715_10115736 | 3300006163 | Bacteria | 1271 |
| 314 | Ga0070715_10387977 | 3300006163 | Bacteria | 773 |
| 315 | Ga0070716_100014983 | 3300006173 | Bacteria | 3977 |
| 316 | Ga0070716_100026661 | 3300006173 | Bacteria | 3097 |
| 317 | Ga0070716_100371323 | 3300006173 | Bacteria | 1019 |
| 318 | Ga0070712_100002458 | 3300006175 | Bacteria | 11421 |
| 319 | Ga0070712_100550900 | 3300006175 | Bacteria | 972 |
| 320 | Ga0070712_101090674 | 3300006175 | Bacteria | 693 |
| 321 | Ga0075367_10838451 | 3300006178 | Bacteria | 586 |
| 322 | Ga0075366_10183264 | 3300006195 | Bacteria | 1272 |
| 323 | Ga0075366_10254773 | 3300006195 | Bacteria | 1071 |
| 324 | Ga0075366_10282760 | 3300006195 | Bacteria | 1014 |
| 325 | Ga0097621_100029206 | 3300006237 | Bacteria | 4353 |
| 326 | Ga0097621_100041945 | 3300006237 | Bacteria | 3685 |
| 327 | Ga0097621_100050099 | 3300006237 | Bacteria | 3395 |
| 328 | Ga0097621_100539217 | 3300006237 | Bacteria | 1061 |
| 329 | Ga0097621_101125294 | 3300006237 | Bacteria | 738 |
| 330 | Ga0097621_101223004 | 3300006237 | Bacteria | 708 |
| 331 | Ga0075370_10437976 | 3300006353 | Bacteria | 786 |
| 332 | Ga0068871_100009552 | 3300006358 | Bacteria | 7039 |
| 333 | Ga0068871_100038551 | 3300006358 | Bacteria | 3817 |
| 334 | Ga0068871_100117604 | 3300006358 | Bacteria | 2242 |
| 335 | Ga0068871_100319469 | 3300006358 | Bacteria | 1367 |
| 336 | Ga0068871_100754384 | 3300006358 | Bacteria | 895 |
| 337 | Ga0068871_101032012 | 3300006358 | Bacteria | 767 |
| 338 | Ga0075428_100001284 | 3300006844 | Bacteria | 26756 |
| 339 | Ga0075428_100002724 | 3300006844 | Bacteria | 19213 |
| 340 | Ga0075428_100006022 | 3300006844 | Bacteria | 13466 |
| 341 | Ga0075428_100012167 | 3300006844 | Bacteria | 9570 |
| 342 | Ga0075428_100026057 | 3300006844 | Bacteria | 6475 |
| 343 | Ga0075428_100040146 | 3300006844 | Bacteria | 5150 |
| 344 | Ga0075428_101316727 | 3300006844 | Bacteria | 759 |
| 345 | Ga0075430_100005100 | 3300006846 | Bacteria | 11053 |
| 346 | Ga0075430_100046629 | 3300006846 | Bacteria | 3660 |
| 347 | Ga0075430_100137269 | 3300006846 | Bacteria | 2037 |
| 348 | Ga0075430_100271203 | 3300006846 | Bacteria | 1404 |
| 349 | Ga0075430_100775905 | 3300006846 | Bacteria | 790 |
| 350 | Ga0075430_100860337 | 3300006846 | Bacteria | 747 |
| 351 | Ga0075431_100005080 | 3300006847 | Bacteria | 12943 |
| 352 | Ga0075431_100028173 | 3300006847 | Bacteria | 5768 |
| 353 | Ga0075431_100039938 | 3300006847 | Bacteria | 4834 |
| 354 | Ga0075431_100063667 | 3300006847 | Bacteria | 3806 |
| 355 | Ga0075431_100437027 | 3300006847 | Bacteria | 1306 |
| 356 | Ga0075433_10039105 | 3300006852 | Bacteria | 4100 |
| 357 | Ga0075433_10046168 | 3300006852 | Bacteria | 3787 |
| 358 | Ga0075433_10601384 | 3300006852 | Bacteria | 965 |
| 359 | Ga0075434_100000591 | 3300006871 | Bacteria | 28020 |
| 360 | Ga0075434_100207585 | 3300006871 | Bacteria | 1980 |
| 361 | Ga0075434_100546275 | 3300006871 | Bacteria | 1178 |
| 362 | Ga0075434_101333267 | 3300006871 | Bacteria | 728 |
| 363 | Ga0075429_100006884 | 3300006880 | Bacteria | 9869 |
| 364 | Ga0075429_100013382 | 3300006880 | Bacteria | 7114 |
| 365 | Ga0075429_100336750 | 3300006880 | Bacteria | 1320 |
| 366 | Ga0075429_101724499 | 3300006880 | Bacteria | 544 |
| 367 | Ga0068865_100003296 | 3300006881 | Bacteria | 9668 |
| 368 | Ga0068865_100030070 | 3300006881 | Bacteria | 3609 |
| 369 | Ga0068865_101613591 | 3300006881 | Bacteria | 583 |
| 370 | Ga0068865_101994557 | 3300006881 | Bacteria | 527 |
| 371 | Ga0075436_100136098 | 3300006914 | Bacteria | 1725 |
| 372 | Ga0075436_100358454 | 3300006914 | Bacteria | 1052 |
| 373 | Ga0075436_101035700 | 3300006914 | Bacteria | 617 |
| 374 | Ga0097620_100003949 | 3300006931 | Bacteria | 15134 |
| 375 | Ga0097620_100006748 | 3300006931 | Bacteria | 11662 |
| 376 | Ga0097620_100334659 | 3300006931 | Bacteria | 1608 |
| 377 | Ga0097620_100383952 | 3300006931 | Bacteria | 1500 |
| 378 | Ga0097620_100385649 | 3300006931 | Bacteria | 1497 |
| 379 | Ga0097620_100456600 | 3300006931 | Bacteria | 1374 |
| 380 | Ga0097620_102050421 | 3300006931 | Bacteria | 632 |
| 381 | Ga0099826_10115124 | 3300006948 | Bacteria | 1594 |
| 382 | Ga0075435_100205340 | 3300007076 | Bacteria | 1670 |
| 383 | Ga0075435_100892958 | 3300007076 | Bacteria | 775 |
| 384 | Ga0099794_10051385 | 3300007265 | Bacteria | 1984 |
| 385 | Ga0099794_10163348 | 3300007265 | Bacteria | 1133 |
| 386 | Ga0099794_10287479 | 3300007265 | Bacteria | 850 |
| 387 | Ga0099795_10000810 | 3300007788 | Bacteria | 6176 |
| 388 | Ga0099795_10055988 | 3300007788 | Bacteria | 1449 |
| 389 | Ga0105244_10163870 | 3300009036 | Bacteria | 1061 |
| 390 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 391 | Ga0105250_10012985 | 3300009092 | Bacteria | 3428 |
| 392 | Ga0105250_10079381 | 3300009092 | Bacteria | 1329 |
| 393 | Ga0105250_10172474 | 3300009092 | Bacteria | 906 |
| 394 | Ga0105240_10013342 | 3300009093 | Bacteria | 11292 |
| 395 | Ga0105240_10016052 | 3300009093 | Bacteria | 10149 |
| 396 | Ga0105240_10048490 | 3300009093 | Bacteria | 5368 |
| 397 | Ga0105240_10055566 | 3300009093 | Bacteria | 4956 |
| 398 | Ga0105240_10067857 | 3300009093 | Bacteria | 4420 |
| 399 | Ga0105240_10148426 | 3300009093 | Bacteria | 2795 |
| 400 | Ga0105240_10354070 | 3300009093 | Bacteria | 1665 |
| 401 | Ga0105240_10579386 | 3300009093 | Bacteria | 1238 |
| 402 | Ga0105240_10849646 | 3300009093 | Bacteria | 985 |
| 403 | Ga0105240_11091957 | 3300009093 | Bacteria | 849 |
| 404 | Ga0105240_12281298 | 3300009093 | Bacteria | 561 |
| 405 | Ga0111539_10007423 | 3300009094 | Bacteria | 14049 |
| 406 | Ga0111539_10407029 | 3300009094 | Bacteria | 1584 |
| 407 | Ga0111539_10418179 | 3300009094 | Bacteria | 1561 |
| 408 | Ga0111539_10429523 | 3300009094 | Bacteria | 1538 |
| 409 | Ga0111539_10961665 | 3300009094 | Bacteria | 993 |
| 410 | Ga0105245_10001014 | 3300009098 | Bacteria | 25513 |
| 411 | Ga0105245_10007287 | 3300009098 | Bacteria | 9684 |
| 412 | Ga0105245_10686563 | 3300009098 | Bacteria | 1056 |
| 413 | Ga0105245_10745948 | 3300009098 | Bacteria | 1015 |
| 414 | Ga0105245_11246612 | 3300009098 | Bacteria | 792 |
| 415 | Ga0105247_10000203 | 3300009101 | Bacteria | 58331 |
| 416 | Ga0105247_10010154 | 3300009101 | Bacteria | 5704 |
| 417 | Ga0105247_10017815 | 3300009101 | Bacteria | 4259 |
| 418 | Ga0105247_10031641 | 3300009101 | Bacteria | 3211 |
| 419 | Ga0105247_10044411 | 3300009101 | Bacteria | 2725 |
| 420 | Ga0105247_10187872 | 3300009101 | Bacteria | 1382 |
| 421 | Ga0105247_10382702 | 3300009101 | Bacteria | 998 |
| 422 | Ga0114129_10002581 | 3300009147 | Bacteria | 25171 |
| 423 | Ga0114129_10003487 | 3300009147 | Bacteria | 22118 |
| 424 | Ga0114129_10072430 | 3300009147 | Bacteria | 4803 |
| 425 | Ga0114129_10516111 | 3300009147 | Bacteria | 1559 |
| 426 | Ga0105243_10071523 | 3300009148 | Bacteria | 2805 |
| 427 | Ga0105243_10077500 | 3300009148 | Bacteria | 2704 |
| 428 | Ga0105243_10179170 | 3300009148 | Bacteria | 1842 |
| 429 | Ga0105241_10042258 | 3300009174 | Bacteria | 3447 |
| 430 | Ga0105241_10172527 | 3300009174 | Bacteria | 1787 |
| 431 | Ga0105241_10266258 | 3300009174 | Bacteria | 1458 |
| 432 | Ga0105241_10273723 | 3300009174 | Bacteria | 1439 |
| 433 | Ga0105241_10580452 | 3300009174 | Bacteria | 1010 |
| 434 | Ga0105241_10653432 | 3300009174 | Bacteria | 955 |
| 435 | Ga0105241_12038860 | 3300009174 | Bacteria | 566 |
| 436 | Ga0105242_10012501 | 3300009176 | Bacteria | 6535 |
| 437 | Ga0105242_10102563 | 3300009176 | Bacteria | 2426 |
| 438 | Ga0105242_10845196 | 3300009176 | Bacteria | 910 |
| 439 | Ga0105242_11127368 | 3300009176 | Bacteria | 800 |
| 440 | Ga0105242_11156372 | 3300009176 | Bacteria | 791 |
| 441 | Ga0105242_11763905 | 3300009176 | Bacteria | 657 |
| 442 | Ga0105242_11920094 | 3300009176 | Bacteria | 633 |
| 443 | Ga0105248_10002240 | 3300009177 | Bacteria | 21387 |
| 444 | Ga0105248_10003720 | 3300009177 | Bacteria | 16908 |
| 445 | Ga0105248_10009721 | 3300009177 | Bacteria | 10592 |
| 446 | Ga0105248_10148848 | 3300009177 | Bacteria | 2641 |
| 447 | Ga0105248_10200615 | 3300009177 | Bacteria | 2247 |
| 448 | Ga0105248_10957965 | 3300009177 | Bacteria | 966 |
| 449 | Ga0105248_11795139 | 3300009177 | Bacteria | 695 |
| 450 | Ga0105248_11808215 | 3300009177 | Bacteria | 693 |
| 451 | Ga0105248_12598693 | 3300009177 | Bacteria | 577 |
| 452 | Ga0105237_10004537 | 3300009545 | Bacteria | 16046 |
| 453 | Ga0105237_10025945 | 3300009545 | Bacteria | 5991 |
| 454 | Ga0105237_10143166 | 3300009545 | Bacteria | 2385 |
| 455 | Ga0105237_10229018 | 3300009545 | Bacteria | 1859 |
| 456 | Ga0105237_10521788 | 3300009545 | Bacteria | 1194 |
| 457 | Ga0105237_11101957 | 3300009545 | Bacteria | 801 |
| 458 | Ga0105238_10048918 | 3300009551 | Bacteria | 4260 |
| 459 | Ga0105238_10067107 | 3300009551 | Bacteria | 3589 |
| 460 | Ga0105238_10109784 | 3300009551 | Bacteria | 2740 |
| 461 | Ga0105238_10230701 | 3300009551 | Bacteria | 1828 |
| 462 | Ga0105238_10506977 | 3300009551 | Bacteria | 1208 |
| 463 | Ga0105238_11261366 | 3300009551 | Bacteria | 764 |
| 464 | Ga0105238_11415658 | 3300009551 | Bacteria | 723 |
| 465 | Ga0105238_11741192 | 3300009551 | Bacteria | 655 |
| 466 | Ga0105238_11926722 | 3300009551 | Bacteria | 624 |
| 467 | Ga0105238_12319906 | 3300009551 | Bacteria | 572 |
| 468 | Ga0105238_12558343 | 3300009551 | Bacteria | 546 |
| 469 | Ga0105249_10003331 | 3300009553 | Bacteria | 13914 |
| 470 | Ga0105249_10012111 | 3300009553 | Bacteria | 7593 |
| 471 | Ga0105249_10303459 | 3300009553 | Bacteria | 1602 |
| 472 | Ga0105249_10484899 | 3300009553 | Bacteria | 1279 |
| 473 | Ga0105249_10584700 | 3300009553 | Bacteria | 1170 |
| 474 | Ga0105249_10735227 | 3300009553 | Bacteria | 1048 |
| 475 | Ga0105249_11614564 | 3300009553 | Bacteria | 721 |
| 476 | Ga0099796_10000821 | 3300010159 | Bacteria | 5655 |
| 477 | Ga0099796_10071209 | 3300010159 | Bacteria | 1256 |
| 478 | Ga0099796_10111308 | 3300010159 | Bacteria | 1042 |
| 479 | Ga0105239_10035422 | 3300010375 | Bacteria | 5482 |
| 480 | Ga0105239_10223365 | 3300010375 | Bacteria | 2112 |
| 481 | Ga0105239_10351468 | 3300010375 | Bacteria | 1664 |
| 482 | Ga0105239_10774918 | 3300010375 | Bacteria | 1098 |
| 483 | Ga0105239_11489720 | 3300010375 | Bacteria | 782 |
| 484 | Ga0105239_11724941 | 3300010375 | Bacteria | 725 |
| 485 | Ga0105239_11787674 | 3300010375 | Bacteria | 712 |
| 486 | Ga0105239_11917209 | 3300010375 | Bacteria | 687 |
| 487 | Ga0105246_10001416 | 3300011119 | Bacteria | 14203 |
| 488 | Ga0105246_10063084 | 3300011119 | Bacteria | 2583 |
| 489 | Ga0105246_11325006 | 3300011119 | Bacteria | 668 |
| 490 | Ga0157373_10454290 | 3300013100 | Bacteria | 922 |
| 491 | Ga0157373_11173625 | 3300013100 | Bacteria | 578 |
| 492 | Ga0157371_10867778 | 3300013102 | Bacteria | 683 |
| 493 | Ga0157370_10013806 | 3300013104 | Bacteria | 8297 |
| 494 | Ga0157370_10351683 | 3300013104 | Bacteria | 1358 |
| 495 | Ga0157369_10190279 | 3300013105 | Bacteria | 2157 |
| 496 | Ga0157369_10501249 | 3300013105 | Bacteria | 1256 |
| 497 | Ga0157369_11356051 | 3300013105 | Bacteria | 724 |
| 498 | Ga0157374_10009304 | 3300013296 | Bacteria | 8426 |
| 499 | Ga0157374_10036490 | 3300013296 | Bacteria | 4502 |
| 500 | Ga0157374_11344532 | 3300013296 | Bacteria | 737 |
| 501 | Ga0157374_11350659 | 3300013296 | Bacteria | 735 |
| 502 | Ga0157378_10001851 | 3300013297 | Bacteria | 18989 |
| 503 | Ga0157378_10364509 | 3300013297 | Bacteria | 1415 |
| 504 | Ga0157378_10397931 | 3300013297 | Bacteria | 1356 |
| 505 | Ga0157378_10611234 | 3300013297 | Bacteria | 1102 |
| 506 | Ga0157378_12005042 | 3300013297 | Bacteria | 629 |
| 507 | Ga0163162_10028294 | 3300013306 | Bacteria | 5545 |
| 508 | Ga0163162_10056795 | 3300013306 | Bacteria | 3942 |
| 509 | Ga0163162_10075537 | 3300013306 | Bacteria | 3430 |
| 510 | Ga0163162_10111464 | 3300013306 | Bacteria | 2833 |
| 511 | Ga0163162_10112926 | 3300013306 | Bacteria | 2815 |
| 512 | Ga0163162_10915917 | 3300013306 | Bacteria | 989 |
| 513 | Ga0163162_11237125 | 3300013306 | Bacteria | 848 |
| 514 | Ga0163162_13101443 | 3300013306 | Bacteria | 534 |
| 515 | Ga0157372_10070914 | 3300013307 | Bacteria | 3922 |
| 516 | Ga0157372_10133926 | 3300013307 | Bacteria | 2853 |
| 517 | Ga0157372_10796326 | 3300013307 | Bacteria | 1098 |
| 518 | Ga0157372_11363439 | 3300013307 | Bacteria | 818 |
| 519 | Ga0157372_11586240 | 3300013307 | Bacteria | 754 |
| 520 | Ga0157375_10038386 | 3300013308 | Bacteria | 4599 |
| 521 | Ga0157375_10062065 | 3300013308 | Bacteria | 3713 |
| 522 | Ga0157375_10098970 | 3300013308 | Bacteria | 2994 |
| 523 | Ga0157375_10246011 | 3300013308 | Bacteria | 1949 |
| 524 | Ga0157375_10406304 | 3300013308 | Bacteria | 1528 |
| 525 | Ga0157375_10983849 | 3300013308 | Bacteria | 984 |
| 526 | Ga0163163_10016441 | 3300014325 | Bacteria | 6877 |
| 527 | Ga0163163_10032681 | 3300014325 | Bacteria | 5027 |
| 528 | Ga0163163_10049729 | 3300014325 | Bacteria | 4126 |
| 529 | Ga0163163_10103176 | 3300014325 | Bacteria | 2876 |
| 530 | Ga0163163_10126133 | 3300014325 | Bacteria | 2598 |
| 531 | Ga0163163_10248013 | 3300014325 | Bacteria | 1831 |
| 532 | Ga0163163_10480184 | 3300014325 | Bacteria | 1304 |
| 533 | Ga0163163_11457998 | 3300014325 | Bacteria | 746 |
| 534 | Ga0157380_10002239 | 3300014326 | Bacteria | 13014 |
| 535 | Ga0157380_10006793 | 3300014326 | Bacteria | 8083 |
| 536 | Ga0157380_10030001 | 3300014326 | Bacteria | 4161 |
| 537 | Ga0157380_10046767 | 3300014326 | Bacteria | 3400 |
| 538 | Ga0157380_11366724 | 3300014326 | Bacteria | 758 |
| 539 | Ga0157380_12937301 | 3300014326 | Bacteria | 543 |
| 540 | Ga0157377_10000573 | 3300014745 | Bacteria | 15380 |
| 541 | Ga0157377_10129784 | 3300014745 | Bacteria | 1538 |
| 542 | Ga0157377_10192408 | 3300014745 | Bacteria | 1290 |
| 543 | Ga0157377_10924710 | 3300014745 | Bacteria | 654 |
| 544 | Ga0157379_10005099 | 3300014968 | Bacteria | 11268 |
| 545 | Ga0157379_10010834 | 3300014968 | Bacteria | 7951 |
| 546 | Ga0157379_10047864 | 3300014968 | Bacteria | 3816 |
| 547 | Ga0157379_10069513 | 3300014968 | Bacteria | 3149 |
| 548 | Ga0157379_10087072 | 3300014968 | Bacteria | 2801 |
| 549 | Ga0157379_10237878 | 3300014968 | Bacteria | 1651 |
| 550 | Ga0157379_10369731 | 3300014968 | Bacteria | 1315 |
| 551 | Ga0157379_10412809 | 3300014968 | Bacteria | 1242 |
| 552 | Ga0157379_10490910 | 3300014968 | Bacteria | 1137 |
| 553 | Ga0157379_11161360 | 3300014968 | Bacteria | 741 |
| 554 | Ga0157379_11600538 | 3300014968 | Bacteria | 636 |
| 555 | Ga0157379_12215417 | 3300014968 | Bacteria | 546 |
| 556 | Ga0157379_12439204 | 3300014968 | Bacteria | 522 |
| 557 | Ga0157379_12488711 | 3300014968 | Bacteria | 517 |
| 558 | Ga0157376_10089514 | 3300014969 | Bacteria | 2661 |
| 559 | Ga0157376_10095866 | 3300014969 | Bacteria | 2581 |
| 560 | Ga0157376_10373275 | 3300014969 | Bacteria | 1372 |
| 561 | Ga0157376_10449877 | 3300014969 | Bacteria | 1256 |
| 562 | Ga0157376_10528053 | 3300014969 | Bacteria | 1164 |
| 563 | Ga0157376_11231690 | 3300014969 | Bacteria | 777 |
| 564 | Ga0157376_13101898 | 3300014969 | Bacteria | 503 |
| 565 | Ga0163161_10215085 | 3300017792 | Bacteria | 1486 |
| 566 | Ga0163161_10282142 | 3300017792 | Bacteria | 1303 |
| 567 | Ga0163161_10380596 | 3300017792 | Bacteria | 1128 |
| 568 | Ga0163161_10690530 | 3300017792 | Bacteria | 849 |
| 569 | Ga0197907_10383539 | 3300020069 | Bacteria | 1964 |
| 570 | Ga0197907_10664428 | 3300020069 | Bacteria | 548 |
| 571 | Ga0197907_11466352 | 3300020069 | Bacteria | 929 |
| 572 | Ga0206356_10120402 | 3300020070 | Bacteria | 874 |
| 573 | Ga0206356_11266440 | 3300020070 | Bacteria | 825 |
| 574 | Ga0206356_11585042 | 3300020070 | Bacteria | 1019 |
| 575 | Ga0206355_1423457 | 3300020076 | Bacteria | 572 |
| 576 | Ga0206352_10211733 | 3300020078 | Bacteria | 1073 |
| 577 | Ga0206352_10523350 | 3300020078 | Bacteria | 1001 |
| 578 | Ga0206350_10545034 | 3300020080 | Bacteria | 837 |
| 579 | Ga0206354_11507845 | 3300020081 | Bacteria | 1860 |
| 580 | Ga0206354_11691571 | 3300020081 | Bacteria | 1008 |
| 581 | Ga0206353_11185898 | 3300020082 | Bacteria | 1650 |
| 582 | Ga0154015_1346390 | 3300020610 | Bacteria | 1208 |
| 583 | Ga0213874_10007794 | 3300021377 | Bacteria | 2585 |
| 584 | Ga0213876_10065609 | 3300021384 | Bacteria | 1916 |
| 585 | Ga0213876_10467771 | 3300021384 | Bacteria | 671 |
| 586 | Ga0213871_10026050 | 3300021441 | Bacteria | 1493 |
| 587 | Ga0213871_10065851 | 3300021441 | Bacteria | 1016 |
| 588 | Ga0224712_10004984 | 3300022467 | Bacteria | 3647 |
| 589 | Ga0224712_10116695 | 3300022467 | Unclassified | 1151 |
| 590 | Ga0228598_1040600 | 3300024227 | Bacteria | 918 |
| 591 | Ga0207656_10046971 | 3300025321 | Bacteria | 1854 |
| 592 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 593 | Ga0207696_1114813 | 3300025711 | Bacteria | 728 |
| 594 | Ga0207692_10054411 | 3300025898 | Bacteria | 2043 |
| 595 | Ga0207692_10454002 | 3300025898 | Bacteria | 807 |
| 596 | Ga0207692_10758916 | 3300025898 | Bacteria | 632 |
| 597 | Ga0207642_10023405 | 3300025899 | Bacteria | 2467 |
| 598 | Ga0207642_10066270 | 3300025899 | Bacteria | 1700 |
| 599 | Ga0207710_10015548 | 3300025900 | Bacteria | 3218 |
| 600 | Ga0207710_10022081 | 3300025900 | Bacteria | 2730 |
| 601 | Ga0207710_10046934 | 3300025900 | Bacteria | 1929 |
| 602 | Ga0207710_10124552 | 3300025900 | Bacteria | 1234 |
| 603 | Ga0207710_10146178 | 3300025900 | Bacteria | 1144 |
| 604 | Ga0207688_10152762 | 3300025901 | Bacteria | 1364 |
| 605 | Ga0207688_10694336 | 3300025901 | Bacteria | 643 |
| 606 | Ga0207680_10007410 | 3300025903 | Bacteria | 5346 |
| 607 | Ga0207680_10020439 | 3300025903 | Bacteria | 3563 |
| 608 | Ga0207680_10020985 | 3300025903 | Bacteria | 3527 |
| 609 | Ga0207680_10102686 | 3300025903 | Bacteria | 1840 |
| 610 | Ga0207680_10143235 | 3300025903 | Bacteria | 1586 |
| 611 | Ga0207680_10170556 | 3300025903 | Bacteria | 1465 |
| 612 | Ga0207685_10042192 | 3300025905 | Bacteria | 1712 |
| 613 | Ga0207685_10098713 | 3300025905 | Bacteria | 1244 |
| 614 | Ga0207685_10138904 | 3300025905 | Bacteria | 1087 |
| 615 | Ga0207685_10329676 | 3300025905 | Bacteria | 764 |
| 616 | Ga0207685_10731805 | 3300025905 | Bacteria | 541 |
| 617 | Ga0207699_10001908 | 3300025906 | Bacteria | 9822 |
| 618 | Ga0207699_10018607 | 3300025906 | Bacteria | 3684 |
| 619 | Ga0207699_10092830 | 3300025906 | Bacteria | 1898 |
| 620 | Ga0207699_10107745 | 3300025906 | Bacteria | 1781 |
| 621 | Ga0207699_10332258 | 3300025906 | Bacteria | 1069 |
| 622 | Ga0207645_10019333 | 3300025907 | Bacteria | 4466 |
| 623 | Ga0207645_10250717 | 3300025907 | Bacteria | 1171 |
| 624 | Ga0207643_10011560 | 3300025908 | Bacteria | 4767 |
| 625 | Ga0207643_10112736 | 3300025908 | Bacteria | 1603 |
| 626 | Ga0207654_10161551 | 3300025911 | Bacteria | 1448 |
| 627 | Ga0207654_10610377 | 3300025911 | Bacteria | 779 |
| 628 | Ga0207707_10003587 | 3300025912 | Bacteria | 13757 |
| 629 | Ga0207707_10015501 | 3300025912 | Bacteria | 6639 |
| 630 | Ga0207707_10017238 | 3300025912 | Bacteria | 6294 |
| 631 | Ga0207707_10053515 | 3300025912 | Bacteria | 3514 |
| 632 | Ga0207707_10141708 | 3300025912 | Bacteria | 2102 |
| 633 | Ga0207707_10352986 | 3300025912 | Bacteria | 1267 |
| 634 | Ga0207695_10007963 | 3300025913 | Bacteria | 13367 |
| 635 | Ga0207695_10038713 | 3300025913 | Bacteria | 5130 |
| 636 | Ga0207695_10040273 | 3300025913 | Bacteria | 5013 |
| 637 | Ga0207695_10071846 | 3300025913 | Bacteria | 3533 |
| 638 | Ga0207695_10097689 | 3300025913 | Bacteria | 2938 |
| 639 | Ga0207695_10108868 | 3300025913 | Bacteria | 2754 |
| 640 | Ga0207695_10143174 | 3300025913 | Bacteria | 2337 |
| 641 | Ga0207695_10169571 | 3300025913 | Bacteria | 2109 |
| 642 | Ga0207695_10625571 | 3300025913 | Bacteria | 958 |
| 643 | Ga0207671_10049957 | 3300025914 | Bacteria | 3097 |
| 644 | Ga0207671_10101047 | 3300025914 | Bacteria | 2185 |
| 645 | Ga0207671_10146114 | 3300025914 | Bacteria | 1824 |
| 646 | Ga0207671_10219173 | 3300025914 | Bacteria | 1490 |
| 647 | Ga0207671_10249032 | 3300025914 | Bacteria | 1397 |
| 648 | Ga0207693_10000059 | 3300025915 | Bacteria | 94053 |
| 649 | Ga0207693_10097835 | 3300025915 | Bacteria | 2301 |
| 650 | Ga0207693_10482189 | 3300025915 | Bacteria | 968 |
| 651 | Ga0207693_10632305 | 3300025915 | Bacteria | 832 |
| 652 | Ga0207693_10851795 | 3300025915 | Bacteria | 701 |
| 653 | Ga0207663_10036504 | 3300025916 | Bacteria | 2957 |
| 654 | Ga0207663_10156363 | 3300025916 | Bacteria | 1604 |
| 655 | Ga0207663_10157361 | 3300025916 | Bacteria | 1600 |
| 656 | Ga0207663_10183790 | 3300025916 | Bacteria | 1495 |
| 657 | Ga0207663_10381800 | 3300025916 | Bacteria | 1073 |
| 658 | Ga0207663_10519010 | 3300025916 | Bacteria | 927 |
| 659 | Ga0207660_10020538 | 3300025917 | Bacteria | 4433 |
| 660 | Ga0207660_10026140 | 3300025917 | Bacteria | 3972 |
| 661 | Ga0207660_10107625 | 3300025917 | Bacteria | 2092 |
| 662 | Ga0207660_10159649 | 3300025917 | Bacteria | 1738 |
| 663 | Ga0207660_10167517 | 3300025917 | Bacteria | 1699 |
| 664 | Ga0207662_10023021 | 3300025918 | Bacteria | 3576 |
| 665 | Ga0207662_10113852 | 3300025918 | Bacteria | 1689 |
| 666 | Ga0207662_10486512 | 3300025918 | Bacteria | 848 |
| 667 | Ga0207657_10443334 | 3300025919 | Bacteria | 1019 |
| 668 | Ga0207649_10035110 | 3300025920 | Bacteria | 3010 |
| 669 | Ga0207649_10123608 | 3300025920 | Bacteria | 1748 |
| 670 | Ga0207649_10142705 | 3300025920 | Bacteria | 1641 |
| 671 | Ga0207649_10456757 | 3300025920 | Bacteria | 965 |
| 672 | Ga0207649_10816371 | 3300025920 | Bacteria | 728 |
| 673 | Ga0207649_10860208 | 3300025920 | Bacteria | 710 |
| 674 | Ga0207652_10061066 | 3300025921 | Bacteria | 3254 |
| 675 | Ga0207652_10111024 | 3300025921 | Bacteria | 2431 |
| 676 | Ga0207652_10180218 | 3300025921 | Bacteria | 1898 |
| 677 | Ga0207652_10224686 | 3300025921 | Bacteria | 1692 |
| 678 | Ga0207652_10984970 | 3300025921 | Bacteria | 742 |
| 679 | Ga0207681_10227255 | 3300025923 | Bacteria | 1447 |
| 680 | Ga0207681_11575731 | 3300025923 | Bacteria | 550 |
| 681 | Ga0207694_10082839 | 3300025924 | Bacteria | 2522 |
| 682 | Ga0207694_10184180 | 3300025924 | Bacteria | 1694 |
| 683 | Ga0207694_10208317 | 3300025924 | Bacteria | 1592 |
| 684 | Ga0207694_10216066 | 3300025924 | Bacteria | 1563 |
| 685 | Ga0207694_10365374 | 3300025924 | Bacteria | 1196 |
| 686 | Ga0207694_10792744 | 3300025924 | Bacteria | 800 |
| 687 | Ga0207694_10931883 | 3300025924 | Bacteria | 735 |
| 688 | Ga0207694_11127558 | 3300025924 | Bacteria | 664 |
| 689 | Ga0207694_11820235 | 3300025924 | Bacteria | 511 |
| 690 | Ga0207650_10017320 | 3300025925 | Bacteria | 5043 |
| 691 | Ga0207650_10063279 | 3300025925 | Bacteria | 2766 |
| 692 | Ga0207650_11478566 | 3300025925 | Bacteria | 578 |
| 693 | Ga0207659_10000855 | 3300025926 | Bacteria | 18065 |
| 694 | Ga0207659_10138710 | 3300025926 | Bacteria | 1885 |
| 695 | Ga0207687_10048914 | 3300025927 | Bacteria | 2938 |
| 696 | Ga0207687_10532577 | 3300025927 | Bacteria | 984 |
| 697 | Ga0207687_10542716 | 3300025927 | Bacteria | 975 |
| 698 | Ga0207687_10755223 | 3300025927 | Bacteria | 828 |
| 699 | Ga0207700_10008920 | 3300025928 | Bacteria | 6240 |
| 700 | Ga0207700_10053646 | 3300025928 | Bacteria | 3022 |
| 701 | Ga0207700_10093752 | 3300025928 | Bacteria | 2377 |
| 702 | Ga0207700_10098853 | 3300025928 | Bacteria | 2322 |
| 703 | Ga0207700_10189483 | 3300025928 | Bacteria | 1728 |
| 704 | Ga0207700_10490249 | 3300025928 | Bacteria | 1087 |
| 705 | Ga0207664_10007703 | 3300025929 | Bacteria | 7473 |
| 706 | Ga0207664_10332123 | 3300025929 | Bacteria | 1343 |
| 707 | Ga0207664_10519256 | 3300025929 | Bacteria | 1067 |
| 708 | Ga0207664_10634366 | 3300025929 | Bacteria | 960 |
| 709 | Ga0207644_10003246 | 3300025931 | Bacteria | 10488 |
| 710 | Ga0207644_10008268 | 3300025931 | Bacteria | 6816 |
| 711 | Ga0207644_10021569 | 3300025931 | Bacteria | 4390 |
| 712 | Ga0207644_10099892 | 3300025931 | Bacteria | 2178 |
| 713 | Ga0207644_10414563 | 3300025931 | Bacteria | 1103 |
| 714 | Ga0207644_10886574 | 3300025931 | Bacteria | 747 |
| 715 | Ga0207644_11499964 | 3300025931 | Bacteria | 566 |
| 716 | Ga0207690_10231659 | 3300025932 | Bacteria | 1418 |
| 717 | Ga0207690_10536651 | 3300025932 | Bacteria | 950 |
| 718 | Ga0207690_10672840 | 3300025932 | Bacteria | 849 |
| 719 | Ga0207690_10728854 | 3300025932 | Bacteria | 816 |
| 720 | Ga0207706_10018342 | 3300025933 | Bacteria | 6297 |
| 721 | Ga0207706_10078688 | 3300025933 | Bacteria | 2900 |
| 722 | Ga0207706_10170095 | 3300025933 | Bacteria | 1915 |
| 723 | Ga0207686_10041377 | 3300025934 | Bacteria | 2809 |
| 724 | Ga0207686_11446551 | 3300025934 | Bacteria | 566 |
| 725 | Ga0207709_10115227 | 3300025935 | Bacteria | 1805 |
| 726 | Ga0207709_10201793 | 3300025935 | Bacteria | 1421 |
| 727 | Ga0207670_10011250 | 3300025936 | Bacteria | 5188 |
| 728 | Ga0207670_10233573 | 3300025936 | Bacteria | 1413 |
| 729 | Ga0207670_10338893 | 3300025936 | Bacteria | 1188 |
| 730 | Ga0207669_10075740 | 3300025937 | Bacteria | 2133 |
| 731 | Ga0207704_10019200 | 3300025938 | Bacteria | 3586 |
| 732 | Ga0207704_10165382 | 3300025938 | Bacteria | 1579 |
| 733 | Ga0207665_10024787 | 3300025939 | Bacteria | 3957 |
| 734 | Ga0207665_10042901 | 3300025939 | Bacteria | 3024 |
| 735 | Ga0207665_10326527 | 3300025939 | Bacteria | 1153 |
| 736 | Ga0207691_10073207 | 3300025940 | Bacteria | 3090 |
| 737 | Ga0207691_10143593 | 3300025940 | Bacteria | 2102 |
| 738 | Ga0207691_10173957 | 3300025940 | Bacteria | 1884 |
| 739 | Ga0207691_10270868 | 3300025940 | Bacteria | 1462 |
| 740 | Ga0207711_10007852 | 3300025941 | Bacteria | 8920 |
| 741 | Ga0207711_10011267 | 3300025941 | Bacteria | 7431 |
| 742 | Ga0207711_10019102 | 3300025941 | Bacteria | 5703 |
| 743 | Ga0207711_10086806 | 3300025941 | Bacteria | 2744 |
| 744 | Ga0207711_10138014 | 3300025941 | Bacteria | 2191 |
| 745 | Ga0207689_10008645 | 3300025942 | Bacteria | 8866 |
| 746 | Ga0207689_10175914 | 3300025942 | Bacteria | 1765 |
| 747 | Ga0207689_10243733 | 3300025942 | Bacteria | 1486 |
| 748 | Ga0207689_10272240 | 3300025942 | Bacteria | 1402 |
| 749 | Ga0207689_10461316 | 3300025942 | Bacteria | 1062 |
| 750 | Ga0207689_10503285 | 3300025942 | Bacteria | 1015 |
| 751 | Ga0207689_10678582 | 3300025942 | Bacteria | 868 |
| 752 | Ga0207661_10008500 | 3300025944 | Bacteria | 7338 |
| 753 | Ga0207679_10016535 | 3300025945 | Bacteria | 4902 |
| 754 | Ga0207679_10188739 | 3300025945 | Bacteria | 1711 |
| 755 | Ga0207679_10669664 | 3300025945 | Bacteria | 940 |
| 756 | Ga0207679_10778816 | 3300025945 | Bacteria | 871 |
| 757 | Ga0207679_11641116 | 3300025945 | Bacteria | 589 |
| 758 | Ga0207667_10006976 | 3300025949 | Bacteria | 13650 |
| 759 | Ga0207667_10007164 | 3300025949 | Bacteria | 13460 |
| 760 | Ga0207667_10096212 | 3300025949 | Bacteria | 3056 |
| 761 | Ga0207667_10161197 | 3300025949 | Bacteria | 2307 |
| 762 | Ga0207667_10167834 | 3300025949 | Bacteria | 2256 |
| 763 | Ga0207667_10332262 | 3300025949 | Bacteria | 1552 |
| 764 | Ga0207667_10642504 | 3300025949 | Bacteria | 1067 |
| 765 | Ga0207667_10731544 | 3300025949 | Bacteria | 990 |
| 766 | Ga0207667_11849791 | 3300025949 | Bacteria | 567 |
| 767 | Ga0207651_10031275 | 3300025960 | Bacteria | 3400 |
| 768 | Ga0207651_10115265 | 3300025960 | Bacteria | 2026 |
| 769 | Ga0207651_10148309 | 3300025960 | Bacteria | 1822 |
| 770 | Ga0207651_11190033 | 3300025960 | Bacteria | 684 |
| 771 | Ga0207712_10122301 | 3300025961 | Bacteria | 1971 |
| 772 | Ga0207712_10130265 | 3300025961 | Bacteria | 1916 |
| 773 | Ga0207712_10144899 | 3300025961 | Bacteria | 1827 |
| 774 | Ga0207712_10383284 | 3300025961 | Bacteria | 1177 |
| 775 | Ga0207668_10254718 | 3300025972 | Bacteria | 1427 |
| 776 | Ga0207668_11433202 | 3300025972 | Bacteria | 623 |
| 777 | Ga0207640_10024393 | 3300025981 | Bacteria | 3649 |
| 778 | Ga0207640_10492713 | 3300025981 | Bacteria | 1019 |
| 779 | Ga0207640_10495460 | 3300025981 | Bacteria | 1016 |
| 780 | Ga0207640_10589952 | 3300025981 | Bacteria | 939 |
| 781 | Ga0207640_10699742 | 3300025981 | Bacteria | 869 |
| 782 | Ga0207640_11070477 | 3300025981 | Bacteria | 712 |
| 783 | Ga0207658_10000894 | 3300025986 | Bacteria | 24824 |
| 784 | Ga0207658_10012452 | 3300025986 | Bacteria | 5811 |
| 785 | Ga0207658_10173765 | 3300025986 | Bacteria | 1777 |
| 786 | Ga0207658_10255626 | 3300025986 | Bacteria | 1490 |
| 787 | Ga0207658_10314811 | 3300025986 | Bacteria | 1353 |
| 788 | Ga0207658_10318538 | 3300025986 | Bacteria | 1345 |
| 789 | Ga0207658_11167191 | 3300025986 | Bacteria | 704 |
| 790 | Ga0207677_10006887 | 3300026023 | Bacteria | 6246 |
| 791 | Ga0207677_10039225 | 3300026023 | Bacteria | 3112 |
| 792 | Ga0207677_10043639 | 3300026023 | Bacteria | 2982 |
| 793 | Ga0207677_10174889 | 3300026023 | Bacteria | 1683 |
| 794 | Ga0207703_10003908 | 3300026035 | Bacteria | 12372 |
| 795 | Ga0207703_10006963 | 3300026035 | Bacteria | 9000 |
| 796 | Ga0207703_10048335 | 3300026035 | Bacteria | 3434 |
| 797 | Ga0207703_10303736 | 3300026035 | Bacteria | 1456 |
| 798 | Ga0207639_10080518 | 3300026041 | Bacteria | 2576 |
| 799 | Ga0207678_10036677 | 3300026067 | Bacteria | 4268 |
| 800 | Ga0207678_10421369 | 3300026067 | Bacteria | 1158 |
| 801 | Ga0207678_10493584 | 3300026067 | Bacteria | 1067 |
| 802 | Ga0207678_10629792 | 3300026067 | Bacteria | 941 |
| 803 | Ga0207678_11563075 | 3300026067 | Bacteria | 581 |
| 804 | Ga0207708_10032419 | 3300026075 | Bacteria | 3968 |
| 805 | Ga0207708_10069706 | 3300026075 | Bacteria | 2692 |
| 806 | Ga0207708_10201949 | 3300026075 | Bacteria | 1586 |
| 807 | Ga0207702_10070305 | 3300026078 | Bacteria | 3010 |
| 808 | Ga0207702_10163274 | 3300026078 | Bacteria | 2036 |
| 809 | Ga0207702_10607666 | 3300026078 | Bacteria | 1073 |
| 810 | Ga0207702_10882004 | 3300026078 | Bacteria | 886 |
| 811 | Ga0207641_10000247 | 3300026088 | Bacteria | 69132 |
| 812 | Ga0207641_10002054 | 3300026088 | Bacteria | 19118 |
| 813 | Ga0207641_10003295 | 3300026088 | Bacteria | 14366 |
| 814 | Ga0207641_10034075 | 3300026088 | Bacteria | 4233 |
| 815 | Ga0207641_10194422 | 3300026088 | Bacteria | 1866 |
| 816 | Ga0207641_10859600 | 3300026088 | Bacteria | 899 |
| 817 | Ga0207648_10013598 | 3300026089 | Bacteria | 7559 |
| 818 | Ga0207648_10180849 | 3300026089 | Bacteria | 1866 |
| 819 | Ga0207676_10002982 | 3300026095 | Bacteria | 12064 |
| 820 | Ga0207676_10009829 | 3300026095 | Bacteria | 6804 |
| 821 | Ga0207676_10190035 | 3300026095 | Bacteria | 1806 |
| 822 | Ga0207674_10020693 | 3300026116 | Bacteria | 7100 |
| 823 | Ga0207674_10146209 | 3300026116 | Bacteria | 2322 |
| 824 | Ga0207674_10197918 | 3300026116 | Bacteria | 1959 |
| 825 | Ga0207674_10315664 | 3300026116 | Bacteria | 1512 |
| 826 | Ga0207675_100042310 | 3300026118 | Bacteria | 4253 |
| 827 | Ga0207675_100046452 | 3300026118 | Bacteria | 4056 |
| 828 | Ga0207675_100142064 | 3300026118 | Bacteria | 2281 |
| 829 | Ga0207675_100145872 | 3300026118 | Bacteria | 2251 |
| 830 | Ga0207675_100335032 | 3300026118 | Bacteria | 1480 |
| 831 | Ga0207675_100378465 | 3300026118 | Bacteria | 1392 |
| 832 | Ga0207675_100907301 | 3300026118 | Bacteria | 898 |
| 833 | Ga0207683_10024420 | 3300026121 | Bacteria | 5206 |
| 834 | Ga0207683_10055966 | 3300026121 | Bacteria | 3459 |
| 835 | Ga0207683_10621886 | 3300026121 | Bacteria | 1000 |
| 836 | Ga0207683_11016654 | 3300026121 | Bacteria | 769 |
| 837 | Ga0207698_10373186 | 3300026142 | Bacteria | 1355 |
| 838 | Ga0207698_10775791 | 3300026142 | Bacteria | 959 |
| 839 | Ga0207698_11221566 | 3300026142 | Bacteria | 766 |
| 840 | Ga0209967_1018162 | 3300027364 | Bacteria | 1017 |
| 841 | Ga0209996_1013832 | 3300027395 | Bacteria | 1093 |
| 842 | Ga0209996_1026910 | 3300027395 | Bacteria | 826 |
| 843 | Ga0210000_1014248 | 3300027462 | Bacteria | 1190 |
| 844 | Ga0209179_1001862 | 3300027512 | Bacteria | 2713 |
| 845 | Ga0209968_1008141 | 3300027526 | Bacteria | 1595 |
| 846 | Ga0209999_1065856 | 3300027543 | Bacteria | 692 |
| 847 | Ga0209970_1052455 | 3300027614 | Bacteria | 739 |
| 848 | Ga0209983_1131258 | 3300027665 | Bacteria | 573 |
| 849 | Ga0209282_1140900 | 3300027666 | Bacteria | 1178 |
| 850 | Ga0209588_1058651 | 3300027671 | Bacteria | 1244 |
| 851 | Ga0209971_1047697 | 3300027682 | Bacteria | 1034 |
| 852 | Ga0209971_1057339 | 3300027682 | Bacteria | 942 |
| 853 | Ga0209966_1056340 | 3300027695 | Bacteria | 843 |
| 854 | Ga0209998_10002265 | 3300027717 | Bacteria | 4451 |
| 855 | Ga0209974_10123172 | 3300027876 | Bacteria | 920 |
| 856 | Ga0209974_10136706 | 3300027876 | Bacteria | 877 |
| 857 | Ga0209974_10182486 | 3300027876 | Bacteria | 769 |
| 858 | Ga0207428_10002594 | 3300027907 | Bacteria | 18052 |
| 859 | Ga0207428_10006431 | 3300027907 | Bacteria | 10850 |
| 860 | Ga0207428_10008559 | 3300027907 | Bacteria | 9233 |
| 861 | Ga0207428_10026062 | 3300027907 | Bacteria | 4885 |
| 862 | Ga0265354_1002018 | 3300028016 | Bacteria | 2654 |
| 863 | Ga0265356_1017450 | 3300028017 | Bacteria | 777 |
| 864 | Ga0265356_1029308 | 3300028017 | Bacteria | 598 |
| 865 | Ga0265357_1000774 | 3300028023 | Bacteria | 2075 |
| 866 | Ga0265355_1001702 | 3300028036 | Bacteria | 1466 |
| 867 | Ga0268266_10000392 | 3300028379 | Bacteria | 66301 |
| 868 | Ga0268266_10002024 | 3300028379 | Bacteria | 22580 |
| 869 | Ga0268266_10009975 | 3300028379 | Bacteria | 8338 |
| 870 | Ga0268266_10012788 | 3300028379 | Bacteria | 7251 |
| 871 | Ga0268266_10014903 | 3300028379 | Bacteria | 6676 |
| 872 | Ga0268266_10086412 | 3300028379 | Bacteria | 2742 |
| 873 | Ga0268266_10267985 | 3300028379 | Bacteria | 1584 |
| 874 | Ga0268266_10681221 | 3300028379 | Bacteria | 990 |
| 875 | Ga0268265_10012234 | 3300028380 | Bacteria | 5812 |
| 876 | Ga0268265_10124822 | 3300028380 | Bacteria | 2128 |
| 877 | Ga0268265_10258996 | 3300028380 | Bacteria | 1545 |
| 878 | Ga0268265_10310624 | 3300028380 | Bacteria | 1423 |
| 879 | Ga0268265_10431371 | 3300028380 | Bacteria | 1226 |
| 880 | Ga0268265_10695224 | 3300028380 | Bacteria | 982 |
| 881 | Ga0268265_10758609 | 3300028380 | Bacteria | 942 |
| 882 | Ga0268265_10970044 | 3300028380 | Bacteria | 838 |
| 883 | Ga0268265_11462624 | 3300028380 | Bacteria | 686 |
| 884 | Ga0268264_10000057 | 3300028381 | Bacteria | 309824 |
| 885 | Ga0268264_10000165 | 3300028381 | Bacteria | 147648 |
| 886 | Ga0268264_10000348 | 3300028381 | Bacteria | 70273 |
| 887 | Ga0268264_10017184 | 3300028381 | Bacteria | 5925 |
| 888 | Ga0268264_10075150 | 3300028381 | Bacteria | 2872 |
| 889 | Ga0268264_10204353 | 3300028381 | Bacteria | 1809 |
| 890 | Ga0268264_10253325 | 3300028381 | Bacteria | 1636 |
| 891 | Ga0268264_10582629 | 3300028381 | Bacteria | 1101 |
| 892 | Ga0268264_11445173 | 3300028381 | Bacteria | 698 |
| 893 | Ga0265319_1193705 | 3300028563 | Bacteria | 624 |
| 894 | Ga0265334_10000123 | 3300028573 | Bacteria | 50146 |
| 895 | Ga0265318_10001505 | 3300028577 | Bacteria | 13592 |
| 896 | Ga0307515_10010000 | 3300028794 | Bacteria | 18265 |
| 897 | Ga0265338_10008882 | 3300028800 | Bacteria | 12109 |
| 898 | Ga0265338_10013818 | 3300028800 | Bacteria | 9072 |
| 899 | Ga0265338_10021377 | 3300028800 | Bacteria | 6750 |
| 900 | Ga0265338_10421732 | 3300028800 | Bacteria | 948 |
| 901 | Ga0265324_10181696 | 3300029957 | Bacteria | 714 |
| 902 | Ga0307511_10042260 | 3300030521 | Bacteria | 3832 |
| 903 | Ga0307511_10324335 | 3300030521 | Bacteria | 679 |
| 904 | Ga0265762_1150451 | 3300030760 | Bacteria | 554 |
| 905 | Ga0265777_122563 | 3300030877 | Bacteria | 527 |
| 906 | Ga0265770_1001311 | 3300030878 | Bacteria | 3438 |
| 907 | Ga0265770_1150366 | 3300030878 | Bacteria | 511 |
| 908 | Ga0265765_1032431 | 3300030879 | Bacteria | 671 |
| 909 | Ga0265771_1010170 | 3300031010 | Bacteria | 686 |
| 910 | Ga0265773_1003947 | 3300031018 | Bacteria | 1001 |
| 911 | Ga0265760_10001990 | 3300031090 | Bacteria | 6005 |
| 912 | Ga0265760_10016230 | 3300031090 | Bacteria | 2136 |
| 913 | Ga0265760_10097309 | 3300031090 | Bacteria | 927 |
| 914 | Ga0265330_10041457 | 3300031235 | Bacteria | 2041 |
| 915 | Ga0265332_10001382 | 3300031238 | Bacteria | 13676 |
| 916 | Ga0265328_10002748 | 3300031239 | Bacteria | 7869 |
| 917 | Ga0265328_10005971 | 3300031239 | Bacteria | 5184 |
| 918 | Ga0265320_10003145 | 3300031240 | Bacteria | 11199 |
| 919 | Ga0265320_10066967 | 3300031240 | Bacteria | 1701 |
| 920 | Ga0265325_10002490 | 3300031241 | Bacteria | 12415 |
| 921 | Ga0265329_10000811 | 3300031242 | Bacteria | 15899 |
| 922 | Ga0265340_10010255 | 3300031247 | Bacteria | 5016 |
| 923 | Ga0265340_10053569 | 3300031247 | Bacteria | 1948 |
| 924 | Ga0265340_10139708 | 3300031247 | Bacteria | 1108 |
| 925 | Ga0265339_10004690 | 3300031249 | Bacteria | 9276 |
| 926 | Ga0265331_10002545 | 3300031250 | Bacteria | 12263 |
| 927 | Ga0265316_10005931 | 3300031344 | Bacteria | 11762 |
| 928 | Ga0265316_10051925 | 3300031344 | Bacteria | 3218 |
| 929 | Ga0265316_10169581 | 3300031344 | Bacteria | 1629 |
| 930 | Ga0307513_10052634 | 3300031456 | Bacteria | 4382 |
| 931 | Ga0307513_10326274 | 3300031456 | Bacteria | 1291 |
| 932 | Ga0307509_10000189 | 3300031507 | Bacteria | 96946 |
| 933 | Ga0307509_10730397 | 3300031507 | Bacteria | 656 |
| 934 | Ga0307408_100053153 | 3300031548 | Bacteria | 2924 |
| 935 | Ga0307408_100063217 | 3300031548 | Bacteria | 2707 |
| 936 | Ga0307408_100785696 | 3300031548 | Bacteria | 863 |
| 937 | Ga0307408_100790828 | 3300031548 | Bacteria | 860 |
| 938 | Ga0307408_101432044 | 3300031548 | Bacteria | 651 |
| 939 | Ga0265313_10002136 | 3300031595 | Bacteria | 17574 |
| 940 | Ga0265313_10047515 | 3300031595 | Bacteria | 2077 |
| 941 | Ga0307508_10779035 | 3300031616 | Bacteria | 572 |
| 942 | Ga0307508_10810086 | 3300031616 | Bacteria | 554 |
| 943 | Ga0316575_10005089 | 3300031665 | Bacteria | 4664 |
| 944 | Ga0316575_10072461 | 3300031665 | Bacteria | 1385 |
| 945 | Ga0265314_10006700 | 3300031711 | Bacteria | 10117 |
| 946 | Ga0265342_10003334 | 3300031712 | Bacteria | 13255 |
| 947 | Ga0316576_10004557 | 3300031727 | Bacteria | 8332 |
| 948 | Ga0316576_10016705 | 3300031727 | Bacteria | 4967 |
| 949 | Ga0316576_10142303 | 3300031727 | Bacteria | 1806 |
| 950 | Ga0316578_10001021 | 3300031728 | Bacteria | 10737 |
| 951 | Ga0316578_10266878 | 3300031728 | Bacteria | 1026 |
| 952 | Ga0316578_10609616 | 3300031728 | Bacteria | 639 |
| 953 | Ga0307516_10000423 | 3300031730 | Bacteria | 55387 |
| 954 | Ga0307516_10874425 | 3300031730 | Bacteria | 564 |
| 955 | Ga0307405_10024050 | 3300031731 | Bacteria | 3473 |
| 956 | Ga0307405_10680904 | 3300031731 | Bacteria | 849 |
| 957 | Ga0307405_10794564 | 3300031731 | Bacteria | 792 |
| 958 | Ga0307405_10948993 | 3300031731 | Bacteria | 731 |
| 959 | Ga0307405_11886814 | 3300031731 | Bacteria | 533 |
| 960 | Ga0316577_10300597 | 3300031733 | Bacteria | 909 |
| 961 | Ga0307413_10229377 | 3300031824 | Bacteria | 1362 |
| 962 | Ga0307413_10504397 | 3300031824 | Bacteria | 972 |
| 963 | Ga0307413_11159904 | 3300031824 | Bacteria | 670 |
| 964 | Ga0307410_10063447 | 3300031852 | Bacteria | 2534 |
| 965 | Ga0307410_10065142 | 3300031852 | Bacteria | 2506 |
| 966 | Ga0307410_10917774 | 3300031852 | Bacteria | 751 |
| 967 | Ga0307410_11140255 | 3300031852 | Bacteria | 677 |
| 968 | Ga0307406_10166578 | 3300031901 | Bacteria | 1590 |
| 969 | Ga0307406_10723069 | 3300031901 | Bacteria | 833 |
| 970 | Ga0307407_10260526 | 3300031903 | Bacteria | 1192 |
| 971 | Ga0307407_10636375 | 3300031903 | Bacteria | 798 |
| 972 | Ga0307412_10214112 | 3300031911 | Bacteria | 1472 |
| 973 | Ga0307412_12083520 | 3300031911 | Bacteria | 526 |
| 974 | Ga0307409_100185402 | 3300031995 | Bacteria | 1846 |
| 975 | Ga0307409_100508564 | 3300031995 | Bacteria | 1174 |
| 976 | Ga0307409_101768807 | 3300031995 | Bacteria | 647 |
| 977 | Ga0307409_101778524 | 3300031995 | Bacteria | 645 |
| 978 | Ga0307416_100278174 | 3300032002 | Bacteria | 1648 |
| 979 | Ga0307416_100550973 | 3300032002 | Bacteria | 1226 |
| 980 | Ga0307416_100613069 | 3300032002 | Bacteria | 1169 |
| 981 | Ga0307416_101648148 | 3300032002 | Bacteria | 746 |
| 982 | Ga0307414_10292001 | 3300032004 | Bacteria | 1375 |
| 983 | Ga0307414_12032772 | 3300032004 | Bacteria | 536 |
| 984 | Ga0307411_10112106 | 3300032005 | Bacteria | 1954 |
| 985 | Ga0307411_10335631 | 3300032005 | Bacteria | 1226 |
| 986 | Ga0307411_10411779 | 3300032005 | Bacteria | 1120 |
| 987 | Ga0307411_11057229 | 3300032005 | Bacteria | 729 |
| 988 | Ga0307411_11332163 | 3300032005 | Bacteria | 655 |
| 989 | Ga0307415_100001511 | 3300032126 | Bacteria | 11159 |
| 990 | Ga0307415_100357894 | 3300032126 | Bacteria | 1231 |
| 991 | Ga0307415_100748602 | 3300032126 | Bacteria | 887 |
| 992 | Ga0316585_10030383 | 3300032137 | Bacteria | 1694 |
| 993 | Ga0316580_10004948 | 3300032139 | Bacteria | 3875 |
| 994 | Ga0307510_10001790 | 3300033180 | Bacteria | 23983 |
| 995 | Ga0307510_10355367 | 3300033180 | Bacteria | 915 |
| 996 | Ga0316212_1047236 | 3300033547 | Bacteria | 611 |
| 997 | Ga0373950_0069518 | 3300034818 | Bacteria | 719 |
| 998 | Ga0373958_0016754 | 3300034819 | Bacteria | 1309 |
| 999 | Ga0373958_0122642 | 3300034819 | Bacteria | 629 |
| 1000 | Ga0373938_0082633 | 3300034957 | Bacteria | 784 |
| 1001 | Ga0373928_0013841 | 3300035084 | Bacteria | 1623 |
| 1002 | Ga0373929_0099239 | 3300035085 | Bacteria | 732 |
| 1003 | Ga0373934_0185130 | 3300035086 | Bacteria | 856 |
| 1004 | Ga0373940_0071490 | 3300035088 | Bacteria | 1011 |
| 1005 | Ga0373949_0039405 | 3300035090 | Bacteria | 1157 |
| 1006 | Ga0373951_0082305 | 3300035091 | Bacteria | 835 |
| 1007 | Ga0373923_0124926 | 3300035111 | Bacteria | 1152 |
| 1008 | Ga0373923_0343697 | 3300035111 | Bacteria | 712 |
| 1009 | Ga0373923_0370125 | 3300035111 | Bacteria | 686 |
| 1010 | Ga0373932_0113214 | 3300035112 | Bacteria | 897 |
| 1011 | Ga0373936_0027228 | 3300035113 | Bacteria | 2242 |
| 1012 | Ga0373939_0047646 | 3300035114 | Bacteria | 1317 |
| 1013 | Ga0373941_0060891 | 3300035115 | Bacteria | 1228 |
| 1014 | Ga0373953_0157626 | 3300035117 | Bacteria | 975 |
| 1015 | Ga0373953_0209399 | 3300035117 | Bacteria | 844 |
| 1016 | Ga0373953_0222810 | 3300035117 | Bacteria | 817 |
| 1017 | Ga0373954_0049752 | 3300035118 | Bacteria | 1966 |
| 1018 | Ga0373954_0073506 | 3300035118 | Bacteria | 1627 |
| 1019 | Ga0373957_0101976 | 3300035120 | Bacteria | 1150 |
| 1020 | Ga0373957_0173888 | 3300035120 | Bacteria | 891 |
| 1021 | Ga0373955_0075611 | 3300035172 | Bacteria | 1893 |
| 1022 | Ga0373955_0295342 | 3300035172 | Bacteria | 976 |
| 1023 | Ga0373955_0429121 | 3300035172 | Bacteria | 804 |
| 1024 | Ga0373955_0527194 | 3300035172 | Bacteria | 722 |
| 1025 | Ga0373955_0545013 | 3300035172 | Bacteria | 709 |
| 1026 | Ga0373942_0189103 | 3300035207 | Bacteria | 678 |
| 1027 | Ga0316574_0000008 | 3300035398 | Bacteria | 48126 |
| 1028 | Ga0316574_0004042 | 3300035398 | Bacteria | 7645 |
| 1029 | Ga0316574_0036525 | 3300035398 | Bacteria | 3008 |
| 1030 | Ga0316574_0077564 | 3300035398 | Bacteria | 2106 |
| 1031 | Ga0316574_0335484 | 3300035398 | Bacteria | 958 |
| 1032 | Ga0316574_0481243 | 3300035398 | Bacteria | 775 |
| 1033 | Ga0316574_1000376 | 3300035398 | Bacteria | 503 |
| 1034 | Ga0373924_0049896 | 3300035410 | Bacteria | 1733 |
| 1035 | Ga0373924_0303553 | 3300035410 | Bacteria | 709 |
| 1036 | Ga0373924_0541848 | 3300035410 | Bacteria | 524 |
| 1037 | Ga0373931_0525010 | 3300035691 | Bacteria | 766 |
| 1038 | Ga0373935_0401222 | 3300035692 | Bacteria | 985 |
| 1039 | Ga0373935_0502596 | 3300035692 | Bacteria | 880 |
| 1040 | Ga0373927_0051249 | 3300035695 | Bacteria | 2669 |
| 1041 | Ga0373933_0060043 | 3300035724 | Bacteria | 2292 |
| 1042 | Ga0373933_0455934 | 3300035724 | Bacteria | 836 |
| 1043 | Ga0373933_0706142 | 3300035724 | Bacteria | 663 |
| 1044 | Ga0373947_0147545 | 3300035725 | Bacteria | 1513 |
| 1045 | Ga0373947_0294453 | 3300035725 | Bacteria | 1081 |
| 1046 | Ga0373937_0003618 | 3300036401 | Bacteria | 13034 |
| 1047 | Ga0373937_0016775 | 3300036401 | Bacteria | 6511 |
| 1048 | Ga0373937_0039869 | 3300036401 | Bacteria | 4280 |
| 1049 | Ga0373937_0266404 | 3300036401 | Bacteria | 1616 |
| 1050 | Ga0373937_0317423 | 3300036401 | Bacteria | 1474 |
| 1051 | Ga0373937_0488915 | 3300036401 | Bacteria | 1169 |
| 1052 | Ga0373937_0631185 | 3300036401 | Bacteria | 1016 |
| 1053 | Ga0316582_0014377 | 3300036647 | Bacteria | 4490 |
| 1054 | Ga0316584_0003999 | 3300036712 | Bacteria | 9698 |
| 1055 | Ga0316584_0032987 | 3300036712 | Bacteria | 3833 |
| 1056 | Ga0316584_0115800 | 3300036712 | Bacteria | 2005 |
| 1057 | Ga0316584_0708044 | 3300036712 | Bacteria | 690 |
| 1058 | Ga0373925_0023959 | 3300037068 | Bacteria | 4453 |
| 1059 | Ga0373925_0024612 | 3300037068 | Bacteria | 4397 |
| 1060 | Ga0373925_0821241 | 3300037068 | Bacteria | 766 |
| 1061 | Ga0373925_1020664 | 3300037068 | Bacteria | 681 |
| 1062 | Ga0395900_0904878 | 3300037418 | Bacteria | 806 |
| 1063 | Ga0395905_0745292 | 3300037471 | Bacteria | 882 |
| 1064 | Ga0436364_0162892 | 3300037853 | Bacteria | 990 |
| 1065 | Ga0436365_0377198 | 3300039437 | Bacteria | 965 |
| 1066 | Ga0436365_0407525 | 3300039437 | Bacteria | 839 |
| 1067 | Ga0436365_1019286 | 3300039437 | Bacteria | 2072 |
| 1068 | Ga0436365_1023348 | 3300039437 | Bacteria | 5152 |
| 1069 | Ga0436365_1891849 | 3300039437 | Bacteria | 1335 |
| 1070 | Ga0436360_0327579 | 3300039438 | Bacteria | 571 |
| 1071 | Ga0436360_0525623 | 3300039438 | Bacteria | 16677 |
| 1072 | Ga0436360_1167873 | 3300039438 | Bacteria | 922 |
| 1073 | Ga0436361_0982899 | 3300039447 | Bacteria | 1012 |
| 1074 | Ga0436363_0035707 | 3300039450 | Bacteria | 1351 |
| 1075 | Ga0436363_0331678 | 3300039450 | Bacteria | 1658 |
| 1076 | Ga0436363_0401150 | 3300039450 | Bacteria | 745 |
| 1077 | Ga0436363_0563147 | 3300039450 | Bacteria | 793 |
| 1078 | Ga0436362_0126569 | 3300039453 | Bacteria | 5039 |
| 1079 | Ga0436362_0394144 | 3300039453 | Bacteria | 1024 |
| 1080 | Ga0439436_0258204 | 3300041404 | Bacteria | 507 |
| 1081 | Ga0439439_0192470 | 3300041406 | Bacteria | 591 |
| 1082 | Ga0439447_049395 | 3300041407 | Bacteria | 1007 |
| 1083 | Ga0439447_142854 | 3300041407 | Bacteria | 550 |
| 1084 | Ga0439461_0119655 | 3300041410 | Bacteria | 657 |
| 1085 | Ga0439465_0368206 | 3300041413 | Bacteria | 544 |
| 1086 | Ga0451789_0291202 | 3300041443 | Bacteria | 520 |
| 1087 | Ga0451793_1114941 | 3300041452 | Bacteria | 564 |
| 1088 | Ga0451799_30402 | 3300041454 | Bacteria | 555 |
| 1089 | Ga0451798_0061378 | 3300041458 | Bacteria | 770 |
| 1090 | Ga0451804_1089028 | 3300041463 | Bacteria | 1120 |
| 1091 | Ga0451807_2424518 | 3300041486 | Bacteria | 683 |
| 1092 | Ga0451839_1008795 | 3300041496 | Bacteria | 2138 |
| 1093 | Ga0451841_0425714 | 3300041498 | Bacteria | 3013 |
| 1094 | Ga0451845_0225953 | 3300041501 | Bacteria | 511 |
| 1095 | Ga0451846_61009 | 3300041502 | Bacteria | 1009 |
| 1096 | Ga0451850_18457 | 3300041506 | Bacteria | 668 |
| 1097 | Ga0451851_0921106 | 3300041507 | Bacteria | 1565 |
| 1098 | Ga0451853_1577538 | 3300041512 | Bacteria | 857 |
| 1099 | Ga0451853_3187295 | 3300041512 | Bacteria | 1061 |
| 1100 | Ga0451853_3268539 | 3300041512 | Bacteria | 994 |
| 1101 | Ga0452268_41072 | 3300041907 | Bacteria | 603 |
| 1102 | Ga0452271_32386 | 3300041916 | Bacteria | 671 |
| 1103 | Ga0439431_0083965 | 3300041997 | Bacteria | 861 |
| 1104 | Ga0439433_0040214 | 3300041999 | Bacteria | 1087 |
| 1105 | Ga0439441_047092 | 3300042001 | Bacteria | 879 |
| 1106 | Ga0439442_152000 | 3300042002 | Bacteria | 515 |
| 1107 | Ga0439443_002397 | 3300042003 | Bacteria | 2238 |
| 1108 | Ga0439448_0213124 | 3300042005 | Bacteria | 678 |
| 1109 | Ga0439449_0098130 | 3300042007 | Bacteria | 1082 |
| 1110 | Ga0439451_135894 | 3300042009 | Bacteria | 503 |
| 1111 | Ga0439456_050303 | 3300042013 | Bacteria | 910 |
| 1112 | Ga0439457_025299 | 3300042014 | Bacteria | 1314 |
| 1113 | Ga0439462_0138330 | 3300042015 | Bacteria | 682 |
| 1114 | Ga0439463_106383 | 3300042016 | Bacteria | 724 |
| 1115 | Ga0450912_013395 | 3300042116 | Bacteria | 733 |
| 1116 | Ga0450914_015638 | 3300042118 | Bacteria | 796 |
| 1117 | Ga0450919_040162 | 3300042121 | Bacteria | 543 |
| 1118 | Ga0450920_029397 | 3300042122 | Bacteria | 1079 |
| 1119 | Ga0450921_002385 | 3300042123 | Bacteria | 1246 |
| 1120 | Ga0450923_075394 | 3300042125 | Bacteria | 753 |
| 1121 | Ga0450923_144706 | 3300042125 | Bacteria | 572 |
| 1122 | Ga0450888_015764 | 3300042126 | Bacteria | 925 |
| 1123 | Ga0450890_013971 | 3300042127 | Bacteria | 1052 |
| 1124 | Ga0450890_021116 | 3300042127 | Bacteria | 884 |
| 1125 | Ga0450897_018552 | 3300042128 | Bacteria | 731 |
| 1126 | Ga0450892_039091 | 3300042130 | Bacteria | 518 |
| 1127 | Ga0450894_021638 | 3300042131 | Bacteria | 870 |
| 1128 | Ga0450895_007646 | 3300042132 | Bacteria | 897 |
| 1129 | Ga0450895_007763 | 3300042132 | Bacteria | 892 |
| 1130 | Ga0450896_000823 | 3300042133 | Bacteria | 3517 |
| 1131 | Ga0450896_001057 | 3300042133 | Bacteria | 3239 |
| 1132 | Ga0450898_005988 | 3300042134 | Bacteria | 1856 |
| 1133 | Ga0450900_050043 | 3300042136 | Bacteria | 639 |
| 1134 | Ga0450906_018003 | 3300042145 | Bacteria | 1270 |
| 1135 | Ga0450907_021884 | 3300042146 | Bacteria | 1076 |
| 1136 | Ga0439446_0007988 | 3300042156 | Bacteria | 2795 |
| 1137 | Ga0439446_0029029 | 3300042156 | Bacteria | 1595 |
| 1138 | Ga0439446_0080440 | 3300042156 | Bacteria | 1008 |
| 1139 | Ga0439446_0263132 | 3300042156 | Bacteria | 598 |
| 1140 | Ga0439458_0054890 | 3300042157 | Bacteria | 988 |
| 1141 | Ga0450908_000192 | 3300042184 | Bacteria | 12530 |
| 1142 | Ga0450908_008697 | 3300042184 | Bacteria | 1898 |
| 1143 | Ga0450908_059215 | 3300042184 | Bacteria | 672 |
| 1144 | Ga0450909_010586 | 3300042185 | Bacteria | 1349 |
| 1145 | Ga0439434_0019108 | 3300042435 | Bacteria | 2054 |
| 1146 | Ga0439444_0003242 | 3300042437 | Bacteria | 2288 |
| 1147 | Ga0439444_0032882 | 3300042437 | Bacteria | 983 |
| 1148 | Ga0439459_0234918 | 3300042438 | Bacteria | 513 |
| 1149 | Ga0439464_0219560 | 3300042439 | Bacteria | 609 |
| 1150 | Ga0439460_0037722 | 3300042461 | Bacteria | 1406 |
| 1151 | Ga0439460_0258504 | 3300042461 | Bacteria | 603 |
| 1152 | Ga0450916_107861 | 3300042530 | Bacteria | 500 |
| 1153 | Ga0450918_066275 | 3300042531 | Bacteria | 673 |
| 1154 | Ga0450893_0059821 | 3300042532 | Bacteria | 726 |
| 1155 | Ga0450893_0098607 | 3300042532 | Bacteria | 593 |
| 1156 | Ga0450893_0126900 | 3300042532 | Bacteria | 536 |
| 1157 | Ga0451577_0026508 | 3300042876 | Bacteria | 5249 |
| 1158 | Ga0451577_0071068 | 3300042876 | Bacteria | 3103 |
| 1159 | Ga0451577_0232659 | 3300042876 | Bacteria | 1667 |
| 1160 | Ga0439440_0023912 | 3300042993 | Bacteria | 1397 |
| 1161 | Ga0466969_0000848 | 3300044656 | Bacteria | 16567 |
| 1162 | Ga0466969_0003618 | 3300044656 | Bacteria | 8229 |
| 1163 | Ga0466972_0062906 | 3300044658 | Bacteria | 1778 |
| 1164 | Ga0466972_0070188 | 3300044658 | Bacteria | 1672 |
| 1165 | Ga0466965_0093846 | 3300044683 | Bacteria | 1529 |
| 1166 | Ga0466966_0006187 | 3300044684 | Bacteria | 7914 |
| 1167 | Ga0466966_0334759 | 3300044684 | Bacteria | 910 |
| 1168 | Ga0466961_0005473 | 3300044693 | Bacteria | 8007 |
| 1169 | Ga0466963_0129568 | 3300044694 | Bacteria | 1742 |
| 1170 | Ga0466964_0000149 | 3300044706 | Bacteria | 18838 |
| 1171 | Ga0453684_0100243 | 3300044712 | Bacteria | 3545 |
| 1172 | Ga0453684_0710947 | 3300044712 | Bacteria | 1091 |
| 1173 | Ga0453684_0740785 | 3300044712 | Bacteria | 1065 |
| 1174 | Ga0466971_0000098 | 3300044719 | Bacteria | 31871 |
| 1175 | Ga0466971_0087825 | 3300044719 | Bacteria | 1422 |
| 1176 | Ga0466968_0005494 | 3300044735 | Bacteria | 4744 |
| 1177 | Ga0466970_0006751 | 3300044765 | Bacteria | 5743 |
| 1178 | Ga0466957_0044272 | 3300044842 | Bacteria | 2697 |
| 1179 | Ga0466960_0034653 | 3300044901 | Bacteria | 2354 |
| 1180 | Ga0466959_0020278 | 3300045049 | Bacteria | 4895 |
| 1181 | Ga0451576_0043483 | 3300045051 | Bacteria | 4740 |
| 1182 | Ga0451576_0104353 | 3300045051 | Bacteria | 2948 |
| 1183 | Ga0451576_0156108 | 3300045051 | Bacteria | 2380 |
| 1184 | Ga0451576_0218229 | 3300045051 | Bacteria | 1991 |
| 1185 | Ga0451576_1150502 | 3300045051 | Bacteria | 811 |
| 1186 | Ga0466958_0064653 | 3300045836 | Bacteria | 2232 |
| 1187 | Ga0466967_1180654 | 3300045976 | Bacteria | 763 |
| 1188 | Ga0495603_0075386 | 3300046455 | Bacteria | 1980 |
| 1189 | Ga0495638_0090616 | 3300046460 | Bacteria | 1843 |
| 1190 | Ga0495651_0320767 | 3300046462 | Bacteria | 1033 |
| 1191 | Ga0495650_0004549 | 3300046471 | Bacteria | 9467 |
| 1192 | Ga0495582_0171281 | 3300046473 | Bacteria | 1236 |
| 1193 | Ga0495582_0282462 | 3300046473 | Bacteria | 953 |
| 1194 | Ga0495639_0197200 | 3300046475 | Bacteria | 984 |
| 1195 | Ga0495639_0218363 | 3300046475 | Bacteria | 937 |
| 1196 | Ga0495639_0403790 | 3300046475 | Bacteria | 690 |
| 1197 | Ga0495584_0156842 | 3300046491 | Bacteria | 1157 |
| 1198 | Ga0495585_0251056 | 3300046492 | Bacteria | 883 |
| 1199 | Ga0495596_0106321 | 3300046500 | Bacteria | 1090 |
| 1200 | Ga0495606_0125158 | 3300046507 | Bacteria | 1534 |
| 1201 | Ga0495608_0714315 | 3300046511 | Bacteria | 596 |
| 1202 | Ga0495628_1162360 | 3300046516 | Bacteria | 525 |
| 1203 | Ga0495630_0058019 | 3300046517 | Bacteria | 2902 |
| 1204 | Ga0495632_0037117 | 3300046519 | Bacteria | 2475 |
| 1205 | Ga0495632_0128137 | 3300046519 | Bacteria | 1182 |
| 1206 | Ga0495632_0218911 | 3300046519 | Bacteria | 861 |
| 1207 | Ga0495632_0268102 | 3300046519 | Bacteria | 762 |
| 1208 | Ga0495648_0437045 | 3300046524 | Bacteria | 576 |
| 1209 | Ga0495666_0231105 | 3300046526 | Bacteria | 845 |
| 1210 | Ga0495666_0257055 | 3300046526 | Bacteria | 795 |
| 1211 | Ga0495652_0840483 | 3300046529 | Bacteria | 609 |
| 1212 | Ga0495654_0411180 | 3300046530 | Bacteria | 536 |
| 1213 | Ga0495586_0092668 | 3300046535 | Bacteria | 1670 |
| 1214 | Ga0495586_0326422 | 3300046535 | Bacteria | 880 |
| 1215 | Ga0495586_0445947 | 3300046535 | Bacteria | 746 |
| 1216 | Ga0495609_0022742 | 3300046538 | Bacteria | 2888 |
| 1217 | Ga0495645_0651452 | 3300046543 | Bacteria | 643 |
| 1218 | Ga0495622_0397610 | 3300046557 | Bacteria | 594 |
| 1219 | Ga0495668_0136290 | 3300046616 | Bacteria | 1344 |
| 1220 | Ga0495668_0603974 | 3300046616 | Bacteria | 606 |
| 1221 | Ga0495668_0641655 | 3300046616 | Bacteria | 587 |
| 1222 | Ga0495634_0279558 | 3300046642 | Bacteria | 1014 |
| 1223 | Ga0495611_0324033 | 3300046648 | Bacteria | 709 |
| 1224 | Ga0495625_0129979 | 3300046660 | Bacteria | 1707 |
| 1225 | Ga0495625_0178817 | 3300046660 | Bacteria | 1412 |
| 1226 | Ga0495625_0488389 | 3300046660 | Bacteria | 755 |
| 1227 | Ga0495625_0499700 | 3300046660 | Bacteria | 744 |
| 1228 | Ga0495657_0406019 | 3300046675 | Bacteria | 801 |
| 1229 | Ga0495599_0170708 | 3300046678 | Bacteria | 1342 |
| 1230 | Ga0495623_0721155 | 3300046679 | Bacteria | 509 |
| 1231 | Ga0495658_0052808 | 3300046683 | Bacteria | 2306 |
| 1232 | Ga0495658_0173561 | 3300046683 | Bacteria | 1335 |
| 1233 | Ga0495658_1033422 | 3300046683 | Bacteria | 524 |
| 1234 | Ga0495669_0435268 | 3300046684 | Bacteria | 636 |
| 1235 | Ga0495669_0627373 | 3300046684 | Bacteria | 523 |
| 1236 | Ga0495624_0384492 | 3300046690 | Bacteria | 843 |
| 1237 | Ga0495671_0443699 | 3300046692 | Bacteria | 620 |
| 1238 | Ga0495649_0246279 | 3300046694 | Bacteria | 919 |
| 1239 | Ga0495604_0260761 | 3300047317 | Bacteria | 1178 |
| 1240 | Ga0495674_0063872 | 3300047319 | Bacteria | 3202 |
| 1241 | Ga0495674_0781369 | 3300047319 | Bacteria | 744 |
| 1242 | Ga0495672_0069285 | 3300047320 | Bacteria | 2003 |
| 1243 | Ga0495680_0242678 | 3300047322 | Bacteria | 1279 |
| 1244 | Ga0495680_0338892 | 3300047322 | Bacteria | 1049 |
| 1245 | Ga0495687_077811 | 3300047443 | Bacteria | 1309 |
| 1246 | Ga0495686_0366778 | 3300047472 | Bacteria | 780 |
| 1247 | Ga0495602_0480890 | 3300048088 | Bacteria | 871 |
| 1248 | Ga0495626_0088816 | 3300048091 | Bacteria | 1362 |
| 1249 | Ga0496100_0016220 | 3300048903 | Bacteria | 4369 |
| 1250 | Ga0496100_0850778 | 3300048903 | Bacteria | 715 |
| 1251 | Ga0496101_0043234 | 3300048904 | Bacteria | 3219 |
| 1252 | Ga0496101_0310089 | 3300048904 | Bacteria | 1237 |
| 1253 | Ga0496101_0428937 | 3300048904 | Bacteria | 1042 |
| 1254 | Ga0496101_0633831 | 3300048904 | Bacteria | 845 |
| 1255 | Ga0496102_0021181 | 3300048905 | Bacteria | 5748 |
| 1256 | Ga0496102_0250307 | 3300048905 | Bacteria | 1670 |
| 1257 | Ga0496103_0094054 | 3300048906 | Bacteria | 1893 |
| 1258 | Ga0496103_0286687 | 3300048906 | Bacteria | 1059 |
| 1259 | Ga0496104_0021988 | 3300048907 | Bacteria | 5859 |
| 1260 | Ga0496104_0129108 | 3300048907 | Bacteria | 2427 |
| 1261 | Ga0496104_0150659 | 3300048907 | Bacteria | 2233 |
| 1262 | Ga0496104_0438092 | 3300048907 | Bacteria | 1219 |
| 1263 | Ga0496104_0572269 | 3300048907 | Bacteria | 1040 |
| 1264 | Ga0496105_0006911 | 3300048908 | Bacteria | 8735 |
| 1265 | Ga0496105_0014994 | 3300048908 | Bacteria | 6166 |
| 1266 | Ga0496105_0057715 | 3300048908 | Bacteria | 3205 |
| 1267 | Ga0496106_0047403 | 3300048909 | Bacteria | 3234 |
| 1268 | Ga0496106_0131994 | 3300048909 | Bacteria | 1959 |
| 1269 | Ga0496106_0163360 | 3300048909 | Bacteria | 1762 |
| 1270 | Ga0496106_0422504 | 3300048909 | Bacteria | 1071 |
| 1271 | Ga0496107_0001841 | 3300048910 | Bacteria | 13389 |
| 1272 | Ga0496107_0107883 | 3300048910 | Bacteria | 2045 |
| 1273 | Ga0496107_0129988 | 3300048910 | Bacteria | 1859 |
| 1274 | Ga0496107_0185344 | 3300048910 | Bacteria | 1546 |
| 1275 | Ga0496107_0553541 | 3300048910 | Bacteria | 852 |
| 1276 | Ga0496107_0853388 | 3300048910 | Bacteria | 665 |
| 1277 | Ga0496108_0002437 | 3300048911 | Bacteria | 14865 |
| 1278 | Ga0496108_0039201 | 3300048911 | Bacteria | 3950 |
| 1279 | Ga0496108_0434119 | 3300048911 | Bacteria | 1147 |
| 1280 | Ga0496109_0018965 | 3300048912 | Bacteria | 6057 |
| 1281 | Ga0496109_0027251 | 3300048912 | Bacteria | 5101 |
| 1282 | Ga0496109_1521207 | 3300048912 | Bacteria | 604 |
| 1283 | Ga0496110_0002260 | 3300048913 | Bacteria | 14391 |
| 1284 | Ga0496110_1621609 | 3300048913 | Bacteria | 557 |
| 1285 | Ga0496111_0042076 | 3300048914 | Bacteria | 3280 |
| 1286 | Ga0496111_0085716 | 3300048914 | Bacteria | 2303 |
| 1287 | Ga0496111_0624307 | 3300048914 | Bacteria | 788 |
| 1288 | Ga0496112_0009255 | 3300048915 | Bacteria | 8855 |
| 1289 | Ga0496112_0011818 | 3300048915 | Bacteria | 7995 |
| 1290 | Ga0496112_0051443 | 3300048915 | Bacteria | 4041 |
| 1291 | Ga0496112_0082474 | 3300048915 | Bacteria | 3180 |
| 1292 | Ga0496113_0027417 | 3300048916 | Bacteria | 4084 |
| 1293 | Ga0496113_0128272 | 3300048916 | Bacteria | 1988 |
| 1294 | Ga0496113_0146811 | 3300048916 | Bacteria | 1859 |
| 1295 | Ga0496114_0002691 | 3300048917 | Bacteria | 13577 |
| 1296 | Ga0496114_0009814 | 3300048917 | Bacteria | 7608 |
| 1297 | Ga0496114_0009986 | 3300048917 | Bacteria | 7547 |
| 1298 | Ga0496114_0149762 | 3300048917 | Bacteria | 2024 |
| 1299 | Ga0496114_0277221 | 3300048917 | Bacteria | 1478 |
| 1300 | Ga0496115_0009121 | 3300048918 | Bacteria | 7362 |
| 1301 | Ga0496115_0089907 | 3300048918 | Bacteria | 2508 |
| 1302 | Ga0496115_0099698 | 3300048918 | Bacteria | 2381 |
| 1303 | Ga0496115_0167546 | 3300048918 | Bacteria | 1817 |
| 1304 | Ga0496115_0339075 | 3300048918 | Bacteria | 1227 |
| 1305 | Ga0496115_0443371 | 3300048918 | Bacteria | 1049 |
| 1306 | Ga0496116_0049718 | 3300048919 | Bacteria | 2800 |
| 1307 | Ga0496117_0000228 | 3300048920 | Bacteria | 106070 |
| 1308 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 1309 | Ga0496119_0071045 | 3300048922 | Bacteria | 2039 |
| 1310 | Ga0496120_0003140 | 3300048923 | Bacteria | 15466 |
| 1311 | Ga0496121_0000522 | 3300048924 | Bacteria | 73298 |
| 1312 | Ga0496121_0034180 | 3300048924 | Bacteria | 4580 |
| 1313 | Ga0496121_0104368 | 3300048924 | Bacteria | 2178 |
| 1314 | Ga0496122_0400685 | 3300048925 | Bacteria | 697 |
| 1315 | Ga0496124_0006063 | 3300048927 | Bacteria | 13304 |
| 1316 | Ga0496125_0001732 | 3300048928 | Bacteria | 30347 |
| 1317 | Ga0496125_0008666 | 3300048928 | Bacteria | 10595 |
| 1318 | Ga0496125_0046500 | 3300048928 | Bacteria | 3640 |
| 1319 | Ga0496126_0006131 | 3300048929 | Bacteria | 13471 |
| 1320 | Ga0496126_0007001 | 3300048929 | Bacteria | 12457 |
| 1321 | Ga0496126_0225698 | 3300048929 | Bacteria | 1571 |
| 1322 | Ga0496126_0234217 | 3300048929 | Bacteria | 1537 |
| 1323 | Ga0501306_019749 | 3300049127 | Bacteria | 932 |
| 1324 | Ga0495682_0089028 | 3300049460 | Bacteria | 1109 |
| 1325 | Ga0501291_074711 | 3300049514 | Bacteria | 663 |
| 1326 | Ga0501292_063228 | 3300049515 | Bacteria | 675 |
| 1327 | Ga0501294_016082 | 3300049517 | Bacteria | 777 |
| 1328 | Ga0501295_199824 | 3300049518 | Bacteria | 504 |
| 1329 | Ga0501299_053130 | 3300049522 | Bacteria | 841 |
| 1330 | Ga0501299_081347 | 3300049522 | Bacteria | 720 |
| 1331 | Ga0501300_034043 | 3300049523 | Bacteria | 756 |
| 1332 | Ga0501301_008534 | 3300049524 | Bacteria | 809 |
| 1333 | Ga0501031_0100963 | 3300049568 | Bacteria | 1883 |
| 1334 | Ga0501031_0319551 | 3300049568 | Bacteria | 1006 |
| 1335 | Ga0501032_0028835 | 3300049569 | Bacteria | 3812 |
| 1336 | Ga0501032_0401060 | 3300049569 | Bacteria | 881 |
| 1337 | Ga0501033_0402185 | 3300049570 | Bacteria | 955 |
| 1338 | Ga0501033_0689557 | 3300049570 | Bacteria | 696 |
| 1339 | Ga0501034_0136286 | 3300049571 | Bacteria | 2436 |
| 1340 | Ga0501034_1177008 | 3300049571 | Bacteria | 646 |
| 1341 | Ga0501036_0000947 | 3300049572 | Bacteria | 21826 |
| 1342 | Ga0501036_0031170 | 3300049572 | Bacteria | 4505 |
| 1343 | Ga0501036_0053598 | 3300049572 | Bacteria | 3415 |
| 1344 | Ga0501036_0444443 | 3300049572 | Bacteria | 1080 |
| 1345 | Ga0501037_0016924 | 3300049573 | Bacteria | 5365 |
| 1346 | Ga0501038_0011051 | 3300049574 | Bacteria | 8245 |
| 1347 | Ga0501038_0146197 | 3300049574 | Bacteria | 1930 |
| 1348 | Ga0501038_0323332 | 3300049574 | Bacteria | 1206 |
| 1349 | Ga0501039_0000322 | 3300049575 | Bacteria | 34031 |
| 1350 | Ga0501039_0050028 | 3300049575 | Bacteria | 3232 |
| 1351 | Ga0501039_0197629 | 3300049575 | Bacteria | 1581 |
| 1352 | Ga0501039_0595879 | 3300049575 | Bacteria | 866 |
| 1353 | Ga0501039_0691882 | 3300049575 | Bacteria | 797 |
| 1354 | Ga0501039_1048478 | 3300049575 | Bacteria | 633 |
| 1355 | Ga0501039_1218041 | 3300049575 | Bacteria | 582 |
| 1356 | Ga0501040_0000188 | 3300049576 | Bacteria | 35587 |
| 1357 | Ga0501040_0010458 | 3300049576 | Bacteria | 6068 |
| 1358 | Ga0501040_0624474 | 3300049576 | Bacteria | 779 |
| 1359 | Ga0501041_0000269 | 3300049577 | Bacteria | 24672 |
| 1360 | Ga0501041_0028556 | 3300049577 | Bacteria | 3365 |
| 1361 | Ga0501041_0032199 | 3300049577 | Bacteria | 3169 |
| 1362 | Ga0501041_0177185 | 3300049577 | Bacteria | 1335 |
| 1363 | Ga0501041_0453293 | 3300049577 | Bacteria | 814 |
| 1364 | Ga0501041_1066210 | 3300049577 | Bacteria | 520 |
| 1365 | Ga0501042_0035564 | 3300049578 | Bacteria | 3533 |
| 1366 | Ga0501042_0196877 | 3300049578 | Bacteria | 1453 |
| 1367 | Ga0501043_0008846 | 3300049579 | Bacteria | 7923 |
| 1368 | Ga0501043_0228276 | 3300049579 | Bacteria | 1439 |
| 1369 | Ga0501046_0032906 | 3300049580 | Bacteria | 4195 |
| 1370 | Ga0501046_0065390 | 3300049580 | Bacteria | 2837 |
| 1371 | Ga0501046_0487364 | 3300049580 | Bacteria | 884 |
| 1372 | Ga0501046_0567786 | 3300049580 | Bacteria | 807 |
| 1373 | Ga0501047_0339511 | 3300049581 | Bacteria | 1340 |
| 1374 | Ga0501047_0560936 | 3300049581 | Bacteria | 966 |
| 1375 | Ga0501047_1054888 | 3300049581 | Bacteria | 626 |
| 1376 | Ga0501048_0002660 | 3300049582 | Bacteria | 13638 |
| 1377 | Ga0501048_0036457 | 3300049582 | Bacteria | 3535 |
| 1378 | Ga0501048_0505723 | 3300049582 | Bacteria | 866 |
| 1379 | Ga0501048_1169945 | 3300049582 | Bacteria | 553 |
| 1380 | Ga0501067_0007150 | 3300049583 | Bacteria | 6200 |
| 1381 | Ga0501068_0036761 | 3300049584 | Bacteria | 2930 |
| 1382 | Ga0501068_0556078 | 3300049584 | Bacteria | 746 |
| 1383 | Ga0501069_0108047 | 3300049585 | Bacteria | 1583 |
| 1384 | Ga0501069_0500446 | 3300049585 | Bacteria | 725 |
| 1385 | Ga0501070_0582021 | 3300049586 | Bacteria | 894 |
| 1386 | Ga0501071_0014106 | 3300049587 | Bacteria | 5463 |
| 1387 | Ga0501071_0025539 | 3300049587 | Bacteria | 4139 |
| 1388 | Ga0501071_0121000 | 3300049587 | Bacteria | 1940 |
| 1389 | Ga0501071_0152726 | 3300049587 | Bacteria | 1723 |
| 1390 | Ga0501071_0213057 | 3300049587 | Bacteria | 1453 |
| 1391 | Ga0501071_0310494 | 3300049587 | Bacteria | 1196 |
| 1392 | Ga0501071_0374430 | 3300049587 | Bacteria | 1085 |
| 1393 | Ga0501071_0600918 | 3300049587 | Bacteria | 846 |
| 1394 | Ga0501071_1137620 | 3300049587 | Bacteria | 603 |
| 1395 | Ga0501071_1174680 | 3300049587 | Bacteria | 593 |
| 1396 | Ga0501072_0002259 | 3300049588 | Bacteria | 14395 |
| 1397 | Ga0501072_0038934 | 3300049588 | Bacteria | 3732 |
| 1398 | Ga0501072_0045324 | 3300049588 | Bacteria | 3457 |
| 1399 | Ga0501072_0261277 | 3300049588 | Bacteria | 1378 |
| 1400 | Ga0501072_0297632 | 3300049588 | Bacteria | 1283 |
| 1401 | Ga0501072_0690634 | 3300049588 | Bacteria | 802 |
| 1402 | Ga0501073_0014788 | 3300049589 | Bacteria | 5666 |
| 1403 | Ga0501073_0152515 | 3300049589 | Bacteria | 1601 |
| 1404 | Ga0501073_0179814 | 3300049589 | Bacteria | 1464 |
| 1405 | Ga0501073_0204240 | 3300049589 | Bacteria | 1366 |
| 1406 | Ga0501073_0735081 | 3300049589 | Bacteria | 681 |
| 1407 | Ga0501074_0414237 | 3300049590 | Bacteria | 956 |
| 1408 | Ga0501074_0534173 | 3300049590 | Bacteria | 830 |
| 1409 | Ga0501074_0666513 | 3300049590 | Bacteria | 735 |
| 1410 | Ga0501075_0000082 | 3300049591 | Bacteria | 43214 |
| 1411 | Ga0501075_0042017 | 3300049591 | Bacteria | 3427 |
| 1412 | Ga0501075_0143535 | 3300049591 | Bacteria | 1820 |
| 1413 | Ga0501075_0158999 | 3300049591 | Bacteria | 1723 |
| 1414 | Ga0501075_1521746 | 3300049591 | Bacteria | 506 |
| 1415 | Ga0501076_0006540 | 3300049592 | Bacteria | 8455 |
| 1416 | Ga0501076_0006615 | 3300049592 | Bacteria | 8405 |
| 1417 | Ga0501076_0030447 | 3300049592 | Bacteria | 4203 |
| 1418 | Ga0501076_0047451 | 3300049592 | Bacteria | 3396 |
| 1419 | Ga0501076_0052303 | 3300049592 | Bacteria | 3235 |
| 1420 | Ga0501076_0668716 | 3300049592 | Bacteria | 857 |
| 1421 | Ga0501076_1409431 | 3300049592 | Bacteria | 572 |
| 1422 | Ga0501077_0010560 | 3300049593 | Bacteria | 5751 |
| 1423 | Ga0501077_0049066 | 3300049593 | Bacteria | 2682 |
| 1424 | Ga0501077_0059394 | 3300049593 | Bacteria | 2427 |
| 1425 | Ga0501077_0197227 | 3300049593 | Bacteria | 1279 |
| 1426 | Ga0501216_028415 | 3300049660 | Bacteria | 1020 |
| 1427 | Ga0501217_067008 | 3300049661 | Bacteria | 970 |
| 1428 | Ga0501233_080615 | 3300049668 | Bacteria | 837 |
| 1429 | Ga0501247_089256 | 3300049677 | Bacteria | 506 |
| 1430 | Ga0501249_064476 | 3300049679 | Bacteria | 851 |
| 1431 | Ga0501253_058896 | 3300049683 | Bacteria | 823 |
| 1432 | Ga0501219_016367 | 3300049703 | Bacteria | 608 |
| 1433 | Ga0501225_0041457 | 3300049705 | Bacteria | 1270 |
| 1434 | Ga0501079_0000290 | 3300049741 | Bacteria | 31028 |
| 1435 | Ga0501079_0014415 | 3300049741 | Bacteria | 6026 |
| 1436 | Ga0501079_0058865 | 3300049741 | Bacteria | 2964 |
| 1437 | Ga0501079_0371358 | 3300049741 | Bacteria | 1121 |
| 1438 | Ga0501079_0773406 | 3300049741 | Bacteria | 756 |
| 1439 | Ga0501079_1470233 | 3300049741 | Bacteria | 536 |
| 1440 | Ga0501079_1606202 | 3300049741 | Bacteria | 511 |
| 1441 | Ga0501080_0009710 | 3300049742 | Bacteria | 8787 |
| 1442 | Ga0501080_0140864 | 3300049742 | Bacteria | 2230 |
| 1443 | Ga0501080_0158121 | 3300049742 | Bacteria | 2093 |
| 1444 | Ga0501080_0337875 | 3300049742 | Bacteria | 1361 |
| 1445 | Ga0501080_0519447 | 3300049742 | Bacteria | 1063 |
| 1446 | Ga0501081_0000015 | 3300049743 | Bacteria | 57696 |
| 1447 | Ga0501081_0006175 | 3300049743 | Bacteria | 7759 |
| 1448 | Ga0501081_0050037 | 3300049743 | Bacteria | 2878 |
| 1449 | Ga0501081_0426399 | 3300049743 | Bacteria | 984 |
| 1450 | Ga0501081_1025698 | 3300049743 | Bacteria | 624 |
| 1451 | Ga0501081_1049363 | 3300049743 | Bacteria | 616 |
| 1452 | Ga0501083_0477720 | 3300049744 | Bacteria | 811 |
| 1453 | Ga0501266_014280 | 3300049763 | Bacteria | 1040 |
| 1454 | Ga0501268_108937 | 3300049765 | Bacteria | 602 |
| 1455 | Ga0501270_027915 | 3300049767 | Bacteria | 911 |
| 1456 | Ga0501278_014263 | 3300049774 | Bacteria | 674 |
| 1457 | Ga0501035_0235740 | 3300049822 | Bacteria | 1558 |
| 1458 | Ga0501035_0307350 | 3300049822 | Bacteria | 1335 |
| 1459 | Ga0501035_0330726 | 3300049822 | Bacteria | 1279 |
| 1460 | Ga0501035_0715502 | 3300049822 | Bacteria | 806 |
| 1461 | Ga0501045_0000284 | 3300049824 | Bacteria | 29687 |
| 1462 | Ga0501045_0016097 | 3300049824 | Bacteria | 5306 |
| 1463 | Ga0501045_1284783 | 3300049824 | Bacteria | 533 |
| 1464 | Ga0501212_037303 | 3300049851 | Bacteria | 797 |
| 1465 | nmdc:mga0k408_270731_c1 | 3300050493 | Bacteria | 1014 |
| 1466 | nmdc:mga06z11_581469_c1 | 3300050494 | Bacteria | 681 |
| 1467 | nmdc:mga05p37_381673_c1 | 3300050507 | Bacteria | 1651 |
| 1468 | nmdc:mga05p37_662_c1 | 3300050507 | Bacteria | 38035 |
| 1469 | nmdc:mga05p37_8136_c1 | 3300050507 | Bacteria | 12395 |
| 1470 | nmdc:mga09592_1178559_c1 | 3300050508 | Bacteria | 634 |
| 1471 | nmdc:mga09592_2530_c1 | 3300050508 | Bacteria | 14794 |
| 1472 | nmdc:mga09592_47268_c1 | 3300050508 | Bacteria | 3627 |
| 1473 | nmdc:mga09592_513_c1 | 3300050508 | Bacteria | 29327 |
| 1474 | nmdc:mga0qj67_107101_c1 | 3300050509 | Bacteria | 2255 |
| 1475 | nmdc:mga0qj67_11050_c1 | 3300050509 | Bacteria | 6760 |
| 1476 | nmdc:mga0qj67_14416_c1 | 3300050509 | Bacteria | 5976 |
| 1477 | nmdc:mga0qj67_251514_c1 | 3300050509 | Bacteria | 1434 |
| 1478 | nmdc:mga0qj67_32544_c1 | 3300050509 | Bacteria | 4067 |
| 1479 | nmdc:mga0qj67_51822_c1 | 3300050509 | Bacteria | 3246 |
| 1480 | nmdc:mga0qj67_723954_c1 | 3300050509 | Bacteria | 790 |
| 1481 | nmdc:mga06r32_19490_c1 | 3300050510 | Bacteria | 6228 |
| 1482 | nmdc:mga06r32_2943_c1 | 3300050510 | Bacteria | 15261 |
| 1483 | nmdc:mga06r32_772315_c1 | 3300050510 | Bacteria | 923 |
| 1484 | nmdc:mga06r32_93_c1 | 3300050510 | Bacteria | 62195 |
| 1485 | nmdc:mga08y16_11335_c1 | 3300050511 | Bacteria | 9366 |
| 1486 | nmdc:mga08y16_266615_c1 | 3300050511 | Bacteria | 1768 |
| 1487 | nmdc:mga08y16_30678_c1 | 3300050511 | Bacteria | 5655 |
| 1488 | nmdc:mga08y16_541403_c1 | 3300050511 | Bacteria | 1179 |
| 1489 | nmdc:mga08y16_9557_c1 | 3300050511 | Bacteria | 10179 |
| 1490 | nmdc:mga0n895_1211928_c1 | 3300050512 | Bacteria | 728 |
| 1491 | nmdc:mga0n895_198762_c1 | 3300050512 | Bacteria | 2036 |
| 1492 | nmdc:mga0n895_5728_c1 | 3300050512 | Bacteria | 10427 |
| 1493 | nmdc:mga0n895_635943_c1 | 3300050512 | Bacteria | 1067 |
| 1494 | nmdc:mga0rr50_228421_c1 | 3300050513 | Bacteria | 1539 |
| 1495 | nmdc:mga0rr50_262247_c1 | 3300050513 | Bacteria | 1438 |
| 1496 | nmdc:mga0rr50_279732_c1 | 3300050513 | Bacteria | 1392 |
| 1497 | nmdc:mga0rr50_593413_c1 | 3300050513 | Bacteria | 944 |
| 1498 | nmdc:mga08x19_170284_c1 | 3300050514 | Bacteria | 1483 |
| 1499 | nmdc:mga08x19_635783_c1 | 3300050514 | Bacteria | 757 |
| 1500 | nmdc:mga0a205_1357_c2 | 3300050515 | Bacteria | 11423 |
| 1501 | Ga0495601_0005333 | 3300053077 | Bacteria | 7487 |
| 1502 | Ga0495601_0156897 | 3300053077 | Bacteria | 1486 |
| 1503 | Ga0495601_0178148 | 3300053077 | Bacteria | 1390 |
| 1504 | Ga0495612_0310411 | 3300053078 | Bacteria | 708 |
| 1505 | Ga0500610_0347206 | 3300053079 | Bacteria | 630 |
| 1506 | Ga0495595_0362123 | 3300053084 | Bacteria | 733 |
| 1507 | Ga0495595_0581780 | 3300053084 | Bacteria | 572 |
| 1508 | Ga0500643_085723 | 3300053087 | Bacteria | 862 |
| 1509 | Ga0500644_0146897 | 3300053088 | Bacteria | 942 |
| 1510 | Ga0500644_0218906 | 3300053088 | Bacteria | 793 |
| 1511 | Ga0500646_0059954 | 3300053090 | Bacteria | 1118 |
| 1512 | Ga0500646_0116360 | 3300053090 | Bacteria | 855 |
| 1513 | Ga0500583_0002104 | 3300053092 | Bacteria | 5906 |
| 1514 | Ga0500583_0005358 | 3300053092 | Bacteria | 4292 |
| 1515 | Ga0500583_0072418 | 3300053092 | Bacteria | 1650 |
| 1516 | Ga0500583_0140818 | 3300053092 | Bacteria | 1198 |
| 1517 | Ga0500583_0144740 | 3300053092 | Bacteria | 1182 |
| 1518 | Ga0500583_0188012 | 3300053092 | Bacteria | 1028 |
| 1519 | Ga0500651_0479902 | 3300053093 | Bacteria | 688 |
| 1520 | Ga0500641_0002198 | 3300053096 | Bacteria | 6907 |
| 1521 | Ga0500641_0049471 | 3300053096 | Bacteria | 1724 |
| 1522 | Ga0500641_0066814 | 3300053096 | Bacteria | 1506 |
| 1523 | Ga0500650_0032253 | 3300053098 | Bacteria | 2386 |
| 1524 | Ga0500650_0154479 | 3300053098 | Bacteria | 1060 |
| 1525 | Ga0500650_0350738 | 3300053098 | Bacteria | 645 |
| 1526 | Ga0500650_0449956 | 3300053098 | Bacteria | 552 |
| 1527 | Ga0500660_071612 | 3300053100 | Bacteria | 1623 |
| 1528 | Ga0500556_0037328 | 3300053104 | Bacteria | 1690 |
| 1529 | Ga0500556_0042674 | 3300053104 | Bacteria | 1606 |
| 1530 | Ga0500562_015693 | 3300053108 | Bacteria | 1944 |
| 1531 | Ga0500562_101991 | 3300053108 | Bacteria | 781 |
| 1532 | Ga0500562_114712 | 3300053108 | Bacteria | 734 |
| 1533 | Ga0500569_057131 | 3300053109 | Bacteria | 1195 |
| 1534 | Ga0500572_015317 | 3300053111 | Bacteria | 1933 |
| 1535 | Ga0500591_138439 | 3300053115 | Bacteria | 966 |
| 1536 | Ga0500595_025471 | 3300053119 | Bacteria | 2050 |
| 1537 | Ga0500617_035705 | 3300053124 | Bacteria | 2226 |
| 1538 | Ga0500617_144670 | 3300053124 | Bacteria | 949 |
| 1539 | Ga0500642_0152836 | 3300053130 | Bacteria | 1083 |
| 1540 | Ga0500642_0233466 | 3300053130 | Bacteria | 849 |
| 1541 | Ga0500642_0246502 | 3300053130 | Bacteria | 821 |
| 1542 | Ga0500658_0055102 | 3300053134 | Bacteria | 1636 |
| 1543 | Ga0500658_0126395 | 3300053134 | Bacteria | 1137 |
| 1544 | Ga0500568_0038663 | 3300053139 | Bacteria | 1930 |
| 1545 | Ga0500568_0073441 | 3300053139 | Bacteria | 1306 |
| 1546 | Ga0500568_0152819 | 3300053139 | Bacteria | 854 |
| 1547 | Ga0500577_0075417 | 3300053142 | Bacteria | 1333 |
| 1548 | Ga0500577_0211746 | 3300053142 | Bacteria | 838 |
| 1549 | Ga0500588_0000825 | 3300053146 | Bacteria | 5386 |
| 1550 | Ga0500588_0006662 | 3300053146 | Bacteria | 2629 |
| 1551 | Ga0500588_0037797 | 3300053146 | Bacteria | 1436 |
| 1552 | Ga0500589_063307 | 3300053147 | Bacteria | 1690 |
| 1553 | Ga0500589_122401 | 3300053147 | Bacteria | 1100 |
| 1554 | Ga0500589_187897 | 3300053147 | Bacteria | 805 |
| 1555 | Ga0500590_137705 | 3300053148 | Bacteria | 1120 |
| 1556 | Ga0500604_0069821 | 3300053151 | Bacteria | 1118 |
| 1557 | Ga0500616_0019660 | 3300053153 | Bacteria | 3804 |
| 1558 | Ga0500619_239755 | 3300053154 | Bacteria | 600 |
| 1559 | Ga0500622_0000318 | 3300053156 | Bacteria | 48445 |
| 1560 | Ga0500622_0003146 | 3300053156 | Bacteria | 11303 |
| 1561 | Ga0500622_0173222 | 3300053156 | Bacteria | 1003 |
| 1562 | Ga0500624_143018 | 3300053157 | Bacteria | 512 |
| 1563 | Ga0500627_0064483 | 3300053158 | Bacteria | 1616 |
| 1564 | Ga0500627_0139213 | 3300053158 | Bacteria | 1096 |
| 1565 | Ga0500627_0194676 | 3300053158 | Bacteria | 910 |
| 1566 | Ga0500630_147338 | 3300053159 | Bacteria | 1003 |
| 1567 | Ga0500634_0180186 | 3300053161 | Bacteria | 952 |
| 1568 | Ga0500639_093845 | 3300053163 | Bacteria | 1490 |
| 1569 | Ga0500639_127850 | 3300053163 | Bacteria | 1209 |
| 1570 | Ga0500637_0005251 | 3300053178 | Bacteria | 6257 |
| 1571 | Ga0500637_0005644 | 3300053178 | Bacteria | 6081 |
| 1572 | Ga0500637_0186341 | 3300053178 | Bacteria | 1187 |
| 1573 | Ga0500611_004201 | 3300053727 | Bacteria | 1923 |
| 1574 | Ga0500611_120234 | 3300053727 | Bacteria | 699 |
| 1575 | Ga0500656_009938 | 3300053732 | Bacteria | 1032 |
| 1576 | Ga0501084_0024614 | 3300054114 | Bacteria | 5024 |
| 1577 | Ga0501084_0072927 | 3300054114 | Bacteria | 2875 |
| 1578 | Ga0501084_0569580 | 3300054114 | Bacteria | 957 |
| 1579 | Ga0501084_0587161 | 3300054114 | Bacteria | 941 |
| 1580 | Ga0501084_1838453 | 3300054114 | Bacteria | 506 |
| 1581 | Ga0587084_024783 | 3300059477 | Bacteria | 926 |
| 1582 | Ga0587066_041731 | 3300059490 | Bacteria | 868 |
| 1583 | Ga0587073_0098956 | 3300059492 | Bacteria | 755 |
| 1584 | Ga0587073_0209027 | 3300059492 | Bacteria | 590 |
| 1585 | Ga0587088_060789 | 3300059508 | Bacteria | 765 |
| 1586 | Ga0587090_023914 | 3300059510 | Bacteria | 976 |
| 1587 | Ga0587090_060900 | 3300059510 | Bacteria | 716 |
| 1588 | Ga0587094_056210 | 3300059513 | Bacteria | 678 |
| 1589 | Ga0587130_023277 | 3300059631 | Bacteria | 681 |
| 1590 | Ga0587067_057047 | 3300059640 | Bacteria | 808 |
| 1591 | Ga0587068_078567 | 3300059641 | Bacteria | 663 |
| 1592 | Ga0587076_025250 | 3300059645 | Bacteria | 1014 |
| 1593 | Ga0587078_032918 | 3300059646 | Bacteria | 706 |
| 1594 | Ga0587114_116797 | 3300059655 | Bacteria | 536 |
| 1595 | Ga0587111_0086397 | 3300060346 | Bacteria | 758 |
| 1596 | Ga0587111_0110630 | 3300060346 | Bacteria | 696 |
| 1597 | Ga0501082_0000222 | 3300060353 | Bacteria | 49671 |
| 1598 | Ga0501082_0003441 | 3300060353 | Bacteria | 13814 |
| 1599 | Ga0501082_0025636 | 3300060353 | Bacteria | 5080 |
| 1600 | Ga0501082_0082626 | 3300060353 | Bacteria | 2771 |
| 1601 | Ga0466962_0000641 | 3300061719 | Bacteria | 15594 |
| 1602 | Ga0530510_0001028 | 3300061734 | Bacteria | 18447 |
| 1603 | Ga0530510_0019249 | 3300061734 | Bacteria | 4845 |
| 1604 | Ga0530510_0166162 | 3300061734 | Bacteria | 1633 |
| 1605 | Ga0530510_0222252 | 3300061734 | Bacteria | 1404 |
| 1606 | Ga0530510_0301529 | 3300061734 | Bacteria | 1199 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10412809 | Ga0157379_104128092 | 99 |
| 2 | 3300031616 | Ga0307508_10779035 | Ga0307508_107790351 | 102 |
| 3 | 3300004803 | Ga0058862_10012401 | Ga0058862_100124013 | 103 |
| 4 | 3300004803 | Ga0058862_10022746 | Ga0058862_100227462 | 103 |
| 5 | 3300005290 | Ga0065712_10247271 | Ga0065712_102472712 | 103 |
| 6 | 3300005293 | Ga0065715_10358651 | Ga0065715_103586512 | 103 |
| 7 | 3300005295 | Ga0065707_10083865 | Ga0065707_100838652 | 103 |
| 8 | 3300005328 | Ga0070676_11540199 | Ga0070676_115401991 | 103 |
| 9 | 3300005329 | Ga0070683_100026113 | Ga0070683_1000261132 | 103 |
| 10 | 3300005330 | Ga0070690_100035384 | Ga0070690_1000353842 | 103 |
| 11 | 3300005330 | Ga0070690_100554207 | Ga0070690_1005542071 | 103 |
| 12 | 3300005334 | Ga0068869_100572915 | Ga0068869_1005729152 | 103 |
| 13 | 3300005334 | Ga0068869_100691338 | Ga0068869_1006913382 | 103 |
| 14 | 3300005335 | Ga0070666_10002682 | Ga0070666_100026824 | 103 |
| 15 | 3300005335 | Ga0070666_10169623 | Ga0070666_101696232 | 103 |
| 16 | 3300005338 | Ga0068868_100070972 | Ga0068868_1000709722 | 103 |
| 17 | 3300005347 | Ga0070668_101364736 | Ga0070668_1013647361 | 103 |
| 18 | 3300005355 | Ga0070671_100099731 | Ga0070671_1000997312 | 103 |
| 19 | 3300005367 | Ga0070667_100000225 | Ga0070667_10000022527 | 103 |
| 20 | 3300005367 | Ga0070667_100014966 | Ga0070667_1000149664 | 103 |
| 21 | 3300005367 | Ga0070667_100021572 | Ga0070667_1000215723 | 103 |
| 22 | 3300005367 | Ga0070667_100301923 | Ga0070667_1003019232 | 103 |
| 23 | 3300005434 | Ga0070709_10010490 | Ga0070709_100104904 | 103 |
| 24 | 3300005434 | Ga0070709_10034850 | Ga0070709_100348502 | 103 |
| 25 | 3300005434 | Ga0070709_10205906 | Ga0070709_102059062 | 103 |
| 26 | 3300005435 | Ga0070714_100010659 | Ga0070714_1000106597 | 103 |
| 27 | 3300005436 | Ga0070713_100014651 | Ga0070713_1000146513 | 103 |
| 28 | 3300005436 | Ga0070713_100018884 | Ga0070713_1000188842 | 103 |
| 29 | 3300005436 | Ga0070713_100443918 | Ga0070713_1004439182 | 103 |
| 30 | 3300005436 | Ga0070713_100519955 | Ga0070713_1005199552 | 103 |
| 31 | 3300005437 | Ga0070710_10050466 | Ga0070710_100504662 | 103 |
| 32 | 3300005437 | Ga0070710_10204649 | Ga0070710_102046492 | 103 |
| 33 | 3300005437 | Ga0070710_10786270 | Ga0070710_107862702 | 103 |
| 34 | 3300005439 | Ga0070711_100001783 | Ga0070711_1000017832 | 103 |
| 35 | 3300005439 | Ga0070711_100046563 | Ga0070711_1000465633 | 103 |
| 36 | 3300005439 | Ga0070711_100160105 | Ga0070711_1001601052 | 103 |
| 37 | 3300005439 | Ga0070711_100437871 | Ga0070711_1004378712 | 103 |
| 38 | 3300005440 | Ga0070705_100116100 | Ga0070705_1001161002 | 103 |
| 39 | 3300005444 | Ga0070694_100181515 | Ga0070694_1001815151 | 103 |
| 40 | 3300005458 | Ga0070681_10001003 | Ga0070681_1000100315 | 103 |
| 41 | 3300005458 | Ga0070681_10003796 | Ga0070681_100037963 | 103 |
| 42 | 3300005458 | Ga0070681_10015831 | Ga0070681_100158316 | 103 |
| 43 | 3300005518 | Ga0070699_100011119 | Ga0070699_1000111193 | 103 |
| 44 | 3300005530 | Ga0070679_100065404 | Ga0070679_1000654042 | 103 |
| 45 | 3300005530 | Ga0070679_100177510 | Ga0070679_1001775102 | 103 |
| 46 | 3300005535 | Ga0070684_100033066 | Ga0070684_1000330664 | 103 |
| 47 | 3300005535 | Ga0070684_100107929 | Ga0070684_1001079292 | 103 |
| 48 | 3300005536 | Ga0070697_101870661 | Ga0070697_1018706611 | 103 |
| 49 | 3300005539 | Ga0068853_100635146 | Ga0068853_1006351461 | 103 |
| 50 | 3300005544 | Ga0070686_100491627 | Ga0070686_1004916272 | 103 |
| 51 | 3300005545 | Ga0070695_100058416 | Ga0070695_1000584162 | 103 |
| 52 | 3300005547 | Ga0070693_100063788 | Ga0070693_1000637882 | 103 |
| 53 | 3300005547 | Ga0070693_100098453 | Ga0070693_1000984533 | 103 |
| 54 | 3300005548 | Ga0070665_100000709 | Ga0070665_10000070916 | 103 |
| 55 | 3300005548 | Ga0070665_100029156 | Ga0070665_1000291565 | 103 |
| 56 | 3300005548 | Ga0070665_100048772 | Ga0070665_1000487722 | 103 |
| 57 | 3300005548 | Ga0070665_100210433 | Ga0070665_1002104332 | 103 |
| 58 | 3300005549 | Ga0070704_100889236 | Ga0070704_1008892362 | 103 |
| 59 | 3300005563 | Ga0068855_100000869 | Ga0068855_10000086925 | 103 |
| 60 | 3300005563 | Ga0068855_100184350 | Ga0068855_1001843503 | 103 |
| 61 | 3300005563 | Ga0068855_101007972 | Ga0068855_1010079722 | 103 |
| 62 | 3300005563 | Ga0068855_101366358 | Ga0068855_1013663582 | 103 |
| 63 | 3300005614 | Ga0068856_100007934 | Ga0068856_1000079342 | 103 |
| 64 | 3300005614 | Ga0068856_100015998 | Ga0068856_1000159982 | 103 |
| 65 | 3300005614 | Ga0068856_100155520 | Ga0068856_1001555202 | 103 |
| 66 | 3300005614 | Ga0068856_100341147 | Ga0068856_1003411472 | 103 |
| 67 | 3300005616 | Ga0068852_101625101 | Ga0068852_1016251012 | 103 |
| 68 | 3300005617 | Ga0068859_100334671 | Ga0068859_1003346712 | 103 |
| 69 | 3300005618 | Ga0068864_100046025 | Ga0068864_1000460252 | 103 |
| 70 | 3300005718 | Ga0068866_10091482 | Ga0068866_100914822 | 103 |
| 71 | 3300005834 | Ga0068851_10079150 | Ga0068851_100791502 | 103 |
| 72 | 3300005841 | Ga0068863_100029303 | Ga0068863_1000293035 | 103 |
| 73 | 3300005841 | Ga0068863_100712039 | Ga0068863_1007120392 | 103 |
| 74 | 3300005842 | Ga0068858_100230532 | Ga0068858_1002305322 | 103 |
| 75 | 3300005843 | Ga0068860_100004920 | Ga0068860_1000049202 | 103 |
| 76 | 3300005843 | Ga0068860_100014216 | Ga0068860_1000142162 | 103 |
| 77 | 3300005843 | Ga0068860_100483832 | Ga0068860_1004838322 | 103 |
| 78 | 3300005843 | Ga0068860_101016986 | Ga0068860_1010169861 | 103 |
| 79 | 3300005844 | Ga0068862_100076918 | Ga0068862_1000769182 | 103 |
| 80 | 3300005937 | Ga0081455_10463888 | Ga0081455_104638882 | 103 |
| 81 | 3300006028 | Ga0070717_10002768 | Ga0070717_100027682 | 103 |
| 82 | 3300006028 | Ga0070717_11706155 | Ga0070717_117061552 | 103 |
| 83 | 3300006163 | Ga0070715_10000150 | Ga0070715_100001505 | 103 |
| 84 | 3300006163 | Ga0070715_10019225 | Ga0070715_100192253 | 103 |
| 85 | 3300006163 | Ga0070715_10387977 | Ga0070715_103879772 | 103 |
| 86 | 3300006173 | Ga0070716_100014983 | Ga0070716_1000149832 | 103 |
| 87 | 3300006173 | Ga0070716_100026661 | Ga0070716_1000266612 | 103 |
| 88 | 3300006173 | Ga0070716_100371323 | Ga0070716_1003713232 | 103 |
| 89 | 3300006175 | Ga0070712_100002458 | Ga0070712_1000024586 | 103 |
| 90 | 3300006175 | Ga0070712_100550900 | Ga0070712_1005509001 | 103 |
| 91 | 3300006175 | Ga0070712_101090674 | Ga0070712_1010906742 | 103 |
| 92 | 3300006237 | Ga0097621_100050099 | Ga0097621_1000500992 | 103 |
| 93 | 3300006237 | Ga0097621_100539217 | Ga0097621_1005392171 | 103 |
| 94 | 3300006358 | Ga0068871_100009552 | Ga0068871_1000095522 | 103 |
| 95 | 3300006358 | Ga0068871_100319469 | Ga0068871_1003194692 | 103 |
| 96 | 3300006871 | Ga0075434_100546275 | Ga0075434_1005462752 | 103 |
| 97 | 3300006881 | Ga0068865_100003296 | Ga0068865_1000032966 | 103 |
| 98 | 3300006914 | Ga0075436_100136098 | Ga0075436_1001360982 | 103 |
| 99 | 3300006914 | Ga0075436_100358454 | Ga0075436_1003584542 | 103 |
| 100 | 3300006931 | Ga0097620_100334659 | Ga0097620_1003346592 | 103 |
| 101 | 3300007076 | Ga0075435_100892958 | Ga0075435_1008929582 | 103 |
| 102 | 3300007265 | Ga0099794_10287479 | Ga0099794_102874792 | 103 |
| 103 | 3300007788 | Ga0099795_10055988 | Ga0099795_100559882 | 103 |
| 104 | 3300009092 | Ga0105250_10012985 | Ga0105250_100129852 | 103 |
| 105 | 3300009092 | Ga0105250_10079381 | Ga0105250_100793812 | 103 |
| 106 | 3300009093 | Ga0105240_10016052 | Ga0105240_100160524 | 103 |
| 107 | 3300009093 | Ga0105240_10055566 | Ga0105240_100555665 | 103 |
| 108 | 3300009093 | Ga0105240_10067857 | Ga0105240_100678574 | 103 |
| 109 | 3300009093 | Ga0105240_10148426 | Ga0105240_101484263 | 103 |
| 110 | 3300009093 | Ga0105240_10579386 | Ga0105240_105793861 | 103 |
| 111 | 3300009093 | Ga0105240_10849646 | Ga0105240_108496462 | 103 |
| 112 | 3300009093 | Ga0105240_11091957 | Ga0105240_110919571 | 103 |
| 113 | 3300009093 | Ga0105240_12281298 | Ga0105240_122812981 | 103 |
| 114 | 3300009098 | Ga0105245_10007287 | Ga0105245_100072874 | 103 |
| 115 | 3300009098 | Ga0105245_10686563 | Ga0105245_106865632 | 103 |
| 116 | 3300009101 | Ga0105247_10000203 | Ga0105247_100002035 | 103 |
| 117 | 3300009101 | Ga0105247_10010154 | Ga0105247_100101542 | 103 |
| 118 | 3300009101 | Ga0105247_10017815 | Ga0105247_100178152 | 103 |
| 119 | 3300009101 | Ga0105247_10044411 | Ga0105247_100444112 | 103 |
| 120 | 3300009148 | Ga0105243_10179170 | Ga0105243_101791702 | 103 |
| 121 | 3300009174 | Ga0105241_10042258 | Ga0105241_100422582 | 103 |
| 122 | 3300009174 | Ga0105241_10266258 | Ga0105241_102662582 | 103 |
| 123 | 3300009174 | Ga0105241_10580452 | Ga0105241_105804522 | 103 |
| 124 | 3300009174 | Ga0105241_10653432 | Ga0105241_106534322 | 103 |
| 125 | 3300009174 | Ga0105241_12038860 | Ga0105241_120388602 | 103 |
| 126 | 3300009176 | Ga0105242_10012501 | Ga0105242_100125014 | 103 |
| 127 | 3300009176 | Ga0105242_11156372 | Ga0105242_111563721 | 103 |
| 128 | 3300009176 | Ga0105242_11763905 | Ga0105242_117639051 | 103 |
| 129 | 3300009177 | Ga0105248_10009721 | Ga0105248_100097215 | 103 |
| 130 | 3300009177 | Ga0105248_10148848 | Ga0105248_101488483 | 103 |
| 131 | 3300009177 | Ga0105248_10200615 | Ga0105248_102006152 | 103 |
| 132 | 3300009177 | Ga0105248_11795139 | Ga0105248_117951392 | 103 |
| 133 | 3300009177 | Ga0105248_12598693 | Ga0105248_125986932 | 103 |
| 134 | 3300009545 | Ga0105237_10004537 | Ga0105237_100045378 | 103 |
| 135 | 3300009545 | Ga0105237_10025945 | Ga0105237_100259456 | 103 |
| 136 | 3300009545 | Ga0105237_10229018 | Ga0105237_102290182 | 103 |
| 137 | 3300009545 | Ga0105237_11101957 | Ga0105237_111019572 | 103 |
| 138 | 3300009551 | Ga0105238_10067107 | Ga0105238_100671071 | 103 |
| 139 | 3300009551 | Ga0105238_10230701 | Ga0105238_102307012 | 103 |
| 140 | 3300009551 | Ga0105238_10506977 | Ga0105238_105069772 | 103 |
| 141 | 3300009551 | Ga0105238_11261366 | Ga0105238_112613662 | 103 |
| 142 | 3300009551 | Ga0105238_11415658 | Ga0105238_114156581 | 103 |
| 143 | 3300009551 | Ga0105238_11926722 | Ga0105238_119267221 | 103 |
| 144 | 3300009551 | Ga0105238_12319906 | Ga0105238_123199061 | 103 |
| 145 | 3300009553 | Ga0105249_10003331 | Ga0105249_100033317 | 103 |
| 146 | 3300009553 | Ga0105249_10303459 | Ga0105249_103034592 | 103 |
| 147 | 3300009553 | Ga0105249_10584700 | Ga0105249_105847002 | 103 |
| 148 | 3300009553 | Ga0105249_10735227 | Ga0105249_107352272 | 103 |
| 149 | 3300010159 | Ga0099796_10111308 | Ga0099796_101113082 | 103 |
| 150 | 3300010375 | Ga0105239_10035422 | Ga0105239_100354224 | 103 |
| 151 | 3300010375 | Ga0105239_10351468 | Ga0105239_103514682 | 103 |
| 152 | 3300010375 | Ga0105239_11489720 | Ga0105239_114897201 | 103 |
| 153 | 3300010375 | Ga0105239_11724941 | Ga0105239_117249412 | 103 |
| 154 | 3300011119 | Ga0105246_10063084 | Ga0105246_100630842 | 103 |
| 155 | 3300013100 | Ga0157373_10454290 | Ga0157373_104542902 | 103 |
| 156 | 3300013104 | Ga0157370_10013806 | Ga0157370_100138064 | 103 |
| 157 | 3300013105 | Ga0157369_10190279 | Ga0157369_101902791 | 103 |
| 158 | 3300013105 | Ga0157369_10501249 | Ga0157369_105012492 | 103 |
| 159 | 3300013105 | Ga0157369_11356051 | Ga0157369_113560512 | 103 |
| 160 | 3300013296 | Ga0157374_10036490 | Ga0157374_100364902 | 103 |
| 161 | 3300013296 | Ga0157374_11350659 | Ga0157374_113506592 | 103 |
| 162 | 3300013297 | Ga0157378_10001851 | Ga0157378_100018517 | 103 |
| 163 | 3300013297 | Ga0157378_10611234 | Ga0157378_106112342 | 103 |
| 164 | 3300013306 | Ga0163162_10028294 | Ga0163162_100282943 | 103 |
| 165 | 3300013306 | Ga0163162_10111464 | Ga0163162_101114643 | 103 |
| 166 | 3300013306 | Ga0163162_10112926 | Ga0163162_101129262 | 103 |
| 167 | 3300013306 | Ga0163162_11237125 | Ga0163162_112371252 | 103 |
| 168 | 3300013307 | Ga0157372_10133926 | Ga0157372_101339262 | 103 |
| 169 | 3300013307 | Ga0157372_11363439 | Ga0157372_113634391 | 103 |
| 170 | 3300013307 | Ga0157372_11586240 | Ga0157372_115862401 | 103 |
| 171 | 3300013308 | Ga0157375_10062065 | Ga0157375_100620654 | 103 |
| 172 | 3300013308 | Ga0157375_10406304 | Ga0157375_104063042 | 103 |
| 173 | 3300014325 | Ga0163163_10016441 | Ga0163163_100164415 | 103 |
| 174 | 3300014325 | Ga0163163_10049729 | Ga0163163_100497292 | 103 |
| 175 | 3300014325 | Ga0163163_10103176 | Ga0163163_101031763 | 103 |
| 176 | 3300014325 | Ga0163163_10248013 | Ga0163163_102480131 | 103 |
| 177 | 3300014325 | Ga0163163_10480184 | Ga0163163_104801842 | 103 |
| 178 | 3300014326 | Ga0157380_12937301 | Ga0157380_129373011 | 103 |
| 179 | 3300014968 | Ga0157379_10010834 | Ga0157379_100108342 | 103 |
| 180 | 3300014968 | Ga0157379_10047864 | Ga0157379_100478642 | 103 |
| 181 | 3300014968 | Ga0157379_10087072 | Ga0157379_100870722 | 103 |
| 182 | 3300014968 | Ga0157379_10490910 | Ga0157379_104909102 | 103 |
| 183 | 3300014968 | Ga0157379_11600538 | Ga0157379_116005381 | 103 |
| 184 | 3300014969 | Ga0157376_10089514 | Ga0157376_100895143 | 103 |
| 185 | 3300014969 | Ga0157376_10095866 | Ga0157376_100958661 | 103 |
| 186 | 3300014969 | Ga0157376_10449877 | Ga0157376_104498771 | 103 |
| 187 | 3300014969 | Ga0157376_11231690 | Ga0157376_112316902 | 103 |
| 188 | 3300014969 | Ga0157376_13101898 | Ga0157376_131018982 | 103 |
| 189 | 3300020069 | Ga0197907_10383539 | Ga0197907_103835392 | 103 |
| 190 | 3300020070 | Ga0206356_10120402 | Ga0206356_101204022 | 103 |
| 191 | 3300020078 | Ga0206352_10211733 | Ga0206352_102117332 | 103 |
| 192 | 3300020078 | Ga0206352_10523350 | Ga0206352_105233502 | 103 |
| 193 | 3300020080 | Ga0206350_10545034 | Ga0206350_105450341 | 103 |
| 194 | 3300020081 | Ga0206354_11691571 | Ga0206354_116915712 | 103 |
| 195 | 3300020610 | Ga0154015_1346390 | Ga0154015_13463902 | 103 |
| 196 | 3300021377 | Ga0213874_10007794 | Ga0213874_100077942 | 103 |
| 197 | 3300021384 | Ga0213876_10065609 | Ga0213876_100656093 | 103 |
| 198 | 3300021384 | Ga0213876_10467771 | Ga0213876_104677712 | 103 |
| 199 | 3300021441 | Ga0213871_10026050 | Ga0213871_100260501 | 103 |
| 200 | 3300021441 | Ga0213871_10065851 | Ga0213871_100658512 | 103 |
| 201 | 3300022467 | Ga0224712_10004984 | Ga0224712_100049843 | 103 |
| 202 | 3300022467 | Ga0224712_10116695 | Ga0224712_101166951 | 103 |
| 203 | 3300025711 | Ga0207696_1114813 | Ga0207696_11148132 | 103 |
| 204 | 3300025898 | Ga0207692_10054411 | Ga0207692_100544112 | 103 |
| 205 | 3300025898 | Ga0207692_10454002 | Ga0207692_104540022 | 103 |
| 206 | 3300025898 | Ga0207692_10758916 | Ga0207692_107589162 | 103 |
| 207 | 3300025899 | Ga0207642_10066270 | Ga0207642_100662702 | 103 |
| 208 | 3300025900 | Ga0207710_10015548 | Ga0207710_100155483 | 103 |
| 209 | 3300025900 | Ga0207710_10046934 | Ga0207710_100469342 | 103 |
| 210 | 3300025903 | Ga0207680_10020439 | Ga0207680_100204392 | 103 |
| 211 | 3300025903 | Ga0207680_10020985 | Ga0207680_100209852 | 103 |
| 212 | 3300025903 | Ga0207680_10102686 | Ga0207680_101026862 | 103 |
| 213 | 3300025905 | Ga0207685_10042192 | Ga0207685_100421922 | 103 |
| 214 | 3300025905 | Ga0207685_10098713 | Ga0207685_100987131 | 103 |
| 215 | 3300025905 | Ga0207685_10138904 | Ga0207685_101389042 | 103 |
| 216 | 3300025905 | Ga0207685_10329676 | Ga0207685_103296761 | 103 |
| 217 | 3300025906 | Ga0207699_10001908 | Ga0207699_100019087 | 103 |
| 218 | 3300025906 | Ga0207699_10018607 | Ga0207699_100186072 | 103 |
| 219 | 3300025906 | Ga0207699_10092830 | Ga0207699_100928302 | 103 |
| 220 | 3300025906 | Ga0207699_10107745 | Ga0207699_101077452 | 103 |
| 221 | 3300025906 | Ga0207699_10332258 | Ga0207699_103322581 | 103 |
| 222 | 3300025907 | Ga0207645_10250717 | Ga0207645_102507172 | 103 |
| 223 | 3300025911 | Ga0207654_10161551 | Ga0207654_101615512 | 103 |
| 224 | 3300025912 | Ga0207707_10003587 | Ga0207707_100035873 | 103 |
| 225 | 3300025912 | Ga0207707_10015501 | Ga0207707_100155013 | 103 |
| 226 | 3300025912 | Ga0207707_10053515 | Ga0207707_100535152 | 103 |
| 227 | 3300025912 | Ga0207707_10141708 | Ga0207707_101417082 | 103 |
| 228 | 3300025913 | Ga0207695_10007963 | Ga0207695_100079633 | 103 |
| 229 | 3300025913 | Ga0207695_10040273 | Ga0207695_100402732 | 103 |
| 230 | 3300025913 | Ga0207695_10097689 | Ga0207695_100976892 | 103 |
| 231 | 3300025914 | Ga0207671_10049957 | Ga0207671_100499572 | 103 |
| 232 | 3300025914 | Ga0207671_10146114 | Ga0207671_101461142 | 103 |
| 233 | 3300025914 | Ga0207671_10219173 | Ga0207671_102191732 | 103 |
| 234 | 3300025914 | Ga0207671_10249032 | Ga0207671_102490322 | 103 |
| 235 | 3300025915 | Ga0207693_10000059 | Ga0207693_1000005971 | 103 |
| 236 | 3300025915 | Ga0207693_10097835 | Ga0207693_100978352 | 103 |
| 237 | 3300025915 | Ga0207693_10482189 | Ga0207693_104821892 | 103 |
| 238 | 3300025915 | Ga0207693_10851795 | Ga0207693_108517951 | 103 |
| 239 | 3300025916 | Ga0207663_10036504 | Ga0207663_100365042 | 103 |
| 240 | 3300025916 | Ga0207663_10157361 | Ga0207663_101573612 | 103 |
| 241 | 3300025916 | Ga0207663_10183790 | Ga0207663_101837902 | 103 |
| 242 | 3300025916 | Ga0207663_10519010 | Ga0207663_105190101 | 103 |
| 243 | 3300025917 | Ga0207660_10026140 | Ga0207660_100261402 | 103 |
| 244 | 3300025917 | Ga0207660_10167517 | Ga0207660_101675172 | 103 |
| 245 | 3300025919 | Ga0207657_10443334 | Ga0207657_104433342 | 103 |
| 246 | 3300025920 | Ga0207649_10456757 | Ga0207649_104567572 | 103 |
| 247 | 3300025921 | Ga0207652_10111024 | Ga0207652_101110243 | 103 |
| 248 | 3300025921 | Ga0207652_10224686 | Ga0207652_102246862 | 103 |
| 249 | 3300025924 | Ga0207694_10208317 | Ga0207694_102083172 | 103 |
| 250 | 3300025924 | Ga0207694_10216066 | Ga0207694_102160662 | 103 |
| 251 | 3300025924 | Ga0207694_10365374 | Ga0207694_103653742 | 103 |
| 252 | 3300025924 | Ga0207694_11820235 | Ga0207694_118202352 | 103 |
| 253 | 3300025927 | Ga0207687_10755223 | Ga0207687_107552232 | 103 |
| 254 | 3300025928 | Ga0207700_10008920 | Ga0207700_100089203 | 103 |
| 255 | 3300025928 | Ga0207700_10093752 | Ga0207700_100937523 | 103 |
| 256 | 3300025928 | Ga0207700_10098853 | Ga0207700_100988532 | 103 |
| 257 | 3300025928 | Ga0207700_10189483 | Ga0207700_101894832 | 103 |
| 258 | 3300025928 | Ga0207700_10490249 | Ga0207700_104902491 | 103 |
| 259 | 3300025929 | Ga0207664_10007703 | Ga0207664_100077032 | 103 |
| 260 | 3300025929 | Ga0207664_10332123 | Ga0207664_103321232 | 103 |
| 261 | 3300025929 | Ga0207664_10634366 | Ga0207664_106343662 | 103 |
| 262 | 3300025931 | Ga0207644_10003246 | Ga0207644_100032466 | 103 |
| 263 | 3300025931 | Ga0207644_10008268 | Ga0207644_100082684 | 103 |
| 264 | 3300025931 | Ga0207644_10414563 | Ga0207644_104145632 | 103 |
| 265 | 3300025932 | Ga0207690_10536651 | Ga0207690_105366511 | 103 |
| 266 | 3300025934 | Ga0207686_10041377 | Ga0207686_100413773 | 103 |
| 267 | 3300025935 | Ga0207709_10201793 | Ga0207709_102017932 | 103 |
| 268 | 3300025938 | Ga0207704_10165382 | Ga0207704_101653822 | 103 |
| 269 | 3300025939 | Ga0207665_10024787 | Ga0207665_100247873 | 103 |
| 270 | 3300025939 | Ga0207665_10042901 | Ga0207665_100429013 | 103 |
| 271 | 3300025941 | Ga0207711_10011267 | Ga0207711_100112673 | 103 |
| 272 | 3300025941 | Ga0207711_10138014 | Ga0207711_101380143 | 103 |
| 273 | 3300025942 | Ga0207689_10175914 | Ga0207689_101759142 | 103 |
| 274 | 3300025942 | Ga0207689_10678582 | Ga0207689_106785822 | 103 |
| 275 | 3300025944 | Ga0207661_10008500 | Ga0207661_100085004 | 103 |
| 276 | 3300025945 | Ga0207679_10669664 | Ga0207679_106696642 | 103 |
| 277 | 3300025949 | Ga0207667_10006976 | Ga0207667_100069768 | 103 |
| 278 | 3300025949 | Ga0207667_10007164 | Ga0207667_100071647 | 103 |
| 279 | 3300025949 | Ga0207667_10161197 | Ga0207667_101611972 | 103 |
| 280 | 3300025949 | Ga0207667_10332262 | Ga0207667_103322622 | 103 |
| 281 | 3300025960 | Ga0207651_10115265 | Ga0207651_101152652 | 103 |
| 282 | 3300025961 | Ga0207712_10130265 | Ga0207712_101302652 | 103 |
| 283 | 3300025961 | Ga0207712_10383284 | Ga0207712_103832842 | 103 |
| 284 | 3300025981 | Ga0207640_10495460 | Ga0207640_104954602 | 103 |
| 285 | 3300025986 | Ga0207658_10000894 | Ga0207658_1000089421 | 103 |
| 286 | 3300025986 | Ga0207658_10012452 | Ga0207658_100124522 | 103 |
| 287 | 3300025986 | Ga0207658_10314811 | Ga0207658_103148112 | 103 |
| 288 | 3300025986 | Ga0207658_11167191 | Ga0207658_111671911 | 103 |
| 289 | 3300026023 | Ga0207677_10043639 | Ga0207677_100436392 | 103 |
| 290 | 3300026035 | Ga0207703_10048335 | Ga0207703_100483352 | 103 |
| 291 | 3300026041 | Ga0207639_10080518 | Ga0207639_100805182 | 103 |
| 292 | 3300026078 | Ga0207702_10163274 | Ga0207702_101632742 | 103 |
| 293 | 3300026078 | Ga0207702_10607666 | Ga0207702_106076662 | 103 |
| 294 | 3300026078 | Ga0207702_10882004 | Ga0207702_108820042 | 103 |
| 295 | 3300026088 | Ga0207641_10002054 | Ga0207641_100020542 | 103 |
| 296 | 3300026088 | Ga0207641_10194422 | Ga0207641_101944222 | 103 |
| 297 | 3300026088 | Ga0207641_10859600 | Ga0207641_108596002 | 103 |
| 298 | 3300026116 | Ga0207674_10146209 | Ga0207674_101462092 | 103 |
| 299 | 3300026121 | Ga0207683_10055966 | Ga0207683_100559663 | 103 |
| 300 | 3300026142 | Ga0207698_10373186 | Ga0207698_103731862 | 103 |
| 301 | 3300028379 | Ga0268266_10000392 | Ga0268266_1000039242 | 103 |
| 302 | 3300028379 | Ga0268266_10002024 | Ga0268266_1000202416 | 103 |
| 303 | 3300028379 | Ga0268266_10014903 | Ga0268266_100149033 | 103 |
| 304 | 3300028379 | Ga0268266_10086412 | Ga0268266_100864122 | 103 |
| 305 | 3300028379 | Ga0268266_10267985 | Ga0268266_102679852 | 103 |
| 306 | 3300028380 | Ga0268265_10758609 | Ga0268265_107586092 | 103 |
| 307 | 3300028381 | Ga0268264_10017184 | Ga0268264_100171842 | 103 |
| 308 | 3300028381 | Ga0268264_10075150 | Ga0268264_100751503 | 103 |
| 309 | 3300028563 | Ga0265319_1193705 | Ga0265319_11937051 | 103 |
| 310 | 3300028573 | Ga0265334_10000123 | Ga0265334_1000012327 | 103 |
| 311 | 3300028577 | Ga0265318_10001505 | Ga0265318_100015053 | 103 |
| 312 | 3300028794 | Ga0307515_10010000 | Ga0307515_1001000011 | 103 |
| 313 | 3300028800 | Ga0265338_10008882 | Ga0265338_100088828 | 103 |
| 314 | 3300028800 | Ga0265338_10013818 | Ga0265338_100138187 | 103 |
| 315 | 3300029957 | Ga0265324_10181696 | Ga0265324_101816962 | 103 |
| 316 | 3300030521 | Ga0307511_10042260 | Ga0307511_100422602 | 103 |
| 317 | 3300031090 | Ga0265760_10097309 | Ga0265760_100973092 | 103 |
| 318 | 3300031235 | Ga0265330_10041457 | Ga0265330_100414571 | 103 |
| 319 | 3300031238 | Ga0265332_10001382 | Ga0265332_100013824 | 103 |
| 320 | 3300031239 | Ga0265328_10005971 | Ga0265328_100059714 | 103 |
| 321 | 3300031240 | Ga0265320_10003145 | Ga0265320_100031459 | 103 |
| 322 | 3300031241 | Ga0265325_10002490 | Ga0265325_100024903 | 103 |
| 323 | 3300031242 | Ga0265329_10000811 | Ga0265329_100008118 | 103 |
| 324 | 3300031247 | Ga0265340_10010255 | Ga0265340_100102553 | 103 |
| 325 | 3300031249 | Ga0265339_10004690 | Ga0265339_100046903 | 103 |
| 326 | 3300031250 | Ga0265331_10002545 | Ga0265331_100025453 | 103 |
| 327 | 3300031344 | Ga0265316_10005931 | Ga0265316_100059319 | 103 |
| 328 | 3300031456 | Ga0307513_10326274 | Ga0307513_103262742 | 103 |
| 329 | 3300031595 | Ga0265313_10002136 | Ga0265313_100021364 | 103 |
| 330 | 3300031711 | Ga0265314_10006700 | Ga0265314_100067002 | 103 |
| 331 | 3300031712 | Ga0265342_10003334 | Ga0265342_100033348 | 103 |
| 332 | 3300035111 | Ga0373923_0370125 | Ga0373923_0370125_180_500 | 103 |
| 333 | 3300035113 | Ga0373936_0027228 | Ga0373936_0027228_1122_1442 | 103 |
| 334 | 3300035117 | Ga0373953_0157626 | Ga0373953_0157626_320_640 | 103 |
| 335 | 3300035117 | Ga0373953_0222810 | Ga0373953_0222810_184_504 | 103 |
| 336 | 3300035172 | Ga0373955_0295342 | Ga0373955_0295342_77_397 | 103 |
| 337 | 3300035172 | Ga0373955_0527194 | Ga0373955_0527194_223_543 | 103 |
| 338 | 3300035410 | Ga0373924_0049896 | Ga0373924_0049896_609_929 | 103 |
| 339 | 3300035410 | Ga0373924_0541848 | Ga0373924_0541848_176_496 | 103 |
| 340 | 3300035692 | Ga0373935_0401222 | Ga0373935_0401222_418_738 | 103 |
| 341 | 3300035695 | Ga0373927_0051249 | Ga0373927_0051249_1195_1515 | 103 |
| 342 | 3300035724 | Ga0373933_0060043 | Ga0373933_0060043_1754_2074 | 103 |
| 343 | 3300035724 | Ga0373933_0455934 | Ga0373933_0455934_432_752 | 103 |
| 344 | 3300035725 | Ga0373947_0147545 | Ga0373947_0147545_445_765 | 103 |
| 345 | 3300036401 | Ga0373937_0039869 | Ga0373937_0039869_2340_2660 | 103 |
| 346 | 3300036401 | Ga0373937_0631185 | Ga0373937_0631185_540_860 | 103 |
| 347 | 3300037068 | Ga0373925_0023959 | Ga0373925_0023959_2415_2735 | 103 |
| 348 | 3300037853 | Ga0436364_0162892 | Ga0436364_0162892_195_515 | 103 |
| 349 | 3300039437 | Ga0436365_0377198 | Ga0436365_0377198_221_541 | 103 |
| 350 | 3300039437 | Ga0436365_0407525 | Ga0436365_0407525_150_470 | 103 |
| 351 | 3300039437 | Ga0436365_1019286 | Ga0436365_1019286_12_332 | 103 |
| 352 | 3300039437 | Ga0436365_1023348 | Ga0436365_1023348_883_1203 | 103 |
| 353 | 3300039438 | Ga0436360_0525623 | Ga0436360_0525623_14317_14637 | 103 |
| 354 | 3300039438 | Ga0436360_1167873 | Ga0436360_1167873_430_750 | 103 |
| 355 | 3300039447 | Ga0436361_0982899 | Ga0436361_0982899_561_881 | 103 |
| 356 | 3300039450 | Ga0436363_0035707 | Ga0436363_0035707_16_336 | 103 |
| 357 | 3300039450 | Ga0436363_0331678 | Ga0436363_0331678_877_1197 | 103 |
| 358 | 3300039450 | Ga0436363_0401150 | Ga0436363_0401150_93_413 | 103 |
| 359 | 3300039450 | Ga0436363_0563147 | Ga0436363_0563147_414_734 | 103 |
| 360 | 3300039453 | Ga0436362_0126569 | Ga0436362_0126569_467_787 | 103 |
| 361 | 3300039453 | Ga0436362_0394144 | Ga0436362_0394144_24_344 | 103 |
| 362 | 3300041501 | Ga0451845_0225953 | Ga0451845_0225953_110_430 | 103 |
| 363 | 3300041512 | Ga0451853_1577538 | Ga0451853_1577538_417_737 | 103 |
| 364 | 3300042876 | Ga0451577_0232659 | Ga0451577_0232659_516_908 | 103 |
| 365 | 3300046462 | Ga0495651_0320767 | Ga0495651_0320767_332_652 | 103 |
| 366 | 3300046473 | Ga0495582_0171281 | Ga0495582_0171281_840_1160 | 103 |
| 367 | 3300046473 | Ga0495582_0282462 | Ga0495582_0282462_292_612 | 103 |
| 368 | 3300046475 | Ga0495639_0218363 | Ga0495639_0218363_566_886 | 103 |
| 369 | 3300046507 | Ga0495606_0125158 | Ga0495606_0125158_1150_1470 | 103 |
| 370 | 3300046511 | Ga0495608_0714315 | Ga0495608_0714315_39_359 | 103 |
| 371 | 3300046517 | Ga0495630_0058019 | Ga0495630_0058019_1869_2189 | 103 |
| 372 | 3300046519 | Ga0495632_0128137 | Ga0495632_0128137_807_1127 | 103 |
| 373 | 3300046519 | Ga0495632_0218911 | Ga0495632_0218911_325_645 | 103 |
| 374 | 3300046524 | Ga0495648_0437045 | Ga0495648_0437045_104_424 | 103 |
| 375 | 3300046526 | Ga0495666_0257055 | Ga0495666_0257055_262_582 | 103 |
| 376 | 3300046538 | Ga0495609_0022742 | Ga0495609_0022742_1504_1824 | 103 |
| 377 | 3300046543 | Ga0495645_0651452 | Ga0495645_0651452_296_616 | 103 |
| 378 | 3300046616 | Ga0495668_0641655 | Ga0495668_0641655_131_451 | 103 |
| 379 | 3300046648 | Ga0495611_0324033 | Ga0495611_0324033_281_601 | 103 |
| 380 | 3300046678 | Ga0495599_0170708 | Ga0495599_0170708_934_1254 | 103 |
| 381 | 3300046679 | Ga0495623_0721155 | Ga0495623_0721155_38_358 | 103 |
| 382 | 3300046683 | Ga0495658_1033422 | Ga0495658_1033422_178_498 | 103 |
| 383 | 3300046692 | Ga0495671_0443699 | Ga0495671_0443699_64_390 | 103 |
| 384 | 3300046694 | Ga0495649_0246279 | Ga0495649_0246279_236_556 | 103 |
| 385 | 3300047317 | Ga0495604_0260761 | Ga0495604_0260761_83_403 | 103 |
| 386 | 3300047319 | Ga0495674_0063872 | Ga0495674_0063872_601_921 | 103 |
| 387 | 3300047443 | Ga0495687_077811 | Ga0495687_077811_513_833 | 103 |
| 388 | 3300048088 | Ga0495602_0480890 | Ga0495602_0480890_116_436 | 103 |
| 389 | 3300048903 | Ga0496100_0016220 | Ga0496100_0016220_1554_1874 | 103 |
| 390 | 3300048904 | Ga0496101_0043234 | Ga0496101_0043234_654_974 | 103 |
| 391 | 3300048904 | Ga0496101_0310089 | Ga0496101_0310089_387_707 | 103 |
| 392 | 3300048904 | Ga0496101_0428937 | Ga0496101_0428937_596_916 | 103 |
| 393 | 3300048904 | Ga0496101_0633831 | Ga0496101_0633831_513_833 | 103 |
| 394 | 3300048905 | Ga0496102_0021181 | Ga0496102_0021181_1035_1355 | 103 |
| 395 | 3300048905 | Ga0496102_0250307 | Ga0496102_0250307_668_988 | 103 |
| 396 | 3300048906 | Ga0496103_0094054 | Ga0496103_0094054_1103_1423 | 103 |
| 397 | 3300048906 | Ga0496103_0286687 | Ga0496103_0286687_724_1044 | 103 |
| 398 | 3300048907 | Ga0496104_0129108 | Ga0496104_0129108_1217_1537 | 103 |
| 399 | 3300048907 | Ga0496104_0150659 | Ga0496104_0150659_1065_1385 | 103 |
| 400 | 3300048907 | Ga0496104_0438092 | Ga0496104_0438092_180_500 | 103 |
| 401 | 3300048908 | Ga0496105_0006911 | Ga0496105_0006911_6941_7261 | 103 |
| 402 | 3300048909 | Ga0496106_0047403 | Ga0496106_0047403_2162_2482 | 103 |
| 403 | 3300048909 | Ga0496106_0131994 | Ga0496106_0131994_915_1235 | 103 |
| 404 | 3300048909 | Ga0496106_0163360 | Ga0496106_0163360_315_635 | 103 |
| 405 | 3300048910 | Ga0496107_0001841 | Ga0496107_0001841_9567_9887 | 103 |
| 406 | 3300048910 | Ga0496107_0107883 | Ga0496107_0107883_1063_1383 | 103 |
| 407 | 3300048910 | Ga0496107_0853388 | Ga0496107_0853388_335_655 | 103 |
| 408 | 3300048911 | Ga0496108_0002437 | Ga0496108_0002437_7320_7640 | 103 |
| 409 | 3300048911 | Ga0496108_0434119 | Ga0496108_0434119_458_778 | 103 |
| 410 | 3300048912 | Ga0496109_0018965 | Ga0496109_0018965_4093_4413 | 103 |
| 411 | 3300048912 | Ga0496109_0027251 | Ga0496109_0027251_4647_4967 | 103 |
| 412 | 3300048912 | Ga0496109_1521207 | Ga0496109_1521207_124_444 | 103 |
| 413 | 3300048913 | Ga0496110_0002260 | Ga0496110_0002260_9952_10272 | 103 |
| 414 | 3300048914 | Ga0496111_0085716 | Ga0496111_0085716_748_1068 | 103 |
| 415 | 3300048915 | Ga0496112_0011818 | Ga0496112_0011818_730_1050 | 103 |
| 416 | 3300048915 | Ga0496112_0051443 | Ga0496112_0051443_3099_3419 | 103 |
| 417 | 3300048916 | Ga0496113_0027417 | Ga0496113_0027417_2290_2610 | 103 |
| 418 | 3300048917 | Ga0496114_0002691 | Ga0496114_0002691_8221_8541 | 103 |
| 419 | 3300048918 | Ga0496115_0009121 | Ga0496115_0009121_5218_5538 | 103 |
| 420 | 3300048918 | Ga0496115_0099698 | Ga0496115_0099698_1279_1599 | 103 |
| 421 | 3300048918 | Ga0496115_0167546 | Ga0496115_0167546_598_918 | 103 |
| 422 | 3300048918 | Ga0496115_0339075 | Ga0496115_0339075_488_808 | 103 |
| 423 | 3300048919 | Ga0496116_0049718 | Ga0496116_0049718_1156_1476 | 103 |
| 424 | 3300048920 | Ga0496117_0000228 | Ga0496117_0000228_88466_88786 | 103 |
| 425 | 3300048921 | Ga0496118_0000005 | Ga0496118_0000005_194281_194601 | 103 |
| 426 | 3300048922 | Ga0496119_0071045 | Ga0496119_0071045_1035_1355 | 103 |
| 427 | 3300048923 | Ga0496120_0003140 | Ga0496120_0003140_15104_15424 | 103 |
| 428 | 3300048924 | Ga0496121_0000522 | Ga0496121_0000522_21881_22201 | 103 |
| 429 | 3300048924 | Ga0496121_0034180 | Ga0496121_0034180_914_1234 | 103 |
| 430 | 3300048924 | Ga0496121_0104368 | Ga0496121_0104368_1766_2086 | 103 |
| 431 | 3300048925 | Ga0496122_0400685 | Ga0496122_0400685_180_500 | 103 |
| 432 | 3300048927 | Ga0496124_0006063 | Ga0496124_0006063_3193_3513 | 103 |
| 433 | 3300048928 | Ga0496125_0001732 | Ga0496125_0001732_29466_29786 | 103 |
| 434 | 3300048928 | Ga0496125_0008666 | Ga0496125_0008666_9043_9363 | 103 |
| 435 | 3300048928 | Ga0496125_0046500 | Ga0496125_0046500_728_1048 | 103 |
| 436 | 3300048929 | Ga0496126_0006131 | Ga0496126_0006131_11061_11381 | 103 |
| 437 | 3300048929 | Ga0496126_0007001 | Ga0496126_0007001_11302_11622 | 103 |
| 438 | 3300048929 | Ga0496126_0225698 | Ga0496126_0225698_1229_1549 | 103 |
| 439 | 3300048929 | Ga0496126_0234217 | Ga0496126_0234217_1191_1511 | 103 |
| 440 | 3300049460 | Ga0495682_0089028 | Ga0495682_0089028_12_332 | 103 |
| 441 | 3300049765 | Ga0501268_108937 | Ga0501268_108937_85_405 | 103 |
| 442 | 3300050512 | nmdc:mga0n895_635943_c1 | nmdc:mga0n895_635943_c1_446_766 | 103 |
| 443 | 3300050513 | nmdc:mga0rr50_279732_c1 | nmdc:mga0rr50_279732_c1_313_633 | 103 |
| 444 | 3300050513 | nmdc:mga0rr50_593413_c1 | nmdc:mga0rr50_593413_c1_469_789 | 103 |
| 445 | 3300050514 | nmdc:mga08x19_170284_c1 | nmdc:mga08x19_170284_c1_282_602 | 103 |
| 446 | 3300050514 | nmdc:mga08x19_635783_c1 | nmdc:mga08x19_635783_c1_78_398 | 103 |
| 447 | 3300053078 | Ga0495612_0310411 | Ga0495612_0310411_273_593 | 103 |
| 448 | 3300053084 | Ga0495595_0581780 | Ga0495595_0581780_139_459 | 103 |
| 449 | 3300053088 | Ga0500644_0146897 | Ga0500644_0146897_358_678 | 103 |
| 450 | 3300053092 | Ga0500583_0002104 | Ga0500583_0002104_150_470 | 103 |
| 451 | 3300053092 | Ga0500583_0140818 | Ga0500583_0140818_90_410 | 103 |
| 452 | 3300053096 | Ga0500641_0066814 | Ga0500641_0066814_585_905 | 103 |
| 453 | 3300053098 | Ga0500650_0449956 | Ga0500650_0449956_113_433 | 103 |
| 454 | 3300053100 | Ga0500660_071612 | Ga0500660_071612_1036_1356 | 103 |
| 455 | 3300053108 | Ga0500562_015693 | Ga0500562_015693_766_1086 | 103 |
| 456 | 3300053109 | Ga0500569_057131 | Ga0500569_057131_565_885 | 103 |
| 457 | 3300053111 | Ga0500572_015317 | Ga0500572_015317_1478_1798 | 103 |
| 458 | 3300053115 | Ga0500591_138439 | Ga0500591_138439_131_451 | 103 |
| 459 | 3300053119 | Ga0500595_025471 | Ga0500595_025471_931_1251 | 103 |
| 460 | 3300053142 | Ga0500577_0075417 | Ga0500577_0075417_14_334 | 103 |
| 461 | 3300053148 | Ga0500590_137705 | Ga0500590_137705_590_910 | 103 |
| 462 | 3300053154 | Ga0500619_239755 | Ga0500619_239755_151_471 | 103 |
| 463 | 3300053156 | Ga0500622_0173222 | Ga0500622_0173222_533_853 | 103 |
| 464 | 3300053157 | Ga0500624_143018 | Ga0500624_143018_92_412 | 103 |
| 465 | 3300053159 | Ga0500630_147338 | Ga0500630_147338_47_367 | 103 |
| 466 | 3300053163 | Ga0500639_093845 | Ga0500639_093845_34_354 | 103 |
| 467 | 3300053163 | Ga0500639_127850 | Ga0500639_127850_793_1113 | 103 |
| 468 | 3300053178 | Ga0500637_0005644 | Ga0500637_0005644_1606_1926 | 103 |
| 469 | 3300053178 | Ga0500637_0186341 | Ga0500637_0186341_240_560 | 103 |
| 470 | 3300053727 | Ga0500611_004201 | Ga0500611_004201_1331_1651 | 103 |
| 471 | 3300059646 | Ga0587078_032918 | Ga0587078_032918_289_609 | 103 |
| 472 | 3300059655 | Ga0587114_116797 | Ga0587114_116797_25_345 | 103 |
| 473 | 3300060346 | Ga0587111_0086397 | Ga0587111_0086397_293_613 | 103 |
| 474 | 3300003323 | rootH1_10211908 | rootH1_102119082 | 104 |
| 475 | 3300005330 | Ga0070690_100434119 | Ga0070690_1004341192 | 104 |
| 476 | 3300005331 | Ga0070670_100027123 | Ga0070670_1000271234 | 104 |
| 477 | 3300005331 | Ga0070670_100118934 | Ga0070670_1001189342 | 104 |
| 478 | 3300005331 | Ga0070670_101388768 | Ga0070670_1013887681 | 104 |
| 479 | 3300005334 | Ga0068869_100129027 | Ga0068869_1001290272 | 104 |
| 480 | 3300005334 | Ga0068869_100992031 | Ga0068869_1009920312 | 104 |
| 481 | 3300005335 | Ga0070666_10146958 | Ga0070666_101469582 | 104 |
| 482 | 3300005335 | Ga0070666_10391354 | Ga0070666_103913541 | 104 |
| 483 | 3300005337 | Ga0070682_100364321 | Ga0070682_1003643212 | 104 |
| 484 | 3300005337 | Ga0070682_100884905 | Ga0070682_1008849052 | 104 |
| 485 | 3300005338 | Ga0068868_100004850 | Ga0068868_1000048509 | 104 |
| 486 | 3300005338 | Ga0068868_100094689 | Ga0068868_1000946892 | 104 |
| 487 | 3300005340 | Ga0070689_100004882 | Ga0070689_1000048822 | 104 |
| 488 | 3300005344 | Ga0070661_100035493 | Ga0070661_1000354932 | 104 |
| 489 | 3300005353 | Ga0070669_100548820 | Ga0070669_1005488202 | 104 |
| 490 | 3300005354 | Ga0070675_100107242 | Ga0070675_1001072423 | 104 |
| 491 | 3300005354 | Ga0070675_102257557 | Ga0070675_1022575571 | 104 |
| 492 | 3300005355 | Ga0070671_100002194 | Ga0070671_1000021947 | 104 |
| 493 | 3300005355 | Ga0070671_100098944 | Ga0070671_1000989442 | 104 |
| 494 | 3300005364 | Ga0070673_100016500 | Ga0070673_1000165005 | 104 |
| 495 | 3300005364 | Ga0070673_100544164 | Ga0070673_1005441642 | 104 |
| 496 | 3300005364 | Ga0070673_101655195 | Ga0070673_1016551951 | 104 |
| 497 | 3300005366 | Ga0070659_100450430 | Ga0070659_1004504302 | 104 |
| 498 | 3300005367 | Ga0070667_100029388 | Ga0070667_1000293885 | 104 |
| 499 | 3300005367 | Ga0070667_100553473 | Ga0070667_1005534731 | 104 |
| 500 | 3300005367 | Ga0070667_101023584 | Ga0070667_1010235841 | 104 |
| 501 | 3300005367 | Ga0070667_101221502 | Ga0070667_1012215021 | 104 |
| 502 | 3300005439 | Ga0070711_100460678 | Ga0070711_1004606783 | 104 |
| 503 | 3300005440 | Ga0070705_100347593 | Ga0070705_1003475932 | 104 |
| 504 | 3300005440 | Ga0070705_100636152 | Ga0070705_1006361521 | 104 |
| 505 | 3300005441 | Ga0070700_101723147 | Ga0070700_1017231471 | 104 |
| 506 | 3300005455 | Ga0070663_100391485 | Ga0070663_1003914852 | 104 |
| 507 | 3300005455 | Ga0070663_100538279 | Ga0070663_1005382792 | 104 |
| 508 | 3300005455 | Ga0070663_100538900 | Ga0070663_1005389002 | 104 |
| 509 | 3300005456 | Ga0070678_100843082 | Ga0070678_1008430822 | 104 |
| 510 | 3300005457 | Ga0070662_100383507 | Ga0070662_1003835072 | 104 |
| 511 | 3300005457 | Ga0070662_101370415 | Ga0070662_1013704151 | 104 |
| 512 | 3300005458 | Ga0070681_10013362 | Ga0070681_100133627 | 104 |
| 513 | 3300005466 | Ga0070685_10063412 | Ga0070685_100634122 | 104 |
| 514 | 3300005466 | Ga0070685_10680674 | Ga0070685_106806741 | 104 |
| 515 | 3300005467 | Ga0070706_102093621 | Ga0070706_1020936211 | 104 |
| 516 | 3300005530 | Ga0070679_100113205 | Ga0070679_1001132052 | 104 |
| 517 | 3300005535 | Ga0070684_100006012 | Ga0070684_1000060123 | 104 |
| 518 | 3300005535 | Ga0070684_102067403 | Ga0070684_1020674031 | 104 |
| 519 | 3300005539 | Ga0068853_101181577 | Ga0068853_1011815772 | 104 |
| 520 | 3300005543 | Ga0070672_100115740 | Ga0070672_1001157402 | 104 |
| 521 | 3300005543 | Ga0070672_100262365 | Ga0070672_1002623652 | 104 |
| 522 | 3300005544 | Ga0070686_100061083 | Ga0070686_1000610832 | 104 |
| 523 | 3300005547 | Ga0070693_100060935 | Ga0070693_1000609352 | 104 |
| 524 | 3300005548 | Ga0070665_100008098 | Ga0070665_1000080987 | 104 |
| 525 | 3300005548 | Ga0070665_100026875 | Ga0070665_1000268753 | 104 |
| 526 | 3300005548 | Ga0070665_100071765 | Ga0070665_1000717654 | 104 |
| 527 | 3300005548 | Ga0070665_101554237 | Ga0070665_1015542372 | 104 |
| 528 | 3300005563 | Ga0068855_100013822 | Ga0068855_1000138227 | 104 |
| 529 | 3300005564 | Ga0070664_100042866 | Ga0070664_1000428662 | 104 |
| 530 | 3300005577 | Ga0068857_102068997 | Ga0068857_1020689972 | 104 |
| 531 | 3300005578 | Ga0068854_100359733 | Ga0068854_1003597332 | 104 |
| 532 | 3300005614 | Ga0068856_100009532 | Ga0068856_1000095327 | 104 |
| 533 | 3300005614 | Ga0068856_100339780 | Ga0068856_1003397802 | 104 |
| 534 | 3300005615 | Ga0070702_100011767 | Ga0070702_1000117674 | 104 |
| 535 | 3300005615 | Ga0070702_101035006 | Ga0070702_1010350062 | 104 |
| 536 | 3300005616 | Ga0068852_100058878 | Ga0068852_1000588782 | 104 |
| 537 | 3300005616 | Ga0068852_101892213 | Ga0068852_1018922131 | 104 |
| 538 | 3300005617 | Ga0068859_100003949 | Ga0068859_1000039498 | 104 |
| 539 | 3300005617 | Ga0068859_100456600 | Ga0068859_1004566001 | 104 |
| 540 | 3300005618 | Ga0068864_100004196 | Ga0068864_1000041969 | 104 |
| 541 | 3300005719 | Ga0068861_100008139 | Ga0068861_1000081394 | 104 |
| 542 | 3300005719 | Ga0068861_100186356 | Ga0068861_1001863562 | 104 |
| 543 | 3300005719 | Ga0068861_100274311 | Ga0068861_1002743112 | 104 |
| 544 | 3300005719 | Ga0068861_100508673 | Ga0068861_1005086732 | 104 |
| 545 | 3300005841 | Ga0068863_100007487 | Ga0068863_1000074876 | 104 |
| 546 | 3300005842 | Ga0068858_100011250 | Ga0068858_1000112505 | 104 |
| 547 | 3300005843 | Ga0068860_100000219 | Ga0068860_1000002196 | 104 |
| 548 | 3300005843 | Ga0068860_100014788 | Ga0068860_1000147883 | 104 |
| 549 | 3300005844 | Ga0068862_100121504 | Ga0068862_1001215042 | 104 |
| 550 | 3300005844 | Ga0068862_100585066 | Ga0068862_1005850662 | 104 |
| 551 | 3300005937 | Ga0081455_10000099 | Ga0081455_1000009989 | 104 |
| 552 | 3300005983 | Ga0081540_1130441 | Ga0081540_11304412 | 104 |
| 553 | 3300006051 | Ga0075364_11034013 | Ga0075364_110340132 | 104 |
| 554 | 3300006178 | Ga0075367_10838451 | Ga0075367_108384511 | 104 |
| 555 | 3300006195 | Ga0075366_10183264 | Ga0075366_101832642 | 104 |
| 556 | 3300006195 | Ga0075366_10254773 | Ga0075366_102547731 | 104 |
| 557 | 3300006237 | Ga0097621_100029206 | Ga0097621_1000292062 | 104 |
| 558 | 3300006237 | Ga0097621_101125294 | Ga0097621_1011252943 | 104 |
| 559 | 3300006353 | Ga0075370_10437976 | Ga0075370_104379763 | 104 |
| 560 | 3300006358 | Ga0068871_100038551 | Ga0068871_1000385512 | 104 |
| 561 | 3300006358 | Ga0068871_100754384 | Ga0068871_1007543842 | 104 |
| 562 | 3300006358 | Ga0068871_101032012 | Ga0068871_1010320122 | 104 |
| 563 | 3300006881 | Ga0068865_101613591 | Ga0068865_1016135912 | 104 |
| 564 | 3300006881 | Ga0068865_101994557 | Ga0068865_1019945571 | 104 |
| 565 | 3300006931 | Ga0097620_100003949 | Ga0097620_1000039498 | 104 |
| 566 | 3300006931 | Ga0097620_100456600 | Ga0097620_1004566001 | 104 |
| 567 | 3300009093 | Ga0105240_10013342 | Ga0105240_100133425 | 104 |
| 568 | 3300009093 | Ga0105240_10048490 | Ga0105240_100484902 | 104 |
| 569 | 3300009093 | Ga0105240_10354070 | Ga0105240_103540701 | 104 |
| 570 | 3300009098 | Ga0105245_10001014 | Ga0105245_1000101419 | 104 |
| 571 | 3300009101 | Ga0105247_10031641 | Ga0105247_100316413 | 104 |
| 572 | 3300009174 | Ga0105241_10273723 | Ga0105241_102737232 | 104 |
| 573 | 3300009176 | Ga0105242_10102563 | Ga0105242_101025632 | 104 |
| 574 | 3300009176 | Ga0105242_11127368 | Ga0105242_111273681 | 104 |
| 575 | 3300009177 | Ga0105248_10002240 | Ga0105248_100022406 | 104 |
| 576 | 3300009177 | Ga0105248_11808215 | Ga0105248_118082151 | 104 |
| 577 | 3300009545 | Ga0105237_10143166 | Ga0105237_101431662 | 104 |
| 578 | 3300009545 | Ga0105237_10521788 | Ga0105237_105217882 | 104 |
| 579 | 3300009551 | Ga0105238_10048918 | Ga0105238_100489182 | 104 |
| 580 | 3300009551 | Ga0105238_10109784 | Ga0105238_101097842 | 104 |
| 581 | 3300009551 | Ga0105238_12558343 | Ga0105238_125583431 | 104 |
| 582 | 3300010375 | Ga0105239_10223365 | Ga0105239_102233652 | 104 |
| 583 | 3300010375 | Ga0105239_10774918 | Ga0105239_107749182 | 104 |
| 584 | 3300010375 | Ga0105239_11787674 | Ga0105239_117876742 | 104 |
| 585 | 3300011119 | Ga0105246_10001416 | Ga0105246_100014166 | 104 |
| 586 | 3300011119 | Ga0105246_11325006 | Ga0105246_113250061 | 104 |
| 587 | 3300013102 | Ga0157371_10867778 | Ga0157371_108677782 | 104 |
| 588 | 3300013104 | Ga0157370_10351683 | Ga0157370_103516832 | 104 |
| 589 | 3300013296 | Ga0157374_10009304 | Ga0157374_100093048 | 104 |
| 590 | 3300013297 | Ga0157378_10397931 | Ga0157378_103979312 | 104 |
| 591 | 3300013306 | Ga0163162_10056795 | Ga0163162_100567952 | 104 |
| 592 | 3300013306 | Ga0163162_13101443 | Ga0163162_131014431 | 104 |
| 593 | 3300013307 | Ga0157372_10070914 | Ga0157372_100709143 | 104 |
| 594 | 3300013307 | Ga0157372_10796326 | Ga0157372_107963262 | 104 |
| 595 | 3300013308 | Ga0157375_10038386 | Ga0157375_100383862 | 104 |
| 596 | 3300013308 | Ga0157375_10983849 | Ga0157375_109838492 | 104 |
| 597 | 3300014325 | Ga0163163_10126133 | Ga0163163_101261332 | 104 |
| 598 | 3300014325 | Ga0163163_11457998 | Ga0163163_114579982 | 104 |
| 599 | 3300014745 | Ga0157377_10129784 | Ga0157377_101297842 | 104 |
| 600 | 3300014745 | Ga0157377_10924710 | Ga0157377_109247101 | 104 |
| 601 | 3300014968 | Ga0157379_10069513 | Ga0157379_100695132 | 104 |
| 602 | 3300014968 | Ga0157379_10237878 | Ga0157379_102378782 | 104 |
| 603 | 3300014968 | Ga0157379_11161360 | Ga0157379_111613601 | 104 |
| 604 | 3300014968 | Ga0157379_12488711 | Ga0157379_124887111 | 104 |
| 605 | 3300014969 | Ga0157376_10373275 | Ga0157376_103732752 | 104 |
| 606 | 3300014969 | Ga0157376_10528053 | Ga0157376_105280532 | 104 |
| 607 | 3300017792 | Ga0163161_10282142 | Ga0163161_102821422 | 104 |
| 608 | 3300017792 | Ga0163161_10380596 | Ga0163161_103805963 | 104 |
| 609 | 3300020069 | Ga0197907_10664428 | Ga0197907_106644281 | 104 |
| 610 | 3300020069 | Ga0197907_11466352 | Ga0197907_114663522 | 104 |
| 611 | 3300020070 | Ga0206356_11266440 | Ga0206356_112664401 | 104 |
| 612 | 3300020070 | Ga0206356_11585042 | Ga0206356_115850421 | 104 |
| 613 | 3300020076 | Ga0206355_1423457 | Ga0206355_14234571 | 104 |
| 614 | 3300020081 | Ga0206354_11507845 | Ga0206354_115078453 | 104 |
| 615 | 3300020082 | Ga0206353_11185898 | Ga0206353_111858982 | 104 |
| 616 | 3300025321 | Ga0207656_10046971 | Ga0207656_100469712 | 104 |
| 617 | 3300025900 | Ga0207710_10022081 | Ga0207710_100220812 | 104 |
| 618 | 3300025900 | Ga0207710_10124552 | Ga0207710_101245522 | 104 |
| 619 | 3300025903 | Ga0207680_10143235 | Ga0207680_101432352 | 104 |
| 620 | 3300025903 | Ga0207680_10170556 | Ga0207680_101705562 | 104 |
| 621 | 3300025911 | Ga0207654_10610377 | Ga0207654_106103772 | 104 |
| 622 | 3300025913 | Ga0207695_10038713 | Ga0207695_100387133 | 104 |
| 623 | 3300025913 | Ga0207695_10071846 | Ga0207695_100718461 | 104 |
| 624 | 3300025913 | Ga0207695_10108868 | Ga0207695_101088683 | 104 |
| 625 | 3300025913 | Ga0207695_10143174 | Ga0207695_101431742 | 104 |
| 626 | 3300025913 | Ga0207695_10625571 | Ga0207695_106255712 | 104 |
| 627 | 3300025914 | Ga0207671_10101047 | Ga0207671_101010472 | 104 |
| 628 | 3300025915 | Ga0207693_10632305 | Ga0207693_106323052 | 104 |
| 629 | 3300025916 | Ga0207663_10381800 | Ga0207663_103818002 | 104 |
| 630 | 3300025917 | Ga0207660_10159649 | Ga0207660_101596492 | 104 |
| 631 | 3300025920 | Ga0207649_10123608 | Ga0207649_101236082 | 104 |
| 632 | 3300025920 | Ga0207649_10816371 | Ga0207649_108163712 | 104 |
| 633 | 3300025921 | Ga0207652_10180218 | Ga0207652_101802182 | 104 |
| 634 | 3300025924 | Ga0207694_10082839 | Ga0207694_100828392 | 104 |
| 635 | 3300025924 | Ga0207694_10184180 | Ga0207694_101841802 | 104 |
| 636 | 3300025924 | Ga0207694_10792744 | Ga0207694_107927442 | 104 |
| 637 | 3300025924 | Ga0207694_10931883 | Ga0207694_109318832 | 104 |
| 638 | 3300025925 | Ga0207650_10017320 | Ga0207650_100173205 | 104 |
| 639 | 3300025927 | Ga0207687_10048914 | Ga0207687_100489142 | 104 |
| 640 | 3300025929 | Ga0207664_10519256 | Ga0207664_105192562 | 104 |
| 641 | 3300025931 | Ga0207644_10021569 | Ga0207644_100215693 | 104 |
| 642 | 3300025931 | Ga0207644_10099892 | Ga0207644_100998922 | 104 |
| 643 | 3300025931 | Ga0207644_11499964 | Ga0207644_114999641 | 104 |
| 644 | 3300025932 | Ga0207690_10672840 | Ga0207690_106728402 | 104 |
| 645 | 3300025933 | Ga0207706_10078688 | Ga0207706_100786882 | 104 |
| 646 | 3300025934 | Ga0207686_11446551 | Ga0207686_114465512 | 104 |
| 647 | 3300025936 | Ga0207670_10233573 | Ga0207670_102335732 | 104 |
| 648 | 3300025940 | Ga0207691_10143593 | Ga0207691_101435931 | 104 |
| 649 | 3300025940 | Ga0207691_10173957 | Ga0207691_101739572 | 104 |
| 650 | 3300025941 | Ga0207711_10007852 | Ga0207711_100078529 | 104 |
| 651 | 3300025941 | Ga0207711_10086806 | Ga0207711_100868063 | 104 |
| 652 | 3300025942 | Ga0207689_10272240 | Ga0207689_102722402 | 104 |
| 653 | 3300025942 | Ga0207689_10503285 | Ga0207689_105032852 | 104 |
| 654 | 3300025945 | Ga0207679_10188739 | Ga0207679_101887392 | 104 |
| 655 | 3300025945 | Ga0207679_10778816 | Ga0207679_107788162 | 104 |
| 656 | 3300025949 | Ga0207667_10096212 | Ga0207667_100962122 | 104 |
| 657 | 3300025949 | Ga0207667_10167834 | Ga0207667_101678341 | 104 |
| 658 | 3300025949 | Ga0207667_11849791 | Ga0207667_118497911 | 104 |
| 659 | 3300025960 | Ga0207651_11190033 | Ga0207651_111900332 | 104 |
| 660 | 3300025961 | Ga0207712_10122301 | Ga0207712_101223011 | 104 |
| 661 | 3300025961 | Ga0207712_10144899 | Ga0207712_101448992 | 104 |
| 662 | 3300025981 | Ga0207640_10024393 | Ga0207640_100243932 | 104 |
| 663 | 3300025981 | Ga0207640_10492713 | Ga0207640_104927131 | 104 |
| 664 | 3300025981 | Ga0207640_10699742 | Ga0207640_106997422 | 104 |
| 665 | 3300025986 | Ga0207658_10255626 | Ga0207658_102556262 | 104 |
| 666 | 3300025986 | Ga0207658_10318538 | Ga0207658_103185381 | 104 |
| 667 | 3300026023 | Ga0207677_10006887 | Ga0207677_100068876 | 104 |
| 668 | 3300026023 | Ga0207677_10174889 | Ga0207677_101748892 | 104 |
| 669 | 3300026035 | Ga0207703_10003908 | Ga0207703_100039082 | 104 |
| 670 | 3300026035 | Ga0207703_10006963 | Ga0207703_100069636 | 104 |
| 671 | 3300026067 | Ga0207678_10036677 | Ga0207678_100366773 | 104 |
| 672 | 3300026067 | Ga0207678_10421369 | Ga0207678_104213692 | 104 |
| 673 | 3300026067 | Ga0207678_10629792 | Ga0207678_106297922 | 104 |
| 674 | 3300026075 | Ga0207708_10201949 | Ga0207708_102019492 | 104 |
| 675 | 3300026078 | Ga0207702_10070305 | Ga0207702_100703052 | 104 |
| 676 | 3300026088 | Ga0207641_10000247 | Ga0207641_100002474 | 104 |
| 677 | 3300026088 | Ga0207641_10003295 | Ga0207641_1000329510 | 104 |
| 678 | 3300026095 | Ga0207676_10002982 | Ga0207676_100029829 | 104 |
| 679 | 3300026095 | Ga0207676_10190035 | Ga0207676_101900352 | 104 |
| 680 | 3300026116 | Ga0207674_10197918 | Ga0207674_101979183 | 104 |
| 681 | 3300026118 | Ga0207675_100042310 | Ga0207675_1000423101 | 104 |
| 682 | 3300026118 | Ga0207675_100142064 | Ga0207675_1001420642 | 104 |
| 683 | 3300026118 | Ga0207675_100145872 | Ga0207675_1001458722 | 104 |
| 684 | 3300026118 | Ga0207675_100335032 | Ga0207675_1003350322 | 104 |
| 685 | 3300026121 | Ga0207683_10621886 | Ga0207683_106218862 | 104 |
| 686 | 3300026121 | Ga0207683_11016654 | Ga0207683_110166542 | 104 |
| 687 | 3300026142 | Ga0207698_10775791 | Ga0207698_107757912 | 104 |
| 688 | 3300026142 | Ga0207698_11221566 | Ga0207698_112215662 | 104 |
| 689 | 3300028379 | Ga0268266_10009975 | Ga0268266_100099758 | 104 |
| 690 | 3300028379 | Ga0268266_10012788 | Ga0268266_100127883 | 104 |
| 691 | 3300028380 | Ga0268265_10124822 | Ga0268265_101248222 | 104 |
| 692 | 3300028380 | Ga0268265_10258996 | Ga0268265_102589962 | 104 |
| 693 | 3300028380 | Ga0268265_10431371 | Ga0268265_104313712 | 104 |
| 694 | 3300028380 | Ga0268265_10970044 | Ga0268265_109700441 | 104 |
| 695 | 3300028381 | Ga0268264_10000057 | Ga0268264_1000005743 | 104 |
| 696 | 3300028381 | Ga0268264_10000165 | Ga0268264_1000016559 | 104 |
| 697 | 3300028381 | Ga0268264_10000348 | Ga0268264_1000034857 | 104 |
| 698 | 3300028381 | Ga0268264_10204353 | Ga0268264_102043532 | 104 |
| 699 | 3300028381 | Ga0268264_10582629 | Ga0268264_105826292 | 104 |
| 700 | 3300028800 | Ga0265338_10021377 | Ga0265338_100213773 | 104 |
| 701 | 3300030521 | Ga0307511_10324335 | Ga0307511_103243351 | 104 |
| 702 | 3300030877 | Ga0265777_122563 | Ga0265777_1225631 | 104 |
| 703 | 3300030878 | Ga0265770_1150366 | Ga0265770_11503662 | 104 |
| 704 | 3300031239 | Ga0265328_10002748 | Ga0265328_100027487 | 104 |
| 705 | 3300031247 | Ga0265340_10053569 | Ga0265340_100535692 | 104 |
| 706 | 3300031247 | Ga0265340_10139708 | Ga0265340_101397081 | 104 |
| 707 | 3300031344 | Ga0265316_10051925 | Ga0265316_100519251 | 104 |
| 708 | 3300031507 | Ga0307509_10730397 | Ga0307509_107303972 | 104 |
| 709 | 3300031548 | Ga0307408_100785696 | Ga0307408_1007856962 | 104 |
| 710 | 3300031730 | Ga0307516_10874425 | Ga0307516_108744251 | 104 |
| 711 | 3300033180 | Ga0307510_10001790 | Ga0307510_1000179011 | 104 |
| 712 | 3300035111 | Ga0373923_0343697 | Ga0373923_0343697_97_420 | 104 |
| 713 | 3300035118 | Ga0373954_0049752 | Ga0373954_0049752_1592_1915 | 104 |
| 714 | 3300035120 | Ga0373957_0173888 | Ga0373957_0173888_301_624 | 104 |
| 715 | 3300035172 | Ga0373955_0075611 | Ga0373955_0075611_1484_1807 | 104 |
| 716 | 3300035172 | Ga0373955_0429121 | Ga0373955_0429121_15_338 | 104 |
| 717 | 3300035410 | Ga0373924_0303553 | Ga0373924_0303553_105_428 | 104 |
| 718 | 3300035724 | Ga0373933_0706142 | Ga0373933_0706142_145_468 | 104 |
| 719 | 3300035725 | Ga0373947_0294453 | Ga0373947_0294453_132_455 | 104 |
| 720 | 3300036401 | Ga0373937_0003618 | Ga0373937_0003618_1640_1963 | 104 |
| 721 | 3300036401 | Ga0373937_0266404 | Ga0373937_0266404_636_959 | 104 |
| 722 | 3300036401 | Ga0373937_0488915 | Ga0373937_0488915_702_1025 | 104 |
| 723 | 3300037068 | Ga0373925_0821241 | Ga0373925_0821241_193_516 | 104 |
| 724 | 3300037418 | Ga0395900_0904878 | Ga0395900_0904878_143_496 | 104 |
| 725 | 3300039438 | Ga0436360_0327579 | Ga0436360_0327579_62_406 | 104 |
| 726 | 3300041443 | Ga0451789_0291202 | Ga0451789_0291202_69_401 | 104 |
| 727 | 3300041452 | Ga0451793_1114941 | Ga0451793_1114941_138_476 | 104 |
| 728 | 3300041454 | Ga0451799_30402 | Ga0451799_30402_10_324 | 104 |
| 729 | 3300041458 | Ga0451798_0061378 | Ga0451798_0061378_118_462 | 104 |
| 730 | 3300041463 | Ga0451804_1089028 | Ga0451804_1089028_760_1098 | 104 |
| 731 | 3300041486 | Ga0451807_2424518 | Ga0451807_2424518_277_600 | 104 |
| 732 | 3300041512 | Ga0451853_3187295 | Ga0451853_3187295_302_625 | 104 |
| 733 | 3300044656 | Ga0466969_0000848 | Ga0466969_0000848_14707_15063 | 104 |
| 734 | 3300044656 | Ga0466969_0003618 | Ga0466969_0003618_5198_5521 | 104 |
| 735 | 3300044658 | Ga0466972_0062906 | Ga0466972_0062906_63_407 | 104 |
| 736 | 3300044658 | Ga0466972_0070188 | Ga0466972_0070188_1133_1489 | 104 |
| 737 | 3300044683 | Ga0466965_0093846 | Ga0466965_0093846_799_1155 | 104 |
| 738 | 3300044684 | Ga0466966_0006187 | Ga0466966_0006187_3668_4024 | 104 |
| 739 | 3300044684 | Ga0466966_0334759 | Ga0466966_0334759_241_594 | 104 |
| 740 | 3300044693 | Ga0466961_0005473 | Ga0466961_0005473_2579_2935 | 104 |
| 741 | 3300044694 | Ga0466963_0129568 | Ga0466963_0129568_1345_1698 | 104 |
| 742 | 3300044706 | Ga0466964_0000149 | Ga0466964_0000149_3345_3701 | 104 |
| 743 | 3300044719 | Ga0466971_0000098 | Ga0466971_0000098_1505_1861 | 104 |
| 744 | 3300044719 | Ga0466971_0087825 | Ga0466971_0087825_550_873 | 104 |
| 745 | 3300044735 | Ga0466968_0005494 | Ga0466968_0005494_2080_2436 | 104 |
| 746 | 3300044765 | Ga0466970_0006751 | Ga0466970_0006751_1505_1861 | 104 |
| 747 | 3300044842 | Ga0466957_0044272 | Ga0466957_0044272_197_553 | 104 |
| 748 | 3300044901 | Ga0466960_0034653 | Ga0466960_0034653_853_1197 | 104 |
| 749 | 3300045049 | Ga0466959_0020278 | Ga0466959_0020278_2257_2613 | 104 |
| 750 | 3300045051 | Ga0451576_0218229 | Ga0451576_0218229_1616_1939 | 104 |
| 751 | 3300045836 | Ga0466958_0064653 | Ga0466958_0064653_290_646 | 104 |
| 752 | 3300045976 | Ga0466967_1180654 | Ga0466967_1180654_375_713 | 104 |
| 753 | 3300046455 | Ga0495603_0075386 | Ga0495603_0075386_1256_1579 | 104 |
| 754 | 3300046475 | Ga0495639_0197200 | Ga0495639_0197200_583_906 | 104 |
| 755 | 3300046500 | Ga0495596_0106321 | Ga0495596_0106321_721_1035 | 104 |
| 756 | 3300046535 | Ga0495586_0326422 | Ga0495586_0326422_503_826 | 104 |
| 757 | 3300046616 | Ga0495668_0603974 | Ga0495668_0603974_188_511 | 104 |
| 758 | 3300046660 | Ga0495625_0488389 | Ga0495625_0488389_261_584 | 104 |
| 759 | 3300046683 | Ga0495658_0173561 | Ga0495658_0173561_349_672 | 104 |
| 760 | 3300046684 | Ga0495669_0627373 | Ga0495669_0627373_21_344 | 104 |
| 761 | 3300047319 | Ga0495674_0781369 | Ga0495674_0781369_56_379 | 104 |
| 762 | 3300047472 | Ga0495686_0366778 | Ga0495686_0366778_270_593 | 104 |
| 763 | 3300048903 | Ga0496100_0850778 | Ga0496100_0850778_316_639 | 104 |
| 764 | 3300048907 | Ga0496104_0572269 | Ga0496104_0572269_470_793 | 104 |
| 765 | 3300048908 | Ga0496105_0057715 | Ga0496105_0057715_1147_1470 | 104 |
| 766 | 3300048910 | Ga0496107_0185344 | Ga0496107_0185344_827_1150 | 104 |
| 767 | 3300048911 | Ga0496108_0039201 | Ga0496108_0039201_222_545 | 104 |
| 768 | 3300048913 | Ga0496110_1621609 | Ga0496110_1621609_82_405 | 104 |
| 769 | 3300048914 | Ga0496111_0624307 | Ga0496111_0624307_423_746 | 104 |
| 770 | 3300048915 | Ga0496112_0009255 | Ga0496112_0009255_1314_1637 | 104 |
| 771 | 3300048916 | Ga0496113_0128272 | Ga0496113_0128272_402_725 | 104 |
| 772 | 3300048917 | Ga0496114_0009986 | Ga0496114_0009986_1051_1374 | 104 |
| 773 | 3300048918 | Ga0496115_0089907 | Ga0496115_0089907_378_701 | 104 |
| 774 | 3300049571 | Ga0501034_1177008 | Ga0501034_1177008_235_573 | 104 |
| 775 | 3300049585 | Ga0501069_0500446 | Ga0501069_0500446_281_607 | 104 |
| 776 | 3300049587 | Ga0501071_1137620 | Ga0501071_1137620_249_575 | 104 |
| 777 | 3300049588 | Ga0501072_0261277 | Ga0501072_0261277_577_906 | 104 |
| 778 | 3300049742 | Ga0501080_0519447 | Ga0501080_0519447_512_850 | 104 |
| 779 | 3300049744 | Ga0501083_0477720 | Ga0501083_0477720_411_755 | 104 |
| 780 | 3300050493 | nmdc:mga0k408_270731_c1 | nmdc:mga0k408_270731_c1_289_633 | 104 |
| 781 | 3300050494 | nmdc:mga06z11_581469_c1 | nmdc:mga06z11_581469_c1_205_543 | 104 |
| 782 | 3300053077 | Ga0495601_0005333 | Ga0495601_0005333_794_1117 | 104 |
| 783 | 3300053077 | Ga0495601_0178148 | Ga0495601_0178148_922_1245 | 104 |
| 784 | 3300053084 | Ga0495595_0362123 | Ga0495595_0362123_304_627 | 104 |
| 785 | 3300053090 | Ga0500646_0059954 | Ga0500646_0059954_102_425 | 104 |
| 786 | 3300053090 | Ga0500646_0116360 | Ga0500646_0116360_474_818 | 104 |
| 787 | 3300053092 | Ga0500583_0005358 | Ga0500583_0005358_2375_2719 | 104 |
| 788 | 3300053093 | Ga0500651_0479902 | Ga0500651_0479902_86_409 | 104 |
| 789 | 3300053096 | Ga0500641_0049471 | Ga0500641_0049471_604_948 | 104 |
| 790 | 3300053098 | Ga0500650_0154479 | Ga0500650_0154479_355_699 | 104 |
| 791 | 3300053098 | Ga0500650_0350738 | Ga0500650_0350738_252_575 | 104 |
| 792 | 3300053104 | Ga0500556_0037328 | Ga0500556_0037328_581_925 | 104 |
| 793 | 3300053108 | Ga0500562_101991 | Ga0500562_101991_233_577 | 104 |
| 794 | 3300053124 | Ga0500617_035705 | Ga0500617_035705_979_1323 | 104 |
| 795 | 3300053130 | Ga0500642_0233466 | Ga0500642_0233466_194_538 | 104 |
| 796 | 3300053130 | Ga0500642_0246502 | Ga0500642_0246502_404_727 | 104 |
| 797 | 3300053139 | Ga0500568_0152819 | Ga0500568_0152819_435_758 | 104 |
| 798 | 3300053146 | Ga0500588_0006662 | Ga0500588_0006662_303_647 | 104 |
| 799 | 3300053147 | Ga0500589_122401 | Ga0500589_122401_460_804 | 104 |
| 800 | 3300053153 | Ga0500616_0019660 | Ga0500616_0019660_1140_1463 | 104 |
| 801 | 3300053158 | Ga0500627_0139213 | Ga0500627_0139213_295_639 | 104 |
| 802 | 3300053161 | Ga0500634_0180186 | Ga0500634_0180186_468_812 | 104 |
| 803 | 3300053732 | Ga0500656_009938 | Ga0500656_009938_382_726 | 104 |
| 804 | 3300059477 | Ga0587084_024783 | Ga0587084_024783_151_489 | 104 |
| 805 | 3300059490 | Ga0587066_041731 | Ga0587066_041731_233_583 | 104 |
| 806 | 3300059492 | Ga0587073_0098956 | Ga0587073_0098956_143_487 | 104 |
| 807 | 3300059492 | Ga0587073_0209027 | Ga0587073_0209027_26_364 | 104 |
| 808 | 3300059508 | Ga0587088_060789 | Ga0587088_060789_279_623 | 104 |
| 809 | 3300059510 | Ga0587090_023914 | Ga0587090_023914_303_653 | 104 |
| 810 | 3300059510 | Ga0587090_060900 | Ga0587090_060900_250_588 | 104 |
| 811 | 3300059513 | Ga0587094_056210 | Ga0587094_056210_125_463 | 104 |
| 812 | 3300059631 | Ga0587130_023277 | Ga0587130_023277_303_647 | 104 |
| 813 | 3300059640 | Ga0587067_057047 | Ga0587067_057047_284_634 | 104 |
| 814 | 3300059641 | Ga0587068_078567 | Ga0587068_078567_119_469 | 104 |
| 815 | 3300059645 | Ga0587076_025250 | Ga0587076_025250_227_577 | 104 |
| 816 | 3300060346 | Ga0587111_0110630 | Ga0587111_0110630_230_568 | 104 |
| 817 | 3300061719 | Ga0466962_0000641 | Ga0466962_0000641_7077_7433 | 104 |
| 818 | 3300002077 | JGI24744J21845_10074202 | JGI24744J21845_100742022 | 105 |
| 819 | 3300003323 | rootH1_10026435 | rootH1_100264352 | 105 |
| 820 | 3300004800 | Ga0058861_11861260 | Ga0058861_118612601 | 105 |
| 821 | 3300004803 | Ga0058862_12010366 | Ga0058862_120103661 | 105 |
| 822 | 3300005289 | Ga0065704_10098711 | Ga0065704_100987112 | 105 |
| 823 | 3300005289 | Ga0065704_10802156 | Ga0065704_108021561 | 105 |
| 824 | 3300005290 | Ga0065712_10072478 | Ga0065712_100724783 | 105 |
| 825 | 3300005290 | Ga0065712_10311057 | Ga0065712_103110572 | 105 |
| 826 | 3300005293 | Ga0065715_10001498 | Ga0065715_100014984 | 105 |
| 827 | 3300005295 | Ga0065707_10085991 | Ga0065707_100859914 | 105 |
| 828 | 3300005295 | Ga0065707_10305113 | Ga0065707_103051133 | 105 |
| 829 | 3300005329 | Ga0070683_100113854 | Ga0070683_1001138543 | 105 |
| 830 | 3300005330 | Ga0070690_100003822 | Ga0070690_1000038221 | 105 |
| 831 | 3300005330 | Ga0070690_101639687 | Ga0070690_1016396871 | 105 |
| 832 | 3300005331 | Ga0070670_100019825 | Ga0070670_1000198253 | 105 |
| 833 | 3300005331 | Ga0070670_100632259 | Ga0070670_1006322592 | 105 |
| 834 | 3300005334 | Ga0068869_100069124 | Ga0068869_1000691242 | 105 |
| 835 | 3300005334 | Ga0068869_100194144 | Ga0068869_1001941442 | 105 |
| 836 | 3300005334 | Ga0068869_100494367 | Ga0068869_1004943672 | 105 |
| 837 | 3300005335 | Ga0070666_10433450 | Ga0070666_104334502 | 105 |
| 838 | 3300005336 | Ga0070680_100254672 | Ga0070680_1002546722 | 105 |
| 839 | 3300005336 | Ga0070680_100260024 | Ga0070680_1002600242 | 105 |
| 840 | 3300005337 | Ga0070682_100020490 | Ga0070682_1000204902 | 105 |
| 841 | 3300005337 | Ga0070682_100233148 | Ga0070682_1002331481 | 105 |
| 842 | 3300005337 | Ga0070682_100339416 | Ga0070682_1003394161 | 105 |
| 843 | 3300005337 | Ga0070682_101291725 | Ga0070682_1012917252 | 105 |
| 844 | 3300005338 | Ga0068868_100183314 | Ga0068868_1001833142 | 105 |
| 845 | 3300005340 | Ga0070689_100001596 | Ga0070689_10000159610 | 105 |
| 846 | 3300005340 | Ga0070689_100547261 | Ga0070689_1005472611 | 105 |
| 847 | 3300005340 | Ga0070689_100614267 | Ga0070689_1006142671 | 105 |
| 848 | 3300005340 | Ga0070689_102111929 | Ga0070689_1021119291 | 105 |
| 849 | 3300005341 | Ga0070691_10347532 | Ga0070691_103475321 | 105 |
| 850 | 3300005341 | Ga0070691_10516887 | Ga0070691_105168871 | 105 |
| 851 | 3300005343 | Ga0070687_100022560 | Ga0070687_1000225601 | 105 |
| 852 | 3300005343 | Ga0070687_100302740 | Ga0070687_1003027402 | 105 |
| 853 | 3300005344 | Ga0070661_100052662 | Ga0070661_1000526623 | 105 |
| 854 | 3300005344 | Ga0070661_100114542 | Ga0070661_1001145422 | 105 |
| 855 | 3300005344 | Ga0070661_101007634 | Ga0070661_1010076341 | 105 |
| 856 | 3300005345 | Ga0070692_10031760 | Ga0070692_100317602 | 105 |
| 857 | 3300005345 | Ga0070692_10115429 | Ga0070692_101154292 | 105 |
| 858 | 3300005345 | Ga0070692_10556486 | Ga0070692_105564861 | 105 |
| 859 | 3300005353 | Ga0070669_100049479 | Ga0070669_1000494791 | 105 |
| 860 | 3300005354 | Ga0070675_100003779 | Ga0070675_1000037792 | 105 |
| 861 | 3300005356 | Ga0070674_100052489 | Ga0070674_1000524892 | 105 |
| 862 | 3300005365 | Ga0070688_100082218 | Ga0070688_1000822183 | 105 |
| 863 | 3300005366 | Ga0070659_100714999 | Ga0070659_1007149992 | 105 |
| 864 | 3300005367 | Ga0070667_100167130 | Ga0070667_1001671302 | 105 |
| 865 | 3300005367 | Ga0070667_102125483 | Ga0070667_1021254831 | 105 |
| 866 | 3300005435 | Ga0070714_102074806 | Ga0070714_1020748061 | 105 |
| 867 | 3300005438 | Ga0070701_10054505 | Ga0070701_100545052 | 105 |
| 868 | 3300005440 | Ga0070705_100108171 | Ga0070705_1001081713 | 105 |
| 869 | 3300005441 | Ga0070700_100069722 | Ga0070700_1000697222 | 105 |
| 870 | 3300005441 | Ga0070700_100231657 | Ga0070700_1002316571 | 105 |
| 871 | 3300005441 | Ga0070700_100269903 | Ga0070700_1002699032 | 105 |
| 872 | 3300005444 | Ga0070694_100052311 | Ga0070694_1000523112 | 105 |
| 873 | 3300005444 | Ga0070694_100140533 | Ga0070694_1001405332 | 105 |
| 874 | 3300005444 | Ga0070694_100456922 | Ga0070694_1004569221 | 105 |
| 875 | 3300005444 | Ga0070694_101042895 | Ga0070694_1010428952 | 105 |
| 876 | 3300005455 | Ga0070663_100147002 | Ga0070663_1001470022 | 105 |
| 877 | 3300005455 | Ga0070663_100610075 | Ga0070663_1006100752 | 105 |
| 878 | 3300005455 | Ga0070663_100883831 | Ga0070663_1008838312 | 105 |
| 879 | 3300005457 | Ga0070662_100867757 | Ga0070662_1008677572 | 105 |
| 880 | 3300005458 | Ga0070681_10509537 | Ga0070681_105095372 | 105 |
| 881 | 3300005459 | Ga0068867_100008080 | Ga0068867_1000080805 | 105 |
| 882 | 3300005459 | Ga0068867_100197722 | Ga0068867_1001977222 | 105 |
| 883 | 3300005466 | Ga0070685_10127754 | Ga0070685_101277541 | 105 |
| 884 | 3300005471 | Ga0070698_101001791 | Ga0070698_1010017912 | 105 |
| 885 | 3300005471 | Ga0070698_101583276 | Ga0070698_1015832762 | 105 |
| 886 | 3300005530 | Ga0070679_100030496 | Ga0070679_1000304963 | 105 |
| 887 | 3300005530 | Ga0070679_100261024 | Ga0070679_1002610241 | 105 |
| 888 | 3300005530 | Ga0070679_101203238 | Ga0070679_1012032381 | 105 |
| 889 | 3300005535 | Ga0070684_100003660 | Ga0070684_10000366010 | 105 |
| 890 | 3300005535 | Ga0070684_102091128 | Ga0070684_1020911281 | 105 |
| 891 | 3300005543 | Ga0070672_100049906 | Ga0070672_1000499062 | 105 |
| 892 | 3300005543 | Ga0070672_100204218 | Ga0070672_1002042183 | 105 |
| 893 | 3300005544 | Ga0070686_100205214 | Ga0070686_1002052142 | 105 |
| 894 | 3300005544 | Ga0070686_100806619 | Ga0070686_1008066191 | 105 |
| 895 | 3300005544 | Ga0070686_101488093 | Ga0070686_1014880931 | 105 |
| 896 | 3300005545 | Ga0070695_100756361 | Ga0070695_1007563611 | 105 |
| 897 | 3300005545 | Ga0070695_100833517 | Ga0070695_1008335172 | 105 |
| 898 | 3300005546 | Ga0070696_100888401 | Ga0070696_1008884012 | 105 |
| 899 | 3300005548 | Ga0070665_100182905 | Ga0070665_1001829051 | 105 |
| 900 | 3300005548 | Ga0070665_100459624 | Ga0070665_1004596242 | 105 |
| 901 | 3300005548 | Ga0070665_101412298 | Ga0070665_1014122981 | 105 |
| 902 | 3300005548 | Ga0070665_102298984 | Ga0070665_1022989841 | 105 |
| 903 | 3300005549 | Ga0070704_100018874 | Ga0070704_1000188741 | 105 |
| 904 | 3300005549 | Ga0070704_100138110 | Ga0070704_1001381102 | 105 |
| 905 | 3300005563 | Ga0068855_100485179 | Ga0068855_1004851792 | 105 |
| 906 | 3300005564 | Ga0070664_100001245 | Ga0070664_10000124518 | 105 |
| 907 | 3300005564 | Ga0070664_100265154 | Ga0070664_1002651542 | 105 |
| 908 | 3300005577 | Ga0068857_100113288 | Ga0068857_1001132882 | 105 |
| 909 | 3300005577 | Ga0068857_100567710 | Ga0068857_1005677101 | 105 |
| 910 | 3300005577 | Ga0068857_100918134 | Ga0068857_1009181342 | 105 |
| 911 | 3300005578 | Ga0068854_100053916 | Ga0068854_1000539163 | 105 |
| 912 | 3300005615 | Ga0070702_100010658 | Ga0070702_1000106582 | 105 |
| 913 | 3300005615 | Ga0070702_101740670 | Ga0070702_1017406701 | 105 |
| 914 | 3300005617 | Ga0068859_100006748 | Ga0068859_1000067482 | 105 |
| 915 | 3300005617 | Ga0068859_100383959 | Ga0068859_1003839592 | 105 |
| 916 | 3300005617 | Ga0068859_100385650 | Ga0068859_1003856502 | 105 |
| 917 | 3300005618 | Ga0068864_100005110 | Ga0068864_1000051107 | 105 |
| 918 | 3300005718 | Ga0068866_10014160 | Ga0068866_100141602 | 105 |
| 919 | 3300005719 | Ga0068861_100071052 | Ga0068861_1000710522 | 105 |
| 920 | 3300005719 | Ga0068861_100082512 | Ga0068861_1000825122 | 105 |
| 921 | 3300005840 | Ga0068870_10016521 | Ga0068870_100165212 | 105 |
| 922 | 3300005841 | Ga0068863_100102119 | Ga0068863_1001021192 | 105 |
| 923 | 3300005842 | Ga0068858_100717037 | Ga0068858_1007170372 | 105 |
| 924 | 3300005843 | Ga0068860_100312784 | Ga0068860_1003127842 | 105 |
| 925 | 3300005844 | Ga0068862_100381362 | Ga0068862_1003813622 | 105 |
| 926 | 3300005844 | Ga0068862_100418427 | Ga0068862_1004184272 | 105 |
| 927 | 3300005937 | Ga0081455_10436627 | Ga0081455_104366272 | 105 |
| 928 | 3300005937 | Ga0081455_10505365 | Ga0081455_105053651 | 105 |
| 929 | 3300005981 | Ga0081538_10088879 | Ga0081538_100888792 | 105 |
| 930 | 3300005983 | Ga0081540_1186417 | Ga0081540_11864172 | 105 |
| 931 | 3300005985 | Ga0081539_10059565 | Ga0081539_100595652 | 105 |
| 932 | 3300006195 | Ga0075366_10282760 | Ga0075366_102827602 | 105 |
| 933 | 3300006237 | Ga0097621_100041945 | Ga0097621_1000419454 | 105 |
| 934 | 3300006237 | Ga0097621_101223004 | Ga0097621_1012230042 | 105 |
| 935 | 3300006358 | Ga0068871_100117604 | Ga0068871_1001176042 | 105 |
| 936 | 3300006844 | Ga0075428_100002724 | Ga0075428_10000272413 | 105 |
| 937 | 3300006844 | Ga0075428_100006022 | Ga0075428_10000602211 | 105 |
| 938 | 3300006844 | Ga0075428_100012167 | Ga0075428_1000121672 | 105 |
| 939 | 3300006844 | Ga0075428_100026057 | Ga0075428_1000260573 | 105 |
| 940 | 3300006844 | Ga0075428_100040146 | Ga0075428_1000401464 | 105 |
| 941 | 3300006844 | Ga0075428_101316727 | Ga0075428_1013167271 | 105 |
| 942 | 3300006846 | Ga0075430_100005100 | Ga0075430_1000051005 | 105 |
| 943 | 3300006846 | Ga0075430_100046629 | Ga0075430_1000466293 | 105 |
| 944 | 3300006846 | Ga0075430_100137269 | Ga0075430_1001372692 | 105 |
| 945 | 3300006846 | Ga0075430_100271203 | Ga0075430_1002712032 | 105 |
| 946 | 3300006846 | Ga0075430_100860337 | Ga0075430_1008603371 | 105 |
| 947 | 3300006847 | Ga0075431_100005080 | Ga0075431_10000508013 | 105 |
| 948 | 3300006847 | Ga0075431_100028173 | Ga0075431_1000281731 | 105 |
| 949 | 3300006847 | Ga0075431_100039938 | Ga0075431_1000399384 | 105 |
| 950 | 3300006847 | Ga0075431_100063667 | Ga0075431_1000636672 | 105 |
| 951 | 3300006847 | Ga0075431_100437027 | Ga0075431_1004370272 | 105 |
| 952 | 3300006852 | Ga0075433_10039105 | Ga0075433_100391053 | 105 |
| 953 | 3300006852 | Ga0075433_10601384 | Ga0075433_106013842 | 105 |
| 954 | 3300006871 | Ga0075434_100207585 | Ga0075434_1002075851 | 105 |
| 955 | 3300006871 | Ga0075434_101333267 | Ga0075434_1013332671 | 105 |
| 956 | 3300006880 | Ga0075429_100006884 | Ga0075429_1000068847 | 105 |
| 957 | 3300006880 | Ga0075429_100013382 | Ga0075429_1000133824 | 105 |
| 958 | 3300006880 | Ga0075429_100336750 | Ga0075429_1003367502 | 105 |
| 959 | 3300006881 | Ga0068865_100030070 | Ga0068865_1000300702 | 105 |
| 960 | 3300006914 | Ga0075436_101035700 | Ga0075436_1010357002 | 105 |
| 961 | 3300006931 | Ga0097620_100006748 | Ga0097620_1000067488 | 105 |
| 962 | 3300006931 | Ga0097620_100383952 | Ga0097620_1003839522 | 105 |
| 963 | 3300006931 | Ga0097620_100385649 | Ga0097620_1003856492 | 105 |
| 964 | 3300006948 | Ga0099826_10115124 | Ga0099826_101151243 | 105 |
| 965 | 3300007076 | Ga0075435_100205340 | Ga0075435_1002053402 | 105 |
| 966 | 3300009092 | Ga0105250_10000006 | Ga0105250_10000006109 | 105 |
| 967 | 3300009092 | Ga0105250_10172474 | Ga0105250_101724741 | 105 |
| 968 | 3300009094 | Ga0111539_10407029 | Ga0111539_104070292 | 105 |
| 969 | 3300009094 | Ga0111539_10418179 | Ga0111539_104181792 | 105 |
| 970 | 3300009094 | Ga0111539_10429523 | Ga0111539_104295232 | 105 |
| 971 | 3300009094 | Ga0111539_10961665 | Ga0111539_109616651 | 105 |
| 972 | 3300009098 | Ga0105245_10745948 | Ga0105245_107459481 | 105 |
| 973 | 3300009098 | Ga0105245_11246612 | Ga0105245_112466122 | 105 |
| 974 | 3300009101 | Ga0105247_10187872 | Ga0105247_101878722 | 105 |
| 975 | 3300009101 | Ga0105247_10382702 | Ga0105247_103827022 | 105 |
| 976 | 3300009147 | Ga0114129_10002581 | Ga0114129_100025818 | 105 |
| 977 | 3300009147 | Ga0114129_10003487 | Ga0114129_1000348716 | 105 |
| 978 | 3300009147 | Ga0114129_10072430 | Ga0114129_100724304 | 105 |
| 979 | 3300009147 | Ga0114129_10516111 | Ga0114129_105161112 | 105 |
| 980 | 3300009148 | Ga0105243_10071523 | Ga0105243_100715232 | 105 |
| 981 | 3300009148 | Ga0105243_10077500 | Ga0105243_100775002 | 105 |
| 982 | 3300009174 | Ga0105241_10172527 | Ga0105241_101725272 | 105 |
| 983 | 3300009176 | Ga0105242_10845196 | Ga0105242_108451961 | 105 |
| 984 | 3300009176 | Ga0105242_11920094 | Ga0105242_119200942 | 105 |
| 985 | 3300009177 | Ga0105248_10003720 | Ga0105248_100037209 | 105 |
| 986 | 3300009177 | Ga0105248_10957965 | Ga0105248_109579651 | 105 |
| 987 | 3300009551 | Ga0105238_11741192 | Ga0105238_117411921 | 105 |
| 988 | 3300009553 | Ga0105249_10012111 | Ga0105249_100121112 | 105 |
| 989 | 3300009553 | Ga0105249_10484899 | Ga0105249_104848992 | 105 |
| 990 | 3300010375 | Ga0105239_11917209 | Ga0105239_119172092 | 105 |
| 991 | 3300013100 | Ga0157373_11173625 | Ga0157373_111736251 | 105 |
| 992 | 3300013296 | Ga0157374_11344532 | Ga0157374_113445321 | 105 |
| 993 | 3300013297 | Ga0157378_10364509 | Ga0157378_103645092 | 105 |
| 994 | 3300013297 | Ga0157378_12005042 | Ga0157378_120050422 | 105 |
| 995 | 3300013306 | Ga0163162_10075537 | Ga0163162_100755372 | 105 |
| 996 | 3300013308 | Ga0157375_10098970 | Ga0157375_100989702 | 105 |
| 997 | 3300013308 | Ga0157375_10246011 | Ga0157375_102460112 | 105 |
| 998 | 3300014325 | Ga0163163_10032681 | Ga0163163_100326812 | 105 |
| 999 | 3300014326 | Ga0157380_10002239 | Ga0157380_100022392 | 105 |
| 1000 | 3300014326 | Ga0157380_10046767 | Ga0157380_100467673 | 105 |
| 1001 | 3300014745 | Ga0157377_10000573 | Ga0157377_100005737 | 105 |
| 1002 | 3300014745 | Ga0157377_10192408 | Ga0157377_101924083 | 105 |
| 1003 | 3300014968 | Ga0157379_10005099 | Ga0157379_100050992 | 105 |
| 1004 | 3300014968 | Ga0157379_10369731 | Ga0157379_103697312 | 105 |
| 1005 | 3300014968 | Ga0157379_12215417 | Ga0157379_122154171 | 105 |
| 1006 | 3300014968 | Ga0157379_12439204 | Ga0157379_124392042 | 105 |
| 1007 | 3300017792 | Ga0163161_10215085 | Ga0163161_102150852 | 105 |
| 1008 | 3300017792 | Ga0163161_10690530 | Ga0163161_106905302 | 105 |
| 1009 | 3300025711 | Ga0207696_1000069 | Ga0207696_1000069109 | 105 |
| 1010 | 3300025899 | Ga0207642_10023405 | Ga0207642_100234053 | 105 |
| 1011 | 3300025900 | Ga0207710_10146178 | Ga0207710_101461782 | 105 |
| 1012 | 3300025901 | Ga0207688_10152762 | Ga0207688_101527622 | 105 |
| 1013 | 3300025903 | Ga0207680_10007410 | Ga0207680_100074103 | 105 |
| 1014 | 3300025907 | Ga0207645_10019333 | Ga0207645_100193334 | 105 |
| 1015 | 3300025908 | Ga0207643_10011560 | Ga0207643_100115603 | 105 |
| 1016 | 3300025912 | Ga0207707_10017238 | Ga0207707_100172387 | 105 |
| 1017 | 3300025912 | Ga0207707_10352986 | Ga0207707_103529862 | 105 |
| 1018 | 3300025917 | Ga0207660_10020538 | Ga0207660_100205383 | 105 |
| 1019 | 3300025917 | Ga0207660_10107625 | Ga0207660_101076252 | 105 |
| 1020 | 3300025918 | Ga0207662_10023021 | Ga0207662_100230212 | 105 |
| 1021 | 3300025918 | Ga0207662_10113852 | Ga0207662_101138522 | 105 |
| 1022 | 3300025918 | Ga0207662_10486512 | Ga0207662_104865121 | 105 |
| 1023 | 3300025920 | Ga0207649_10035110 | Ga0207649_100351102 | 105 |
| 1024 | 3300025920 | Ga0207649_10142705 | Ga0207649_101427051 | 105 |
| 1025 | 3300025920 | Ga0207649_10860208 | Ga0207649_108602081 | 105 |
| 1026 | 3300025921 | Ga0207652_10061066 | Ga0207652_100610662 | 105 |
| 1027 | 3300025921 | Ga0207652_10984970 | Ga0207652_109849702 | 105 |
| 1028 | 3300025923 | Ga0207681_11575731 | Ga0207681_115757312 | 105 |
| 1029 | 3300025924 | Ga0207694_11127558 | Ga0207694_111275582 | 105 |
| 1030 | 3300025925 | Ga0207650_10063279 | Ga0207650_100632793 | 105 |
| 1031 | 3300025925 | Ga0207650_11478566 | Ga0207650_114785662 | 105 |
| 1032 | 3300025926 | Ga0207659_10000855 | Ga0207659_100008552 | 105 |
| 1033 | 3300025927 | Ga0207687_10532577 | Ga0207687_105325771 | 105 |
| 1034 | 3300025927 | Ga0207687_10542716 | Ga0207687_105427162 | 105 |
| 1035 | 3300025931 | Ga0207644_10886574 | Ga0207644_108865742 | 105 |
| 1036 | 3300025932 | Ga0207690_10231659 | Ga0207690_102316592 | 105 |
| 1037 | 3300025932 | Ga0207690_10728854 | Ga0207690_107288542 | 105 |
| 1038 | 3300025933 | Ga0207706_10018342 | Ga0207706_100183424 | 105 |
| 1039 | 3300025933 | Ga0207706_10170095 | Ga0207706_101700952 | 105 |
| 1040 | 3300025935 | Ga0207709_10115227 | Ga0207709_101152272 | 105 |
| 1041 | 3300025936 | Ga0207670_10011250 | Ga0207670_100112502 | 105 |
| 1042 | 3300025936 | Ga0207670_10338893 | Ga0207670_103388932 | 105 |
| 1043 | 3300025937 | Ga0207669_10075740 | Ga0207669_100757403 | 105 |
| 1044 | 3300025938 | Ga0207704_10019200 | Ga0207704_100192003 | 105 |
| 1045 | 3300025940 | Ga0207691_10270868 | Ga0207691_102708682 | 105 |
| 1046 | 3300025941 | Ga0207711_10019102 | Ga0207711_100191024 | 105 |
| 1047 | 3300025942 | Ga0207689_10008645 | Ga0207689_100086452 | 105 |
| 1048 | 3300025942 | Ga0207689_10243733 | Ga0207689_102437332 | 105 |
| 1049 | 3300025942 | Ga0207689_10461316 | Ga0207689_104613162 | 105 |
| 1050 | 3300025945 | Ga0207679_10016535 | Ga0207679_100165352 | 105 |
| 1051 | 3300025945 | Ga0207679_11641116 | Ga0207679_116411161 | 105 |
| 1052 | 3300025949 | Ga0207667_10731544 | Ga0207667_107315442 | 105 |
| 1053 | 3300025960 | Ga0207651_10031275 | Ga0207651_100312752 | 105 |
| 1054 | 3300025972 | Ga0207668_10254718 | Ga0207668_102547182 | 105 |
| 1055 | 3300025981 | Ga0207640_10589952 | Ga0207640_105899522 | 105 |
| 1056 | 3300025981 | Ga0207640_11070477 | Ga0207640_110704772 | 105 |
| 1057 | 3300025986 | Ga0207658_10173765 | Ga0207658_101737652 | 105 |
| 1058 | 3300026023 | Ga0207677_10039225 | Ga0207677_100392252 | 105 |
| 1059 | 3300026035 | Ga0207703_10303736 | Ga0207703_103037362 | 105 |
| 1060 | 3300026067 | Ga0207678_10493584 | Ga0207678_104935841 | 105 |
| 1061 | 3300026067 | Ga0207678_11563075 | Ga0207678_115630751 | 105 |
| 1062 | 3300026075 | Ga0207708_10032419 | Ga0207708_100324192 | 105 |
| 1063 | 3300026075 | Ga0207708_10069706 | Ga0207708_100697063 | 105 |
| 1064 | 3300026088 | Ga0207641_10034075 | Ga0207641_100340753 | 105 |
| 1065 | 3300026089 | Ga0207648_10013598 | Ga0207648_100135983 | 105 |
| 1066 | 3300026089 | Ga0207648_10180849 | Ga0207648_101808492 | 105 |
| 1067 | 3300026095 | Ga0207676_10009829 | Ga0207676_100098292 | 105 |
| 1068 | 3300026116 | Ga0207674_10020693 | Ga0207674_100206935 | 105 |
| 1069 | 3300026118 | Ga0207675_100046452 | Ga0207675_1000464522 | 105 |
| 1070 | 3300026118 | Ga0207675_100907301 | Ga0207675_1009073011 | 105 |
| 1071 | 3300026121 | Ga0207683_10024420 | Ga0207683_100244204 | 105 |
| 1072 | 3300027364 | Ga0209967_1018162 | Ga0209967_10181622 | 105 |
| 1073 | 3300027395 | Ga0209996_1013832 | Ga0209996_10138322 | 105 |
| 1074 | 3300027462 | Ga0210000_1014248 | Ga0210000_10142482 | 105 |
| 1075 | 3300027526 | Ga0209968_1008141 | Ga0209968_10081412 | 105 |
| 1076 | 3300027543 | Ga0209999_1065856 | Ga0209999_10658562 | 105 |
| 1077 | 3300027614 | Ga0209970_1052455 | Ga0209970_10524552 | 105 |
| 1078 | 3300027665 | Ga0209983_1131258 | Ga0209983_11312581 | 105 |
| 1079 | 3300027666 | Ga0209282_1140900 | Ga0209282_11409003 | 105 |
| 1080 | 3300027682 | Ga0209971_1047697 | Ga0209971_10476971 | 105 |
| 1081 | 3300027682 | Ga0209971_1057339 | Ga0209971_10573392 | 105 |
| 1082 | 3300027876 | Ga0209974_10136706 | Ga0209974_101367062 | 105 |
| 1083 | 3300027876 | Ga0209974_10182486 | Ga0209974_101824861 | 105 |
| 1084 | 3300027907 | Ga0207428_10002594 | Ga0207428_100025946 | 105 |
| 1085 | 3300027907 | Ga0207428_10008559 | Ga0207428_100085592 | 105 |
| 1086 | 3300027907 | Ga0207428_10026062 | Ga0207428_100260624 | 105 |
| 1087 | 3300028379 | Ga0268266_10681221 | Ga0268266_106812212 | 105 |
| 1088 | 3300028380 | Ga0268265_10012234 | Ga0268265_100122343 | 105 |
| 1089 | 3300028380 | Ga0268265_10310624 | Ga0268265_103106242 | 105 |
| 1090 | 3300028380 | Ga0268265_10695224 | Ga0268265_106952242 | 105 |
| 1091 | 3300028380 | Ga0268265_11462624 | Ga0268265_114626242 | 105 |
| 1092 | 3300028381 | Ga0268264_10253325 | Ga0268264_102533252 | 105 |
| 1093 | 3300028381 | Ga0268264_11445173 | Ga0268264_114451732 | 105 |
| 1094 | 3300031240 | Ga0265320_10066967 | Ga0265320_100669672 | 105 |
| 1095 | 3300031456 | Ga0307513_10052634 | Ga0307513_100526344 | 105 |
| 1096 | 3300031507 | Ga0307509_10000189 | Ga0307509_1000018979 | 105 |
| 1097 | 3300031548 | Ga0307408_100053153 | Ga0307408_1000531532 | 105 |
| 1098 | 3300031548 | Ga0307408_100063217 | Ga0307408_1000632172 | 105 |
| 1099 | 3300031548 | Ga0307408_100790828 | Ga0307408_1007908282 | 105 |
| 1100 | 3300031616 | Ga0307508_10810086 | Ga0307508_108100861 | 105 |
| 1101 | 3300031665 | Ga0316575_10005089 | Ga0316575_100050893 | 105 |
| 1102 | 3300031665 | Ga0316575_10072461 | Ga0316575_100724611 | 105 |
| 1103 | 3300031727 | Ga0316576_10004557 | Ga0316576_100045575 | 105 |
| 1104 | 3300031727 | Ga0316576_10016705 | Ga0316576_100167053 | 105 |
| 1105 | 3300031727 | Ga0316576_10142303 | Ga0316576_101423032 | 105 |
| 1106 | 3300031728 | Ga0316578_10001021 | Ga0316578_100010214 | 105 |
| 1107 | 3300031728 | Ga0316578_10266878 | Ga0316578_102668782 | 105 |
| 1108 | 3300031728 | Ga0316578_10609616 | Ga0316578_106096161 | 105 |
| 1109 | 3300031731 | Ga0307405_10680904 | Ga0307405_106809042 | 105 |
| 1110 | 3300031731 | Ga0307405_10794564 | Ga0307405_107945641 | 105 |
| 1111 | 3300031731 | Ga0307405_10948993 | Ga0307405_109489931 | 105 |
| 1112 | 3300031731 | Ga0307405_11886814 | Ga0307405_118868142 | 105 |
| 1113 | 3300031733 | Ga0316577_10300597 | Ga0316577_103005971 | 105 |
| 1114 | 3300031824 | Ga0307413_10504397 | Ga0307413_105043972 | 105 |
| 1115 | 3300031824 | Ga0307413_11159904 | Ga0307413_111599041 | 105 |
| 1116 | 3300031852 | Ga0307410_10065142 | Ga0307410_100651421 | 105 |
| 1117 | 3300031852 | Ga0307410_10917774 | Ga0307410_109177742 | 105 |
| 1118 | 3300031852 | Ga0307410_11140255 | Ga0307410_111402552 | 105 |
| 1119 | 3300031901 | Ga0307406_10166578 | Ga0307406_101665782 | 105 |
| 1120 | 3300031903 | Ga0307407_10636375 | Ga0307407_106363751 | 105 |
| 1121 | 3300031995 | Ga0307409_100508564 | Ga0307409_1005085642 | 105 |
| 1122 | 3300031995 | Ga0307409_101768807 | Ga0307409_1017688072 | 105 |
| 1123 | 3300031995 | Ga0307409_101778524 | Ga0307409_1017785242 | 105 |
| 1124 | 3300032002 | Ga0307416_100278174 | Ga0307416_1002781742 | 105 |
| 1125 | 3300032002 | Ga0307416_100613069 | Ga0307416_1006130691 | 105 |
| 1126 | 3300032002 | Ga0307416_101648148 | Ga0307416_1016481481 | 105 |
| 1127 | 3300032004 | Ga0307414_10292001 | Ga0307414_102920012 | 105 |
| 1128 | 3300032005 | Ga0307411_10112106 | Ga0307411_101121062 | 105 |
| 1129 | 3300032005 | Ga0307411_10335631 | Ga0307411_103356312 | 105 |
| 1130 | 3300032005 | Ga0307411_10411779 | Ga0307411_104117792 | 105 |
| 1131 | 3300032005 | Ga0307411_11332163 | Ga0307411_113321631 | 105 |
| 1132 | 3300032126 | Ga0307415_100357894 | Ga0307415_1003578941 | 105 |
| 1133 | 3300032126 | Ga0307415_100748602 | Ga0307415_1007486022 | 105 |
| 1134 | 3300032137 | Ga0316585_10030383 | Ga0316585_100303832 | 105 |
| 1135 | 3300032139 | Ga0316580_10004948 | Ga0316580_100049483 | 105 |
| 1136 | 3300034818 | Ga0373950_0069518 | Ga0373950_0069518_286_603 | 105 |
| 1137 | 3300034819 | Ga0373958_0016754 | Ga0373958_0016754_127_444 | 105 |
| 1138 | 3300034819 | Ga0373958_0122642 | Ga0373958_0122642_78_407 | 105 |
| 1139 | 3300034957 | Ga0373938_0082633 | Ga0373938_0082633_205_522 | 105 |
| 1140 | 3300035084 | Ga0373928_0013841 | Ga0373928_0013841_918_1235 | 105 |
| 1141 | 3300035085 | Ga0373929_0099239 | Ga0373929_0099239_74_391 | 105 |
| 1142 | 3300035086 | Ga0373934_0185130 | Ga0373934_0185130_84_401 | 105 |
| 1143 | 3300035088 | Ga0373940_0071490 | Ga0373940_0071490_170_487 | 105 |
| 1144 | 3300035090 | Ga0373949_0039405 | Ga0373949_0039405_95_412 | 105 |
| 1145 | 3300035091 | Ga0373951_0082305 | Ga0373951_0082305_283_600 | 105 |
| 1146 | 3300035112 | Ga0373932_0113214 | Ga0373932_0113214_252_569 | 105 |
| 1147 | 3300035114 | Ga0373939_0047646 | Ga0373939_0047646_481_798 | 105 |
| 1148 | 3300035115 | Ga0373941_0060891 | Ga0373941_0060891_609_926 | 105 |
| 1149 | 3300035207 | Ga0373942_0189103 | Ga0373942_0189103_321_638 | 105 |
| 1150 | 3300035398 | Ga0316574_0000008 | Ga0316574_0000008_4849_5166 | 105 |
| 1151 | 3300035398 | Ga0316574_0004042 | Ga0316574_0004042_5773_6102 | 105 |
| 1152 | 3300035398 | Ga0316574_0036525 | Ga0316574_0036525_1421_1738 | 105 |
| 1153 | 3300035398 | Ga0316574_0077564 | Ga0316574_0077564_147_476 | 105 |
| 1154 | 3300035398 | Ga0316574_0335484 | Ga0316574_0335484_147_476 | 105 |
| 1155 | 3300035398 | Ga0316574_0481243 | Ga0316574_0481243_193_510 | 105 |
| 1156 | 3300035398 | Ga0316574_1000376 | Ga0316574_1000376_115_444 | 105 |
| 1157 | 3300035691 | Ga0373931_0525010 | Ga0373931_0525010_325_642 | 105 |
| 1158 | 3300036401 | Ga0373937_0016775 | Ga0373937_0016775_4517_4834 | 105 |
| 1159 | 3300036647 | Ga0316582_0014377 | Ga0316582_0014377_885_1202 | 105 |
| 1160 | 3300036712 | Ga0316584_0003999 | Ga0316584_0003999_3320_3637 | 105 |
| 1161 | 3300036712 | Ga0316584_0032987 | Ga0316584_0032987_2053_2370 | 105 |
| 1162 | 3300036712 | Ga0316584_0115800 | Ga0316584_0115800_148_477 | 105 |
| 1163 | 3300036712 | Ga0316584_0708044 | Ga0316584_0708044_278_607 | 105 |
| 1164 | 3300037068 | Ga0373925_1020664 | Ga0373925_1020664_291_608 | 105 |
| 1165 | 3300037471 | Ga0395905_0745292 | Ga0395905_0745292_69_386 | 105 |
| 1166 | 3300041404 | Ga0439436_0258204 | Ga0439436_0258204_160_477 | 105 |
| 1167 | 3300041406 | Ga0439439_0192470 | Ga0439439_0192470_165_482 | 105 |
| 1168 | 3300041407 | Ga0439447_142854 | Ga0439447_142854_202_519 | 105 |
| 1169 | 3300041413 | Ga0439465_0368206 | Ga0439465_0368206_139_456 | 105 |
| 1170 | 3300041496 | Ga0451839_1008795 | Ga0451839_1008795_740_1057 | 105 |
| 1171 | 3300041498 | Ga0451841_0425714 | Ga0451841_0425714_292_609 | 105 |
| 1172 | 3300041502 | Ga0451846_61009 | Ga0451846_61009_127_444 | 105 |
| 1173 | 3300041506 | Ga0451850_18457 | Ga0451850_18457_238_555 | 105 |
| 1174 | 3300041507 | Ga0451851_0921106 | Ga0451851_0921106_1151_1468 | 105 |
| 1175 | 3300041512 | Ga0451853_3268539 | Ga0451853_3268539_196_513 | 105 |
| 1176 | 3300041907 | Ga0452268_41072 | Ga0452268_41072_168_485 | 105 |
| 1177 | 3300041916 | Ga0452271_32386 | Ga0452271_32386_126_443 | 105 |
| 1178 | 3300042002 | Ga0439442_152000 | Ga0439442_152000_152_469 | 105 |
| 1179 | 3300042005 | Ga0439448_0213124 | Ga0439448_0213124_73_390 | 105 |
| 1180 | 3300042007 | Ga0439449_0098130 | Ga0439449_0098130_193_510 | 105 |
| 1181 | 3300042009 | Ga0439451_135894 | Ga0439451_135894_33_350 | 105 |
| 1182 | 3300042014 | Ga0439457_025299 | Ga0439457_025299_614_931 | 105 |
| 1183 | 3300042015 | Ga0439462_0138330 | Ga0439462_0138330_263_580 | 105 |
| 1184 | 3300042016 | Ga0439463_106383 | Ga0439463_106383_263_580 | 105 |
| 1185 | 3300042118 | Ga0450914_015638 | Ga0450914_015638_261_578 | 105 |
| 1186 | 3300042125 | Ga0450923_144706 | Ga0450923_144706_176_505 | 105 |
| 1187 | 3300042126 | Ga0450888_015764 | Ga0450888_015764_451_768 | 105 |
| 1188 | 3300042128 | Ga0450897_018552 | Ga0450897_018552_98_415 | 105 |
| 1189 | 3300042130 | Ga0450892_039091 | Ga0450892_039091_119_436 | 105 |
| 1190 | 3300042131 | Ga0450894_021638 | Ga0450894_021638_430_747 | 105 |
| 1191 | 3300042132 | Ga0450895_007763 | Ga0450895_007763_194_511 | 105 |
| 1192 | 3300042136 | Ga0450900_050043 | Ga0450900_050043_174_491 | 105 |
| 1193 | 3300042145 | Ga0450906_018003 | Ga0450906_018003_819_1136 | 105 |
| 1194 | 3300042156 | Ga0439446_0263132 | Ga0439446_0263132_123_440 | 105 |
| 1195 | 3300042157 | Ga0439458_0054890 | Ga0439458_0054890_259_576 | 105 |
| 1196 | 3300042184 | Ga0450908_059215 | Ga0450908_059215_257_574 | 105 |
| 1197 | 3300042437 | Ga0439444_0032882 | Ga0439444_0032882_545_862 | 105 |
| 1198 | 3300042438 | Ga0439459_0234918 | Ga0439459_0234918_113_430 | 105 |
| 1199 | 3300042439 | Ga0439464_0219560 | Ga0439464_0219560_223_540 | 105 |
| 1200 | 3300042461 | Ga0439460_0258504 | Ga0439460_0258504_54_371 | 105 |
| 1201 | 3300042531 | Ga0450918_066275 | Ga0450918_066275_117_434 | 105 |
| 1202 | 3300042532 | Ga0450893_0098607 | Ga0450893_0098607_215_532 | 105 |
| 1203 | 3300042532 | Ga0450893_0126900 | Ga0450893_0126900_99_428 | 105 |
| 1204 | 3300042876 | Ga0451577_0026508 | Ga0451577_0026508_2357_2674 | 105 |
| 1205 | 3300042876 | Ga0451577_0071068 | Ga0451577_0071068_124_513 | 105 |
| 1206 | 3300042993 | Ga0439440_0023912 | Ga0439440_0023912_191_508 | 105 |
| 1207 | 3300044712 | Ga0453684_0100243 | Ga0453684_0100243_1109_1426 | 105 |
| 1208 | 3300044712 | Ga0453684_0710947 | Ga0453684_0710947_26_415 | 105 |
| 1209 | 3300045051 | Ga0451576_0043483 | Ga0451576_0043483_3425_3742 | 105 |
| 1210 | 3300045051 | Ga0451576_0156108 | Ga0451576_0156108_731_1048 | 105 |
| 1211 | 3300045051 | Ga0451576_1150502 | Ga0451576_1150502_284_601 | 105 |
| 1212 | 3300046460 | Ga0495638_0090616 | Ga0495638_0090616_1097_1414 | 105 |
| 1213 | 3300046471 | Ga0495650_0004549 | Ga0495650_0004549_6745_7062 | 105 |
| 1214 | 3300046475 | Ga0495639_0403790 | Ga0495639_0403790_290_607 | 105 |
| 1215 | 3300046492 | Ga0495585_0251056 | Ga0495585_0251056_484_801 | 105 |
| 1216 | 3300046519 | Ga0495632_0037117 | Ga0495632_0037117_2111_2428 | 105 |
| 1217 | 3300046519 | Ga0495632_0268102 | Ga0495632_0268102_44_361 | 105 |
| 1218 | 3300046526 | Ga0495666_0231105 | Ga0495666_0231105_401_718 | 105 |
| 1219 | 3300046530 | Ga0495654_0411180 | Ga0495654_0411180_140_457 | 105 |
| 1220 | 3300046535 | Ga0495586_0092668 | Ga0495586_0092668_431_748 | 105 |
| 1221 | 3300046535 | Ga0495586_0445947 | Ga0495586_0445947_349_666 | 105 |
| 1222 | 3300046616 | Ga0495668_0136290 | Ga0495668_0136290_714_1031 | 105 |
| 1223 | 3300046642 | Ga0495634_0279558 | Ga0495634_0279558_285_602 | 105 |
| 1224 | 3300046660 | Ga0495625_0129979 | Ga0495625_0129979_411_728 | 105 |
| 1225 | 3300046660 | Ga0495625_0178817 | Ga0495625_0178817_376_693 | 105 |
| 1226 | 3300046660 | Ga0495625_0499700 | Ga0495625_0499700_369_686 | 105 |
| 1227 | 3300046675 | Ga0495657_0406019 | Ga0495657_0406019_157_474 | 105 |
| 1228 | 3300046683 | Ga0495658_0052808 | Ga0495658_0052808_1463_1780 | 105 |
| 1229 | 3300046684 | Ga0495669_0435268 | Ga0495669_0435268_256_573 | 105 |
| 1230 | 3300046690 | Ga0495624_0384492 | Ga0495624_0384492_338_655 | 105 |
| 1231 | 3300047320 | Ga0495672_0069285 | Ga0495672_0069285_289_606 | 105 |
| 1232 | 3300047322 | Ga0495680_0242678 | Ga0495680_0242678_18_335 | 105 |
| 1233 | 3300048091 | Ga0495626_0088816 | Ga0495626_0088816_472_789 | 105 |
| 1234 | 3300048909 | Ga0496106_0422504 | Ga0496106_0422504_352_669 | 105 |
| 1235 | 3300048910 | Ga0496107_0553541 | Ga0496107_0553541_168_485 | 105 |
| 1236 | 3300048914 | Ga0496111_0042076 | Ga0496111_0042076_132_449 | 105 |
| 1237 | 3300048915 | Ga0496112_0082474 | Ga0496112_0082474_926_1243 | 105 |
| 1238 | 3300048916 | Ga0496113_0146811 | Ga0496113_0146811_554_871 | 105 |
| 1239 | 3300048917 | Ga0496114_0149762 | Ga0496114_0149762_16_333 | 105 |
| 1240 | 3300048917 | Ga0496114_0277221 | Ga0496114_0277221_372_689 | 105 |
| 1241 | 3300049127 | Ga0501306_019749 | Ga0501306_019749_48_365 | 105 |
| 1242 | 3300049514 | Ga0501291_074711 | Ga0501291_074711_137_454 | 105 |
| 1243 | 3300049515 | Ga0501292_063228 | Ga0501292_063228_124_441 | 105 |
| 1244 | 3300049517 | Ga0501294_016082 | Ga0501294_016082_207_524 | 105 |
| 1245 | 3300049518 | Ga0501295_199824 | Ga0501295_199824_167_484 | 105 |
| 1246 | 3300049522 | Ga0501299_053130 | Ga0501299_053130_465_782 | 105 |
| 1247 | 3300049522 | Ga0501299_081347 | Ga0501299_081347_162_479 | 105 |
| 1248 | 3300049523 | Ga0501300_034043 | Ga0501300_034043_13_330 | 105 |
| 1249 | 3300049524 | Ga0501301_008534 | Ga0501301_008534_308_625 | 105 |
| 1250 | 3300049569 | Ga0501032_0401060 | Ga0501032_0401060_464_793 | 105 |
| 1251 | 3300049571 | Ga0501034_0136286 | Ga0501034_0136286_231_548 | 105 |
| 1252 | 3300049572 | Ga0501036_0444443 | Ga0501036_0444443_380_709 | 105 |
| 1253 | 3300049575 | Ga0501039_1048478 | Ga0501039_1048478_284_613 | 105 |
| 1254 | 3300049575 | Ga0501039_1218041 | Ga0501039_1218041_56_385 | 105 |
| 1255 | 3300049576 | Ga0501040_0624474 | Ga0501040_0624474_281_610 | 105 |
| 1256 | 3300049577 | Ga0501041_0177185 | Ga0501041_0177185_727_1056 | 105 |
| 1257 | 3300049577 | Ga0501041_1066210 | Ga0501041_1066210_154_471 | 105 |
| 1258 | 3300049580 | Ga0501046_0487364 | Ga0501046_0487364_478_795 | 105 |
| 1259 | 3300049581 | Ga0501047_0339511 | Ga0501047_0339511_285_602 | 105 |
| 1260 | 3300049581 | Ga0501047_1054888 | Ga0501047_1054888_164_481 | 105 |
| 1261 | 3300049582 | Ga0501048_1169945 | Ga0501048_1169945_15_332 | 105 |
| 1262 | 3300049587 | Ga0501071_0152726 | Ga0501071_0152726_684_1013 | 105 |
| 1263 | 3300049587 | Ga0501071_0213057 | Ga0501071_0213057_960_1277 | 105 |
| 1264 | 3300049589 | Ga0501073_0735081 | Ga0501073_0735081_231_560 | 105 |
| 1265 | 3300049590 | Ga0501074_0414237 | Ga0501074_0414237_408_737 | 105 |
| 1266 | 3300049590 | Ga0501074_0666513 | Ga0501074_0666513_297_614 | 105 |
| 1267 | 3300049592 | Ga0501076_0668716 | Ga0501076_0668716_483_800 | 105 |
| 1268 | 3300049660 | Ga0501216_028415 | Ga0501216_028415_137_454 | 105 |
| 1269 | 3300049661 | Ga0501217_067008 | Ga0501217_067008_393_710 | 105 |
| 1270 | 3300049668 | Ga0501233_080615 | Ga0501233_080615_127_444 | 105 |
| 1271 | 3300049677 | Ga0501247_089256 | Ga0501247_089256_175_492 | 105 |
| 1272 | 3300049679 | Ga0501249_064476 | Ga0501249_064476_415_732 | 105 |
| 1273 | 3300049683 | Ga0501253_058896 | Ga0501253_058896_78_395 | 105 |
| 1274 | 3300049703 | Ga0501219_016367 | Ga0501219_016367_204_521 | 105 |
| 1275 | 3300049705 | Ga0501225_0041457 | Ga0501225_0041457_457_774 | 105 |
| 1276 | 3300049741 | Ga0501079_0371358 | Ga0501079_0371358_86_415 | 105 |
| 1277 | 3300049741 | Ga0501079_1470233 | Ga0501079_1470233_36_353 | 105 |
| 1278 | 3300049742 | Ga0501080_0140864 | Ga0501080_0140864_1806_2135 | 105 |
| 1279 | 3300049763 | Ga0501266_014280 | Ga0501266_014280_143_460 | 105 |
| 1280 | 3300049767 | Ga0501270_027915 | Ga0501270_027915_218_535 | 105 |
| 1281 | 3300049774 | Ga0501278_014263 | Ga0501278_014263_179_496 | 105 |
| 1282 | 3300049822 | Ga0501035_0330726 | Ga0501035_0330726_757_1086 | 105 |
| 1283 | 3300049824 | Ga0501045_1284783 | Ga0501045_1284783_36_365 | 105 |
| 1284 | 3300049851 | Ga0501212_037303 | Ga0501212_037303_331_648 | 105 |
| 1285 | 3300050507 | nmdc:mga05p37_381673_c1 | nmdc:mga05p37_381673_c1_702_1019 | 105 |
| 1286 | 3300050507 | nmdc:mga05p37_662_c1 | nmdc:mga05p37_662_c1_19739_20056 | 105 |
| 1287 | 3300050507 | nmdc:mga05p37_8136_c1 | nmdc:mga05p37_8136_c1_7437_7754 | 105 |
| 1288 | 3300050508 | nmdc:mga09592_2530_c1 | nmdc:mga09592_2530_c1_3145_3462 | 105 |
| 1289 | 3300050508 | nmdc:mga09592_47268_c1 | nmdc:mga09592_47268_c1_2615_2944 | 105 |
| 1290 | 3300050508 | nmdc:mga09592_513_c1 | nmdc:mga09592_513_c1_1638_1955 | 105 |
| 1291 | 3300050509 | nmdc:mga0qj67_107101_c1 | nmdc:mga0qj67_107101_c1_127_456 | 105 |
| 1292 | 3300050509 | nmdc:mga0qj67_11050_c1 | nmdc:mga0qj67_11050_c1_1462_1779 | 105 |
| 1293 | 3300050509 | nmdc:mga0qj67_14416_c1 | nmdc:mga0qj67_14416_c1_5110_5427 | 105 |
| 1294 | 3300050509 | nmdc:mga0qj67_251514_c1 | nmdc:mga0qj67_251514_c1_1058_1375 | 105 |
| 1295 | 3300050509 | nmdc:mga0qj67_32544_c1 | nmdc:mga0qj67_32544_c1_2532_2849 | 105 |
| 1296 | 3300050509 | nmdc:mga0qj67_51822_c1 | nmdc:mga0qj67_51822_c1_1171_1488 | 105 |
| 1297 | 3300050509 | nmdc:mga0qj67_723954_c1 | nmdc:mga0qj67_723954_c1_284_601 | 105 |
| 1298 | 3300050510 | nmdc:mga06r32_19490_c1 | nmdc:mga06r32_19490_c1_2962_3279 | 105 |
| 1299 | 3300050510 | nmdc:mga06r32_2943_c1 | nmdc:mga06r32_2943_c1_8298_8615 | 105 |
| 1300 | 3300050510 | nmdc:mga06r32_772315_c1 | nmdc:mga06r32_772315_c1_204_521 | 105 |
| 1301 | 3300050510 | nmdc:mga06r32_93_c1 | nmdc:mga06r32_93_c1_13390_13707 | 105 |
| 1302 | 3300050511 | nmdc:mga08y16_11335_c1 | nmdc:mga08y16_11335_c1_5841_6170 | 105 |
| 1303 | 3300050511 | nmdc:mga08y16_30678_c1 | nmdc:mga08y16_30678_c1_2285_2602 | 105 |
| 1304 | 3300050511 | nmdc:mga08y16_541403_c1 | nmdc:mga08y16_541403_c1_661_990 | 105 |
| 1305 | 3300050512 | nmdc:mga0n895_1211928_c1 | nmdc:mga0n895_1211928_c1_371_688 | 105 |
| 1306 | 3300050512 | nmdc:mga0n895_198762_c1 | nmdc:mga0n895_198762_c1_853_1170 | 105 |
| 1307 | 3300050513 | nmdc:mga0rr50_262247_c1 | nmdc:mga0rr50_262247_c1_486_815 | 105 |
| 1308 | 3300053079 | Ga0500610_0347206 | Ga0500610_0347206_257_574 | 105 |
| 1309 | 3300053087 | Ga0500643_085723 | Ga0500643_085723_437_754 | 105 |
| 1310 | 3300053088 | Ga0500644_0218906 | Ga0500644_0218906_244_561 | 105 |
| 1311 | 3300053092 | Ga0500583_0144740 | Ga0500583_0144740_101_418 | 105 |
| 1312 | 3300053092 | Ga0500583_0188012 | Ga0500583_0188012_290_607 | 105 |
| 1313 | 3300053096 | Ga0500641_0002198 | Ga0500641_0002198_3097_3426 | 105 |
| 1314 | 3300053098 | Ga0500650_0032253 | Ga0500650_0032253_627_944 | 105 |
| 1315 | 3300053104 | Ga0500556_0042674 | Ga0500556_0042674_573_890 | 105 |
| 1316 | 3300053108 | Ga0500562_114712 | Ga0500562_114712_216_533 | 105 |
| 1317 | 3300053124 | Ga0500617_144670 | Ga0500617_144670_148_465 | 105 |
| 1318 | 3300053130 | Ga0500642_0152836 | Ga0500642_0152836_541_858 | 105 |
| 1319 | 3300053134 | Ga0500658_0055102 | Ga0500658_0055102_655_972 | 105 |
| 1320 | 3300053134 | Ga0500658_0126395 | Ga0500658_0126395_318_635 | 105 |
| 1321 | 3300053139 | Ga0500568_0038663 | Ga0500568_0038663_705_1040 | 105 |
| 1322 | 3300053139 | Ga0500568_0073441 | Ga0500568_0073441_101_418 | 105 |
| 1323 | 3300053142 | Ga0500577_0211746 | Ga0500577_0211746_388_705 | 105 |
| 1324 | 3300053146 | Ga0500588_0000825 | Ga0500588_0000825_3153_3470 | 105 |
| 1325 | 3300053146 | Ga0500588_0037797 | Ga0500588_0037797_444_761 | 105 |
| 1326 | 3300053147 | Ga0500589_063307 | Ga0500589_063307_859_1176 | 105 |
| 1327 | 3300053147 | Ga0500589_187897 | Ga0500589_187897_187_504 | 105 |
| 1328 | 3300053151 | Ga0500604_0069821 | Ga0500604_0069821_354_671 | 105 |
| 1329 | 3300053156 | Ga0500622_0000318 | Ga0500622_0000318_28322_28639 | 105 |
| 1330 | 3300053156 | Ga0500622_0003146 | Ga0500622_0003146_931_1248 | 105 |
| 1331 | 3300053158 | Ga0500627_0064483 | Ga0500627_0064483_65_382 | 105 |
| 1332 | 3300053158 | Ga0500627_0194676 | Ga0500627_0194676_181_498 | 105 |
| 1333 | 3300053727 | Ga0500611_120234 | Ga0500611_120234_308_625 | 105 |
| 1334 | 3300054114 | Ga0501084_1838453 | Ga0501084_1838453_138_455 | 105 |
| 1335 | 3300061734 | Ga0530510_0301529 | Ga0530510_0301529_854_1183 | 105 |
| 1336 | 3300000546 | LJNas_1005235 | LJNas_10052352 | 106 |
| 1337 | 3300001977 | JGI24746J21847_1038090 | JGI24746J21847_10380901 | 106 |
| 1338 | 3300002239 | JGI24034J26672_10044462 | JGI24034J26672_100444621 | 106 |
| 1339 | 3300004798 | Ga0058859_11646593 | Ga0058859_116465932 | 106 |
| 1340 | 3300004801 | Ga0058860_11393278 | Ga0058860_113932781 | 106 |
| 1341 | 3300005288 | Ga0065714_10207824 | Ga0065714_102078241 | 106 |
| 1342 | 3300005290 | Ga0065712_10216368 | Ga0065712_102163682 | 106 |
| 1343 | 3300005295 | Ga0065707_10067934 | Ga0065707_100679341 | 106 |
| 1344 | 3300005327 | Ga0070658_10830157 | Ga0070658_108301572 | 106 |
| 1345 | 3300005334 | Ga0068869_100610042 | Ga0068869_1006100421 | 106 |
| 1346 | 3300005347 | Ga0070668_100149836 | Ga0070668_1001498362 | 106 |
| 1347 | 3300005347 | Ga0070668_101163669 | Ga0070668_1011636692 | 106 |
| 1348 | 3300005353 | Ga0070669_100293528 | Ga0070669_1002935282 | 106 |
| 1349 | 3300005355 | Ga0070671_100253518 | Ga0070671_1002535182 | 106 |
| 1350 | 3300005364 | Ga0070673_100112326 | Ga0070673_1001123263 | 106 |
| 1351 | 3300005364 | Ga0070673_100921735 | Ga0070673_1009217352 | 106 |
| 1352 | 3300005365 | Ga0070688_100224277 | Ga0070688_1002242771 | 106 |
| 1353 | 3300005366 | Ga0070659_100804647 | Ga0070659_1008046472 | 106 |
| 1354 | 3300005436 | Ga0070713_100025052 | Ga0070713_1000250522 | 106 |
| 1355 | 3300005439 | Ga0070711_100056066 | Ga0070711_1000560662 | 106 |
| 1356 | 3300005440 | Ga0070705_100088221 | Ga0070705_1000882212 | 106 |
| 1357 | 3300005444 | Ga0070694_100442600 | Ga0070694_1004426001 | 106 |
| 1358 | 3300005456 | Ga0070678_100346570 | Ga0070678_1003465701 | 106 |
| 1359 | 3300005458 | Ga0070681_10101137 | Ga0070681_101011372 | 106 |
| 1360 | 3300005458 | Ga0070681_10421308 | Ga0070681_104213082 | 106 |
| 1361 | 3300005545 | Ga0070695_100821432 | Ga0070695_1008214321 | 106 |
| 1362 | 3300005546 | Ga0070696_100000793 | Ga0070696_1000007939 | 106 |
| 1363 | 3300005546 | Ga0070696_100768358 | Ga0070696_1007683581 | 106 |
| 1364 | 3300005547 | Ga0070693_100361855 | Ga0070693_1003618552 | 106 |
| 1365 | 3300005549 | Ga0070704_100016184 | Ga0070704_1000161843 | 106 |
| 1366 | 3300005549 | Ga0070704_100326746 | Ga0070704_1003267462 | 106 |
| 1367 | 3300005563 | Ga0068855_100308078 | Ga0068855_1003080782 | 106 |
| 1368 | 3300005577 | Ga0068857_100156726 | Ga0068857_1001567262 | 106 |
| 1369 | 3300005617 | Ga0068859_102050216 | Ga0068859_1020502162 | 106 |
| 1370 | 3300005719 | Ga0068861_100485387 | Ga0068861_1004853872 | 106 |
| 1371 | 3300005844 | Ga0068862_100823930 | Ga0068862_1008239302 | 106 |
| 1372 | 3300006163 | Ga0070715_10115736 | Ga0070715_101157361 | 106 |
| 1373 | 3300006844 | Ga0075428_100001284 | Ga0075428_1000012844 | 106 |
| 1374 | 3300006846 | Ga0075430_100775905 | Ga0075430_1007759051 | 106 |
| 1375 | 3300006852 | Ga0075433_10046168 | Ga0075433_100461683 | 106 |
| 1376 | 3300006871 | Ga0075434_100000591 | Ga0075434_10000059117 | 106 |
| 1377 | 3300006880 | Ga0075429_101724499 | Ga0075429_1017244991 | 106 |
| 1378 | 3300006931 | Ga0097620_102050421 | Ga0097620_1020504212 | 106 |
| 1379 | 3300007265 | Ga0099794_10051385 | Ga0099794_100513851 | 106 |
| 1380 | 3300007265 | Ga0099794_10163348 | Ga0099794_101633482 | 106 |
| 1381 | 3300007788 | Ga0099795_10000810 | Ga0099795_100008102 | 106 |
| 1382 | 3300009036 | Ga0105244_10163870 | Ga0105244_101638701 | 106 |
| 1383 | 3300009094 | Ga0111539_10007423 | Ga0111539_1000742310 | 106 |
| 1384 | 3300009553 | Ga0105249_11614564 | Ga0105249_116145642 | 106 |
| 1385 | 3300010159 | Ga0099796_10000821 | Ga0099796_100008214 | 106 |
| 1386 | 3300010159 | Ga0099796_10071209 | Ga0099796_100712092 | 106 |
| 1387 | 3300013306 | Ga0163162_10915917 | Ga0163162_109159171 | 106 |
| 1388 | 3300014326 | Ga0157380_10006793 | Ga0157380_100067934 | 106 |
| 1389 | 3300014326 | Ga0157380_10030001 | Ga0157380_100300013 | 106 |
| 1390 | 3300014326 | Ga0157380_11366724 | Ga0157380_113667242 | 106 |
| 1391 | 3300024227 | Ga0228598_1040600 | Ga0228598_10406002 | 106 |
| 1392 | 3300025901 | Ga0207688_10694336 | Ga0207688_106943361 | 106 |
| 1393 | 3300025905 | Ga0207685_10731805 | Ga0207685_107318051 | 106 |
| 1394 | 3300025908 | Ga0207643_10112736 | Ga0207643_101127363 | 106 |
| 1395 | 3300025913 | Ga0207695_10169571 | Ga0207695_101695712 | 106 |
| 1396 | 3300025916 | Ga0207663_10156363 | Ga0207663_101563632 | 106 |
| 1397 | 3300025923 | Ga0207681_10227255 | Ga0207681_102272552 | 106 |
| 1398 | 3300025926 | Ga0207659_10138710 | Ga0207659_101387102 | 106 |
| 1399 | 3300025928 | Ga0207700_10053646 | Ga0207700_100536463 | 106 |
| 1400 | 3300025939 | Ga0207665_10326527 | Ga0207665_103265272 | 106 |
| 1401 | 3300025940 | Ga0207691_10073207 | Ga0207691_100732073 | 106 |
| 1402 | 3300025949 | Ga0207667_10642504 | Ga0207667_106425042 | 106 |
| 1403 | 3300025960 | Ga0207651_10148309 | Ga0207651_101483092 | 106 |
| 1404 | 3300025972 | Ga0207668_11433202 | Ga0207668_114332021 | 106 |
| 1405 | 3300026116 | Ga0207674_10315664 | Ga0207674_103156642 | 106 |
| 1406 | 3300026118 | Ga0207675_100378465 | Ga0207675_1003784652 | 106 |
| 1407 | 3300027395 | Ga0209996_1026910 | Ga0209996_10269102 | 106 |
| 1408 | 3300027512 | Ga0209179_1001862 | Ga0209179_10018622 | 106 |
| 1409 | 3300027671 | Ga0209588_1058651 | Ga0209588_10586512 | 106 |
| 1410 | 3300027695 | Ga0209966_1056340 | Ga0209966_10563401 | 106 |
| 1411 | 3300027717 | Ga0209998_10002265 | Ga0209998_100022654 | 106 |
| 1412 | 3300027876 | Ga0209974_10123172 | Ga0209974_101231722 | 106 |
| 1413 | 3300027907 | Ga0207428_10006431 | Ga0207428_100064314 | 106 |
| 1414 | 3300028016 | Ga0265354_1002018 | Ga0265354_10020182 | 106 |
| 1415 | 3300028017 | Ga0265356_1017450 | Ga0265356_10174502 | 106 |
| 1416 | 3300028017 | Ga0265356_1029308 | Ga0265356_10293081 | 106 |
| 1417 | 3300028023 | Ga0265357_1000774 | Ga0265357_10007742 | 106 |
| 1418 | 3300028036 | Ga0265355_1001702 | Ga0265355_10017022 | 106 |
| 1419 | 3300028800 | Ga0265338_10421732 | Ga0265338_104217322 | 106 |
| 1420 | 3300030760 | Ga0265762_1150451 | Ga0265762_11504511 | 106 |
| 1421 | 3300030878 | Ga0265770_1001311 | Ga0265770_10013113 | 106 |
| 1422 | 3300030879 | Ga0265765_1032431 | Ga0265765_10324312 | 106 |
| 1423 | 3300031010 | Ga0265771_1010170 | Ga0265771_10101702 | 106 |
| 1424 | 3300031018 | Ga0265773_1003947 | Ga0265773_10039472 | 106 |
| 1425 | 3300031090 | Ga0265760_10001990 | Ga0265760_100019903 | 106 |
| 1426 | 3300031090 | Ga0265760_10016230 | Ga0265760_100162302 | 106 |
| 1427 | 3300031344 | Ga0265316_10169581 | Ga0265316_101695812 | 106 |
| 1428 | 3300031548 | Ga0307408_101432044 | Ga0307408_1014320442 | 106 |
| 1429 | 3300031595 | Ga0265313_10047515 | Ga0265313_100475151 | 106 |
| 1430 | 3300031730 | Ga0307516_10000423 | Ga0307516_1000042337 | 106 |
| 1431 | 3300031731 | Ga0307405_10024050 | Ga0307405_100240503 | 106 |
| 1432 | 3300031824 | Ga0307413_10229377 | Ga0307413_102293772 | 106 |
| 1433 | 3300031852 | Ga0307410_10063447 | Ga0307410_100634472 | 106 |
| 1434 | 3300031901 | Ga0307406_10723069 | Ga0307406_107230692 | 106 |
| 1435 | 3300031903 | Ga0307407_10260526 | Ga0307407_102605261 | 106 |
| 1436 | 3300031911 | Ga0307412_10214112 | Ga0307412_102141122 | 106 |
| 1437 | 3300031911 | Ga0307412_12083520 | Ga0307412_120835201 | 106 |
| 1438 | 3300031995 | Ga0307409_100185402 | Ga0307409_1001854021 | 106 |
| 1439 | 3300032002 | Ga0307416_100550973 | Ga0307416_1005509732 | 106 |
| 1440 | 3300032004 | Ga0307414_12032772 | Ga0307414_120327722 | 106 |
| 1441 | 3300032005 | Ga0307411_11057229 | Ga0307411_110572292 | 106 |
| 1442 | 3300032126 | Ga0307415_100001511 | Ga0307415_1000015115 | 106 |
| 1443 | 3300033180 | Ga0307510_10355367 | Ga0307510_103553672 | 106 |
| 1444 | 3300033547 | Ga0316212_1047236 | Ga0316212_10472362 | 106 |
| 1445 | 3300035111 | Ga0373923_0124926 | Ga0373923_0124926_120_440 | 106 |
| 1446 | 3300035117 | Ga0373953_0209399 | Ga0373953_0209399_95_415 | 106 |
| 1447 | 3300035118 | Ga0373954_0073506 | Ga0373954_0073506_194_514 | 106 |
| 1448 | 3300035120 | Ga0373957_0101976 | Ga0373957_0101976_312_632 | 106 |
| 1449 | 3300035172 | Ga0373955_0545013 | Ga0373955_0545013_131_451 | 106 |
| 1450 | 3300035692 | Ga0373935_0502596 | Ga0373935_0502596_67_387 | 106 |
| 1451 | 3300036401 | Ga0373937_0317423 | Ga0373937_0317423_717_1037 | 106 |
| 1452 | 3300037068 | Ga0373925_0024612 | Ga0373925_0024612_293_613 | 106 |
| 1453 | 3300039437 | Ga0436365_1891849 | Ga0436365_1891849_240_560 | 106 |
| 1454 | 3300041407 | Ga0439447_049395 | Ga0439447_049395_389_748 | 106 |
| 1455 | 3300041410 | Ga0439461_0119655 | Ga0439461_0119655_123_452 | 106 |
| 1456 | 3300041997 | Ga0439431_0083965 | Ga0439431_0083965_504_833 | 106 |
| 1457 | 3300041999 | Ga0439433_0040214 | Ga0439433_0040214_55_384 | 106 |
| 1458 | 3300042001 | Ga0439441_047092 | Ga0439441_047092_394_753 | 106 |
| 1459 | 3300042003 | Ga0439443_002397 | Ga0439443_002397_382_741 | 106 |
| 1460 | 3300042013 | Ga0439456_050303 | Ga0439456_050303_335_694 | 106 |
| 1461 | 3300042116 | Ga0450912_013395 | Ga0450912_013395_22_351 | 106 |
| 1462 | 3300042121 | Ga0450919_040162 | Ga0450919_040162_59_388 | 106 |
| 1463 | 3300042122 | Ga0450920_029397 | Ga0450920_029397_453_812 | 106 |
| 1464 | 3300042123 | Ga0450921_002385 | Ga0450921_002385_863_1192 | 106 |
| 1465 | 3300042125 | Ga0450923_075394 | Ga0450923_075394_24_353 | 106 |
| 1466 | 3300042127 | Ga0450890_013971 | Ga0450890_013971_676_1035 | 106 |
| 1467 | 3300042127 | Ga0450890_021116 | Ga0450890_021116_99_428 | 106 |
| 1468 | 3300042132 | Ga0450895_007646 | Ga0450895_007646_105_434 | 106 |
| 1469 | 3300042133 | Ga0450896_000823 | Ga0450896_000823_1456_1785 | 106 |
| 1470 | 3300042133 | Ga0450896_001057 | Ga0450896_001057_819_1148 | 106 |
| 1471 | 3300042134 | Ga0450898_005988 | Ga0450898_005988_561_920 | 106 |
| 1472 | 3300042146 | Ga0450907_021884 | Ga0450907_021884_257_616 | 106 |
| 1473 | 3300042156 | Ga0439446_0007988 | Ga0439446_0007988_592_951 | 106 |
| 1474 | 3300042156 | Ga0439446_0029029 | Ga0439446_0029029_519_848 | 106 |
| 1475 | 3300042156 | Ga0439446_0080440 | Ga0439446_0080440_529_888 | 106 |
| 1476 | 3300042184 | Ga0450908_000192 | Ga0450908_000192_5818_6147 | 106 |
| 1477 | 3300042184 | Ga0450908_008697 | Ga0450908_008697_578_937 | 106 |
| 1478 | 3300042185 | Ga0450909_010586 | Ga0450909_010586_216_575 | 106 |
| 1479 | 3300042435 | Ga0439434_0019108 | Ga0439434_0019108_1354_1683 | 106 |
| 1480 | 3300042437 | Ga0439444_0003242 | Ga0439444_0003242_1741_2070 | 106 |
| 1481 | 3300042461 | Ga0439460_0037722 | Ga0439460_0037722_584_943 | 106 |
| 1482 | 3300042530 | Ga0450916_107861 | Ga0450916_107861_75_404 | 106 |
| 1483 | 3300042532 | Ga0450893_0059821 | Ga0450893_0059821_151_510 | 106 |
| 1484 | 3300044712 | Ga0453684_0740785 | Ga0453684_0740785_603_923 | 106 |
| 1485 | 3300045051 | Ga0451576_0104353 | Ga0451576_0104353_122_442 | 106 |
| 1486 | 3300046491 | Ga0495584_0156842 | Ga0495584_0156842_251_571 | 106 |
| 1487 | 3300046516 | Ga0495628_1162360 | Ga0495628_1162360_151_471 | 106 |
| 1488 | 3300046529 | Ga0495652_0840483 | Ga0495652_0840483_183_503 | 106 |
| 1489 | 3300046557 | Ga0495622_0397610 | Ga0495622_0397610_27_350 | 106 |
| 1490 | 3300047322 | Ga0495680_0338892 | Ga0495680_0338892_321_644 | 106 |
| 1491 | 3300048907 | Ga0496104_0021988 | Ga0496104_0021988_941_1261 | 106 |
| 1492 | 3300048908 | Ga0496105_0014994 | Ga0496105_0014994_4644_4964 | 106 |
| 1493 | 3300048910 | Ga0496107_0129988 | Ga0496107_0129988_446_766 | 106 |
| 1494 | 3300048917 | Ga0496114_0009814 | Ga0496114_0009814_4950_5270 | 106 |
| 1495 | 3300048918 | Ga0496115_0443371 | Ga0496115_0443371_138_458 | 106 |
| 1496 | 3300049568 | Ga0501031_0100963 | Ga0501031_0100963_136_465 | 106 |
| 1497 | 3300049568 | Ga0501031_0319551 | Ga0501031_0319551_29_349 | 106 |
| 1498 | 3300049569 | Ga0501032_0028835 | Ga0501032_0028835_988_1317 | 106 |
| 1499 | 3300049570 | Ga0501033_0402185 | Ga0501033_0402185_439_768 | 106 |
| 1500 | 3300049570 | Ga0501033_0689557 | Ga0501033_0689557_289_609 | 106 |
| 1501 | 3300049572 | Ga0501036_0000947 | Ga0501036_0000947_18826_19146 | 106 |
| 1502 | 3300049572 | Ga0501036_0031170 | Ga0501036_0031170_307_636 | 106 |
| 1503 | 3300049572 | Ga0501036_0053598 | Ga0501036_0053598_2164_2484 | 106 |
| 1504 | 3300049573 | Ga0501037_0016924 | Ga0501037_0016924_4723_5052 | 106 |
| 1505 | 3300049574 | Ga0501038_0011051 | Ga0501038_0011051_4067_4387 | 106 |
| 1506 | 3300049574 | Ga0501038_0146197 | Ga0501038_0146197_1055_1384 | 106 |
| 1507 | 3300049574 | Ga0501038_0323332 | Ga0501038_0323332_385_714 | 106 |
| 1508 | 3300049575 | Ga0501039_0000322 | Ga0501039_0000322_32571_32891 | 106 |
| 1509 | 3300049575 | Ga0501039_0050028 | Ga0501039_0050028_2688_3008 | 106 |
| 1510 | 3300049575 | Ga0501039_0197629 | Ga0501039_0197629_324_653 | 106 |
| 1511 | 3300049575 | Ga0501039_0595879 | Ga0501039_0595879_286_615 | 106 |
| 1512 | 3300049575 | Ga0501039_0691882 | Ga0501039_0691882_75_404 | 106 |
| 1513 | 3300049576 | Ga0501040_0000188 | Ga0501040_0000188_22_342 | 106 |
| 1514 | 3300049576 | Ga0501040_0010458 | Ga0501040_0010458_3477_3806 | 106 |
| 1515 | 3300049577 | Ga0501041_0000269 | Ga0501041_0000269_20170_20490 | 106 |
| 1516 | 3300049577 | Ga0501041_0028556 | Ga0501041_0028556_2515_2835 | 106 |
| 1517 | 3300049577 | Ga0501041_0032199 | Ga0501041_0032199_430_759 | 106 |
| 1518 | 3300049577 | Ga0501041_0453293 | Ga0501041_0453293_103_432 | 106 |
| 1519 | 3300049578 | Ga0501042_0035564 | Ga0501042_0035564_998_1318 | 106 |
| 1520 | 3300049578 | Ga0501042_0196877 | Ga0501042_0196877_382_711 | 106 |
| 1521 | 3300049579 | Ga0501043_0008846 | Ga0501043_0008846_5397_5717 | 106 |
| 1522 | 3300049579 | Ga0501043_0228276 | Ga0501043_0228276_522_851 | 106 |
| 1523 | 3300049580 | Ga0501046_0032906 | Ga0501046_0032906_2314_2643 | 106 |
| 1524 | 3300049580 | Ga0501046_0065390 | Ga0501046_0065390_2382_2702 | 106 |
| 1525 | 3300049580 | Ga0501046_0567786 | Ga0501046_0567786_18_338 | 106 |
| 1526 | 3300049581 | Ga0501047_0560936 | Ga0501047_0560936_337_666 | 106 |
| 1527 | 3300049582 | Ga0501048_0002660 | Ga0501048_0002660_12479_12799 | 106 |
| 1528 | 3300049582 | Ga0501048_0036457 | Ga0501048_0036457_788_1117 | 106 |
| 1529 | 3300049582 | Ga0501048_0505723 | Ga0501048_0505723_318_647 | 106 |
| 1530 | 3300049583 | Ga0501067_0007150 | Ga0501067_0007150_2264_2593 | 106 |
| 1531 | 3300049584 | Ga0501068_0036761 | Ga0501068_0036761_367_696 | 106 |
| 1532 | 3300049584 | Ga0501068_0556078 | Ga0501068_0556078_282_611 | 106 |
| 1533 | 3300049585 | Ga0501069_0108047 | Ga0501069_0108047_874_1203 | 106 |
| 1534 | 3300049586 | Ga0501070_0582021 | Ga0501070_0582021_142_471 | 106 |
| 1535 | 3300049587 | Ga0501071_0014106 | Ga0501071_0014106_2912_3232 | 106 |
| 1536 | 3300049587 | Ga0501071_0025539 | Ga0501071_0025539_1401_1721 | 106 |
| 1537 | 3300049587 | Ga0501071_0121000 | Ga0501071_0121000_666_995 | 106 |
| 1538 | 3300049587 | Ga0501071_0310494 | Ga0501071_0310494_612_941 | 106 |
| 1539 | 3300049587 | Ga0501071_0374430 | Ga0501071_0374430_741_1070 | 106 |
| 1540 | 3300049587 | Ga0501071_0600918 | Ga0501071_0600918_197_526 | 106 |
| 1541 | 3300049587 | Ga0501071_1174680 | Ga0501071_1174680_138_467 | 106 |
| 1542 | 3300049588 | Ga0501072_0002259 | Ga0501072_0002259_6144_6464 | 106 |
| 1543 | 3300049588 | Ga0501072_0038934 | Ga0501072_0038934_2314_2643 | 106 |
| 1544 | 3300049588 | Ga0501072_0045324 | Ga0501072_0045324_2707_3027 | 106 |
| 1545 | 3300049588 | Ga0501072_0297632 | Ga0501072_0297632_386_715 | 106 |
| 1546 | 3300049588 | Ga0501072_0690634 | Ga0501072_0690634_140_469 | 106 |
| 1547 | 3300049589 | Ga0501073_0014788 | Ga0501073_0014788_3970_4299 | 106 |
| 1548 | 3300049589 | Ga0501073_0152515 | Ga0501073_0152515_439_768 | 106 |
| 1549 | 3300049589 | Ga0501073_0179814 | Ga0501073_0179814_302_622 | 106 |
| 1550 | 3300049589 | Ga0501073_0204240 | Ga0501073_0204240_831_1160 | 106 |
| 1551 | 3300049590 | Ga0501074_0534173 | Ga0501074_0534173_120_449 | 106 |
| 1552 | 3300049591 | Ga0501075_0000082 | Ga0501075_0000082_2424_2744 | 106 |
| 1553 | 3300049591 | Ga0501075_0042017 | Ga0501075_0042017_439_759 | 106 |
| 1554 | 3300049591 | Ga0501075_0143535 | Ga0501075_0143535_735_1064 | 106 |
| 1555 | 3300049591 | Ga0501075_0158999 | Ga0501075_0158999_906_1235 | 106 |
| 1556 | 3300049591 | Ga0501075_1521746 | Ga0501075_1521746_167_496 | 106 |
| 1557 | 3300049592 | Ga0501076_0006540 | Ga0501076_0006540_8055_8375 | 106 |
| 1558 | 3300049592 | Ga0501076_0006615 | Ga0501076_0006615_302_622 | 106 |
| 1559 | 3300049592 | Ga0501076_0030447 | Ga0501076_0030447_268_597 | 106 |
| 1560 | 3300049592 | Ga0501076_0047451 | Ga0501076_0047451_1788_2108 | 106 |
| 1561 | 3300049592 | Ga0501076_0052303 | Ga0501076_0052303_2270_2599 | 106 |
| 1562 | 3300049592 | Ga0501076_1409431 | Ga0501076_1409431_115_444 | 106 |
| 1563 | 3300049593 | Ga0501077_0010560 | Ga0501077_0010560_917_1246 | 106 |
| 1564 | 3300049593 | Ga0501077_0049066 | Ga0501077_0049066_18_338 | 106 |
| 1565 | 3300049593 | Ga0501077_0059394 | Ga0501077_0059394_1097_1417 | 106 |
| 1566 | 3300049593 | Ga0501077_0197227 | Ga0501077_0197227_601_930 | 106 |
| 1567 | 3300049741 | Ga0501079_0000290 | Ga0501079_0000290_23121_23441 | 106 |
| 1568 | 3300049741 | Ga0501079_0014415 | Ga0501079_0014415_3020_3340 | 106 |
| 1569 | 3300049741 | Ga0501079_0058865 | Ga0501079_0058865_815_1144 | 106 |
| 1570 | 3300049741 | Ga0501079_0773406 | Ga0501079_0773406_106_435 | 106 |
| 1571 | 3300049741 | Ga0501079_1606202 | Ga0501079_1606202_142_471 | 106 |
| 1572 | 3300049742 | Ga0501080_0009710 | Ga0501080_0009710_8130_8459 | 106 |
| 1573 | 3300049742 | Ga0501080_0158121 | Ga0501080_0158121_157_477 | 106 |
| 1574 | 3300049742 | Ga0501080_0337875 | Ga0501080_0337875_192_521 | 106 |
| 1575 | 3300049743 | Ga0501081_0000015 | Ga0501081_0000015_34561_34881 | 106 |
| 1576 | 3300049743 | Ga0501081_0006175 | Ga0501081_0006175_6852_7181 | 106 |
| 1577 | 3300049743 | Ga0501081_0050037 | Ga0501081_0050037_2222_2542 | 106 |
| 1578 | 3300049743 | Ga0501081_0426399 | Ga0501081_0426399_151_480 | 106 |
| 1579 | 3300049743 | Ga0501081_1025698 | Ga0501081_1025698_82_411 | 106 |
| 1580 | 3300049743 | Ga0501081_1049363 | Ga0501081_1049363_152_481 | 106 |
| 1581 | 3300049822 | Ga0501035_0235740 | Ga0501035_0235740_414_734 | 106 |
| 1582 | 3300049822 | Ga0501035_0307350 | Ga0501035_0307350_460_789 | 106 |
| 1583 | 3300049822 | Ga0501035_0715502 | Ga0501035_0715502_366_686 | 106 |
| 1584 | 3300049824 | Ga0501045_0000284 | Ga0501045_0000284_29319_29639 | 106 |
| 1585 | 3300049824 | Ga0501045_0016097 | Ga0501045_0016097_2255_2575 | 106 |
| 1586 | 3300050508 | nmdc:mga09592_1178559_c1 | nmdc:mga09592_1178559_c1_236_565 | 106 |
| 1587 | 3300050511 | nmdc:mga08y16_266615_c1 | nmdc:mga08y16_266615_c1_855_1184 | 106 |
| 1588 | 3300050511 | nmdc:mga08y16_9557_c1 | nmdc:mga08y16_9557_c1_764_1093 | 106 |
| 1589 | 3300050512 | nmdc:mga0n895_5728_c1 | nmdc:mga0n895_5728_c1_1747_2076 | 106 |
| 1590 | 3300050513 | nmdc:mga0rr50_228421_c1 | nmdc:mga0rr50_228421_c1_63_392 | 106 |
| 1591 | 3300050515 | nmdc:mga0a205_1357_c2 | nmdc:mga0a205_1357_c2_8237_8566 | 106 |
| 1592 | 3300053077 | Ga0495601_0156897 | Ga0495601_0156897_971_1291 | 106 |
| 1593 | 3300053092 | Ga0500583_0072418 | Ga0500583_0072418_1245_1568 | 106 |
| 1594 | 3300053178 | Ga0500637_0005251 | Ga0500637_0005251_1387_1710 | 106 |
| 1595 | 3300054114 | Ga0501084_0024614 | Ga0501084_0024614_4341_4670 | 106 |
| 1596 | 3300054114 | Ga0501084_0072927 | Ga0501084_0072927_1820_2149 | 106 |
| 1597 | 3300054114 | Ga0501084_0569580 | Ga0501084_0569580_19_348 | 106 |
| 1598 | 3300054114 | Ga0501084_0587161 | Ga0501084_0587161_407_736 | 106 |
| 1599 | 3300060353 | Ga0501082_0000222 | Ga0501082_0000222_8909_9229 | 106 |
| 1600 | 3300060353 | Ga0501082_0003441 | Ga0501082_0003441_7815_8144 | 106 |
| 1601 | 3300060353 | Ga0501082_0025636 | Ga0501082_0025636_2186_2506 | 106 |
| 1602 | 3300060353 | Ga0501082_0082626 | Ga0501082_0082626_780_1109 | 106 |
| 1603 | 3300061734 | Ga0530510_0001028 | Ga0530510_0001028_2434_2754 | 106 |
| 1604 | 3300061734 | Ga0530510_0019249 | Ga0530510_0019249_1732_2052 | 106 |
| 1605 | 3300061734 | Ga0530510_0166162 | Ga0530510_0166162_780_1109 | 106 |
| 1606 | 3300061734 | Ga0530510_0222252 | Ga0530510_0222252_462_791 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dnj-assembly2.cif.gz_A | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide | 0.9906 | 28 | 106 |
| 3g3p-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9897 | 25 | 106 |
| 3gq1-assembly2.cif.gz_B | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide | 0.9844 | 23 | 106 |
| 2wa9-assembly2.cif.gz_B | structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps - trp peptide structure | 0.9806 | 23 | 106 |
| 3o1f-assembly2.cif.gz_B | p1 crystal form of e. coli clps at 1.4 a resolution | 0.9797 | 27 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8Q6_1_106_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9821 | 22 | 106 | 3.30.1390.10 |
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9746 | 27 | 106 | 3.30.1390.10 |
| 4ykaD00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9618 | 24 | 106 | 3.30.1390.10 |
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9511 | 27 | 106 | 3.30.1390.10 |
| 4ykaD00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9508 | 24 | 106 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S5MC12-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9853 | 18 | 106 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A2R7Q341-F1-model_v4 | deleted | 0.9834 | 20 | 106 |
|
| AF-A0A381GJP6-F1-model_v4 | deleted | 0.9833 | 22 | 106 |
|
| AF-A0A0L6JMT2-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9825 | 22 | 106 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A4R3Z2M3-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9818 | 22 | 106 |
GO:0006508
GO:0008233 GO:0030163 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar