F495024

General Info

Members Datasets Scaffolds Average Seq Length
1606 597 1606 108

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10216368|Ga0065712_102163682
Length 129
Sequence LCGEQADPINEAKAKDGLKAVAKDKDREIGQGGFDLAVEEAQPKLRKPPLYQVVLLNDDYTPMEFVVDVLERIFSLDRLRATRVMLEVHTKGKGVCGVFTFEIAETKVAQVMTYSRQHQHPLLCTMEET

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
147 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
228 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
235 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
236 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
237 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
248 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
258 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
266 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
267 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
268 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
269 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
270 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
274 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
275 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
276 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
277 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
284 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
285 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
286 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
287 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
288 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
289 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
290 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
291 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
292 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
293 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
294 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
295 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
296 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
297 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
298 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
299 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
300 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
301 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
303 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
304 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
305 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
306 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
307 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
308 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
309 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
310 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
311 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
312 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
317 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
320 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
324 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
325 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
326 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
327 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
328 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
329 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
330 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
331 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
332 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
333 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
334 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
335 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
336 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
337 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
338 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
339 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
340 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
341 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
342 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
343 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
344 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
345 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
346 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
347 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
348 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
349 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
350 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
351 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
352 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
353 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
354 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
355 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
356 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
357 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
358 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
359 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
360 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
361 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
362 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
363 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
364 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
365 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
366 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
367 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
368 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
369 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
370 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
371 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
372 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
373 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
374 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
375 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
376 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
377 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
378 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
379 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
380 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
381 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
382 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
383 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
384 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
385 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
386 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
387 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
388 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
389 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
390 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
391 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
392 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
393 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
394 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
395 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
398 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
399 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
400 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
401 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
402 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
403 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
404 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
405 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
406 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
407 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
408 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
409 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
410 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
411 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
412 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
413 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
414 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
415 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
416 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
417 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
418 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
419 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
420 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
421 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
422 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
423 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
424 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
425 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
426 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
427 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
428 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
429 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
430 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
431 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
432 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
433 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
434 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
435 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
436 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
437 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
438 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
439 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
440 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
441 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
442 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
443 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
444 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
445 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
446 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
447 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
448 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
449 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
450 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
451 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
452 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
453 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
454 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
455 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
456 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
457 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
458 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
459 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
460 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
461 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
462 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
463 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
464 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
465 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
466 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
467 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
480 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
481 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
482 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
483 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
484 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
485 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
486 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
487 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
503 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
504 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
505 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
506 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
507 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
508 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
509 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
510 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
511 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
512 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
513 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
514 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
515 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
516 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
517 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
518 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
519 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
520 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
521 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
522 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
523 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
524 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
525 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
526 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
527 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
528 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
529 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
532 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
533 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
534 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
535 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
536 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
537 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
538 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
539 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
540 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
541 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
542 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
543 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
544 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
545 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
546 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
547 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
548 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
549 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
550 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
551 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
552 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
553 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
554 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
555 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
556 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
557 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
558 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
559 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
560 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
561 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
562 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
563 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
564 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
565 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
566 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
567 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
568 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
569 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
570 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
571 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
572 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
573 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
574 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
575 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
576 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
577 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
578 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
579 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
580 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
581 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
582 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
596 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
597 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 3.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0.12
Rhizoplane 3.92
Rhizosphere 87.48
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1005235 3300000546 Bacteria 1419
2 JGI24746J21847_1038090 3300001977 Bacteria 666
3 JGI24744J21845_10074202 3300002077 Bacteria 621
4 JGI24034J26672_10044462 3300002239 Bacteria 752
5 rootH1_10026435 3300003323 Bacteria 5436
6 rootH1_10211908 3300003323 Bacteria 2103
7 Ga0058859_11646593 3300004798 Bacteria 813
8 Ga0058861_11861260 3300004800 Bacteria 571
9 Ga0058860_11393278 3300004801 Bacteria 1230
10 Ga0058862_10012401 3300004803 Bacteria 3578
11 Ga0058862_10022746 3300004803 Bacteria 1771
12 Ga0058862_12010366 3300004803 Bacteria 568
13 Ga0065714_10207824 3300005288 Bacteria 875
14 Ga0065704_10098711 3300005289 Bacteria 2342
15 Ga0065704_10802156 3300005289 Bacteria 524
16 Ga0065712_10072478 3300005290 Bacteria 4735
17 Ga0065712_10216368 3300005290 Bacteria 1055
18 Ga0065712_10247271 3300005290 Bacteria 968
19 Ga0065712_10311057 3300005290 Bacteria 844
20 Ga0065715_10001498 3300005293 Bacteria 6981
21 Ga0065715_10358651 3300005293 Bacteria 939
22 Ga0065707_10067934 3300005295 Bacteria 632
23 Ga0065707_10083865 3300005295 Bacteria 8082
24 Ga0065707_10085991 3300005295 Bacteria 5737
25 Ga0065707_10305113 3300005295 Bacteria 996
26 Ga0070658_10830157 3300005327 Bacteria 803
27 Ga0070676_11540199 3300005328 Bacteria 513
28 Ga0070683_100026113 3300005329 Bacteria 5254
29 Ga0070683_100113854 3300005329 Bacteria 2553
30 Ga0070690_100003822 3300005330 Bacteria 8290
31 Ga0070690_100035384 3300005330 Bacteria 3134
32 Ga0070690_100434119 3300005330 Bacteria 971
33 Ga0070690_100554207 3300005330 Bacteria 867
34 Ga0070690_101639687 3300005330 Bacteria 522
35 Ga0070670_100019825 3300005331 Bacteria 5773
36 Ga0070670_100027123 3300005331 Bacteria 4926
37 Ga0070670_100118934 3300005331 Bacteria 2279
38 Ga0070670_100632259 3300005331 Bacteria 959
39 Ga0070670_101388768 3300005331 Bacteria 644
40 Ga0068869_100069124 3300005334 Bacteria 2610
41 Ga0068869_100129027 3300005334 Bacteria 1942
42 Ga0068869_100194144 3300005334 Bacteria 1598
43 Ga0068869_100494367 3300005334 Bacteria 1020
44 Ga0068869_100572915 3300005334 Bacteria 951
45 Ga0068869_100610042 3300005334 Bacteria 923
46 Ga0068869_100691338 3300005334 Bacteria 869
47 Ga0068869_100992031 3300005334 Bacteria 731
48 Ga0070666_10002682 3300005335 Bacteria 10736
49 Ga0070666_10146958 3300005335 Bacteria 1643
50 Ga0070666_10169623 3300005335 Bacteria 1528
51 Ga0070666_10391354 3300005335 Bacteria 998
52 Ga0070666_10433450 3300005335 Bacteria 948
53 Ga0070680_100254672 3300005336 Bacteria 1485
54 Ga0070680_100260024 3300005336 Bacteria 1468
55 Ga0070682_100020490 3300005337 Bacteria 3890
56 Ga0070682_100233148 3300005337 Bacteria 1317
57 Ga0070682_100339416 3300005337 Bacteria 1116
58 Ga0070682_100364321 3300005337 Bacteria 1082
59 Ga0070682_100884905 3300005337 Bacteria 733
60 Ga0070682_101291725 3300005337 Bacteria 620
61 Ga0068868_100004850 3300005338 Bacteria 9444
62 Ga0068868_100070972 3300005338 Bacteria 2777
63 Ga0068868_100094689 3300005338 Bacteria 2409
64 Ga0068868_100183314 3300005338 Bacteria 1738
65 Ga0070689_100001596 3300005340 Bacteria 14466
66 Ga0070689_100004882 3300005340 Bacteria 9103
67 Ga0070689_100547261 3300005340 Bacteria 997
68 Ga0070689_100614267 3300005340 Bacteria 943
69 Ga0070689_102111929 3300005340 Bacteria 516
70 Ga0070691_10347532 3300005341 Bacteria 823
71 Ga0070691_10516887 3300005341 Bacteria 692
72 Ga0070687_100022560 3300005343 Bacteria 2978
73 Ga0070687_100302740 3300005343 Bacteria 1015
74 Ga0070661_100035493 3300005344 Bacteria 3621
75 Ga0070661_100052662 3300005344 Bacteria 2979
76 Ga0070661_100114542 3300005344 Bacteria 2016
77 Ga0070661_101007634 3300005344 Bacteria 691
78 Ga0070692_10031760 3300005345 Bacteria 2649
79 Ga0070692_10115429 3300005345 Bacteria 1491
80 Ga0070692_10556486 3300005345 Bacteria 752
81 Ga0070668_100149836 3300005347 Bacteria 1885
82 Ga0070668_101163669 3300005347 Bacteria 698
83 Ga0070668_101364736 3300005347 Bacteria 645
84 Ga0070669_100049479 3300005353 Bacteria 3068
85 Ga0070669_100293528 3300005353 Bacteria 1306
86 Ga0070669_100548820 3300005353 Bacteria 963
87 Ga0070675_100003779 3300005354 Bacteria 11497
88 Ga0070675_100107242 3300005354 Bacteria 2359
89 Ga0070675_102257557 3300005354 Bacteria 501
90 Ga0070671_100002194 3300005355 Bacteria 15085
91 Ga0070671_100098944 3300005355 Bacteria 2446
92 Ga0070671_100099731 3300005355 Bacteria 2436
93 Ga0070671_100253518 3300005355 Bacteria 1495
94 Ga0070674_100052489 3300005356 Bacteria 2813
95 Ga0070673_100016500 3300005364 Bacteria 5224
96 Ga0070673_100112326 3300005364 Bacteria 2261
97 Ga0070673_100544164 3300005364 Bacteria 1054
98 Ga0070673_100921735 3300005364 Bacteria 811
99 Ga0070673_101655195 3300005364 Bacteria 605
100 Ga0070688_100082218 3300005365 Bacteria 2087
101 Ga0070688_100224277 3300005365 Bacteria 1326
102 Ga0070659_100450430 3300005366 Bacteria 1092
103 Ga0070659_100714999 3300005366 Bacteria 867
104 Ga0070659_100804647 3300005366 Bacteria 817
105 Ga0070667_100000225 3300005367 Bacteria 65088
106 Ga0070667_100014966 3300005367 Bacteria 6408
107 Ga0070667_100021572 3300005367 Bacteria 5346
108 Ga0070667_100029388 3300005367 Bacteria 4578
109 Ga0070667_100167130 3300005367 Bacteria 1940
110 Ga0070667_100301923 3300005367 Bacteria 1442
111 Ga0070667_100553473 3300005367 Bacteria 1057
112 Ga0070667_101023584 3300005367 Bacteria 771
113 Ga0070667_101221502 3300005367 Bacteria 704
114 Ga0070667_102125483 3300005367 Bacteria 529
115 Ga0070709_10010490 3300005434 Bacteria 5134
116 Ga0070709_10034850 3300005434 Bacteria 3055
117 Ga0070709_10205906 3300005434 Bacteria 1396
118 Ga0070714_100010659 3300005435 Bacteria 7272
119 Ga0070714_102074806 3300005435 Bacteria 554
120 Ga0070713_100014651 3300005436 Bacteria 5830
121 Ga0070713_100018884 3300005436 Bacteria 5249
122 Ga0070713_100025052 3300005436 Bacteria 4659
123 Ga0070713_100443918 3300005436 Bacteria 1217
124 Ga0070713_100519955 3300005436 Bacteria 1124
125 Ga0070710_10050466 3300005437 Bacteria 2333
126 Ga0070710_10204649 3300005437 Bacteria 1248
127 Ga0070710_10786270 3300005437 Bacteria 679
128 Ga0070701_10054505 3300005438 Bacteria 2085
129 Ga0070711_100001783 3300005439 Bacteria 11983
130 Ga0070711_100046563 3300005439 Bacteria 2955
131 Ga0070711_100056066 3300005439 Bacteria 2724
132 Ga0070711_100160105 3300005439 Bacteria 1706
133 Ga0070711_100437871 3300005439 Bacteria 1068
134 Ga0070711_100460678 3300005439 Bacteria 1042
135 Ga0070705_100088221 3300005440 Bacteria 1925
136 Ga0070705_100108171 3300005440 Bacteria 1770
137 Ga0070705_100116100 3300005440 Bacteria 1720
138 Ga0070705_100347593 3300005440 Bacteria 1080
139 Ga0070705_100636152 3300005440 Bacteria 830
140 Ga0070700_100069722 3300005441 Bacteria 2239
141 Ga0070700_100231657 3300005441 Bacteria 1315
142 Ga0070700_100269903 3300005441 Bacteria 1229
143 Ga0070700_101723147 3300005441 Bacteria 538
144 Ga0070694_100052311 3300005444 Bacteria 2760
145 Ga0070694_100140533 3300005444 Bacteria 1753
146 Ga0070694_100181515 3300005444 Bacteria 1557
147 Ga0070694_100442600 3300005444 Bacteria 1024
148 Ga0070694_100456922 3300005444 Bacteria 1009
149 Ga0070694_101042895 3300005444 Bacteria 680
150 Ga0070663_100147002 3300005455 Bacteria 1804
151 Ga0070663_100391485 3300005455 Bacteria 1134
152 Ga0070663_100538279 3300005455 Bacteria 974
153 Ga0070663_100538900 3300005455 Bacteria 974
154 Ga0070663_100610075 3300005455 Bacteria 919
155 Ga0070663_100883831 3300005455 Bacteria 771
156 Ga0070678_100346570 3300005456 Bacteria 1276
157 Ga0070678_100843082 3300005456 Bacteria 835
158 Ga0070662_100383507 3300005457 Bacteria 1157
159 Ga0070662_100867757 3300005457 Bacteria 769
160 Ga0070662_101370415 3300005457 Bacteria 609
161 Ga0070681_10001003 3300005458 Bacteria 23931
162 Ga0070681_10003796 3300005458 Bacteria 14193
163 Ga0070681_10013362 3300005458 Bacteria 8159
164 Ga0070681_10015831 3300005458 Bacteria 7517
165 Ga0070681_10101137 3300005458 Bacteria 2828
166 Ga0070681_10421308 3300005458 Bacteria 1247
167 Ga0070681_10509537 3300005458 Bacteria 1117
168 Ga0068867_100008080 3300005459 Bacteria 7435
169 Ga0068867_100197722 3300005459 Bacteria 1608
170 Ga0070685_10063412 3300005466 Bacteria 2170
171 Ga0070685_10127754 3300005466 Bacteria 1586
172 Ga0070685_10680674 3300005466 Bacteria 748
173 Ga0070706_102093621 3300005467 Bacteria 512
174 Ga0070698_101001791 3300005471 Bacteria 783
175 Ga0070698_101583276 3300005471 Bacteria 607
176 Ga0070699_100011119 3300005518 Bacteria 7779
177 Ga0070679_100030496 3300005530 Bacteria 5324
178 Ga0070679_100065404 3300005530 Bacteria 3624
179 Ga0070679_100113205 3300005530 Bacteria 2699
180 Ga0070679_100177510 3300005530 Bacteria 2103
181 Ga0070679_100261024 3300005530 Bacteria 1687
182 Ga0070679_101203238 3300005530 Bacteria 703
183 Ga0070684_100003660 3300005535 Bacteria 11596
184 Ga0070684_100006012 3300005535 Bacteria 9348
185 Ga0070684_100033066 3300005535 Bacteria 4413
186 Ga0070684_100107929 3300005535 Bacteria 2494
187 Ga0070684_102067403 3300005535 Bacteria 538
188 Ga0070684_102091128 3300005535 Bacteria 534
189 Ga0070697_101870661 3300005536 Bacteria 537
190 Ga0068853_100635146 3300005539 Bacteria 1015
191 Ga0068853_101181577 3300005539 Bacteria 738
192 Ga0070672_100049906 3300005543 Bacteria 3258
193 Ga0070672_100115740 3300005543 Bacteria 2190
194 Ga0070672_100204218 3300005543 Bacteria 1653
195 Ga0070672_100262365 3300005543 Bacteria 1457
196 Ga0070686_100061083 3300005544 Bacteria 2434
197 Ga0070686_100205214 3300005544 Bacteria 1415
198 Ga0070686_100491627 3300005544 Bacteria 950
199 Ga0070686_100806619 3300005544 Bacteria 757
200 Ga0070686_101488093 3300005544 Bacteria 570
201 Ga0070695_100058416 3300005545 Bacteria 2494
202 Ga0070695_100756361 3300005545 Bacteria 775
203 Ga0070695_100821432 3300005545 Bacteria 746
204 Ga0070695_100833517 3300005545 Bacteria 741
205 Ga0070696_100000793 3300005546 Bacteria 20343
206 Ga0070696_100768358 3300005546 Bacteria 791
207 Ga0070696_100888401 3300005546 Bacteria 738
208 Ga0070693_100060935 3300005547 Bacteria 2192
209 Ga0070693_100063788 3300005547 Bacteria 2148
210 Ga0070693_100098453 3300005547 Bacteria 1777
211 Ga0070693_100361855 3300005547 Bacteria 996
212 Ga0070665_100000709 3300005548 Bacteria 44346
213 Ga0070665_100008098 3300005548 Bacteria 10638
214 Ga0070665_100026875 3300005548 Bacteria 5797
215 Ga0070665_100029156 3300005548 Bacteria 5554
216 Ga0070665_100048772 3300005548 Bacteria 4251
217 Ga0070665_100071765 3300005548 Bacteria 3469
218 Ga0070665_100182905 3300005548 Bacteria 2097
219 Ga0070665_100210433 3300005548 Bacteria 1945
220 Ga0070665_100459624 3300005548 Bacteria 1283
221 Ga0070665_101412298 3300005548 Bacteria 705
222 Ga0070665_101554237 3300005548 Bacteria 670
223 Ga0070665_102298984 3300005548 Bacteria 542
224 Ga0070704_100016184 3300005549 Bacteria 4707
225 Ga0070704_100018874 3300005549 Bacteria 4420
226 Ga0070704_100138110 3300005549 Bacteria 1899
227 Ga0070704_100326746 3300005549 Bacteria 1287
228 Ga0070704_100889236 3300005549 Bacteria 800
229 Ga0068855_100000869 3300005563 Bacteria 37546
230 Ga0068855_100013822 3300005563 Bacteria 9733
231 Ga0068855_100184350 3300005563 Bacteria 2358
232 Ga0068855_100308078 3300005563 Bacteria 1753
233 Ga0068855_100485179 3300005563 Bacteria 1345
234 Ga0068855_101007972 3300005563 Bacteria 875
235 Ga0068855_101366358 3300005563 Bacteria 731
236 Ga0070664_100001245 3300005564 Bacteria 20363
237 Ga0070664_100042866 3300005564 Bacteria 3818
238 Ga0070664_100265154 3300005564 Bacteria 1546
239 Ga0068857_100113288 3300005577 Bacteria 2438
240 Ga0068857_100156726 3300005577 Bacteria 2065
241 Ga0068857_100567710 3300005577 Bacteria 1070
242 Ga0068857_100918134 3300005577 Bacteria 840
243 Ga0068857_102068997 3300005577 Bacteria 559
244 Ga0068854_100053916 3300005578 Bacteria 2890
245 Ga0068854_100359733 3300005578 Bacteria 1194
246 Ga0068856_100007934 3300005614 Bacteria 10369
247 Ga0068856_100009532 3300005614 Bacteria 9433
248 Ga0068856_100015998 3300005614 Bacteria 7251
249 Ga0068856_100155520 3300005614 Bacteria 2296
250 Ga0068856_100339780 3300005614 Bacteria 1519
251 Ga0068856_100341147 3300005614 Bacteria 1516
252 Ga0070702_100010658 3300005615 Bacteria 4539
253 Ga0070702_100011767 3300005615 Bacteria 4363
254 Ga0070702_101035006 3300005615 Bacteria 652
255 Ga0070702_101740670 3300005615 Bacteria 519
256 Ga0068852_100058878 3300005616 Bacteria 3329
257 Ga0068852_101625101 3300005616 Bacteria 669
258 Ga0068852_101892213 3300005616 Bacteria 619
259 Ga0068859_100003949 3300005617 Bacteria 15134
260 Ga0068859_100006748 3300005617 Bacteria 11662
261 Ga0068859_100334671 3300005617 Bacteria 1608
262 Ga0068859_100383959 3300005617 Bacteria 1500
263 Ga0068859_100385650 3300005617 Bacteria 1497
264 Ga0068859_100456600 3300005617 Bacteria 1374
265 Ga0068859_102050216 3300005617 Bacteria 632
266 Ga0068864_100004196 3300005618 Bacteria 11848
267 Ga0068864_100005110 3300005618 Bacteria 10753
268 Ga0068864_100046025 3300005618 Bacteria 3743
269 Ga0068866_10014160 3300005718 Bacteria 3515
270 Ga0068866_10091482 3300005718 Bacteria 1658
271 Ga0068861_100008139 3300005719 Bacteria 7214
272 Ga0068861_100071052 3300005719 Bacteria 2697
273 Ga0068861_100082512 3300005719 Bacteria 2519
274 Ga0068861_100186356 3300005719 Bacteria 1731
275 Ga0068861_100274311 3300005719 Bacteria 1449
276 Ga0068861_100485387 3300005719 Bacteria 1114
277 Ga0068861_100508673 3300005719 Bacteria 1090
278 Ga0068851_10079150 3300005834 Bacteria 1713
279 Ga0068870_10016521 3300005840 Bacteria 3528
280 Ga0068863_100007487 3300005841 Bacteria 10679
281 Ga0068863_100029303 3300005841 Bacteria 5254
282 Ga0068863_100102119 3300005841 Bacteria 2726
283 Ga0068863_100712039 3300005841 Bacteria 998
284 Ga0068858_100011250 3300005842 Bacteria 8455
285 Ga0068858_100230532 3300005842 Bacteria 1756
286 Ga0068858_100717037 3300005842 Bacteria 974
287 Ga0068860_100000219 3300005843 Bacteria 89810
288 Ga0068860_100004920 3300005843 Bacteria 13614
289 Ga0068860_100014216 3300005843 Bacteria 7805
290 Ga0068860_100014788 3300005843 Bacteria 7632
291 Ga0068860_100312784 3300005843 Bacteria 1540
292 Ga0068860_100483832 3300005843 Bacteria 1234
293 Ga0068860_101016986 3300005843 Bacteria 847
294 Ga0068862_100076918 3300005844 Bacteria 2889
295 Ga0068862_100121504 3300005844 Bacteria 2303
296 Ga0068862_100381362 3300005844 Bacteria 1315
297 Ga0068862_100418427 3300005844 Bacteria 1257
298 Ga0068862_100585066 3300005844 Bacteria 1070
299 Ga0068862_100823930 3300005844 Bacteria 908
300 Ga0081455_10000099 3300005937 Bacteria 95044
301 Ga0081455_10436627 3300005937 Bacteria 898
302 Ga0081455_10463888 3300005937 Bacteria 862
303 Ga0081455_10505365 3300005937 Bacteria 811
304 Ga0081538_10088879 3300005981 Bacteria 1606
305 Ga0081540_1130441 3300005983 Bacteria 1027
306 Ga0081540_1186417 3300005983 Bacteria 770
307 Ga0081539_10059565 3300005985 Bacteria 2101
308 Ga0070717_10002768 3300006028 Bacteria 12402
309 Ga0070717_11706155 3300006028 Bacteria 570
310 Ga0075364_11034013 3300006051 Bacteria 558
311 Ga0070715_10000150 3300006163 Bacteria 16297
312 Ga0070715_10019225 3300006163 Bacteria 2616
313 Ga0070715_10115736 3300006163 Bacteria 1271
314 Ga0070715_10387977 3300006163 Bacteria 773
315 Ga0070716_100014983 3300006173 Bacteria 3977
316 Ga0070716_100026661 3300006173 Bacteria 3097
317 Ga0070716_100371323 3300006173 Bacteria 1019
318 Ga0070712_100002458 3300006175 Bacteria 11421
319 Ga0070712_100550900 3300006175 Bacteria 972
320 Ga0070712_101090674 3300006175 Bacteria 693
321 Ga0075367_10838451 3300006178 Bacteria 586
322 Ga0075366_10183264 3300006195 Bacteria 1272
323 Ga0075366_10254773 3300006195 Bacteria 1071
324 Ga0075366_10282760 3300006195 Bacteria 1014
325 Ga0097621_100029206 3300006237 Bacteria 4353
326 Ga0097621_100041945 3300006237 Bacteria 3685
327 Ga0097621_100050099 3300006237 Bacteria 3395
328 Ga0097621_100539217 3300006237 Bacteria 1061
329 Ga0097621_101125294 3300006237 Bacteria 738
330 Ga0097621_101223004 3300006237 Bacteria 708
331 Ga0075370_10437976 3300006353 Bacteria 786
332 Ga0068871_100009552 3300006358 Bacteria 7039
333 Ga0068871_100038551 3300006358 Bacteria 3817
334 Ga0068871_100117604 3300006358 Bacteria 2242
335 Ga0068871_100319469 3300006358 Bacteria 1367
336 Ga0068871_100754384 3300006358 Bacteria 895
337 Ga0068871_101032012 3300006358 Bacteria 767
338 Ga0075428_100001284 3300006844 Bacteria 26756
339 Ga0075428_100002724 3300006844 Bacteria 19213
340 Ga0075428_100006022 3300006844 Bacteria 13466
341 Ga0075428_100012167 3300006844 Bacteria 9570
342 Ga0075428_100026057 3300006844 Bacteria 6475
343 Ga0075428_100040146 3300006844 Bacteria 5150
344 Ga0075428_101316727 3300006844 Bacteria 759
345 Ga0075430_100005100 3300006846 Bacteria 11053
346 Ga0075430_100046629 3300006846 Bacteria 3660
347 Ga0075430_100137269 3300006846 Bacteria 2037
348 Ga0075430_100271203 3300006846 Bacteria 1404
349 Ga0075430_100775905 3300006846 Bacteria 790
350 Ga0075430_100860337 3300006846 Bacteria 747
351 Ga0075431_100005080 3300006847 Bacteria 12943
352 Ga0075431_100028173 3300006847 Bacteria 5768
353 Ga0075431_100039938 3300006847 Bacteria 4834
354 Ga0075431_100063667 3300006847 Bacteria 3806
355 Ga0075431_100437027 3300006847 Bacteria 1306
356 Ga0075433_10039105 3300006852 Bacteria 4100
357 Ga0075433_10046168 3300006852 Bacteria 3787
358 Ga0075433_10601384 3300006852 Bacteria 965
359 Ga0075434_100000591 3300006871 Bacteria 28020
360 Ga0075434_100207585 3300006871 Bacteria 1980
361 Ga0075434_100546275 3300006871 Bacteria 1178
362 Ga0075434_101333267 3300006871 Bacteria 728
363 Ga0075429_100006884 3300006880 Bacteria 9869
364 Ga0075429_100013382 3300006880 Bacteria 7114
365 Ga0075429_100336750 3300006880 Bacteria 1320
366 Ga0075429_101724499 3300006880 Bacteria 544
367 Ga0068865_100003296 3300006881 Bacteria 9668
368 Ga0068865_100030070 3300006881 Bacteria 3609
369 Ga0068865_101613591 3300006881 Bacteria 583
370 Ga0068865_101994557 3300006881 Bacteria 527
371 Ga0075436_100136098 3300006914 Bacteria 1725
372 Ga0075436_100358454 3300006914 Bacteria 1052
373 Ga0075436_101035700 3300006914 Bacteria 617
374 Ga0097620_100003949 3300006931 Bacteria 15134
375 Ga0097620_100006748 3300006931 Bacteria 11662
376 Ga0097620_100334659 3300006931 Bacteria 1608
377 Ga0097620_100383952 3300006931 Bacteria 1500
378 Ga0097620_100385649 3300006931 Bacteria 1497
379 Ga0097620_100456600 3300006931 Bacteria 1374
380 Ga0097620_102050421 3300006931 Bacteria 632
381 Ga0099826_10115124 3300006948 Bacteria 1594
382 Ga0075435_100205340 3300007076 Bacteria 1670
383 Ga0075435_100892958 3300007076 Bacteria 775
384 Ga0099794_10051385 3300007265 Bacteria 1984
385 Ga0099794_10163348 3300007265 Bacteria 1133
386 Ga0099794_10287479 3300007265 Bacteria 850
387 Ga0099795_10000810 3300007788 Bacteria 6176
388 Ga0099795_10055988 3300007788 Bacteria 1449
389 Ga0105244_10163870 3300009036 Bacteria 1061
390 Ga0105250_10000006 3300009092 Bacteria 390071
391 Ga0105250_10012985 3300009092 Bacteria 3428
392 Ga0105250_10079381 3300009092 Bacteria 1329
393 Ga0105250_10172474 3300009092 Bacteria 906
394 Ga0105240_10013342 3300009093 Bacteria 11292
395 Ga0105240_10016052 3300009093 Bacteria 10149
396 Ga0105240_10048490 3300009093 Bacteria 5368
397 Ga0105240_10055566 3300009093 Bacteria 4956
398 Ga0105240_10067857 3300009093 Bacteria 4420
399 Ga0105240_10148426 3300009093 Bacteria 2795
400 Ga0105240_10354070 3300009093 Bacteria 1665
401 Ga0105240_10579386 3300009093 Bacteria 1238
402 Ga0105240_10849646 3300009093 Bacteria 985
403 Ga0105240_11091957 3300009093 Bacteria 849
404 Ga0105240_12281298 3300009093 Bacteria 561
405 Ga0111539_10007423 3300009094 Bacteria 14049
406 Ga0111539_10407029 3300009094 Bacteria 1584
407 Ga0111539_10418179 3300009094 Bacteria 1561
408 Ga0111539_10429523 3300009094 Bacteria 1538
409 Ga0111539_10961665 3300009094 Bacteria 993
410 Ga0105245_10001014 3300009098 Bacteria 25513
411 Ga0105245_10007287 3300009098 Bacteria 9684
412 Ga0105245_10686563 3300009098 Bacteria 1056
413 Ga0105245_10745948 3300009098 Bacteria 1015
414 Ga0105245_11246612 3300009098 Bacteria 792
415 Ga0105247_10000203 3300009101 Bacteria 58331
416 Ga0105247_10010154 3300009101 Bacteria 5704
417 Ga0105247_10017815 3300009101 Bacteria 4259
418 Ga0105247_10031641 3300009101 Bacteria 3211
419 Ga0105247_10044411 3300009101 Bacteria 2725
420 Ga0105247_10187872 3300009101 Bacteria 1382
421 Ga0105247_10382702 3300009101 Bacteria 998
422 Ga0114129_10002581 3300009147 Bacteria 25171
423 Ga0114129_10003487 3300009147 Bacteria 22118
424 Ga0114129_10072430 3300009147 Bacteria 4803
425 Ga0114129_10516111 3300009147 Bacteria 1559
426 Ga0105243_10071523 3300009148 Bacteria 2805
427 Ga0105243_10077500 3300009148 Bacteria 2704
428 Ga0105243_10179170 3300009148 Bacteria 1842
429 Ga0105241_10042258 3300009174 Bacteria 3447
430 Ga0105241_10172527 3300009174 Bacteria 1787
431 Ga0105241_10266258 3300009174 Bacteria 1458
432 Ga0105241_10273723 3300009174 Bacteria 1439
433 Ga0105241_10580452 3300009174 Bacteria 1010
434 Ga0105241_10653432 3300009174 Bacteria 955
435 Ga0105241_12038860 3300009174 Bacteria 566
436 Ga0105242_10012501 3300009176 Bacteria 6535
437 Ga0105242_10102563 3300009176 Bacteria 2426
438 Ga0105242_10845196 3300009176 Bacteria 910
439 Ga0105242_11127368 3300009176 Bacteria 800
440 Ga0105242_11156372 3300009176 Bacteria 791
441 Ga0105242_11763905 3300009176 Bacteria 657
442 Ga0105242_11920094 3300009176 Bacteria 633
443 Ga0105248_10002240 3300009177 Bacteria 21387
444 Ga0105248_10003720 3300009177 Bacteria 16908
445 Ga0105248_10009721 3300009177 Bacteria 10592
446 Ga0105248_10148848 3300009177 Bacteria 2641
447 Ga0105248_10200615 3300009177 Bacteria 2247
448 Ga0105248_10957965 3300009177 Bacteria 966
449 Ga0105248_11795139 3300009177 Bacteria 695
450 Ga0105248_11808215 3300009177 Bacteria 693
451 Ga0105248_12598693 3300009177 Bacteria 577
452 Ga0105237_10004537 3300009545 Bacteria 16046
453 Ga0105237_10025945 3300009545 Bacteria 5991
454 Ga0105237_10143166 3300009545 Bacteria 2385
455 Ga0105237_10229018 3300009545 Bacteria 1859
456 Ga0105237_10521788 3300009545 Bacteria 1194
457 Ga0105237_11101957 3300009545 Bacteria 801
458 Ga0105238_10048918 3300009551 Bacteria 4260
459 Ga0105238_10067107 3300009551 Bacteria 3589
460 Ga0105238_10109784 3300009551 Bacteria 2740
461 Ga0105238_10230701 3300009551 Bacteria 1828
462 Ga0105238_10506977 3300009551 Bacteria 1208
463 Ga0105238_11261366 3300009551 Bacteria 764
464 Ga0105238_11415658 3300009551 Bacteria 723
465 Ga0105238_11741192 3300009551 Bacteria 655
466 Ga0105238_11926722 3300009551 Bacteria 624
467 Ga0105238_12319906 3300009551 Bacteria 572
468 Ga0105238_12558343 3300009551 Bacteria 546
469 Ga0105249_10003331 3300009553 Bacteria 13914
470 Ga0105249_10012111 3300009553 Bacteria 7593
471 Ga0105249_10303459 3300009553 Bacteria 1602
472 Ga0105249_10484899 3300009553 Bacteria 1279
473 Ga0105249_10584700 3300009553 Bacteria 1170
474 Ga0105249_10735227 3300009553 Bacteria 1048
475 Ga0105249_11614564 3300009553 Bacteria 721
476 Ga0099796_10000821 3300010159 Bacteria 5655
477 Ga0099796_10071209 3300010159 Bacteria 1256
478 Ga0099796_10111308 3300010159 Bacteria 1042
479 Ga0105239_10035422 3300010375 Bacteria 5482
480 Ga0105239_10223365 3300010375 Bacteria 2112
481 Ga0105239_10351468 3300010375 Bacteria 1664
482 Ga0105239_10774918 3300010375 Bacteria 1098
483 Ga0105239_11489720 3300010375 Bacteria 782
484 Ga0105239_11724941 3300010375 Bacteria 725
485 Ga0105239_11787674 3300010375 Bacteria 712
486 Ga0105239_11917209 3300010375 Bacteria 687
487 Ga0105246_10001416 3300011119 Bacteria 14203
488 Ga0105246_10063084 3300011119 Bacteria 2583
489 Ga0105246_11325006 3300011119 Bacteria 668
490 Ga0157373_10454290 3300013100 Bacteria 922
491 Ga0157373_11173625 3300013100 Bacteria 578
492 Ga0157371_10867778 3300013102 Bacteria 683
493 Ga0157370_10013806 3300013104 Bacteria 8297
494 Ga0157370_10351683 3300013104 Bacteria 1358
495 Ga0157369_10190279 3300013105 Bacteria 2157
496 Ga0157369_10501249 3300013105 Bacteria 1256
497 Ga0157369_11356051 3300013105 Bacteria 724
498 Ga0157374_10009304 3300013296 Bacteria 8426
499 Ga0157374_10036490 3300013296 Bacteria 4502
500 Ga0157374_11344532 3300013296 Bacteria 737
501 Ga0157374_11350659 3300013296 Bacteria 735
502 Ga0157378_10001851 3300013297 Bacteria 18989
503 Ga0157378_10364509 3300013297 Bacteria 1415
504 Ga0157378_10397931 3300013297 Bacteria 1356
505 Ga0157378_10611234 3300013297 Bacteria 1102
506 Ga0157378_12005042 3300013297 Bacteria 629
507 Ga0163162_10028294 3300013306 Bacteria 5545
508 Ga0163162_10056795 3300013306 Bacteria 3942
509 Ga0163162_10075537 3300013306 Bacteria 3430
510 Ga0163162_10111464 3300013306 Bacteria 2833
511 Ga0163162_10112926 3300013306 Bacteria 2815
512 Ga0163162_10915917 3300013306 Bacteria 989
513 Ga0163162_11237125 3300013306 Bacteria 848
514 Ga0163162_13101443 3300013306 Bacteria 534
515 Ga0157372_10070914 3300013307 Bacteria 3922
516 Ga0157372_10133926 3300013307 Bacteria 2853
517 Ga0157372_10796326 3300013307 Bacteria 1098
518 Ga0157372_11363439 3300013307 Bacteria 818
519 Ga0157372_11586240 3300013307 Bacteria 754
520 Ga0157375_10038386 3300013308 Bacteria 4599
521 Ga0157375_10062065 3300013308 Bacteria 3713
522 Ga0157375_10098970 3300013308 Bacteria 2994
523 Ga0157375_10246011 3300013308 Bacteria 1949
524 Ga0157375_10406304 3300013308 Bacteria 1528
525 Ga0157375_10983849 3300013308 Bacteria 984
526 Ga0163163_10016441 3300014325 Bacteria 6877
527 Ga0163163_10032681 3300014325 Bacteria 5027
528 Ga0163163_10049729 3300014325 Bacteria 4126
529 Ga0163163_10103176 3300014325 Bacteria 2876
530 Ga0163163_10126133 3300014325 Bacteria 2598
531 Ga0163163_10248013 3300014325 Bacteria 1831
532 Ga0163163_10480184 3300014325 Bacteria 1304
533 Ga0163163_11457998 3300014325 Bacteria 746
534 Ga0157380_10002239 3300014326 Bacteria 13014
535 Ga0157380_10006793 3300014326 Bacteria 8083
536 Ga0157380_10030001 3300014326 Bacteria 4161
537 Ga0157380_10046767 3300014326 Bacteria 3400
538 Ga0157380_11366724 3300014326 Bacteria 758
539 Ga0157380_12937301 3300014326 Bacteria 543
540 Ga0157377_10000573 3300014745 Bacteria 15380
541 Ga0157377_10129784 3300014745 Bacteria 1538
542 Ga0157377_10192408 3300014745 Bacteria 1290
543 Ga0157377_10924710 3300014745 Bacteria 654
544 Ga0157379_10005099 3300014968 Bacteria 11268
545 Ga0157379_10010834 3300014968 Bacteria 7951
546 Ga0157379_10047864 3300014968 Bacteria 3816
547 Ga0157379_10069513 3300014968 Bacteria 3149
548 Ga0157379_10087072 3300014968 Bacteria 2801
549 Ga0157379_10237878 3300014968 Bacteria 1651
550 Ga0157379_10369731 3300014968 Bacteria 1315
551 Ga0157379_10412809 3300014968 Bacteria 1242
552 Ga0157379_10490910 3300014968 Bacteria 1137
553 Ga0157379_11161360 3300014968 Bacteria 741
554 Ga0157379_11600538 3300014968 Bacteria 636
555 Ga0157379_12215417 3300014968 Bacteria 546
556 Ga0157379_12439204 3300014968 Bacteria 522
557 Ga0157379_12488711 3300014968 Bacteria 517
558 Ga0157376_10089514 3300014969 Bacteria 2661
559 Ga0157376_10095866 3300014969 Bacteria 2581
560 Ga0157376_10373275 3300014969 Bacteria 1372
561 Ga0157376_10449877 3300014969 Bacteria 1256
562 Ga0157376_10528053 3300014969 Bacteria 1164
563 Ga0157376_11231690 3300014969 Bacteria 777
564 Ga0157376_13101898 3300014969 Bacteria 503
565 Ga0163161_10215085 3300017792 Bacteria 1486
566 Ga0163161_10282142 3300017792 Bacteria 1303
567 Ga0163161_10380596 3300017792 Bacteria 1128
568 Ga0163161_10690530 3300017792 Bacteria 849
569 Ga0197907_10383539 3300020069 Bacteria 1964
570 Ga0197907_10664428 3300020069 Bacteria 548
571 Ga0197907_11466352 3300020069 Bacteria 929
572 Ga0206356_10120402 3300020070 Bacteria 874
573 Ga0206356_11266440 3300020070 Bacteria 825
574 Ga0206356_11585042 3300020070 Bacteria 1019
575 Ga0206355_1423457 3300020076 Bacteria 572
576 Ga0206352_10211733 3300020078 Bacteria 1073
577 Ga0206352_10523350 3300020078 Bacteria 1001
578 Ga0206350_10545034 3300020080 Bacteria 837
579 Ga0206354_11507845 3300020081 Bacteria 1860
580 Ga0206354_11691571 3300020081 Bacteria 1008
581 Ga0206353_11185898 3300020082 Bacteria 1650
582 Ga0154015_1346390 3300020610 Bacteria 1208
583 Ga0213874_10007794 3300021377 Bacteria 2585
584 Ga0213876_10065609 3300021384 Bacteria 1916
585 Ga0213876_10467771 3300021384 Bacteria 671
586 Ga0213871_10026050 3300021441 Bacteria 1493
587 Ga0213871_10065851 3300021441 Bacteria 1016
588 Ga0224712_10004984 3300022467 Bacteria 3647
589 Ga0224712_10116695 3300022467 Unclassified 1151
590 Ga0228598_1040600 3300024227 Bacteria 918
591 Ga0207656_10046971 3300025321 Bacteria 1854
592 Ga0207696_1000069 3300025711 Bacteria 227744
593 Ga0207696_1114813 3300025711 Bacteria 728
594 Ga0207692_10054411 3300025898 Bacteria 2043
595 Ga0207692_10454002 3300025898 Bacteria 807
596 Ga0207692_10758916 3300025898 Bacteria 632
597 Ga0207642_10023405 3300025899 Bacteria 2467
598 Ga0207642_10066270 3300025899 Bacteria 1700
599 Ga0207710_10015548 3300025900 Bacteria 3218
600 Ga0207710_10022081 3300025900 Bacteria 2730
601 Ga0207710_10046934 3300025900 Bacteria 1929
602 Ga0207710_10124552 3300025900 Bacteria 1234
603 Ga0207710_10146178 3300025900 Bacteria 1144
604 Ga0207688_10152762 3300025901 Bacteria 1364
605 Ga0207688_10694336 3300025901 Bacteria 643
606 Ga0207680_10007410 3300025903 Bacteria 5346
607 Ga0207680_10020439 3300025903 Bacteria 3563
608 Ga0207680_10020985 3300025903 Bacteria 3527
609 Ga0207680_10102686 3300025903 Bacteria 1840
610 Ga0207680_10143235 3300025903 Bacteria 1586
611 Ga0207680_10170556 3300025903 Bacteria 1465
612 Ga0207685_10042192 3300025905 Bacteria 1712
613 Ga0207685_10098713 3300025905 Bacteria 1244
614 Ga0207685_10138904 3300025905 Bacteria 1087
615 Ga0207685_10329676 3300025905 Bacteria 764
616 Ga0207685_10731805 3300025905 Bacteria 541
617 Ga0207699_10001908 3300025906 Bacteria 9822
618 Ga0207699_10018607 3300025906 Bacteria 3684
619 Ga0207699_10092830 3300025906 Bacteria 1898
620 Ga0207699_10107745 3300025906 Bacteria 1781
621 Ga0207699_10332258 3300025906 Bacteria 1069
622 Ga0207645_10019333 3300025907 Bacteria 4466
623 Ga0207645_10250717 3300025907 Bacteria 1171
624 Ga0207643_10011560 3300025908 Bacteria 4767
625 Ga0207643_10112736 3300025908 Bacteria 1603
626 Ga0207654_10161551 3300025911 Bacteria 1448
627 Ga0207654_10610377 3300025911 Bacteria 779
628 Ga0207707_10003587 3300025912 Bacteria 13757
629 Ga0207707_10015501 3300025912 Bacteria 6639
630 Ga0207707_10017238 3300025912 Bacteria 6294
631 Ga0207707_10053515 3300025912 Bacteria 3514
632 Ga0207707_10141708 3300025912 Bacteria 2102
633 Ga0207707_10352986 3300025912 Bacteria 1267
634 Ga0207695_10007963 3300025913 Bacteria 13367
635 Ga0207695_10038713 3300025913 Bacteria 5130
636 Ga0207695_10040273 3300025913 Bacteria 5013
637 Ga0207695_10071846 3300025913 Bacteria 3533
638 Ga0207695_10097689 3300025913 Bacteria 2938
639 Ga0207695_10108868 3300025913 Bacteria 2754
640 Ga0207695_10143174 3300025913 Bacteria 2337
641 Ga0207695_10169571 3300025913 Bacteria 2109
642 Ga0207695_10625571 3300025913 Bacteria 958
643 Ga0207671_10049957 3300025914 Bacteria 3097
644 Ga0207671_10101047 3300025914 Bacteria 2185
645 Ga0207671_10146114 3300025914 Bacteria 1824
646 Ga0207671_10219173 3300025914 Bacteria 1490
647 Ga0207671_10249032 3300025914 Bacteria 1397
648 Ga0207693_10000059 3300025915 Bacteria 94053
649 Ga0207693_10097835 3300025915 Bacteria 2301
650 Ga0207693_10482189 3300025915 Bacteria 968
651 Ga0207693_10632305 3300025915 Bacteria 832
652 Ga0207693_10851795 3300025915 Bacteria 701
653 Ga0207663_10036504 3300025916 Bacteria 2957
654 Ga0207663_10156363 3300025916 Bacteria 1604
655 Ga0207663_10157361 3300025916 Bacteria 1600
656 Ga0207663_10183790 3300025916 Bacteria 1495
657 Ga0207663_10381800 3300025916 Bacteria 1073
658 Ga0207663_10519010 3300025916 Bacteria 927
659 Ga0207660_10020538 3300025917 Bacteria 4433
660 Ga0207660_10026140 3300025917 Bacteria 3972
661 Ga0207660_10107625 3300025917 Bacteria 2092
662 Ga0207660_10159649 3300025917 Bacteria 1738
663 Ga0207660_10167517 3300025917 Bacteria 1699
664 Ga0207662_10023021 3300025918 Bacteria 3576
665 Ga0207662_10113852 3300025918 Bacteria 1689
666 Ga0207662_10486512 3300025918 Bacteria 848
667 Ga0207657_10443334 3300025919 Bacteria 1019
668 Ga0207649_10035110 3300025920 Bacteria 3010
669 Ga0207649_10123608 3300025920 Bacteria 1748
670 Ga0207649_10142705 3300025920 Bacteria 1641
671 Ga0207649_10456757 3300025920 Bacteria 965
672 Ga0207649_10816371 3300025920 Bacteria 728
673 Ga0207649_10860208 3300025920 Bacteria 710
674 Ga0207652_10061066 3300025921 Bacteria 3254
675 Ga0207652_10111024 3300025921 Bacteria 2431
676 Ga0207652_10180218 3300025921 Bacteria 1898
677 Ga0207652_10224686 3300025921 Bacteria 1692
678 Ga0207652_10984970 3300025921 Bacteria 742
679 Ga0207681_10227255 3300025923 Bacteria 1447
680 Ga0207681_11575731 3300025923 Bacteria 550
681 Ga0207694_10082839 3300025924 Bacteria 2522
682 Ga0207694_10184180 3300025924 Bacteria 1694
683 Ga0207694_10208317 3300025924 Bacteria 1592
684 Ga0207694_10216066 3300025924 Bacteria 1563
685 Ga0207694_10365374 3300025924 Bacteria 1196
686 Ga0207694_10792744 3300025924 Bacteria 800
687 Ga0207694_10931883 3300025924 Bacteria 735
688 Ga0207694_11127558 3300025924 Bacteria 664
689 Ga0207694_11820235 3300025924 Bacteria 511
690 Ga0207650_10017320 3300025925 Bacteria 5043
691 Ga0207650_10063279 3300025925 Bacteria 2766
692 Ga0207650_11478566 3300025925 Bacteria 578
693 Ga0207659_10000855 3300025926 Bacteria 18065
694 Ga0207659_10138710 3300025926 Bacteria 1885
695 Ga0207687_10048914 3300025927 Bacteria 2938
696 Ga0207687_10532577 3300025927 Bacteria 984
697 Ga0207687_10542716 3300025927 Bacteria 975
698 Ga0207687_10755223 3300025927 Bacteria 828
699 Ga0207700_10008920 3300025928 Bacteria 6240
700 Ga0207700_10053646 3300025928 Bacteria 3022
701 Ga0207700_10093752 3300025928 Bacteria 2377
702 Ga0207700_10098853 3300025928 Bacteria 2322
703 Ga0207700_10189483 3300025928 Bacteria 1728
704 Ga0207700_10490249 3300025928 Bacteria 1087
705 Ga0207664_10007703 3300025929 Bacteria 7473
706 Ga0207664_10332123 3300025929 Bacteria 1343
707 Ga0207664_10519256 3300025929 Bacteria 1067
708 Ga0207664_10634366 3300025929 Bacteria 960
709 Ga0207644_10003246 3300025931 Bacteria 10488
710 Ga0207644_10008268 3300025931 Bacteria 6816
711 Ga0207644_10021569 3300025931 Bacteria 4390
712 Ga0207644_10099892 3300025931 Bacteria 2178
713 Ga0207644_10414563 3300025931 Bacteria 1103
714 Ga0207644_10886574 3300025931 Bacteria 747
715 Ga0207644_11499964 3300025931 Bacteria 566
716 Ga0207690_10231659 3300025932 Bacteria 1418
717 Ga0207690_10536651 3300025932 Bacteria 950
718 Ga0207690_10672840 3300025932 Bacteria 849
719 Ga0207690_10728854 3300025932 Bacteria 816
720 Ga0207706_10018342 3300025933 Bacteria 6297
721 Ga0207706_10078688 3300025933 Bacteria 2900
722 Ga0207706_10170095 3300025933 Bacteria 1915
723 Ga0207686_10041377 3300025934 Bacteria 2809
724 Ga0207686_11446551 3300025934 Bacteria 566
725 Ga0207709_10115227 3300025935 Bacteria 1805
726 Ga0207709_10201793 3300025935 Bacteria 1421
727 Ga0207670_10011250 3300025936 Bacteria 5188
728 Ga0207670_10233573 3300025936 Bacteria 1413
729 Ga0207670_10338893 3300025936 Bacteria 1188
730 Ga0207669_10075740 3300025937 Bacteria 2133
731 Ga0207704_10019200 3300025938 Bacteria 3586
732 Ga0207704_10165382 3300025938 Bacteria 1579
733 Ga0207665_10024787 3300025939 Bacteria 3957
734 Ga0207665_10042901 3300025939 Bacteria 3024
735 Ga0207665_10326527 3300025939 Bacteria 1153
736 Ga0207691_10073207 3300025940 Bacteria 3090
737 Ga0207691_10143593 3300025940 Bacteria 2102
738 Ga0207691_10173957 3300025940 Bacteria 1884
739 Ga0207691_10270868 3300025940 Bacteria 1462
740 Ga0207711_10007852 3300025941 Bacteria 8920
741 Ga0207711_10011267 3300025941 Bacteria 7431
742 Ga0207711_10019102 3300025941 Bacteria 5703
743 Ga0207711_10086806 3300025941 Bacteria 2744
744 Ga0207711_10138014 3300025941 Bacteria 2191
745 Ga0207689_10008645 3300025942 Bacteria 8866
746 Ga0207689_10175914 3300025942 Bacteria 1765
747 Ga0207689_10243733 3300025942 Bacteria 1486
748 Ga0207689_10272240 3300025942 Bacteria 1402
749 Ga0207689_10461316 3300025942 Bacteria 1062
750 Ga0207689_10503285 3300025942 Bacteria 1015
751 Ga0207689_10678582 3300025942 Bacteria 868
752 Ga0207661_10008500 3300025944 Bacteria 7338
753 Ga0207679_10016535 3300025945 Bacteria 4902
754 Ga0207679_10188739 3300025945 Bacteria 1711
755 Ga0207679_10669664 3300025945 Bacteria 940
756 Ga0207679_10778816 3300025945 Bacteria 871
757 Ga0207679_11641116 3300025945 Bacteria 589
758 Ga0207667_10006976 3300025949 Bacteria 13650
759 Ga0207667_10007164 3300025949 Bacteria 13460
760 Ga0207667_10096212 3300025949 Bacteria 3056
761 Ga0207667_10161197 3300025949 Bacteria 2307
762 Ga0207667_10167834 3300025949 Bacteria 2256
763 Ga0207667_10332262 3300025949 Bacteria 1552
764 Ga0207667_10642504 3300025949 Bacteria 1067
765 Ga0207667_10731544 3300025949 Bacteria 990
766 Ga0207667_11849791 3300025949 Bacteria 567
767 Ga0207651_10031275 3300025960 Bacteria 3400
768 Ga0207651_10115265 3300025960 Bacteria 2026
769 Ga0207651_10148309 3300025960 Bacteria 1822
770 Ga0207651_11190033 3300025960 Bacteria 684
771 Ga0207712_10122301 3300025961 Bacteria 1971
772 Ga0207712_10130265 3300025961 Bacteria 1916
773 Ga0207712_10144899 3300025961 Bacteria 1827
774 Ga0207712_10383284 3300025961 Bacteria 1177
775 Ga0207668_10254718 3300025972 Bacteria 1427
776 Ga0207668_11433202 3300025972 Bacteria 623
777 Ga0207640_10024393 3300025981 Bacteria 3649
778 Ga0207640_10492713 3300025981 Bacteria 1019
779 Ga0207640_10495460 3300025981 Bacteria 1016
780 Ga0207640_10589952 3300025981 Bacteria 939
781 Ga0207640_10699742 3300025981 Bacteria 869
782 Ga0207640_11070477 3300025981 Bacteria 712
783 Ga0207658_10000894 3300025986 Bacteria 24824
784 Ga0207658_10012452 3300025986 Bacteria 5811
785 Ga0207658_10173765 3300025986 Bacteria 1777
786 Ga0207658_10255626 3300025986 Bacteria 1490
787 Ga0207658_10314811 3300025986 Bacteria 1353
788 Ga0207658_10318538 3300025986 Bacteria 1345
789 Ga0207658_11167191 3300025986 Bacteria 704
790 Ga0207677_10006887 3300026023 Bacteria 6246
791 Ga0207677_10039225 3300026023 Bacteria 3112
792 Ga0207677_10043639 3300026023 Bacteria 2982
793 Ga0207677_10174889 3300026023 Bacteria 1683
794 Ga0207703_10003908 3300026035 Bacteria 12372
795 Ga0207703_10006963 3300026035 Bacteria 9000
796 Ga0207703_10048335 3300026035 Bacteria 3434
797 Ga0207703_10303736 3300026035 Bacteria 1456
798 Ga0207639_10080518 3300026041 Bacteria 2576
799 Ga0207678_10036677 3300026067 Bacteria 4268
800 Ga0207678_10421369 3300026067 Bacteria 1158
801 Ga0207678_10493584 3300026067 Bacteria 1067
802 Ga0207678_10629792 3300026067 Bacteria 941
803 Ga0207678_11563075 3300026067 Bacteria 581
804 Ga0207708_10032419 3300026075 Bacteria 3968
805 Ga0207708_10069706 3300026075 Bacteria 2692
806 Ga0207708_10201949 3300026075 Bacteria 1586
807 Ga0207702_10070305 3300026078 Bacteria 3010
808 Ga0207702_10163274 3300026078 Bacteria 2036
809 Ga0207702_10607666 3300026078 Bacteria 1073
810 Ga0207702_10882004 3300026078 Bacteria 886
811 Ga0207641_10000247 3300026088 Bacteria 69132
812 Ga0207641_10002054 3300026088 Bacteria 19118
813 Ga0207641_10003295 3300026088 Bacteria 14366
814 Ga0207641_10034075 3300026088 Bacteria 4233
815 Ga0207641_10194422 3300026088 Bacteria 1866
816 Ga0207641_10859600 3300026088 Bacteria 899
817 Ga0207648_10013598 3300026089 Bacteria 7559
818 Ga0207648_10180849 3300026089 Bacteria 1866
819 Ga0207676_10002982 3300026095 Bacteria 12064
820 Ga0207676_10009829 3300026095 Bacteria 6804
821 Ga0207676_10190035 3300026095 Bacteria 1806
822 Ga0207674_10020693 3300026116 Bacteria 7100
823 Ga0207674_10146209 3300026116 Bacteria 2322
824 Ga0207674_10197918 3300026116 Bacteria 1959
825 Ga0207674_10315664 3300026116 Bacteria 1512
826 Ga0207675_100042310 3300026118 Bacteria 4253
827 Ga0207675_100046452 3300026118 Bacteria 4056
828 Ga0207675_100142064 3300026118 Bacteria 2281
829 Ga0207675_100145872 3300026118 Bacteria 2251
830 Ga0207675_100335032 3300026118 Bacteria 1480
831 Ga0207675_100378465 3300026118 Bacteria 1392
832 Ga0207675_100907301 3300026118 Bacteria 898
833 Ga0207683_10024420 3300026121 Bacteria 5206
834 Ga0207683_10055966 3300026121 Bacteria 3459
835 Ga0207683_10621886 3300026121 Bacteria 1000
836 Ga0207683_11016654 3300026121 Bacteria 769
837 Ga0207698_10373186 3300026142 Bacteria 1355
838 Ga0207698_10775791 3300026142 Bacteria 959
839 Ga0207698_11221566 3300026142 Bacteria 766
840 Ga0209967_1018162 3300027364 Bacteria 1017
841 Ga0209996_1013832 3300027395 Bacteria 1093
842 Ga0209996_1026910 3300027395 Bacteria 826
843 Ga0210000_1014248 3300027462 Bacteria 1190
844 Ga0209179_1001862 3300027512 Bacteria 2713
845 Ga0209968_1008141 3300027526 Bacteria 1595
846 Ga0209999_1065856 3300027543 Bacteria 692
847 Ga0209970_1052455 3300027614 Bacteria 739
848 Ga0209983_1131258 3300027665 Bacteria 573
849 Ga0209282_1140900 3300027666 Bacteria 1178
850 Ga0209588_1058651 3300027671 Bacteria 1244
851 Ga0209971_1047697 3300027682 Bacteria 1034
852 Ga0209971_1057339 3300027682 Bacteria 942
853 Ga0209966_1056340 3300027695 Bacteria 843
854 Ga0209998_10002265 3300027717 Bacteria 4451
855 Ga0209974_10123172 3300027876 Bacteria 920
856 Ga0209974_10136706 3300027876 Bacteria 877
857 Ga0209974_10182486 3300027876 Bacteria 769
858 Ga0207428_10002594 3300027907 Bacteria 18052
859 Ga0207428_10006431 3300027907 Bacteria 10850
860 Ga0207428_10008559 3300027907 Bacteria 9233
861 Ga0207428_10026062 3300027907 Bacteria 4885
862 Ga0265354_1002018 3300028016 Bacteria 2654
863 Ga0265356_1017450 3300028017 Bacteria 777
864 Ga0265356_1029308 3300028017 Bacteria 598
865 Ga0265357_1000774 3300028023 Bacteria 2075
866 Ga0265355_1001702 3300028036 Bacteria 1466
867 Ga0268266_10000392 3300028379 Bacteria 66301
868 Ga0268266_10002024 3300028379 Bacteria 22580
869 Ga0268266_10009975 3300028379 Bacteria 8338
870 Ga0268266_10012788 3300028379 Bacteria 7251
871 Ga0268266_10014903 3300028379 Bacteria 6676
872 Ga0268266_10086412 3300028379 Bacteria 2742
873 Ga0268266_10267985 3300028379 Bacteria 1584
874 Ga0268266_10681221 3300028379 Bacteria 990
875 Ga0268265_10012234 3300028380 Bacteria 5812
876 Ga0268265_10124822 3300028380 Bacteria 2128
877 Ga0268265_10258996 3300028380 Bacteria 1545
878 Ga0268265_10310624 3300028380 Bacteria 1423
879 Ga0268265_10431371 3300028380 Bacteria 1226
880 Ga0268265_10695224 3300028380 Bacteria 982
881 Ga0268265_10758609 3300028380 Bacteria 942
882 Ga0268265_10970044 3300028380 Bacteria 838
883 Ga0268265_11462624 3300028380 Bacteria 686
884 Ga0268264_10000057 3300028381 Bacteria 309824
885 Ga0268264_10000165 3300028381 Bacteria 147648
886 Ga0268264_10000348 3300028381 Bacteria 70273
887 Ga0268264_10017184 3300028381 Bacteria 5925
888 Ga0268264_10075150 3300028381 Bacteria 2872
889 Ga0268264_10204353 3300028381 Bacteria 1809
890 Ga0268264_10253325 3300028381 Bacteria 1636
891 Ga0268264_10582629 3300028381 Bacteria 1101
892 Ga0268264_11445173 3300028381 Bacteria 698
893 Ga0265319_1193705 3300028563 Bacteria 624
894 Ga0265334_10000123 3300028573 Bacteria 50146
895 Ga0265318_10001505 3300028577 Bacteria 13592
896 Ga0307515_10010000 3300028794 Bacteria 18265
897 Ga0265338_10008882 3300028800 Bacteria 12109
898 Ga0265338_10013818 3300028800 Bacteria 9072
899 Ga0265338_10021377 3300028800 Bacteria 6750
900 Ga0265338_10421732 3300028800 Bacteria 948
901 Ga0265324_10181696 3300029957 Bacteria 714
902 Ga0307511_10042260 3300030521 Bacteria 3832
903 Ga0307511_10324335 3300030521 Bacteria 679
904 Ga0265762_1150451 3300030760 Bacteria 554
905 Ga0265777_122563 3300030877 Bacteria 527
906 Ga0265770_1001311 3300030878 Bacteria 3438
907 Ga0265770_1150366 3300030878 Bacteria 511
908 Ga0265765_1032431 3300030879 Bacteria 671
909 Ga0265771_1010170 3300031010 Bacteria 686
910 Ga0265773_1003947 3300031018 Bacteria 1001
911 Ga0265760_10001990 3300031090 Bacteria 6005
912 Ga0265760_10016230 3300031090 Bacteria 2136
913 Ga0265760_10097309 3300031090 Bacteria 927
914 Ga0265330_10041457 3300031235 Bacteria 2041
915 Ga0265332_10001382 3300031238 Bacteria 13676
916 Ga0265328_10002748 3300031239 Bacteria 7869
917 Ga0265328_10005971 3300031239 Bacteria 5184
918 Ga0265320_10003145 3300031240 Bacteria 11199
919 Ga0265320_10066967 3300031240 Bacteria 1701
920 Ga0265325_10002490 3300031241 Bacteria 12415
921 Ga0265329_10000811 3300031242 Bacteria 15899
922 Ga0265340_10010255 3300031247 Bacteria 5016
923 Ga0265340_10053569 3300031247 Bacteria 1948
924 Ga0265340_10139708 3300031247 Bacteria 1108
925 Ga0265339_10004690 3300031249 Bacteria 9276
926 Ga0265331_10002545 3300031250 Bacteria 12263
927 Ga0265316_10005931 3300031344 Bacteria 11762
928 Ga0265316_10051925 3300031344 Bacteria 3218
929 Ga0265316_10169581 3300031344 Bacteria 1629
930 Ga0307513_10052634 3300031456 Bacteria 4382
931 Ga0307513_10326274 3300031456 Bacteria 1291
932 Ga0307509_10000189 3300031507 Bacteria 96946
933 Ga0307509_10730397 3300031507 Bacteria 656
934 Ga0307408_100053153 3300031548 Bacteria 2924
935 Ga0307408_100063217 3300031548 Bacteria 2707
936 Ga0307408_100785696 3300031548 Bacteria 863
937 Ga0307408_100790828 3300031548 Bacteria 860
938 Ga0307408_101432044 3300031548 Bacteria 651
939 Ga0265313_10002136 3300031595 Bacteria 17574
940 Ga0265313_10047515 3300031595 Bacteria 2077
941 Ga0307508_10779035 3300031616 Bacteria 572
942 Ga0307508_10810086 3300031616 Bacteria 554
943 Ga0316575_10005089 3300031665 Bacteria 4664
944 Ga0316575_10072461 3300031665 Bacteria 1385
945 Ga0265314_10006700 3300031711 Bacteria 10117
946 Ga0265342_10003334 3300031712 Bacteria 13255
947 Ga0316576_10004557 3300031727 Bacteria 8332
948 Ga0316576_10016705 3300031727 Bacteria 4967
949 Ga0316576_10142303 3300031727 Bacteria 1806
950 Ga0316578_10001021 3300031728 Bacteria 10737
951 Ga0316578_10266878 3300031728 Bacteria 1026
952 Ga0316578_10609616 3300031728 Bacteria 639
953 Ga0307516_10000423 3300031730 Bacteria 55387
954 Ga0307516_10874425 3300031730 Bacteria 564
955 Ga0307405_10024050 3300031731 Bacteria 3473
956 Ga0307405_10680904 3300031731 Bacteria 849
957 Ga0307405_10794564 3300031731 Bacteria 792
958 Ga0307405_10948993 3300031731 Bacteria 731
959 Ga0307405_11886814 3300031731 Bacteria 533
960 Ga0316577_10300597 3300031733 Bacteria 909
961 Ga0307413_10229377 3300031824 Bacteria 1362
962 Ga0307413_10504397 3300031824 Bacteria 972
963 Ga0307413_11159904 3300031824 Bacteria 670
964 Ga0307410_10063447 3300031852 Bacteria 2534
965 Ga0307410_10065142 3300031852 Bacteria 2506
966 Ga0307410_10917774 3300031852 Bacteria 751
967 Ga0307410_11140255 3300031852 Bacteria 677
968 Ga0307406_10166578 3300031901 Bacteria 1590
969 Ga0307406_10723069 3300031901 Bacteria 833
970 Ga0307407_10260526 3300031903 Bacteria 1192
971 Ga0307407_10636375 3300031903 Bacteria 798
972 Ga0307412_10214112 3300031911 Bacteria 1472
973 Ga0307412_12083520 3300031911 Bacteria 526
974 Ga0307409_100185402 3300031995 Bacteria 1846
975 Ga0307409_100508564 3300031995 Bacteria 1174
976 Ga0307409_101768807 3300031995 Bacteria 647
977 Ga0307409_101778524 3300031995 Bacteria 645
978 Ga0307416_100278174 3300032002 Bacteria 1648
979 Ga0307416_100550973 3300032002 Bacteria 1226
980 Ga0307416_100613069 3300032002 Bacteria 1169
981 Ga0307416_101648148 3300032002 Bacteria 746
982 Ga0307414_10292001 3300032004 Bacteria 1375
983 Ga0307414_12032772 3300032004 Bacteria 536
984 Ga0307411_10112106 3300032005 Bacteria 1954
985 Ga0307411_10335631 3300032005 Bacteria 1226
986 Ga0307411_10411779 3300032005 Bacteria 1120
987 Ga0307411_11057229 3300032005 Bacteria 729
988 Ga0307411_11332163 3300032005 Bacteria 655
989 Ga0307415_100001511 3300032126 Bacteria 11159
990 Ga0307415_100357894 3300032126 Bacteria 1231
991 Ga0307415_100748602 3300032126 Bacteria 887
992 Ga0316585_10030383 3300032137 Bacteria 1694
993 Ga0316580_10004948 3300032139 Bacteria 3875
994 Ga0307510_10001790 3300033180 Bacteria 23983
995 Ga0307510_10355367 3300033180 Bacteria 915
996 Ga0316212_1047236 3300033547 Bacteria 611
997 Ga0373950_0069518 3300034818 Bacteria 719
998 Ga0373958_0016754 3300034819 Bacteria 1309
999 Ga0373958_0122642 3300034819 Bacteria 629
1000 Ga0373938_0082633 3300034957 Bacteria 784
1001 Ga0373928_0013841 3300035084 Bacteria 1623
1002 Ga0373929_0099239 3300035085 Bacteria 732
1003 Ga0373934_0185130 3300035086 Bacteria 856
1004 Ga0373940_0071490 3300035088 Bacteria 1011
1005 Ga0373949_0039405 3300035090 Bacteria 1157
1006 Ga0373951_0082305 3300035091 Bacteria 835
1007 Ga0373923_0124926 3300035111 Bacteria 1152
1008 Ga0373923_0343697 3300035111 Bacteria 712
1009 Ga0373923_0370125 3300035111 Bacteria 686
1010 Ga0373932_0113214 3300035112 Bacteria 897
1011 Ga0373936_0027228 3300035113 Bacteria 2242
1012 Ga0373939_0047646 3300035114 Bacteria 1317
1013 Ga0373941_0060891 3300035115 Bacteria 1228
1014 Ga0373953_0157626 3300035117 Bacteria 975
1015 Ga0373953_0209399 3300035117 Bacteria 844
1016 Ga0373953_0222810 3300035117 Bacteria 817
1017 Ga0373954_0049752 3300035118 Bacteria 1966
1018 Ga0373954_0073506 3300035118 Bacteria 1627
1019 Ga0373957_0101976 3300035120 Bacteria 1150
1020 Ga0373957_0173888 3300035120 Bacteria 891
1021 Ga0373955_0075611 3300035172 Bacteria 1893
1022 Ga0373955_0295342 3300035172 Bacteria 976
1023 Ga0373955_0429121 3300035172 Bacteria 804
1024 Ga0373955_0527194 3300035172 Bacteria 722
1025 Ga0373955_0545013 3300035172 Bacteria 709
1026 Ga0373942_0189103 3300035207 Bacteria 678
1027 Ga0316574_0000008 3300035398 Bacteria 48126
1028 Ga0316574_0004042 3300035398 Bacteria 7645
1029 Ga0316574_0036525 3300035398 Bacteria 3008
1030 Ga0316574_0077564 3300035398 Bacteria 2106
1031 Ga0316574_0335484 3300035398 Bacteria 958
1032 Ga0316574_0481243 3300035398 Bacteria 775
1033 Ga0316574_1000376 3300035398 Bacteria 503
1034 Ga0373924_0049896 3300035410 Bacteria 1733
1035 Ga0373924_0303553 3300035410 Bacteria 709
1036 Ga0373924_0541848 3300035410 Bacteria 524
1037 Ga0373931_0525010 3300035691 Bacteria 766
1038 Ga0373935_0401222 3300035692 Bacteria 985
1039 Ga0373935_0502596 3300035692 Bacteria 880
1040 Ga0373927_0051249 3300035695 Bacteria 2669
1041 Ga0373933_0060043 3300035724 Bacteria 2292
1042 Ga0373933_0455934 3300035724 Bacteria 836
1043 Ga0373933_0706142 3300035724 Bacteria 663
1044 Ga0373947_0147545 3300035725 Bacteria 1513
1045 Ga0373947_0294453 3300035725 Bacteria 1081
1046 Ga0373937_0003618 3300036401 Bacteria 13034
1047 Ga0373937_0016775 3300036401 Bacteria 6511
1048 Ga0373937_0039869 3300036401 Bacteria 4280
1049 Ga0373937_0266404 3300036401 Bacteria 1616
1050 Ga0373937_0317423 3300036401 Bacteria 1474
1051 Ga0373937_0488915 3300036401 Bacteria 1169
1052 Ga0373937_0631185 3300036401 Bacteria 1016
1053 Ga0316582_0014377 3300036647 Bacteria 4490
1054 Ga0316584_0003999 3300036712 Bacteria 9698
1055 Ga0316584_0032987 3300036712 Bacteria 3833
1056 Ga0316584_0115800 3300036712 Bacteria 2005
1057 Ga0316584_0708044 3300036712 Bacteria 690
1058 Ga0373925_0023959 3300037068 Bacteria 4453
1059 Ga0373925_0024612 3300037068 Bacteria 4397
1060 Ga0373925_0821241 3300037068 Bacteria 766
1061 Ga0373925_1020664 3300037068 Bacteria 681
1062 Ga0395900_0904878 3300037418 Bacteria 806
1063 Ga0395905_0745292 3300037471 Bacteria 882
1064 Ga0436364_0162892 3300037853 Bacteria 990
1065 Ga0436365_0377198 3300039437 Bacteria 965
1066 Ga0436365_0407525 3300039437 Bacteria 839
1067 Ga0436365_1019286 3300039437 Bacteria 2072
1068 Ga0436365_1023348 3300039437 Bacteria 5152
1069 Ga0436365_1891849 3300039437 Bacteria 1335
1070 Ga0436360_0327579 3300039438 Bacteria 571
1071 Ga0436360_0525623 3300039438 Bacteria 16677
1072 Ga0436360_1167873 3300039438 Bacteria 922
1073 Ga0436361_0982899 3300039447 Bacteria 1012
1074 Ga0436363_0035707 3300039450 Bacteria 1351
1075 Ga0436363_0331678 3300039450 Bacteria 1658
1076 Ga0436363_0401150 3300039450 Bacteria 745
1077 Ga0436363_0563147 3300039450 Bacteria 793
1078 Ga0436362_0126569 3300039453 Bacteria 5039
1079 Ga0436362_0394144 3300039453 Bacteria 1024
1080 Ga0439436_0258204 3300041404 Bacteria 507
1081 Ga0439439_0192470 3300041406 Bacteria 591
1082 Ga0439447_049395 3300041407 Bacteria 1007
1083 Ga0439447_142854 3300041407 Bacteria 550
1084 Ga0439461_0119655 3300041410 Bacteria 657
1085 Ga0439465_0368206 3300041413 Bacteria 544
1086 Ga0451789_0291202 3300041443 Bacteria 520
1087 Ga0451793_1114941 3300041452 Bacteria 564
1088 Ga0451799_30402 3300041454 Bacteria 555
1089 Ga0451798_0061378 3300041458 Bacteria 770
1090 Ga0451804_1089028 3300041463 Bacteria 1120
1091 Ga0451807_2424518 3300041486 Bacteria 683
1092 Ga0451839_1008795 3300041496 Bacteria 2138
1093 Ga0451841_0425714 3300041498 Bacteria 3013
1094 Ga0451845_0225953 3300041501 Bacteria 511
1095 Ga0451846_61009 3300041502 Bacteria 1009
1096 Ga0451850_18457 3300041506 Bacteria 668
1097 Ga0451851_0921106 3300041507 Bacteria 1565
1098 Ga0451853_1577538 3300041512 Bacteria 857
1099 Ga0451853_3187295 3300041512 Bacteria 1061
1100 Ga0451853_3268539 3300041512 Bacteria 994
1101 Ga0452268_41072 3300041907 Bacteria 603
1102 Ga0452271_32386 3300041916 Bacteria 671
1103 Ga0439431_0083965 3300041997 Bacteria 861
1104 Ga0439433_0040214 3300041999 Bacteria 1087
1105 Ga0439441_047092 3300042001 Bacteria 879
1106 Ga0439442_152000 3300042002 Bacteria 515
1107 Ga0439443_002397 3300042003 Bacteria 2238
1108 Ga0439448_0213124 3300042005 Bacteria 678
1109 Ga0439449_0098130 3300042007 Bacteria 1082
1110 Ga0439451_135894 3300042009 Bacteria 503
1111 Ga0439456_050303 3300042013 Bacteria 910
1112 Ga0439457_025299 3300042014 Bacteria 1314
1113 Ga0439462_0138330 3300042015 Bacteria 682
1114 Ga0439463_106383 3300042016 Bacteria 724
1115 Ga0450912_013395 3300042116 Bacteria 733
1116 Ga0450914_015638 3300042118 Bacteria 796
1117 Ga0450919_040162 3300042121 Bacteria 543
1118 Ga0450920_029397 3300042122 Bacteria 1079
1119 Ga0450921_002385 3300042123 Bacteria 1246
1120 Ga0450923_075394 3300042125 Bacteria 753
1121 Ga0450923_144706 3300042125 Bacteria 572
1122 Ga0450888_015764 3300042126 Bacteria 925
1123 Ga0450890_013971 3300042127 Bacteria 1052
1124 Ga0450890_021116 3300042127 Bacteria 884
1125 Ga0450897_018552 3300042128 Bacteria 731
1126 Ga0450892_039091 3300042130 Bacteria 518
1127 Ga0450894_021638 3300042131 Bacteria 870
1128 Ga0450895_007646 3300042132 Bacteria 897
1129 Ga0450895_007763 3300042132 Bacteria 892
1130 Ga0450896_000823 3300042133 Bacteria 3517
1131 Ga0450896_001057 3300042133 Bacteria 3239
1132 Ga0450898_005988 3300042134 Bacteria 1856
1133 Ga0450900_050043 3300042136 Bacteria 639
1134 Ga0450906_018003 3300042145 Bacteria 1270
1135 Ga0450907_021884 3300042146 Bacteria 1076
1136 Ga0439446_0007988 3300042156 Bacteria 2795
1137 Ga0439446_0029029 3300042156 Bacteria 1595
1138 Ga0439446_0080440 3300042156 Bacteria 1008
1139 Ga0439446_0263132 3300042156 Bacteria 598
1140 Ga0439458_0054890 3300042157 Bacteria 988
1141 Ga0450908_000192 3300042184 Bacteria 12530
1142 Ga0450908_008697 3300042184 Bacteria 1898
1143 Ga0450908_059215 3300042184 Bacteria 672
1144 Ga0450909_010586 3300042185 Bacteria 1349
1145 Ga0439434_0019108 3300042435 Bacteria 2054
1146 Ga0439444_0003242 3300042437 Bacteria 2288
1147 Ga0439444_0032882 3300042437 Bacteria 983
1148 Ga0439459_0234918 3300042438 Bacteria 513
1149 Ga0439464_0219560 3300042439 Bacteria 609
1150 Ga0439460_0037722 3300042461 Bacteria 1406
1151 Ga0439460_0258504 3300042461 Bacteria 603
1152 Ga0450916_107861 3300042530 Bacteria 500
1153 Ga0450918_066275 3300042531 Bacteria 673
1154 Ga0450893_0059821 3300042532 Bacteria 726
1155 Ga0450893_0098607 3300042532 Bacteria 593
1156 Ga0450893_0126900 3300042532 Bacteria 536
1157 Ga0451577_0026508 3300042876 Bacteria 5249
1158 Ga0451577_0071068 3300042876 Bacteria 3103
1159 Ga0451577_0232659 3300042876 Bacteria 1667
1160 Ga0439440_0023912 3300042993 Bacteria 1397
1161 Ga0466969_0000848 3300044656 Bacteria 16567
1162 Ga0466969_0003618 3300044656 Bacteria 8229
1163 Ga0466972_0062906 3300044658 Bacteria 1778
1164 Ga0466972_0070188 3300044658 Bacteria 1672
1165 Ga0466965_0093846 3300044683 Bacteria 1529
1166 Ga0466966_0006187 3300044684 Bacteria 7914
1167 Ga0466966_0334759 3300044684 Bacteria 910
1168 Ga0466961_0005473 3300044693 Bacteria 8007
1169 Ga0466963_0129568 3300044694 Bacteria 1742
1170 Ga0466964_0000149 3300044706 Bacteria 18838
1171 Ga0453684_0100243 3300044712 Bacteria 3545
1172 Ga0453684_0710947 3300044712 Bacteria 1091
1173 Ga0453684_0740785 3300044712 Bacteria 1065
1174 Ga0466971_0000098 3300044719 Bacteria 31871
1175 Ga0466971_0087825 3300044719 Bacteria 1422
1176 Ga0466968_0005494 3300044735 Bacteria 4744
1177 Ga0466970_0006751 3300044765 Bacteria 5743
1178 Ga0466957_0044272 3300044842 Bacteria 2697
1179 Ga0466960_0034653 3300044901 Bacteria 2354
1180 Ga0466959_0020278 3300045049 Bacteria 4895
1181 Ga0451576_0043483 3300045051 Bacteria 4740
1182 Ga0451576_0104353 3300045051 Bacteria 2948
1183 Ga0451576_0156108 3300045051 Bacteria 2380
1184 Ga0451576_0218229 3300045051 Bacteria 1991
1185 Ga0451576_1150502 3300045051 Bacteria 811
1186 Ga0466958_0064653 3300045836 Bacteria 2232
1187 Ga0466967_1180654 3300045976 Bacteria 763
1188 Ga0495603_0075386 3300046455 Bacteria 1980
1189 Ga0495638_0090616 3300046460 Bacteria 1843
1190 Ga0495651_0320767 3300046462 Bacteria 1033
1191 Ga0495650_0004549 3300046471 Bacteria 9467
1192 Ga0495582_0171281 3300046473 Bacteria 1236
1193 Ga0495582_0282462 3300046473 Bacteria 953
1194 Ga0495639_0197200 3300046475 Bacteria 984
1195 Ga0495639_0218363 3300046475 Bacteria 937
1196 Ga0495639_0403790 3300046475 Bacteria 690
1197 Ga0495584_0156842 3300046491 Bacteria 1157
1198 Ga0495585_0251056 3300046492 Bacteria 883
1199 Ga0495596_0106321 3300046500 Bacteria 1090
1200 Ga0495606_0125158 3300046507 Bacteria 1534
1201 Ga0495608_0714315 3300046511 Bacteria 596
1202 Ga0495628_1162360 3300046516 Bacteria 525
1203 Ga0495630_0058019 3300046517 Bacteria 2902
1204 Ga0495632_0037117 3300046519 Bacteria 2475
1205 Ga0495632_0128137 3300046519 Bacteria 1182
1206 Ga0495632_0218911 3300046519 Bacteria 861
1207 Ga0495632_0268102 3300046519 Bacteria 762
1208 Ga0495648_0437045 3300046524 Bacteria 576
1209 Ga0495666_0231105 3300046526 Bacteria 845
1210 Ga0495666_0257055 3300046526 Bacteria 795
1211 Ga0495652_0840483 3300046529 Bacteria 609
1212 Ga0495654_0411180 3300046530 Bacteria 536
1213 Ga0495586_0092668 3300046535 Bacteria 1670
1214 Ga0495586_0326422 3300046535 Bacteria 880
1215 Ga0495586_0445947 3300046535 Bacteria 746
1216 Ga0495609_0022742 3300046538 Bacteria 2888
1217 Ga0495645_0651452 3300046543 Bacteria 643
1218 Ga0495622_0397610 3300046557 Bacteria 594
1219 Ga0495668_0136290 3300046616 Bacteria 1344
1220 Ga0495668_0603974 3300046616 Bacteria 606
1221 Ga0495668_0641655 3300046616 Bacteria 587
1222 Ga0495634_0279558 3300046642 Bacteria 1014
1223 Ga0495611_0324033 3300046648 Bacteria 709
1224 Ga0495625_0129979 3300046660 Bacteria 1707
1225 Ga0495625_0178817 3300046660 Bacteria 1412
1226 Ga0495625_0488389 3300046660 Bacteria 755
1227 Ga0495625_0499700 3300046660 Bacteria 744
1228 Ga0495657_0406019 3300046675 Bacteria 801
1229 Ga0495599_0170708 3300046678 Bacteria 1342
1230 Ga0495623_0721155 3300046679 Bacteria 509
1231 Ga0495658_0052808 3300046683 Bacteria 2306
1232 Ga0495658_0173561 3300046683 Bacteria 1335
1233 Ga0495658_1033422 3300046683 Bacteria 524
1234 Ga0495669_0435268 3300046684 Bacteria 636
1235 Ga0495669_0627373 3300046684 Bacteria 523
1236 Ga0495624_0384492 3300046690 Bacteria 843
1237 Ga0495671_0443699 3300046692 Bacteria 620
1238 Ga0495649_0246279 3300046694 Bacteria 919
1239 Ga0495604_0260761 3300047317 Bacteria 1178
1240 Ga0495674_0063872 3300047319 Bacteria 3202
1241 Ga0495674_0781369 3300047319 Bacteria 744
1242 Ga0495672_0069285 3300047320 Bacteria 2003
1243 Ga0495680_0242678 3300047322 Bacteria 1279
1244 Ga0495680_0338892 3300047322 Bacteria 1049
1245 Ga0495687_077811 3300047443 Bacteria 1309
1246 Ga0495686_0366778 3300047472 Bacteria 780
1247 Ga0495602_0480890 3300048088 Bacteria 871
1248 Ga0495626_0088816 3300048091 Bacteria 1362
1249 Ga0496100_0016220 3300048903 Bacteria 4369
1250 Ga0496100_0850778 3300048903 Bacteria 715
1251 Ga0496101_0043234 3300048904 Bacteria 3219
1252 Ga0496101_0310089 3300048904 Bacteria 1237
1253 Ga0496101_0428937 3300048904 Bacteria 1042
1254 Ga0496101_0633831 3300048904 Bacteria 845
1255 Ga0496102_0021181 3300048905 Bacteria 5748
1256 Ga0496102_0250307 3300048905 Bacteria 1670
1257 Ga0496103_0094054 3300048906 Bacteria 1893
1258 Ga0496103_0286687 3300048906 Bacteria 1059
1259 Ga0496104_0021988 3300048907 Bacteria 5859
1260 Ga0496104_0129108 3300048907 Bacteria 2427
1261 Ga0496104_0150659 3300048907 Bacteria 2233
1262 Ga0496104_0438092 3300048907 Bacteria 1219
1263 Ga0496104_0572269 3300048907 Bacteria 1040
1264 Ga0496105_0006911 3300048908 Bacteria 8735
1265 Ga0496105_0014994 3300048908 Bacteria 6166
1266 Ga0496105_0057715 3300048908 Bacteria 3205
1267 Ga0496106_0047403 3300048909 Bacteria 3234
1268 Ga0496106_0131994 3300048909 Bacteria 1959
1269 Ga0496106_0163360 3300048909 Bacteria 1762
1270 Ga0496106_0422504 3300048909 Bacteria 1071
1271 Ga0496107_0001841 3300048910 Bacteria 13389
1272 Ga0496107_0107883 3300048910 Bacteria 2045
1273 Ga0496107_0129988 3300048910 Bacteria 1859
1274 Ga0496107_0185344 3300048910 Bacteria 1546
1275 Ga0496107_0553541 3300048910 Bacteria 852
1276 Ga0496107_0853388 3300048910 Bacteria 665
1277 Ga0496108_0002437 3300048911 Bacteria 14865
1278 Ga0496108_0039201 3300048911 Bacteria 3950
1279 Ga0496108_0434119 3300048911 Bacteria 1147
1280 Ga0496109_0018965 3300048912 Bacteria 6057
1281 Ga0496109_0027251 3300048912 Bacteria 5101
1282 Ga0496109_1521207 3300048912 Bacteria 604
1283 Ga0496110_0002260 3300048913 Bacteria 14391
1284 Ga0496110_1621609 3300048913 Bacteria 557
1285 Ga0496111_0042076 3300048914 Bacteria 3280
1286 Ga0496111_0085716 3300048914 Bacteria 2303
1287 Ga0496111_0624307 3300048914 Bacteria 788
1288 Ga0496112_0009255 3300048915 Bacteria 8855
1289 Ga0496112_0011818 3300048915 Bacteria 7995
1290 Ga0496112_0051443 3300048915 Bacteria 4041
1291 Ga0496112_0082474 3300048915 Bacteria 3180
1292 Ga0496113_0027417 3300048916 Bacteria 4084
1293 Ga0496113_0128272 3300048916 Bacteria 1988
1294 Ga0496113_0146811 3300048916 Bacteria 1859
1295 Ga0496114_0002691 3300048917 Bacteria 13577
1296 Ga0496114_0009814 3300048917 Bacteria 7608
1297 Ga0496114_0009986 3300048917 Bacteria 7547
1298 Ga0496114_0149762 3300048917 Bacteria 2024
1299 Ga0496114_0277221 3300048917 Bacteria 1478
1300 Ga0496115_0009121 3300048918 Bacteria 7362
1301 Ga0496115_0089907 3300048918 Bacteria 2508
1302 Ga0496115_0099698 3300048918 Bacteria 2381
1303 Ga0496115_0167546 3300048918 Bacteria 1817
1304 Ga0496115_0339075 3300048918 Bacteria 1227
1305 Ga0496115_0443371 3300048918 Bacteria 1049
1306 Ga0496116_0049718 3300048919 Bacteria 2800
1307 Ga0496117_0000228 3300048920 Bacteria 106070
1308 Ga0496118_0000005 3300048921 Bacteria 697350
1309 Ga0496119_0071045 3300048922 Bacteria 2039
1310 Ga0496120_0003140 3300048923 Bacteria 15466
1311 Ga0496121_0000522 3300048924 Bacteria 73298
1312 Ga0496121_0034180 3300048924 Bacteria 4580
1313 Ga0496121_0104368 3300048924 Bacteria 2178
1314 Ga0496122_0400685 3300048925 Bacteria 697
1315 Ga0496124_0006063 3300048927 Bacteria 13304
1316 Ga0496125_0001732 3300048928 Bacteria 30347
1317 Ga0496125_0008666 3300048928 Bacteria 10595
1318 Ga0496125_0046500 3300048928 Bacteria 3640
1319 Ga0496126_0006131 3300048929 Bacteria 13471
1320 Ga0496126_0007001 3300048929 Bacteria 12457
1321 Ga0496126_0225698 3300048929 Bacteria 1571
1322 Ga0496126_0234217 3300048929 Bacteria 1537
1323 Ga0501306_019749 3300049127 Bacteria 932
1324 Ga0495682_0089028 3300049460 Bacteria 1109
1325 Ga0501291_074711 3300049514 Bacteria 663
1326 Ga0501292_063228 3300049515 Bacteria 675
1327 Ga0501294_016082 3300049517 Bacteria 777
1328 Ga0501295_199824 3300049518 Bacteria 504
1329 Ga0501299_053130 3300049522 Bacteria 841
1330 Ga0501299_081347 3300049522 Bacteria 720
1331 Ga0501300_034043 3300049523 Bacteria 756
1332 Ga0501301_008534 3300049524 Bacteria 809
1333 Ga0501031_0100963 3300049568 Bacteria 1883
1334 Ga0501031_0319551 3300049568 Bacteria 1006
1335 Ga0501032_0028835 3300049569 Bacteria 3812
1336 Ga0501032_0401060 3300049569 Bacteria 881
1337 Ga0501033_0402185 3300049570 Bacteria 955
1338 Ga0501033_0689557 3300049570 Bacteria 696
1339 Ga0501034_0136286 3300049571 Bacteria 2436
1340 Ga0501034_1177008 3300049571 Bacteria 646
1341 Ga0501036_0000947 3300049572 Bacteria 21826
1342 Ga0501036_0031170 3300049572 Bacteria 4505
1343 Ga0501036_0053598 3300049572 Bacteria 3415
1344 Ga0501036_0444443 3300049572 Bacteria 1080
1345 Ga0501037_0016924 3300049573 Bacteria 5365
1346 Ga0501038_0011051 3300049574 Bacteria 8245
1347 Ga0501038_0146197 3300049574 Bacteria 1930
1348 Ga0501038_0323332 3300049574 Bacteria 1206
1349 Ga0501039_0000322 3300049575 Bacteria 34031
1350 Ga0501039_0050028 3300049575 Bacteria 3232
1351 Ga0501039_0197629 3300049575 Bacteria 1581
1352 Ga0501039_0595879 3300049575 Bacteria 866
1353 Ga0501039_0691882 3300049575 Bacteria 797
1354 Ga0501039_1048478 3300049575 Bacteria 633
1355 Ga0501039_1218041 3300049575 Bacteria 582
1356 Ga0501040_0000188 3300049576 Bacteria 35587
1357 Ga0501040_0010458 3300049576 Bacteria 6068
1358 Ga0501040_0624474 3300049576 Bacteria 779
1359 Ga0501041_0000269 3300049577 Bacteria 24672
1360 Ga0501041_0028556 3300049577 Bacteria 3365
1361 Ga0501041_0032199 3300049577 Bacteria 3169
1362 Ga0501041_0177185 3300049577 Bacteria 1335
1363 Ga0501041_0453293 3300049577 Bacteria 814
1364 Ga0501041_1066210 3300049577 Bacteria 520
1365 Ga0501042_0035564 3300049578 Bacteria 3533
1366 Ga0501042_0196877 3300049578 Bacteria 1453
1367 Ga0501043_0008846 3300049579 Bacteria 7923
1368 Ga0501043_0228276 3300049579 Bacteria 1439
1369 Ga0501046_0032906 3300049580 Bacteria 4195
1370 Ga0501046_0065390 3300049580 Bacteria 2837
1371 Ga0501046_0487364 3300049580 Bacteria 884
1372 Ga0501046_0567786 3300049580 Bacteria 807
1373 Ga0501047_0339511 3300049581 Bacteria 1340
1374 Ga0501047_0560936 3300049581 Bacteria 966
1375 Ga0501047_1054888 3300049581 Bacteria 626
1376 Ga0501048_0002660 3300049582 Bacteria 13638
1377 Ga0501048_0036457 3300049582 Bacteria 3535
1378 Ga0501048_0505723 3300049582 Bacteria 866
1379 Ga0501048_1169945 3300049582 Bacteria 553
1380 Ga0501067_0007150 3300049583 Bacteria 6200
1381 Ga0501068_0036761 3300049584 Bacteria 2930
1382 Ga0501068_0556078 3300049584 Bacteria 746
1383 Ga0501069_0108047 3300049585 Bacteria 1583
1384 Ga0501069_0500446 3300049585 Bacteria 725
1385 Ga0501070_0582021 3300049586 Bacteria 894
1386 Ga0501071_0014106 3300049587 Bacteria 5463
1387 Ga0501071_0025539 3300049587 Bacteria 4139
1388 Ga0501071_0121000 3300049587 Bacteria 1940
1389 Ga0501071_0152726 3300049587 Bacteria 1723
1390 Ga0501071_0213057 3300049587 Bacteria 1453
1391 Ga0501071_0310494 3300049587 Bacteria 1196
1392 Ga0501071_0374430 3300049587 Bacteria 1085
1393 Ga0501071_0600918 3300049587 Bacteria 846
1394 Ga0501071_1137620 3300049587 Bacteria 603
1395 Ga0501071_1174680 3300049587 Bacteria 593
1396 Ga0501072_0002259 3300049588 Bacteria 14395
1397 Ga0501072_0038934 3300049588 Bacteria 3732
1398 Ga0501072_0045324 3300049588 Bacteria 3457
1399 Ga0501072_0261277 3300049588 Bacteria 1378
1400 Ga0501072_0297632 3300049588 Bacteria 1283
1401 Ga0501072_0690634 3300049588 Bacteria 802
1402 Ga0501073_0014788 3300049589 Bacteria 5666
1403 Ga0501073_0152515 3300049589 Bacteria 1601
1404 Ga0501073_0179814 3300049589 Bacteria 1464
1405 Ga0501073_0204240 3300049589 Bacteria 1366
1406 Ga0501073_0735081 3300049589 Bacteria 681
1407 Ga0501074_0414237 3300049590 Bacteria 956
1408 Ga0501074_0534173 3300049590 Bacteria 830
1409 Ga0501074_0666513 3300049590 Bacteria 735
1410 Ga0501075_0000082 3300049591 Bacteria 43214
1411 Ga0501075_0042017 3300049591 Bacteria 3427
1412 Ga0501075_0143535 3300049591 Bacteria 1820
1413 Ga0501075_0158999 3300049591 Bacteria 1723
1414 Ga0501075_1521746 3300049591 Bacteria 506
1415 Ga0501076_0006540 3300049592 Bacteria 8455
1416 Ga0501076_0006615 3300049592 Bacteria 8405
1417 Ga0501076_0030447 3300049592 Bacteria 4203
1418 Ga0501076_0047451 3300049592 Bacteria 3396
1419 Ga0501076_0052303 3300049592 Bacteria 3235
1420 Ga0501076_0668716 3300049592 Bacteria 857
1421 Ga0501076_1409431 3300049592 Bacteria 572
1422 Ga0501077_0010560 3300049593 Bacteria 5751
1423 Ga0501077_0049066 3300049593 Bacteria 2682
1424 Ga0501077_0059394 3300049593 Bacteria 2427
1425 Ga0501077_0197227 3300049593 Bacteria 1279
1426 Ga0501216_028415 3300049660 Bacteria 1020
1427 Ga0501217_067008 3300049661 Bacteria 970
1428 Ga0501233_080615 3300049668 Bacteria 837
1429 Ga0501247_089256 3300049677 Bacteria 506
1430 Ga0501249_064476 3300049679 Bacteria 851
1431 Ga0501253_058896 3300049683 Bacteria 823
1432 Ga0501219_016367 3300049703 Bacteria 608
1433 Ga0501225_0041457 3300049705 Bacteria 1270
1434 Ga0501079_0000290 3300049741 Bacteria 31028
1435 Ga0501079_0014415 3300049741 Bacteria 6026
1436 Ga0501079_0058865 3300049741 Bacteria 2964
1437 Ga0501079_0371358 3300049741 Bacteria 1121
1438 Ga0501079_0773406 3300049741 Bacteria 756
1439 Ga0501079_1470233 3300049741 Bacteria 536
1440 Ga0501079_1606202 3300049741 Bacteria 511
1441 Ga0501080_0009710 3300049742 Bacteria 8787
1442 Ga0501080_0140864 3300049742 Bacteria 2230
1443 Ga0501080_0158121 3300049742 Bacteria 2093
1444 Ga0501080_0337875 3300049742 Bacteria 1361
1445 Ga0501080_0519447 3300049742 Bacteria 1063
1446 Ga0501081_0000015 3300049743 Bacteria 57696
1447 Ga0501081_0006175 3300049743 Bacteria 7759
1448 Ga0501081_0050037 3300049743 Bacteria 2878
1449 Ga0501081_0426399 3300049743 Bacteria 984
1450 Ga0501081_1025698 3300049743 Bacteria 624
1451 Ga0501081_1049363 3300049743 Bacteria 616
1452 Ga0501083_0477720 3300049744 Bacteria 811
1453 Ga0501266_014280 3300049763 Bacteria 1040
1454 Ga0501268_108937 3300049765 Bacteria 602
1455 Ga0501270_027915 3300049767 Bacteria 911
1456 Ga0501278_014263 3300049774 Bacteria 674
1457 Ga0501035_0235740 3300049822 Bacteria 1558
1458 Ga0501035_0307350 3300049822 Bacteria 1335
1459 Ga0501035_0330726 3300049822 Bacteria 1279
1460 Ga0501035_0715502 3300049822 Bacteria 806
1461 Ga0501045_0000284 3300049824 Bacteria 29687
1462 Ga0501045_0016097 3300049824 Bacteria 5306
1463 Ga0501045_1284783 3300049824 Bacteria 533
1464 Ga0501212_037303 3300049851 Bacteria 797
1465 nmdc:mga0k408_270731_c1 3300050493 Bacteria 1014
1466 nmdc:mga06z11_581469_c1 3300050494 Bacteria 681
1467 nmdc:mga05p37_381673_c1 3300050507 Bacteria 1651
1468 nmdc:mga05p37_662_c1 3300050507 Bacteria 38035
1469 nmdc:mga05p37_8136_c1 3300050507 Bacteria 12395
1470 nmdc:mga09592_1178559_c1 3300050508 Bacteria 634
1471 nmdc:mga09592_2530_c1 3300050508 Bacteria 14794
1472 nmdc:mga09592_47268_c1 3300050508 Bacteria 3627
1473 nmdc:mga09592_513_c1 3300050508 Bacteria 29327
1474 nmdc:mga0qj67_107101_c1 3300050509 Bacteria 2255
1475 nmdc:mga0qj67_11050_c1 3300050509 Bacteria 6760
1476 nmdc:mga0qj67_14416_c1 3300050509 Bacteria 5976
1477 nmdc:mga0qj67_251514_c1 3300050509 Bacteria 1434
1478 nmdc:mga0qj67_32544_c1 3300050509 Bacteria 4067
1479 nmdc:mga0qj67_51822_c1 3300050509 Bacteria 3246
1480 nmdc:mga0qj67_723954_c1 3300050509 Bacteria 790
1481 nmdc:mga06r32_19490_c1 3300050510 Bacteria 6228
1482 nmdc:mga06r32_2943_c1 3300050510 Bacteria 15261
1483 nmdc:mga06r32_772315_c1 3300050510 Bacteria 923
1484 nmdc:mga06r32_93_c1 3300050510 Bacteria 62195
1485 nmdc:mga08y16_11335_c1 3300050511 Bacteria 9366
1486 nmdc:mga08y16_266615_c1 3300050511 Bacteria 1768
1487 nmdc:mga08y16_30678_c1 3300050511 Bacteria 5655
1488 nmdc:mga08y16_541403_c1 3300050511 Bacteria 1179
1489 nmdc:mga08y16_9557_c1 3300050511 Bacteria 10179
1490 nmdc:mga0n895_1211928_c1 3300050512 Bacteria 728
1491 nmdc:mga0n895_198762_c1 3300050512 Bacteria 2036
1492 nmdc:mga0n895_5728_c1 3300050512 Bacteria 10427
1493 nmdc:mga0n895_635943_c1 3300050512 Bacteria 1067
1494 nmdc:mga0rr50_228421_c1 3300050513 Bacteria 1539
1495 nmdc:mga0rr50_262247_c1 3300050513 Bacteria 1438
1496 nmdc:mga0rr50_279732_c1 3300050513 Bacteria 1392
1497 nmdc:mga0rr50_593413_c1 3300050513 Bacteria 944
1498 nmdc:mga08x19_170284_c1 3300050514 Bacteria 1483
1499 nmdc:mga08x19_635783_c1 3300050514 Bacteria 757
1500 nmdc:mga0a205_1357_c2 3300050515 Bacteria 11423
1501 Ga0495601_0005333 3300053077 Bacteria 7487
1502 Ga0495601_0156897 3300053077 Bacteria 1486
1503 Ga0495601_0178148 3300053077 Bacteria 1390
1504 Ga0495612_0310411 3300053078 Bacteria 708
1505 Ga0500610_0347206 3300053079 Bacteria 630
1506 Ga0495595_0362123 3300053084 Bacteria 733
1507 Ga0495595_0581780 3300053084 Bacteria 572
1508 Ga0500643_085723 3300053087 Bacteria 862
1509 Ga0500644_0146897 3300053088 Bacteria 942
1510 Ga0500644_0218906 3300053088 Bacteria 793
1511 Ga0500646_0059954 3300053090 Bacteria 1118
1512 Ga0500646_0116360 3300053090 Bacteria 855
1513 Ga0500583_0002104 3300053092 Bacteria 5906
1514 Ga0500583_0005358 3300053092 Bacteria 4292
1515 Ga0500583_0072418 3300053092 Bacteria 1650
1516 Ga0500583_0140818 3300053092 Bacteria 1198
1517 Ga0500583_0144740 3300053092 Bacteria 1182
1518 Ga0500583_0188012 3300053092 Bacteria 1028
1519 Ga0500651_0479902 3300053093 Bacteria 688
1520 Ga0500641_0002198 3300053096 Bacteria 6907
1521 Ga0500641_0049471 3300053096 Bacteria 1724
1522 Ga0500641_0066814 3300053096 Bacteria 1506
1523 Ga0500650_0032253 3300053098 Bacteria 2386
1524 Ga0500650_0154479 3300053098 Bacteria 1060
1525 Ga0500650_0350738 3300053098 Bacteria 645
1526 Ga0500650_0449956 3300053098 Bacteria 552
1527 Ga0500660_071612 3300053100 Bacteria 1623
1528 Ga0500556_0037328 3300053104 Bacteria 1690
1529 Ga0500556_0042674 3300053104 Bacteria 1606
1530 Ga0500562_015693 3300053108 Bacteria 1944
1531 Ga0500562_101991 3300053108 Bacteria 781
1532 Ga0500562_114712 3300053108 Bacteria 734
1533 Ga0500569_057131 3300053109 Bacteria 1195
1534 Ga0500572_015317 3300053111 Bacteria 1933
1535 Ga0500591_138439 3300053115 Bacteria 966
1536 Ga0500595_025471 3300053119 Bacteria 2050
1537 Ga0500617_035705 3300053124 Bacteria 2226
1538 Ga0500617_144670 3300053124 Bacteria 949
1539 Ga0500642_0152836 3300053130 Bacteria 1083
1540 Ga0500642_0233466 3300053130 Bacteria 849
1541 Ga0500642_0246502 3300053130 Bacteria 821
1542 Ga0500658_0055102 3300053134 Bacteria 1636
1543 Ga0500658_0126395 3300053134 Bacteria 1137
1544 Ga0500568_0038663 3300053139 Bacteria 1930
1545 Ga0500568_0073441 3300053139 Bacteria 1306
1546 Ga0500568_0152819 3300053139 Bacteria 854
1547 Ga0500577_0075417 3300053142 Bacteria 1333
1548 Ga0500577_0211746 3300053142 Bacteria 838
1549 Ga0500588_0000825 3300053146 Bacteria 5386
1550 Ga0500588_0006662 3300053146 Bacteria 2629
1551 Ga0500588_0037797 3300053146 Bacteria 1436
1552 Ga0500589_063307 3300053147 Bacteria 1690
1553 Ga0500589_122401 3300053147 Bacteria 1100
1554 Ga0500589_187897 3300053147 Bacteria 805
1555 Ga0500590_137705 3300053148 Bacteria 1120
1556 Ga0500604_0069821 3300053151 Bacteria 1118
1557 Ga0500616_0019660 3300053153 Bacteria 3804
1558 Ga0500619_239755 3300053154 Bacteria 600
1559 Ga0500622_0000318 3300053156 Bacteria 48445
1560 Ga0500622_0003146 3300053156 Bacteria 11303
1561 Ga0500622_0173222 3300053156 Bacteria 1003
1562 Ga0500624_143018 3300053157 Bacteria 512
1563 Ga0500627_0064483 3300053158 Bacteria 1616
1564 Ga0500627_0139213 3300053158 Bacteria 1096
1565 Ga0500627_0194676 3300053158 Bacteria 910
1566 Ga0500630_147338 3300053159 Bacteria 1003
1567 Ga0500634_0180186 3300053161 Bacteria 952
1568 Ga0500639_093845 3300053163 Bacteria 1490
1569 Ga0500639_127850 3300053163 Bacteria 1209
1570 Ga0500637_0005251 3300053178 Bacteria 6257
1571 Ga0500637_0005644 3300053178 Bacteria 6081
1572 Ga0500637_0186341 3300053178 Bacteria 1187
1573 Ga0500611_004201 3300053727 Bacteria 1923
1574 Ga0500611_120234 3300053727 Bacteria 699
1575 Ga0500656_009938 3300053732 Bacteria 1032
1576 Ga0501084_0024614 3300054114 Bacteria 5024
1577 Ga0501084_0072927 3300054114 Bacteria 2875
1578 Ga0501084_0569580 3300054114 Bacteria 957
1579 Ga0501084_0587161 3300054114 Bacteria 941
1580 Ga0501084_1838453 3300054114 Bacteria 506
1581 Ga0587084_024783 3300059477 Bacteria 926
1582 Ga0587066_041731 3300059490 Bacteria 868
1583 Ga0587073_0098956 3300059492 Bacteria 755
1584 Ga0587073_0209027 3300059492 Bacteria 590
1585 Ga0587088_060789 3300059508 Bacteria 765
1586 Ga0587090_023914 3300059510 Bacteria 976
1587 Ga0587090_060900 3300059510 Bacteria 716
1588 Ga0587094_056210 3300059513 Bacteria 678
1589 Ga0587130_023277 3300059631 Bacteria 681
1590 Ga0587067_057047 3300059640 Bacteria 808
1591 Ga0587068_078567 3300059641 Bacteria 663
1592 Ga0587076_025250 3300059645 Bacteria 1014
1593 Ga0587078_032918 3300059646 Bacteria 706
1594 Ga0587114_116797 3300059655 Bacteria 536
1595 Ga0587111_0086397 3300060346 Bacteria 758
1596 Ga0587111_0110630 3300060346 Bacteria 696
1597 Ga0501082_0000222 3300060353 Bacteria 49671
1598 Ga0501082_0003441 3300060353 Bacteria 13814
1599 Ga0501082_0025636 3300060353 Bacteria 5080
1600 Ga0501082_0082626 3300060353 Bacteria 2771
1601 Ga0466962_0000641 3300061719 Bacteria 15594
1602 Ga0530510_0001028 3300061734 Bacteria 18447
1603 Ga0530510_0019249 3300061734 Bacteria 4845
1604 Ga0530510_0166162 3300061734 Bacteria 1633
1605 Ga0530510_0222252 3300061734 Bacteria 1404
1606 Ga0530510_0301529 3300061734 Bacteria 1199

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10412809 Ga0157379_104128092 99
2 3300031616 Ga0307508_10779035 Ga0307508_107790351 102
3 3300004803 Ga0058862_10012401 Ga0058862_100124013 103
4 3300004803 Ga0058862_10022746 Ga0058862_100227462 103
5 3300005290 Ga0065712_10247271 Ga0065712_102472712 103
6 3300005293 Ga0065715_10358651 Ga0065715_103586512 103
7 3300005295 Ga0065707_10083865 Ga0065707_100838652 103
8 3300005328 Ga0070676_11540199 Ga0070676_115401991 103
9 3300005329 Ga0070683_100026113 Ga0070683_1000261132 103
10 3300005330 Ga0070690_100035384 Ga0070690_1000353842 103
11 3300005330 Ga0070690_100554207 Ga0070690_1005542071 103
12 3300005334 Ga0068869_100572915 Ga0068869_1005729152 103
13 3300005334 Ga0068869_100691338 Ga0068869_1006913382 103
14 3300005335 Ga0070666_10002682 Ga0070666_100026824 103
15 3300005335 Ga0070666_10169623 Ga0070666_101696232 103
16 3300005338 Ga0068868_100070972 Ga0068868_1000709722 103
17 3300005347 Ga0070668_101364736 Ga0070668_1013647361 103
18 3300005355 Ga0070671_100099731 Ga0070671_1000997312 103
19 3300005367 Ga0070667_100000225 Ga0070667_10000022527 103
20 3300005367 Ga0070667_100014966 Ga0070667_1000149664 103
21 3300005367 Ga0070667_100021572 Ga0070667_1000215723 103
22 3300005367 Ga0070667_100301923 Ga0070667_1003019232 103
23 3300005434 Ga0070709_10010490 Ga0070709_100104904 103
24 3300005434 Ga0070709_10034850 Ga0070709_100348502 103
25 3300005434 Ga0070709_10205906 Ga0070709_102059062 103
26 3300005435 Ga0070714_100010659 Ga0070714_1000106597 103
27 3300005436 Ga0070713_100014651 Ga0070713_1000146513 103
28 3300005436 Ga0070713_100018884 Ga0070713_1000188842 103
29 3300005436 Ga0070713_100443918 Ga0070713_1004439182 103
30 3300005436 Ga0070713_100519955 Ga0070713_1005199552 103
31 3300005437 Ga0070710_10050466 Ga0070710_100504662 103
32 3300005437 Ga0070710_10204649 Ga0070710_102046492 103
33 3300005437 Ga0070710_10786270 Ga0070710_107862702 103
34 3300005439 Ga0070711_100001783 Ga0070711_1000017832 103
35 3300005439 Ga0070711_100046563 Ga0070711_1000465633 103
36 3300005439 Ga0070711_100160105 Ga0070711_1001601052 103
37 3300005439 Ga0070711_100437871 Ga0070711_1004378712 103
38 3300005440 Ga0070705_100116100 Ga0070705_1001161002 103
39 3300005444 Ga0070694_100181515 Ga0070694_1001815151 103
40 3300005458 Ga0070681_10001003 Ga0070681_1000100315 103
41 3300005458 Ga0070681_10003796 Ga0070681_100037963 103
42 3300005458 Ga0070681_10015831 Ga0070681_100158316 103
43 3300005518 Ga0070699_100011119 Ga0070699_1000111193 103
44 3300005530 Ga0070679_100065404 Ga0070679_1000654042 103
45 3300005530 Ga0070679_100177510 Ga0070679_1001775102 103
46 3300005535 Ga0070684_100033066 Ga0070684_1000330664 103
47 3300005535 Ga0070684_100107929 Ga0070684_1001079292 103
48 3300005536 Ga0070697_101870661 Ga0070697_1018706611 103
49 3300005539 Ga0068853_100635146 Ga0068853_1006351461 103
50 3300005544 Ga0070686_100491627 Ga0070686_1004916272 103
51 3300005545 Ga0070695_100058416 Ga0070695_1000584162 103
52 3300005547 Ga0070693_100063788 Ga0070693_1000637882 103
53 3300005547 Ga0070693_100098453 Ga0070693_1000984533 103
54 3300005548 Ga0070665_100000709 Ga0070665_10000070916 103
55 3300005548 Ga0070665_100029156 Ga0070665_1000291565 103
56 3300005548 Ga0070665_100048772 Ga0070665_1000487722 103
57 3300005548 Ga0070665_100210433 Ga0070665_1002104332 103
58 3300005549 Ga0070704_100889236 Ga0070704_1008892362 103
59 3300005563 Ga0068855_100000869 Ga0068855_10000086925 103
60 3300005563 Ga0068855_100184350 Ga0068855_1001843503 103
61 3300005563 Ga0068855_101007972 Ga0068855_1010079722 103
62 3300005563 Ga0068855_101366358 Ga0068855_1013663582 103
63 3300005614 Ga0068856_100007934 Ga0068856_1000079342 103
64 3300005614 Ga0068856_100015998 Ga0068856_1000159982 103
65 3300005614 Ga0068856_100155520 Ga0068856_1001555202 103
66 3300005614 Ga0068856_100341147 Ga0068856_1003411472 103
67 3300005616 Ga0068852_101625101 Ga0068852_1016251012 103
68 3300005617 Ga0068859_100334671 Ga0068859_1003346712 103
69 3300005618 Ga0068864_100046025 Ga0068864_1000460252 103
70 3300005718 Ga0068866_10091482 Ga0068866_100914822 103
71 3300005834 Ga0068851_10079150 Ga0068851_100791502 103
72 3300005841 Ga0068863_100029303 Ga0068863_1000293035 103
73 3300005841 Ga0068863_100712039 Ga0068863_1007120392 103
74 3300005842 Ga0068858_100230532 Ga0068858_1002305322 103
75 3300005843 Ga0068860_100004920 Ga0068860_1000049202 103
76 3300005843 Ga0068860_100014216 Ga0068860_1000142162 103
77 3300005843 Ga0068860_100483832 Ga0068860_1004838322 103
78 3300005843 Ga0068860_101016986 Ga0068860_1010169861 103
79 3300005844 Ga0068862_100076918 Ga0068862_1000769182 103
80 3300005937 Ga0081455_10463888 Ga0081455_104638882 103
81 3300006028 Ga0070717_10002768 Ga0070717_100027682 103
82 3300006028 Ga0070717_11706155 Ga0070717_117061552 103
83 3300006163 Ga0070715_10000150 Ga0070715_100001505 103
84 3300006163 Ga0070715_10019225 Ga0070715_100192253 103
85 3300006163 Ga0070715_10387977 Ga0070715_103879772 103
86 3300006173 Ga0070716_100014983 Ga0070716_1000149832 103
87 3300006173 Ga0070716_100026661 Ga0070716_1000266612 103
88 3300006173 Ga0070716_100371323 Ga0070716_1003713232 103
89 3300006175 Ga0070712_100002458 Ga0070712_1000024586 103
90 3300006175 Ga0070712_100550900 Ga0070712_1005509001 103
91 3300006175 Ga0070712_101090674 Ga0070712_1010906742 103
92 3300006237 Ga0097621_100050099 Ga0097621_1000500992 103
93 3300006237 Ga0097621_100539217 Ga0097621_1005392171 103
94 3300006358 Ga0068871_100009552 Ga0068871_1000095522 103
95 3300006358 Ga0068871_100319469 Ga0068871_1003194692 103
96 3300006871 Ga0075434_100546275 Ga0075434_1005462752 103
97 3300006881 Ga0068865_100003296 Ga0068865_1000032966 103
98 3300006914 Ga0075436_100136098 Ga0075436_1001360982 103
99 3300006914 Ga0075436_100358454 Ga0075436_1003584542 103
100 3300006931 Ga0097620_100334659 Ga0097620_1003346592 103
101 3300007076 Ga0075435_100892958 Ga0075435_1008929582 103
102 3300007265 Ga0099794_10287479 Ga0099794_102874792 103
103 3300007788 Ga0099795_10055988 Ga0099795_100559882 103
104 3300009092 Ga0105250_10012985 Ga0105250_100129852 103
105 3300009092 Ga0105250_10079381 Ga0105250_100793812 103
106 3300009093 Ga0105240_10016052 Ga0105240_100160524 103
107 3300009093 Ga0105240_10055566 Ga0105240_100555665 103
108 3300009093 Ga0105240_10067857 Ga0105240_100678574 103
109 3300009093 Ga0105240_10148426 Ga0105240_101484263 103
110 3300009093 Ga0105240_10579386 Ga0105240_105793861 103
111 3300009093 Ga0105240_10849646 Ga0105240_108496462 103
112 3300009093 Ga0105240_11091957 Ga0105240_110919571 103
113 3300009093 Ga0105240_12281298 Ga0105240_122812981 103
114 3300009098 Ga0105245_10007287 Ga0105245_100072874 103
115 3300009098 Ga0105245_10686563 Ga0105245_106865632 103
116 3300009101 Ga0105247_10000203 Ga0105247_100002035 103
117 3300009101 Ga0105247_10010154 Ga0105247_100101542 103
118 3300009101 Ga0105247_10017815 Ga0105247_100178152 103
119 3300009101 Ga0105247_10044411 Ga0105247_100444112 103
120 3300009148 Ga0105243_10179170 Ga0105243_101791702 103
121 3300009174 Ga0105241_10042258 Ga0105241_100422582 103
122 3300009174 Ga0105241_10266258 Ga0105241_102662582 103
123 3300009174 Ga0105241_10580452 Ga0105241_105804522 103
124 3300009174 Ga0105241_10653432 Ga0105241_106534322 103
125 3300009174 Ga0105241_12038860 Ga0105241_120388602 103
126 3300009176 Ga0105242_10012501 Ga0105242_100125014 103
127 3300009176 Ga0105242_11156372 Ga0105242_111563721 103
128 3300009176 Ga0105242_11763905 Ga0105242_117639051 103
129 3300009177 Ga0105248_10009721 Ga0105248_100097215 103
130 3300009177 Ga0105248_10148848 Ga0105248_101488483 103
131 3300009177 Ga0105248_10200615 Ga0105248_102006152 103
132 3300009177 Ga0105248_11795139 Ga0105248_117951392 103
133 3300009177 Ga0105248_12598693 Ga0105248_125986932 103
134 3300009545 Ga0105237_10004537 Ga0105237_100045378 103
135 3300009545 Ga0105237_10025945 Ga0105237_100259456 103
136 3300009545 Ga0105237_10229018 Ga0105237_102290182 103
137 3300009545 Ga0105237_11101957 Ga0105237_111019572 103
138 3300009551 Ga0105238_10067107 Ga0105238_100671071 103
139 3300009551 Ga0105238_10230701 Ga0105238_102307012 103
140 3300009551 Ga0105238_10506977 Ga0105238_105069772 103
141 3300009551 Ga0105238_11261366 Ga0105238_112613662 103
142 3300009551 Ga0105238_11415658 Ga0105238_114156581 103
143 3300009551 Ga0105238_11926722 Ga0105238_119267221 103
144 3300009551 Ga0105238_12319906 Ga0105238_123199061 103
145 3300009553 Ga0105249_10003331 Ga0105249_100033317 103
146 3300009553 Ga0105249_10303459 Ga0105249_103034592 103
147 3300009553 Ga0105249_10584700 Ga0105249_105847002 103
148 3300009553 Ga0105249_10735227 Ga0105249_107352272 103
149 3300010159 Ga0099796_10111308 Ga0099796_101113082 103
150 3300010375 Ga0105239_10035422 Ga0105239_100354224 103
151 3300010375 Ga0105239_10351468 Ga0105239_103514682 103
152 3300010375 Ga0105239_11489720 Ga0105239_114897201 103
153 3300010375 Ga0105239_11724941 Ga0105239_117249412 103
154 3300011119 Ga0105246_10063084 Ga0105246_100630842 103
155 3300013100 Ga0157373_10454290 Ga0157373_104542902 103
156 3300013104 Ga0157370_10013806 Ga0157370_100138064 103
157 3300013105 Ga0157369_10190279 Ga0157369_101902791 103
158 3300013105 Ga0157369_10501249 Ga0157369_105012492 103
159 3300013105 Ga0157369_11356051 Ga0157369_113560512 103
160 3300013296 Ga0157374_10036490 Ga0157374_100364902 103
161 3300013296 Ga0157374_11350659 Ga0157374_113506592 103
162 3300013297 Ga0157378_10001851 Ga0157378_100018517 103
163 3300013297 Ga0157378_10611234 Ga0157378_106112342 103
164 3300013306 Ga0163162_10028294 Ga0163162_100282943 103
165 3300013306 Ga0163162_10111464 Ga0163162_101114643 103
166 3300013306 Ga0163162_10112926 Ga0163162_101129262 103
167 3300013306 Ga0163162_11237125 Ga0163162_112371252 103
168 3300013307 Ga0157372_10133926 Ga0157372_101339262 103
169 3300013307 Ga0157372_11363439 Ga0157372_113634391 103
170 3300013307 Ga0157372_11586240 Ga0157372_115862401 103
171 3300013308 Ga0157375_10062065 Ga0157375_100620654 103
172 3300013308 Ga0157375_10406304 Ga0157375_104063042 103
173 3300014325 Ga0163163_10016441 Ga0163163_100164415 103
174 3300014325 Ga0163163_10049729 Ga0163163_100497292 103
175 3300014325 Ga0163163_10103176 Ga0163163_101031763 103
176 3300014325 Ga0163163_10248013 Ga0163163_102480131 103
177 3300014325 Ga0163163_10480184 Ga0163163_104801842 103
178 3300014326 Ga0157380_12937301 Ga0157380_129373011 103
179 3300014968 Ga0157379_10010834 Ga0157379_100108342 103
180 3300014968 Ga0157379_10047864 Ga0157379_100478642 103
181 3300014968 Ga0157379_10087072 Ga0157379_100870722 103
182 3300014968 Ga0157379_10490910 Ga0157379_104909102 103
183 3300014968 Ga0157379_11600538 Ga0157379_116005381 103
184 3300014969 Ga0157376_10089514 Ga0157376_100895143 103
185 3300014969 Ga0157376_10095866 Ga0157376_100958661 103
186 3300014969 Ga0157376_10449877 Ga0157376_104498771 103
187 3300014969 Ga0157376_11231690 Ga0157376_112316902 103
188 3300014969 Ga0157376_13101898 Ga0157376_131018982 103
189 3300020069 Ga0197907_10383539 Ga0197907_103835392 103
190 3300020070 Ga0206356_10120402 Ga0206356_101204022 103
191 3300020078 Ga0206352_10211733 Ga0206352_102117332 103
192 3300020078 Ga0206352_10523350 Ga0206352_105233502 103
193 3300020080 Ga0206350_10545034 Ga0206350_105450341 103
194 3300020081 Ga0206354_11691571 Ga0206354_116915712 103
195 3300020610 Ga0154015_1346390 Ga0154015_13463902 103
196 3300021377 Ga0213874_10007794 Ga0213874_100077942 103
197 3300021384 Ga0213876_10065609 Ga0213876_100656093 103
198 3300021384 Ga0213876_10467771 Ga0213876_104677712 103
199 3300021441 Ga0213871_10026050 Ga0213871_100260501 103
200 3300021441 Ga0213871_10065851 Ga0213871_100658512 103
201 3300022467 Ga0224712_10004984 Ga0224712_100049843 103
202 3300022467 Ga0224712_10116695 Ga0224712_101166951 103
203 3300025711 Ga0207696_1114813 Ga0207696_11148132 103
204 3300025898 Ga0207692_10054411 Ga0207692_100544112 103
205 3300025898 Ga0207692_10454002 Ga0207692_104540022 103
206 3300025898 Ga0207692_10758916 Ga0207692_107589162 103
207 3300025899 Ga0207642_10066270 Ga0207642_100662702 103
208 3300025900 Ga0207710_10015548 Ga0207710_100155483 103
209 3300025900 Ga0207710_10046934 Ga0207710_100469342 103
210 3300025903 Ga0207680_10020439 Ga0207680_100204392 103
211 3300025903 Ga0207680_10020985 Ga0207680_100209852 103
212 3300025903 Ga0207680_10102686 Ga0207680_101026862 103
213 3300025905 Ga0207685_10042192 Ga0207685_100421922 103
214 3300025905 Ga0207685_10098713 Ga0207685_100987131 103
215 3300025905 Ga0207685_10138904 Ga0207685_101389042 103
216 3300025905 Ga0207685_10329676 Ga0207685_103296761 103
217 3300025906 Ga0207699_10001908 Ga0207699_100019087 103
218 3300025906 Ga0207699_10018607 Ga0207699_100186072 103
219 3300025906 Ga0207699_10092830 Ga0207699_100928302 103
220 3300025906 Ga0207699_10107745 Ga0207699_101077452 103
221 3300025906 Ga0207699_10332258 Ga0207699_103322581 103
222 3300025907 Ga0207645_10250717 Ga0207645_102507172 103
223 3300025911 Ga0207654_10161551 Ga0207654_101615512 103
224 3300025912 Ga0207707_10003587 Ga0207707_100035873 103
225 3300025912 Ga0207707_10015501 Ga0207707_100155013 103
226 3300025912 Ga0207707_10053515 Ga0207707_100535152 103
227 3300025912 Ga0207707_10141708 Ga0207707_101417082 103
228 3300025913 Ga0207695_10007963 Ga0207695_100079633 103
229 3300025913 Ga0207695_10040273 Ga0207695_100402732 103
230 3300025913 Ga0207695_10097689 Ga0207695_100976892 103
231 3300025914 Ga0207671_10049957 Ga0207671_100499572 103
232 3300025914 Ga0207671_10146114 Ga0207671_101461142 103
233 3300025914 Ga0207671_10219173 Ga0207671_102191732 103
234 3300025914 Ga0207671_10249032 Ga0207671_102490322 103
235 3300025915 Ga0207693_10000059 Ga0207693_1000005971 103
236 3300025915 Ga0207693_10097835 Ga0207693_100978352 103
237 3300025915 Ga0207693_10482189 Ga0207693_104821892 103
238 3300025915 Ga0207693_10851795 Ga0207693_108517951 103
239 3300025916 Ga0207663_10036504 Ga0207663_100365042 103
240 3300025916 Ga0207663_10157361 Ga0207663_101573612 103
241 3300025916 Ga0207663_10183790 Ga0207663_101837902 103
242 3300025916 Ga0207663_10519010 Ga0207663_105190101 103
243 3300025917 Ga0207660_10026140 Ga0207660_100261402 103
244 3300025917 Ga0207660_10167517 Ga0207660_101675172 103
245 3300025919 Ga0207657_10443334 Ga0207657_104433342 103
246 3300025920 Ga0207649_10456757 Ga0207649_104567572 103
247 3300025921 Ga0207652_10111024 Ga0207652_101110243 103
248 3300025921 Ga0207652_10224686 Ga0207652_102246862 103
249 3300025924 Ga0207694_10208317 Ga0207694_102083172 103
250 3300025924 Ga0207694_10216066 Ga0207694_102160662 103
251 3300025924 Ga0207694_10365374 Ga0207694_103653742 103
252 3300025924 Ga0207694_11820235 Ga0207694_118202352 103
253 3300025927 Ga0207687_10755223 Ga0207687_107552232 103
254 3300025928 Ga0207700_10008920 Ga0207700_100089203 103
255 3300025928 Ga0207700_10093752 Ga0207700_100937523 103
256 3300025928 Ga0207700_10098853 Ga0207700_100988532 103
257 3300025928 Ga0207700_10189483 Ga0207700_101894832 103
258 3300025928 Ga0207700_10490249 Ga0207700_104902491 103
259 3300025929 Ga0207664_10007703 Ga0207664_100077032 103
260 3300025929 Ga0207664_10332123 Ga0207664_103321232 103
261 3300025929 Ga0207664_10634366 Ga0207664_106343662 103
262 3300025931 Ga0207644_10003246 Ga0207644_100032466 103
263 3300025931 Ga0207644_10008268 Ga0207644_100082684 103
264 3300025931 Ga0207644_10414563 Ga0207644_104145632 103
265 3300025932 Ga0207690_10536651 Ga0207690_105366511 103
266 3300025934 Ga0207686_10041377 Ga0207686_100413773 103
267 3300025935 Ga0207709_10201793 Ga0207709_102017932 103
268 3300025938 Ga0207704_10165382 Ga0207704_101653822 103
269 3300025939 Ga0207665_10024787 Ga0207665_100247873 103
270 3300025939 Ga0207665_10042901 Ga0207665_100429013 103
271 3300025941 Ga0207711_10011267 Ga0207711_100112673 103
272 3300025941 Ga0207711_10138014 Ga0207711_101380143 103
273 3300025942 Ga0207689_10175914 Ga0207689_101759142 103
274 3300025942 Ga0207689_10678582 Ga0207689_106785822 103
275 3300025944 Ga0207661_10008500 Ga0207661_100085004 103
276 3300025945 Ga0207679_10669664 Ga0207679_106696642 103
277 3300025949 Ga0207667_10006976 Ga0207667_100069768 103
278 3300025949 Ga0207667_10007164 Ga0207667_100071647 103
279 3300025949 Ga0207667_10161197 Ga0207667_101611972 103
280 3300025949 Ga0207667_10332262 Ga0207667_103322622 103
281 3300025960 Ga0207651_10115265 Ga0207651_101152652 103
282 3300025961 Ga0207712_10130265 Ga0207712_101302652 103
283 3300025961 Ga0207712_10383284 Ga0207712_103832842 103
284 3300025981 Ga0207640_10495460 Ga0207640_104954602 103
285 3300025986 Ga0207658_10000894 Ga0207658_1000089421 103
286 3300025986 Ga0207658_10012452 Ga0207658_100124522 103
287 3300025986 Ga0207658_10314811 Ga0207658_103148112 103
288 3300025986 Ga0207658_11167191 Ga0207658_111671911 103
289 3300026023 Ga0207677_10043639 Ga0207677_100436392 103
290 3300026035 Ga0207703_10048335 Ga0207703_100483352 103
291 3300026041 Ga0207639_10080518 Ga0207639_100805182 103
292 3300026078 Ga0207702_10163274 Ga0207702_101632742 103
293 3300026078 Ga0207702_10607666 Ga0207702_106076662 103
294 3300026078 Ga0207702_10882004 Ga0207702_108820042 103
295 3300026088 Ga0207641_10002054 Ga0207641_100020542 103
296 3300026088 Ga0207641_10194422 Ga0207641_101944222 103
297 3300026088 Ga0207641_10859600 Ga0207641_108596002 103
298 3300026116 Ga0207674_10146209 Ga0207674_101462092 103
299 3300026121 Ga0207683_10055966 Ga0207683_100559663 103
300 3300026142 Ga0207698_10373186 Ga0207698_103731862 103
301 3300028379 Ga0268266_10000392 Ga0268266_1000039242 103
302 3300028379 Ga0268266_10002024 Ga0268266_1000202416 103
303 3300028379 Ga0268266_10014903 Ga0268266_100149033 103
304 3300028379 Ga0268266_10086412 Ga0268266_100864122 103
305 3300028379 Ga0268266_10267985 Ga0268266_102679852 103
306 3300028380 Ga0268265_10758609 Ga0268265_107586092 103
307 3300028381 Ga0268264_10017184 Ga0268264_100171842 103
308 3300028381 Ga0268264_10075150 Ga0268264_100751503 103
309 3300028563 Ga0265319_1193705 Ga0265319_11937051 103
310 3300028573 Ga0265334_10000123 Ga0265334_1000012327 103
311 3300028577 Ga0265318_10001505 Ga0265318_100015053 103
312 3300028794 Ga0307515_10010000 Ga0307515_1001000011 103
313 3300028800 Ga0265338_10008882 Ga0265338_100088828 103
314 3300028800 Ga0265338_10013818 Ga0265338_100138187 103
315 3300029957 Ga0265324_10181696 Ga0265324_101816962 103
316 3300030521 Ga0307511_10042260 Ga0307511_100422602 103
317 3300031090 Ga0265760_10097309 Ga0265760_100973092 103
318 3300031235 Ga0265330_10041457 Ga0265330_100414571 103
319 3300031238 Ga0265332_10001382 Ga0265332_100013824 103
320 3300031239 Ga0265328_10005971 Ga0265328_100059714 103
321 3300031240 Ga0265320_10003145 Ga0265320_100031459 103
322 3300031241 Ga0265325_10002490 Ga0265325_100024903 103
323 3300031242 Ga0265329_10000811 Ga0265329_100008118 103
324 3300031247 Ga0265340_10010255 Ga0265340_100102553 103
325 3300031249 Ga0265339_10004690 Ga0265339_100046903 103
326 3300031250 Ga0265331_10002545 Ga0265331_100025453 103
327 3300031344 Ga0265316_10005931 Ga0265316_100059319 103
328 3300031456 Ga0307513_10326274 Ga0307513_103262742 103
329 3300031595 Ga0265313_10002136 Ga0265313_100021364 103
330 3300031711 Ga0265314_10006700 Ga0265314_100067002 103
331 3300031712 Ga0265342_10003334 Ga0265342_100033348 103
332 3300035111 Ga0373923_0370125 Ga0373923_0370125_180_500 103
333 3300035113 Ga0373936_0027228 Ga0373936_0027228_1122_1442 103
334 3300035117 Ga0373953_0157626 Ga0373953_0157626_320_640 103
335 3300035117 Ga0373953_0222810 Ga0373953_0222810_184_504 103
336 3300035172 Ga0373955_0295342 Ga0373955_0295342_77_397 103
337 3300035172 Ga0373955_0527194 Ga0373955_0527194_223_543 103
338 3300035410 Ga0373924_0049896 Ga0373924_0049896_609_929 103
339 3300035410 Ga0373924_0541848 Ga0373924_0541848_176_496 103
340 3300035692 Ga0373935_0401222 Ga0373935_0401222_418_738 103
341 3300035695 Ga0373927_0051249 Ga0373927_0051249_1195_1515 103
342 3300035724 Ga0373933_0060043 Ga0373933_0060043_1754_2074 103
343 3300035724 Ga0373933_0455934 Ga0373933_0455934_432_752 103
344 3300035725 Ga0373947_0147545 Ga0373947_0147545_445_765 103
345 3300036401 Ga0373937_0039869 Ga0373937_0039869_2340_2660 103
346 3300036401 Ga0373937_0631185 Ga0373937_0631185_540_860 103
347 3300037068 Ga0373925_0023959 Ga0373925_0023959_2415_2735 103
348 3300037853 Ga0436364_0162892 Ga0436364_0162892_195_515 103
349 3300039437 Ga0436365_0377198 Ga0436365_0377198_221_541 103
350 3300039437 Ga0436365_0407525 Ga0436365_0407525_150_470 103
351 3300039437 Ga0436365_1019286 Ga0436365_1019286_12_332 103
352 3300039437 Ga0436365_1023348 Ga0436365_1023348_883_1203 103
353 3300039438 Ga0436360_0525623 Ga0436360_0525623_14317_14637 103
354 3300039438 Ga0436360_1167873 Ga0436360_1167873_430_750 103
355 3300039447 Ga0436361_0982899 Ga0436361_0982899_561_881 103
356 3300039450 Ga0436363_0035707 Ga0436363_0035707_16_336 103
357 3300039450 Ga0436363_0331678 Ga0436363_0331678_877_1197 103
358 3300039450 Ga0436363_0401150 Ga0436363_0401150_93_413 103
359 3300039450 Ga0436363_0563147 Ga0436363_0563147_414_734 103
360 3300039453 Ga0436362_0126569 Ga0436362_0126569_467_787 103
361 3300039453 Ga0436362_0394144 Ga0436362_0394144_24_344 103
362 3300041501 Ga0451845_0225953 Ga0451845_0225953_110_430 103
363 3300041512 Ga0451853_1577538 Ga0451853_1577538_417_737 103
364 3300042876 Ga0451577_0232659 Ga0451577_0232659_516_908 103
365 3300046462 Ga0495651_0320767 Ga0495651_0320767_332_652 103
366 3300046473 Ga0495582_0171281 Ga0495582_0171281_840_1160 103
367 3300046473 Ga0495582_0282462 Ga0495582_0282462_292_612 103
368 3300046475 Ga0495639_0218363 Ga0495639_0218363_566_886 103
369 3300046507 Ga0495606_0125158 Ga0495606_0125158_1150_1470 103
370 3300046511 Ga0495608_0714315 Ga0495608_0714315_39_359 103
371 3300046517 Ga0495630_0058019 Ga0495630_0058019_1869_2189 103
372 3300046519 Ga0495632_0128137 Ga0495632_0128137_807_1127 103
373 3300046519 Ga0495632_0218911 Ga0495632_0218911_325_645 103
374 3300046524 Ga0495648_0437045 Ga0495648_0437045_104_424 103
375 3300046526 Ga0495666_0257055 Ga0495666_0257055_262_582 103
376 3300046538 Ga0495609_0022742 Ga0495609_0022742_1504_1824 103
377 3300046543 Ga0495645_0651452 Ga0495645_0651452_296_616 103
378 3300046616 Ga0495668_0641655 Ga0495668_0641655_131_451 103
379 3300046648 Ga0495611_0324033 Ga0495611_0324033_281_601 103
380 3300046678 Ga0495599_0170708 Ga0495599_0170708_934_1254 103
381 3300046679 Ga0495623_0721155 Ga0495623_0721155_38_358 103
382 3300046683 Ga0495658_1033422 Ga0495658_1033422_178_498 103
383 3300046692 Ga0495671_0443699 Ga0495671_0443699_64_390 103
384 3300046694 Ga0495649_0246279 Ga0495649_0246279_236_556 103
385 3300047317 Ga0495604_0260761 Ga0495604_0260761_83_403 103
386 3300047319 Ga0495674_0063872 Ga0495674_0063872_601_921 103
387 3300047443 Ga0495687_077811 Ga0495687_077811_513_833 103
388 3300048088 Ga0495602_0480890 Ga0495602_0480890_116_436 103
389 3300048903 Ga0496100_0016220 Ga0496100_0016220_1554_1874 103
390 3300048904 Ga0496101_0043234 Ga0496101_0043234_654_974 103
391 3300048904 Ga0496101_0310089 Ga0496101_0310089_387_707 103
392 3300048904 Ga0496101_0428937 Ga0496101_0428937_596_916 103
393 3300048904 Ga0496101_0633831 Ga0496101_0633831_513_833 103
394 3300048905 Ga0496102_0021181 Ga0496102_0021181_1035_1355 103
395 3300048905 Ga0496102_0250307 Ga0496102_0250307_668_988 103
396 3300048906 Ga0496103_0094054 Ga0496103_0094054_1103_1423 103
397 3300048906 Ga0496103_0286687 Ga0496103_0286687_724_1044 103
398 3300048907 Ga0496104_0129108 Ga0496104_0129108_1217_1537 103
399 3300048907 Ga0496104_0150659 Ga0496104_0150659_1065_1385 103
400 3300048907 Ga0496104_0438092 Ga0496104_0438092_180_500 103
401 3300048908 Ga0496105_0006911 Ga0496105_0006911_6941_7261 103
402 3300048909 Ga0496106_0047403 Ga0496106_0047403_2162_2482 103
403 3300048909 Ga0496106_0131994 Ga0496106_0131994_915_1235 103
404 3300048909 Ga0496106_0163360 Ga0496106_0163360_315_635 103
405 3300048910 Ga0496107_0001841 Ga0496107_0001841_9567_9887 103
406 3300048910 Ga0496107_0107883 Ga0496107_0107883_1063_1383 103
407 3300048910 Ga0496107_0853388 Ga0496107_0853388_335_655 103
408 3300048911 Ga0496108_0002437 Ga0496108_0002437_7320_7640 103
409 3300048911 Ga0496108_0434119 Ga0496108_0434119_458_778 103
410 3300048912 Ga0496109_0018965 Ga0496109_0018965_4093_4413 103
411 3300048912 Ga0496109_0027251 Ga0496109_0027251_4647_4967 103
412 3300048912 Ga0496109_1521207 Ga0496109_1521207_124_444 103
413 3300048913 Ga0496110_0002260 Ga0496110_0002260_9952_10272 103
414 3300048914 Ga0496111_0085716 Ga0496111_0085716_748_1068 103
415 3300048915 Ga0496112_0011818 Ga0496112_0011818_730_1050 103
416 3300048915 Ga0496112_0051443 Ga0496112_0051443_3099_3419 103
417 3300048916 Ga0496113_0027417 Ga0496113_0027417_2290_2610 103
418 3300048917 Ga0496114_0002691 Ga0496114_0002691_8221_8541 103
419 3300048918 Ga0496115_0009121 Ga0496115_0009121_5218_5538 103
420 3300048918 Ga0496115_0099698 Ga0496115_0099698_1279_1599 103
421 3300048918 Ga0496115_0167546 Ga0496115_0167546_598_918 103
422 3300048918 Ga0496115_0339075 Ga0496115_0339075_488_808 103
423 3300048919 Ga0496116_0049718 Ga0496116_0049718_1156_1476 103
424 3300048920 Ga0496117_0000228 Ga0496117_0000228_88466_88786 103
425 3300048921 Ga0496118_0000005 Ga0496118_0000005_194281_194601 103
426 3300048922 Ga0496119_0071045 Ga0496119_0071045_1035_1355 103
427 3300048923 Ga0496120_0003140 Ga0496120_0003140_15104_15424 103
428 3300048924 Ga0496121_0000522 Ga0496121_0000522_21881_22201 103
429 3300048924 Ga0496121_0034180 Ga0496121_0034180_914_1234 103
430 3300048924 Ga0496121_0104368 Ga0496121_0104368_1766_2086 103
431 3300048925 Ga0496122_0400685 Ga0496122_0400685_180_500 103
432 3300048927 Ga0496124_0006063 Ga0496124_0006063_3193_3513 103
433 3300048928 Ga0496125_0001732 Ga0496125_0001732_29466_29786 103
434 3300048928 Ga0496125_0008666 Ga0496125_0008666_9043_9363 103
435 3300048928 Ga0496125_0046500 Ga0496125_0046500_728_1048 103
436 3300048929 Ga0496126_0006131 Ga0496126_0006131_11061_11381 103
437 3300048929 Ga0496126_0007001 Ga0496126_0007001_11302_11622 103
438 3300048929 Ga0496126_0225698 Ga0496126_0225698_1229_1549 103
439 3300048929 Ga0496126_0234217 Ga0496126_0234217_1191_1511 103
440 3300049460 Ga0495682_0089028 Ga0495682_0089028_12_332 103
441 3300049765 Ga0501268_108937 Ga0501268_108937_85_405 103
442 3300050512 nmdc:mga0n895_635943_c1 nmdc:mga0n895_635943_c1_446_766 103
443 3300050513 nmdc:mga0rr50_279732_c1 nmdc:mga0rr50_279732_c1_313_633 103
444 3300050513 nmdc:mga0rr50_593413_c1 nmdc:mga0rr50_593413_c1_469_789 103
445 3300050514 nmdc:mga08x19_170284_c1 nmdc:mga08x19_170284_c1_282_602 103
446 3300050514 nmdc:mga08x19_635783_c1 nmdc:mga08x19_635783_c1_78_398 103
447 3300053078 Ga0495612_0310411 Ga0495612_0310411_273_593 103
448 3300053084 Ga0495595_0581780 Ga0495595_0581780_139_459 103
449 3300053088 Ga0500644_0146897 Ga0500644_0146897_358_678 103
450 3300053092 Ga0500583_0002104 Ga0500583_0002104_150_470 103
451 3300053092 Ga0500583_0140818 Ga0500583_0140818_90_410 103
452 3300053096 Ga0500641_0066814 Ga0500641_0066814_585_905 103
453 3300053098 Ga0500650_0449956 Ga0500650_0449956_113_433 103
454 3300053100 Ga0500660_071612 Ga0500660_071612_1036_1356 103
455 3300053108 Ga0500562_015693 Ga0500562_015693_766_1086 103
456 3300053109 Ga0500569_057131 Ga0500569_057131_565_885 103
457 3300053111 Ga0500572_015317 Ga0500572_015317_1478_1798 103
458 3300053115 Ga0500591_138439 Ga0500591_138439_131_451 103
459 3300053119 Ga0500595_025471 Ga0500595_025471_931_1251 103
460 3300053142 Ga0500577_0075417 Ga0500577_0075417_14_334 103
461 3300053148 Ga0500590_137705 Ga0500590_137705_590_910 103
462 3300053154 Ga0500619_239755 Ga0500619_239755_151_471 103
463 3300053156 Ga0500622_0173222 Ga0500622_0173222_533_853 103
464 3300053157 Ga0500624_143018 Ga0500624_143018_92_412 103
465 3300053159 Ga0500630_147338 Ga0500630_147338_47_367 103
466 3300053163 Ga0500639_093845 Ga0500639_093845_34_354 103
467 3300053163 Ga0500639_127850 Ga0500639_127850_793_1113 103
468 3300053178 Ga0500637_0005644 Ga0500637_0005644_1606_1926 103
469 3300053178 Ga0500637_0186341 Ga0500637_0186341_240_560 103
470 3300053727 Ga0500611_004201 Ga0500611_004201_1331_1651 103
471 3300059646 Ga0587078_032918 Ga0587078_032918_289_609 103
472 3300059655 Ga0587114_116797 Ga0587114_116797_25_345 103
473 3300060346 Ga0587111_0086397 Ga0587111_0086397_293_613 103
474 3300003323 rootH1_10211908 rootH1_102119082 104
475 3300005330 Ga0070690_100434119 Ga0070690_1004341192 104
476 3300005331 Ga0070670_100027123 Ga0070670_1000271234 104
477 3300005331 Ga0070670_100118934 Ga0070670_1001189342 104
478 3300005331 Ga0070670_101388768 Ga0070670_1013887681 104
479 3300005334 Ga0068869_100129027 Ga0068869_1001290272 104
480 3300005334 Ga0068869_100992031 Ga0068869_1009920312 104
481 3300005335 Ga0070666_10146958 Ga0070666_101469582 104
482 3300005335 Ga0070666_10391354 Ga0070666_103913541 104
483 3300005337 Ga0070682_100364321 Ga0070682_1003643212 104
484 3300005337 Ga0070682_100884905 Ga0070682_1008849052 104
485 3300005338 Ga0068868_100004850 Ga0068868_1000048509 104
486 3300005338 Ga0068868_100094689 Ga0068868_1000946892 104
487 3300005340 Ga0070689_100004882 Ga0070689_1000048822 104
488 3300005344 Ga0070661_100035493 Ga0070661_1000354932 104
489 3300005353 Ga0070669_100548820 Ga0070669_1005488202 104
490 3300005354 Ga0070675_100107242 Ga0070675_1001072423 104
491 3300005354 Ga0070675_102257557 Ga0070675_1022575571 104
492 3300005355 Ga0070671_100002194 Ga0070671_1000021947 104
493 3300005355 Ga0070671_100098944 Ga0070671_1000989442 104
494 3300005364 Ga0070673_100016500 Ga0070673_1000165005 104
495 3300005364 Ga0070673_100544164 Ga0070673_1005441642 104
496 3300005364 Ga0070673_101655195 Ga0070673_1016551951 104
497 3300005366 Ga0070659_100450430 Ga0070659_1004504302 104
498 3300005367 Ga0070667_100029388 Ga0070667_1000293885 104
499 3300005367 Ga0070667_100553473 Ga0070667_1005534731 104
500 3300005367 Ga0070667_101023584 Ga0070667_1010235841 104
501 3300005367 Ga0070667_101221502 Ga0070667_1012215021 104
502 3300005439 Ga0070711_100460678 Ga0070711_1004606783 104
503 3300005440 Ga0070705_100347593 Ga0070705_1003475932 104
504 3300005440 Ga0070705_100636152 Ga0070705_1006361521 104
505 3300005441 Ga0070700_101723147 Ga0070700_1017231471 104
506 3300005455 Ga0070663_100391485 Ga0070663_1003914852 104
507 3300005455 Ga0070663_100538279 Ga0070663_1005382792 104
508 3300005455 Ga0070663_100538900 Ga0070663_1005389002 104
509 3300005456 Ga0070678_100843082 Ga0070678_1008430822 104
510 3300005457 Ga0070662_100383507 Ga0070662_1003835072 104
511 3300005457 Ga0070662_101370415 Ga0070662_1013704151 104
512 3300005458 Ga0070681_10013362 Ga0070681_100133627 104
513 3300005466 Ga0070685_10063412 Ga0070685_100634122 104
514 3300005466 Ga0070685_10680674 Ga0070685_106806741 104
515 3300005467 Ga0070706_102093621 Ga0070706_1020936211 104
516 3300005530 Ga0070679_100113205 Ga0070679_1001132052 104
517 3300005535 Ga0070684_100006012 Ga0070684_1000060123 104
518 3300005535 Ga0070684_102067403 Ga0070684_1020674031 104
519 3300005539 Ga0068853_101181577 Ga0068853_1011815772 104
520 3300005543 Ga0070672_100115740 Ga0070672_1001157402 104
521 3300005543 Ga0070672_100262365 Ga0070672_1002623652 104
522 3300005544 Ga0070686_100061083 Ga0070686_1000610832 104
523 3300005547 Ga0070693_100060935 Ga0070693_1000609352 104
524 3300005548 Ga0070665_100008098 Ga0070665_1000080987 104
525 3300005548 Ga0070665_100026875 Ga0070665_1000268753 104
526 3300005548 Ga0070665_100071765 Ga0070665_1000717654 104
527 3300005548 Ga0070665_101554237 Ga0070665_1015542372 104
528 3300005563 Ga0068855_100013822 Ga0068855_1000138227 104
529 3300005564 Ga0070664_100042866 Ga0070664_1000428662 104
530 3300005577 Ga0068857_102068997 Ga0068857_1020689972 104
531 3300005578 Ga0068854_100359733 Ga0068854_1003597332 104
532 3300005614 Ga0068856_100009532 Ga0068856_1000095327 104
533 3300005614 Ga0068856_100339780 Ga0068856_1003397802 104
534 3300005615 Ga0070702_100011767 Ga0070702_1000117674 104
535 3300005615 Ga0070702_101035006 Ga0070702_1010350062 104
536 3300005616 Ga0068852_100058878 Ga0068852_1000588782 104
537 3300005616 Ga0068852_101892213 Ga0068852_1018922131 104
538 3300005617 Ga0068859_100003949 Ga0068859_1000039498 104
539 3300005617 Ga0068859_100456600 Ga0068859_1004566001 104
540 3300005618 Ga0068864_100004196 Ga0068864_1000041969 104
541 3300005719 Ga0068861_100008139 Ga0068861_1000081394 104
542 3300005719 Ga0068861_100186356 Ga0068861_1001863562 104
543 3300005719 Ga0068861_100274311 Ga0068861_1002743112 104
544 3300005719 Ga0068861_100508673 Ga0068861_1005086732 104
545 3300005841 Ga0068863_100007487 Ga0068863_1000074876 104
546 3300005842 Ga0068858_100011250 Ga0068858_1000112505 104
547 3300005843 Ga0068860_100000219 Ga0068860_1000002196 104
548 3300005843 Ga0068860_100014788 Ga0068860_1000147883 104
549 3300005844 Ga0068862_100121504 Ga0068862_1001215042 104
550 3300005844 Ga0068862_100585066 Ga0068862_1005850662 104
551 3300005937 Ga0081455_10000099 Ga0081455_1000009989 104
552 3300005983 Ga0081540_1130441 Ga0081540_11304412 104
553 3300006051 Ga0075364_11034013 Ga0075364_110340132 104
554 3300006178 Ga0075367_10838451 Ga0075367_108384511 104
555 3300006195 Ga0075366_10183264 Ga0075366_101832642 104
556 3300006195 Ga0075366_10254773 Ga0075366_102547731 104
557 3300006237 Ga0097621_100029206 Ga0097621_1000292062 104
558 3300006237 Ga0097621_101125294 Ga0097621_1011252943 104
559 3300006353 Ga0075370_10437976 Ga0075370_104379763 104
560 3300006358 Ga0068871_100038551 Ga0068871_1000385512 104
561 3300006358 Ga0068871_100754384 Ga0068871_1007543842 104
562 3300006358 Ga0068871_101032012 Ga0068871_1010320122 104
563 3300006881 Ga0068865_101613591 Ga0068865_1016135912 104
564 3300006881 Ga0068865_101994557 Ga0068865_1019945571 104
565 3300006931 Ga0097620_100003949 Ga0097620_1000039498 104
566 3300006931 Ga0097620_100456600 Ga0097620_1004566001 104
567 3300009093 Ga0105240_10013342 Ga0105240_100133425 104
568 3300009093 Ga0105240_10048490 Ga0105240_100484902 104
569 3300009093 Ga0105240_10354070 Ga0105240_103540701 104
570 3300009098 Ga0105245_10001014 Ga0105245_1000101419 104
571 3300009101 Ga0105247_10031641 Ga0105247_100316413 104
572 3300009174 Ga0105241_10273723 Ga0105241_102737232 104
573 3300009176 Ga0105242_10102563 Ga0105242_101025632 104
574 3300009176 Ga0105242_11127368 Ga0105242_111273681 104
575 3300009177 Ga0105248_10002240 Ga0105248_100022406 104
576 3300009177 Ga0105248_11808215 Ga0105248_118082151 104
577 3300009545 Ga0105237_10143166 Ga0105237_101431662 104
578 3300009545 Ga0105237_10521788 Ga0105237_105217882 104
579 3300009551 Ga0105238_10048918 Ga0105238_100489182 104
580 3300009551 Ga0105238_10109784 Ga0105238_101097842 104
581 3300009551 Ga0105238_12558343 Ga0105238_125583431 104
582 3300010375 Ga0105239_10223365 Ga0105239_102233652 104
583 3300010375 Ga0105239_10774918 Ga0105239_107749182 104
584 3300010375 Ga0105239_11787674 Ga0105239_117876742 104
585 3300011119 Ga0105246_10001416 Ga0105246_100014166 104
586 3300011119 Ga0105246_11325006 Ga0105246_113250061 104
587 3300013102 Ga0157371_10867778 Ga0157371_108677782 104
588 3300013104 Ga0157370_10351683 Ga0157370_103516832 104
589 3300013296 Ga0157374_10009304 Ga0157374_100093048 104
590 3300013297 Ga0157378_10397931 Ga0157378_103979312 104
591 3300013306 Ga0163162_10056795 Ga0163162_100567952 104
592 3300013306 Ga0163162_13101443 Ga0163162_131014431 104
593 3300013307 Ga0157372_10070914 Ga0157372_100709143 104
594 3300013307 Ga0157372_10796326 Ga0157372_107963262 104
595 3300013308 Ga0157375_10038386 Ga0157375_100383862 104
596 3300013308 Ga0157375_10983849 Ga0157375_109838492 104
597 3300014325 Ga0163163_10126133 Ga0163163_101261332 104
598 3300014325 Ga0163163_11457998 Ga0163163_114579982 104
599 3300014745 Ga0157377_10129784 Ga0157377_101297842 104
600 3300014745 Ga0157377_10924710 Ga0157377_109247101 104
601 3300014968 Ga0157379_10069513 Ga0157379_100695132 104
602 3300014968 Ga0157379_10237878 Ga0157379_102378782 104
603 3300014968 Ga0157379_11161360 Ga0157379_111613601 104
604 3300014968 Ga0157379_12488711 Ga0157379_124887111 104
605 3300014969 Ga0157376_10373275 Ga0157376_103732752 104
606 3300014969 Ga0157376_10528053 Ga0157376_105280532 104
607 3300017792 Ga0163161_10282142 Ga0163161_102821422 104
608 3300017792 Ga0163161_10380596 Ga0163161_103805963 104
609 3300020069 Ga0197907_10664428 Ga0197907_106644281 104
610 3300020069 Ga0197907_11466352 Ga0197907_114663522 104
611 3300020070 Ga0206356_11266440 Ga0206356_112664401 104
612 3300020070 Ga0206356_11585042 Ga0206356_115850421 104
613 3300020076 Ga0206355_1423457 Ga0206355_14234571 104
614 3300020081 Ga0206354_11507845 Ga0206354_115078453 104
615 3300020082 Ga0206353_11185898 Ga0206353_111858982 104
616 3300025321 Ga0207656_10046971 Ga0207656_100469712 104
617 3300025900 Ga0207710_10022081 Ga0207710_100220812 104
618 3300025900 Ga0207710_10124552 Ga0207710_101245522 104
619 3300025903 Ga0207680_10143235 Ga0207680_101432352 104
620 3300025903 Ga0207680_10170556 Ga0207680_101705562 104
621 3300025911 Ga0207654_10610377 Ga0207654_106103772 104
622 3300025913 Ga0207695_10038713 Ga0207695_100387133 104
623 3300025913 Ga0207695_10071846 Ga0207695_100718461 104
624 3300025913 Ga0207695_10108868 Ga0207695_101088683 104
625 3300025913 Ga0207695_10143174 Ga0207695_101431742 104
626 3300025913 Ga0207695_10625571 Ga0207695_106255712 104
627 3300025914 Ga0207671_10101047 Ga0207671_101010472 104
628 3300025915 Ga0207693_10632305 Ga0207693_106323052 104
629 3300025916 Ga0207663_10381800 Ga0207663_103818002 104
630 3300025917 Ga0207660_10159649 Ga0207660_101596492 104
631 3300025920 Ga0207649_10123608 Ga0207649_101236082 104
632 3300025920 Ga0207649_10816371 Ga0207649_108163712 104
633 3300025921 Ga0207652_10180218 Ga0207652_101802182 104
634 3300025924 Ga0207694_10082839 Ga0207694_100828392 104
635 3300025924 Ga0207694_10184180 Ga0207694_101841802 104
636 3300025924 Ga0207694_10792744 Ga0207694_107927442 104
637 3300025924 Ga0207694_10931883 Ga0207694_109318832 104
638 3300025925 Ga0207650_10017320 Ga0207650_100173205 104
639 3300025927 Ga0207687_10048914 Ga0207687_100489142 104
640 3300025929 Ga0207664_10519256 Ga0207664_105192562 104
641 3300025931 Ga0207644_10021569 Ga0207644_100215693 104
642 3300025931 Ga0207644_10099892 Ga0207644_100998922 104
643 3300025931 Ga0207644_11499964 Ga0207644_114999641 104
644 3300025932 Ga0207690_10672840 Ga0207690_106728402 104
645 3300025933 Ga0207706_10078688 Ga0207706_100786882 104
646 3300025934 Ga0207686_11446551 Ga0207686_114465512 104
647 3300025936 Ga0207670_10233573 Ga0207670_102335732 104
648 3300025940 Ga0207691_10143593 Ga0207691_101435931 104
649 3300025940 Ga0207691_10173957 Ga0207691_101739572 104
650 3300025941 Ga0207711_10007852 Ga0207711_100078529 104
651 3300025941 Ga0207711_10086806 Ga0207711_100868063 104
652 3300025942 Ga0207689_10272240 Ga0207689_102722402 104
653 3300025942 Ga0207689_10503285 Ga0207689_105032852 104
654 3300025945 Ga0207679_10188739 Ga0207679_101887392 104
655 3300025945 Ga0207679_10778816 Ga0207679_107788162 104
656 3300025949 Ga0207667_10096212 Ga0207667_100962122 104
657 3300025949 Ga0207667_10167834 Ga0207667_101678341 104
658 3300025949 Ga0207667_11849791 Ga0207667_118497911 104
659 3300025960 Ga0207651_11190033 Ga0207651_111900332 104
660 3300025961 Ga0207712_10122301 Ga0207712_101223011 104
661 3300025961 Ga0207712_10144899 Ga0207712_101448992 104
662 3300025981 Ga0207640_10024393 Ga0207640_100243932 104
663 3300025981 Ga0207640_10492713 Ga0207640_104927131 104
664 3300025981 Ga0207640_10699742 Ga0207640_106997422 104
665 3300025986 Ga0207658_10255626 Ga0207658_102556262 104
666 3300025986 Ga0207658_10318538 Ga0207658_103185381 104
667 3300026023 Ga0207677_10006887 Ga0207677_100068876 104
668 3300026023 Ga0207677_10174889 Ga0207677_101748892 104
669 3300026035 Ga0207703_10003908 Ga0207703_100039082 104
670 3300026035 Ga0207703_10006963 Ga0207703_100069636 104
671 3300026067 Ga0207678_10036677 Ga0207678_100366773 104
672 3300026067 Ga0207678_10421369 Ga0207678_104213692 104
673 3300026067 Ga0207678_10629792 Ga0207678_106297922 104
674 3300026075 Ga0207708_10201949 Ga0207708_102019492 104
675 3300026078 Ga0207702_10070305 Ga0207702_100703052 104
676 3300026088 Ga0207641_10000247 Ga0207641_100002474 104
677 3300026088 Ga0207641_10003295 Ga0207641_1000329510 104
678 3300026095 Ga0207676_10002982 Ga0207676_100029829 104
679 3300026095 Ga0207676_10190035 Ga0207676_101900352 104
680 3300026116 Ga0207674_10197918 Ga0207674_101979183 104
681 3300026118 Ga0207675_100042310 Ga0207675_1000423101 104
682 3300026118 Ga0207675_100142064 Ga0207675_1001420642 104
683 3300026118 Ga0207675_100145872 Ga0207675_1001458722 104
684 3300026118 Ga0207675_100335032 Ga0207675_1003350322 104
685 3300026121 Ga0207683_10621886 Ga0207683_106218862 104
686 3300026121 Ga0207683_11016654 Ga0207683_110166542 104
687 3300026142 Ga0207698_10775791 Ga0207698_107757912 104
688 3300026142 Ga0207698_11221566 Ga0207698_112215662 104
689 3300028379 Ga0268266_10009975 Ga0268266_100099758 104
690 3300028379 Ga0268266_10012788 Ga0268266_100127883 104
691 3300028380 Ga0268265_10124822 Ga0268265_101248222 104
692 3300028380 Ga0268265_10258996 Ga0268265_102589962 104
693 3300028380 Ga0268265_10431371 Ga0268265_104313712 104
694 3300028380 Ga0268265_10970044 Ga0268265_109700441 104
695 3300028381 Ga0268264_10000057 Ga0268264_1000005743 104
696 3300028381 Ga0268264_10000165 Ga0268264_1000016559 104
697 3300028381 Ga0268264_10000348 Ga0268264_1000034857 104
698 3300028381 Ga0268264_10204353 Ga0268264_102043532 104
699 3300028381 Ga0268264_10582629 Ga0268264_105826292 104
700 3300028800 Ga0265338_10021377 Ga0265338_100213773 104
701 3300030521 Ga0307511_10324335 Ga0307511_103243351 104
702 3300030877 Ga0265777_122563 Ga0265777_1225631 104
703 3300030878 Ga0265770_1150366 Ga0265770_11503662 104
704 3300031239 Ga0265328_10002748 Ga0265328_100027487 104
705 3300031247 Ga0265340_10053569 Ga0265340_100535692 104
706 3300031247 Ga0265340_10139708 Ga0265340_101397081 104
707 3300031344 Ga0265316_10051925 Ga0265316_100519251 104
708 3300031507 Ga0307509_10730397 Ga0307509_107303972 104
709 3300031548 Ga0307408_100785696 Ga0307408_1007856962 104
710 3300031730 Ga0307516_10874425 Ga0307516_108744251 104
711 3300033180 Ga0307510_10001790 Ga0307510_1000179011 104
712 3300035111 Ga0373923_0343697 Ga0373923_0343697_97_420 104
713 3300035118 Ga0373954_0049752 Ga0373954_0049752_1592_1915 104
714 3300035120 Ga0373957_0173888 Ga0373957_0173888_301_624 104
715 3300035172 Ga0373955_0075611 Ga0373955_0075611_1484_1807 104
716 3300035172 Ga0373955_0429121 Ga0373955_0429121_15_338 104
717 3300035410 Ga0373924_0303553 Ga0373924_0303553_105_428 104
718 3300035724 Ga0373933_0706142 Ga0373933_0706142_145_468 104
719 3300035725 Ga0373947_0294453 Ga0373947_0294453_132_455 104
720 3300036401 Ga0373937_0003618 Ga0373937_0003618_1640_1963 104
721 3300036401 Ga0373937_0266404 Ga0373937_0266404_636_959 104
722 3300036401 Ga0373937_0488915 Ga0373937_0488915_702_1025 104
723 3300037068 Ga0373925_0821241 Ga0373925_0821241_193_516 104
724 3300037418 Ga0395900_0904878 Ga0395900_0904878_143_496 104
725 3300039438 Ga0436360_0327579 Ga0436360_0327579_62_406 104
726 3300041443 Ga0451789_0291202 Ga0451789_0291202_69_401 104
727 3300041452 Ga0451793_1114941 Ga0451793_1114941_138_476 104
728 3300041454 Ga0451799_30402 Ga0451799_30402_10_324 104
729 3300041458 Ga0451798_0061378 Ga0451798_0061378_118_462 104
730 3300041463 Ga0451804_1089028 Ga0451804_1089028_760_1098 104
731 3300041486 Ga0451807_2424518 Ga0451807_2424518_277_600 104
732 3300041512 Ga0451853_3187295 Ga0451853_3187295_302_625 104
733 3300044656 Ga0466969_0000848 Ga0466969_0000848_14707_15063 104
734 3300044656 Ga0466969_0003618 Ga0466969_0003618_5198_5521 104
735 3300044658 Ga0466972_0062906 Ga0466972_0062906_63_407 104
736 3300044658 Ga0466972_0070188 Ga0466972_0070188_1133_1489 104
737 3300044683 Ga0466965_0093846 Ga0466965_0093846_799_1155 104
738 3300044684 Ga0466966_0006187 Ga0466966_0006187_3668_4024 104
739 3300044684 Ga0466966_0334759 Ga0466966_0334759_241_594 104
740 3300044693 Ga0466961_0005473 Ga0466961_0005473_2579_2935 104
741 3300044694 Ga0466963_0129568 Ga0466963_0129568_1345_1698 104
742 3300044706 Ga0466964_0000149 Ga0466964_0000149_3345_3701 104
743 3300044719 Ga0466971_0000098 Ga0466971_0000098_1505_1861 104
744 3300044719 Ga0466971_0087825 Ga0466971_0087825_550_873 104
745 3300044735 Ga0466968_0005494 Ga0466968_0005494_2080_2436 104
746 3300044765 Ga0466970_0006751 Ga0466970_0006751_1505_1861 104
747 3300044842 Ga0466957_0044272 Ga0466957_0044272_197_553 104
748 3300044901 Ga0466960_0034653 Ga0466960_0034653_853_1197 104
749 3300045049 Ga0466959_0020278 Ga0466959_0020278_2257_2613 104
750 3300045051 Ga0451576_0218229 Ga0451576_0218229_1616_1939 104
751 3300045836 Ga0466958_0064653 Ga0466958_0064653_290_646 104
752 3300045976 Ga0466967_1180654 Ga0466967_1180654_375_713 104
753 3300046455 Ga0495603_0075386 Ga0495603_0075386_1256_1579 104
754 3300046475 Ga0495639_0197200 Ga0495639_0197200_583_906 104
755 3300046500 Ga0495596_0106321 Ga0495596_0106321_721_1035 104
756 3300046535 Ga0495586_0326422 Ga0495586_0326422_503_826 104
757 3300046616 Ga0495668_0603974 Ga0495668_0603974_188_511 104
758 3300046660 Ga0495625_0488389 Ga0495625_0488389_261_584 104
759 3300046683 Ga0495658_0173561 Ga0495658_0173561_349_672 104
760 3300046684 Ga0495669_0627373 Ga0495669_0627373_21_344 104
761 3300047319 Ga0495674_0781369 Ga0495674_0781369_56_379 104
762 3300047472 Ga0495686_0366778 Ga0495686_0366778_270_593 104
763 3300048903 Ga0496100_0850778 Ga0496100_0850778_316_639 104
764 3300048907 Ga0496104_0572269 Ga0496104_0572269_470_793 104
765 3300048908 Ga0496105_0057715 Ga0496105_0057715_1147_1470 104
766 3300048910 Ga0496107_0185344 Ga0496107_0185344_827_1150 104
767 3300048911 Ga0496108_0039201 Ga0496108_0039201_222_545 104
768 3300048913 Ga0496110_1621609 Ga0496110_1621609_82_405 104
769 3300048914 Ga0496111_0624307 Ga0496111_0624307_423_746 104
770 3300048915 Ga0496112_0009255 Ga0496112_0009255_1314_1637 104
771 3300048916 Ga0496113_0128272 Ga0496113_0128272_402_725 104
772 3300048917 Ga0496114_0009986 Ga0496114_0009986_1051_1374 104
773 3300048918 Ga0496115_0089907 Ga0496115_0089907_378_701 104
774 3300049571 Ga0501034_1177008 Ga0501034_1177008_235_573 104
775 3300049585 Ga0501069_0500446 Ga0501069_0500446_281_607 104
776 3300049587 Ga0501071_1137620 Ga0501071_1137620_249_575 104
777 3300049588 Ga0501072_0261277 Ga0501072_0261277_577_906 104
778 3300049742 Ga0501080_0519447 Ga0501080_0519447_512_850 104
779 3300049744 Ga0501083_0477720 Ga0501083_0477720_411_755 104
780 3300050493 nmdc:mga0k408_270731_c1 nmdc:mga0k408_270731_c1_289_633 104
781 3300050494 nmdc:mga06z11_581469_c1 nmdc:mga06z11_581469_c1_205_543 104
782 3300053077 Ga0495601_0005333 Ga0495601_0005333_794_1117 104
783 3300053077 Ga0495601_0178148 Ga0495601_0178148_922_1245 104
784 3300053084 Ga0495595_0362123 Ga0495595_0362123_304_627 104
785 3300053090 Ga0500646_0059954 Ga0500646_0059954_102_425 104
786 3300053090 Ga0500646_0116360 Ga0500646_0116360_474_818 104
787 3300053092 Ga0500583_0005358 Ga0500583_0005358_2375_2719 104
788 3300053093 Ga0500651_0479902 Ga0500651_0479902_86_409 104
789 3300053096 Ga0500641_0049471 Ga0500641_0049471_604_948 104
790 3300053098 Ga0500650_0154479 Ga0500650_0154479_355_699 104
791 3300053098 Ga0500650_0350738 Ga0500650_0350738_252_575 104
792 3300053104 Ga0500556_0037328 Ga0500556_0037328_581_925 104
793 3300053108 Ga0500562_101991 Ga0500562_101991_233_577 104
794 3300053124 Ga0500617_035705 Ga0500617_035705_979_1323 104
795 3300053130 Ga0500642_0233466 Ga0500642_0233466_194_538 104
796 3300053130 Ga0500642_0246502 Ga0500642_0246502_404_727 104
797 3300053139 Ga0500568_0152819 Ga0500568_0152819_435_758 104
798 3300053146 Ga0500588_0006662 Ga0500588_0006662_303_647 104
799 3300053147 Ga0500589_122401 Ga0500589_122401_460_804 104
800 3300053153 Ga0500616_0019660 Ga0500616_0019660_1140_1463 104
801 3300053158 Ga0500627_0139213 Ga0500627_0139213_295_639 104
802 3300053161 Ga0500634_0180186 Ga0500634_0180186_468_812 104
803 3300053732 Ga0500656_009938 Ga0500656_009938_382_726 104
804 3300059477 Ga0587084_024783 Ga0587084_024783_151_489 104
805 3300059490 Ga0587066_041731 Ga0587066_041731_233_583 104
806 3300059492 Ga0587073_0098956 Ga0587073_0098956_143_487 104
807 3300059492 Ga0587073_0209027 Ga0587073_0209027_26_364 104
808 3300059508 Ga0587088_060789 Ga0587088_060789_279_623 104
809 3300059510 Ga0587090_023914 Ga0587090_023914_303_653 104
810 3300059510 Ga0587090_060900 Ga0587090_060900_250_588 104
811 3300059513 Ga0587094_056210 Ga0587094_056210_125_463 104
812 3300059631 Ga0587130_023277 Ga0587130_023277_303_647 104
813 3300059640 Ga0587067_057047 Ga0587067_057047_284_634 104
814 3300059641 Ga0587068_078567 Ga0587068_078567_119_469 104
815 3300059645 Ga0587076_025250 Ga0587076_025250_227_577 104
816 3300060346 Ga0587111_0110630 Ga0587111_0110630_230_568 104
817 3300061719 Ga0466962_0000641 Ga0466962_0000641_7077_7433 104
818 3300002077 JGI24744J21845_10074202 JGI24744J21845_100742022 105
819 3300003323 rootH1_10026435 rootH1_100264352 105
820 3300004800 Ga0058861_11861260 Ga0058861_118612601 105
821 3300004803 Ga0058862_12010366 Ga0058862_120103661 105
822 3300005289 Ga0065704_10098711 Ga0065704_100987112 105
823 3300005289 Ga0065704_10802156 Ga0065704_108021561 105
824 3300005290 Ga0065712_10072478 Ga0065712_100724783 105
825 3300005290 Ga0065712_10311057 Ga0065712_103110572 105
826 3300005293 Ga0065715_10001498 Ga0065715_100014984 105
827 3300005295 Ga0065707_10085991 Ga0065707_100859914 105
828 3300005295 Ga0065707_10305113 Ga0065707_103051133 105
829 3300005329 Ga0070683_100113854 Ga0070683_1001138543 105
830 3300005330 Ga0070690_100003822 Ga0070690_1000038221 105
831 3300005330 Ga0070690_101639687 Ga0070690_1016396871 105
832 3300005331 Ga0070670_100019825 Ga0070670_1000198253 105
833 3300005331 Ga0070670_100632259 Ga0070670_1006322592 105
834 3300005334 Ga0068869_100069124 Ga0068869_1000691242 105
835 3300005334 Ga0068869_100194144 Ga0068869_1001941442 105
836 3300005334 Ga0068869_100494367 Ga0068869_1004943672 105
837 3300005335 Ga0070666_10433450 Ga0070666_104334502 105
838 3300005336 Ga0070680_100254672 Ga0070680_1002546722 105
839 3300005336 Ga0070680_100260024 Ga0070680_1002600242 105
840 3300005337 Ga0070682_100020490 Ga0070682_1000204902 105
841 3300005337 Ga0070682_100233148 Ga0070682_1002331481 105
842 3300005337 Ga0070682_100339416 Ga0070682_1003394161 105
843 3300005337 Ga0070682_101291725 Ga0070682_1012917252 105
844 3300005338 Ga0068868_100183314 Ga0068868_1001833142 105
845 3300005340 Ga0070689_100001596 Ga0070689_10000159610 105
846 3300005340 Ga0070689_100547261 Ga0070689_1005472611 105
847 3300005340 Ga0070689_100614267 Ga0070689_1006142671 105
848 3300005340 Ga0070689_102111929 Ga0070689_1021119291 105
849 3300005341 Ga0070691_10347532 Ga0070691_103475321 105
850 3300005341 Ga0070691_10516887 Ga0070691_105168871 105
851 3300005343 Ga0070687_100022560 Ga0070687_1000225601 105
852 3300005343 Ga0070687_100302740 Ga0070687_1003027402 105
853 3300005344 Ga0070661_100052662 Ga0070661_1000526623 105
854 3300005344 Ga0070661_100114542 Ga0070661_1001145422 105
855 3300005344 Ga0070661_101007634 Ga0070661_1010076341 105
856 3300005345 Ga0070692_10031760 Ga0070692_100317602 105
857 3300005345 Ga0070692_10115429 Ga0070692_101154292 105
858 3300005345 Ga0070692_10556486 Ga0070692_105564861 105
859 3300005353 Ga0070669_100049479 Ga0070669_1000494791 105
860 3300005354 Ga0070675_100003779 Ga0070675_1000037792 105
861 3300005356 Ga0070674_100052489 Ga0070674_1000524892 105
862 3300005365 Ga0070688_100082218 Ga0070688_1000822183 105
863 3300005366 Ga0070659_100714999 Ga0070659_1007149992 105
864 3300005367 Ga0070667_100167130 Ga0070667_1001671302 105
865 3300005367 Ga0070667_102125483 Ga0070667_1021254831 105
866 3300005435 Ga0070714_102074806 Ga0070714_1020748061 105
867 3300005438 Ga0070701_10054505 Ga0070701_100545052 105
868 3300005440 Ga0070705_100108171 Ga0070705_1001081713 105
869 3300005441 Ga0070700_100069722 Ga0070700_1000697222 105
870 3300005441 Ga0070700_100231657 Ga0070700_1002316571 105
871 3300005441 Ga0070700_100269903 Ga0070700_1002699032 105
872 3300005444 Ga0070694_100052311 Ga0070694_1000523112 105
873 3300005444 Ga0070694_100140533 Ga0070694_1001405332 105
874 3300005444 Ga0070694_100456922 Ga0070694_1004569221 105
875 3300005444 Ga0070694_101042895 Ga0070694_1010428952 105
876 3300005455 Ga0070663_100147002 Ga0070663_1001470022 105
877 3300005455 Ga0070663_100610075 Ga0070663_1006100752 105
878 3300005455 Ga0070663_100883831 Ga0070663_1008838312 105
879 3300005457 Ga0070662_100867757 Ga0070662_1008677572 105
880 3300005458 Ga0070681_10509537 Ga0070681_105095372 105
881 3300005459 Ga0068867_100008080 Ga0068867_1000080805 105
882 3300005459 Ga0068867_100197722 Ga0068867_1001977222 105
883 3300005466 Ga0070685_10127754 Ga0070685_101277541 105
884 3300005471 Ga0070698_101001791 Ga0070698_1010017912 105
885 3300005471 Ga0070698_101583276 Ga0070698_1015832762 105
886 3300005530 Ga0070679_100030496 Ga0070679_1000304963 105
887 3300005530 Ga0070679_100261024 Ga0070679_1002610241 105
888 3300005530 Ga0070679_101203238 Ga0070679_1012032381 105
889 3300005535 Ga0070684_100003660 Ga0070684_10000366010 105
890 3300005535 Ga0070684_102091128 Ga0070684_1020911281 105
891 3300005543 Ga0070672_100049906 Ga0070672_1000499062 105
892 3300005543 Ga0070672_100204218 Ga0070672_1002042183 105
893 3300005544 Ga0070686_100205214 Ga0070686_1002052142 105
894 3300005544 Ga0070686_100806619 Ga0070686_1008066191 105
895 3300005544 Ga0070686_101488093 Ga0070686_1014880931 105
896 3300005545 Ga0070695_100756361 Ga0070695_1007563611 105
897 3300005545 Ga0070695_100833517 Ga0070695_1008335172 105
898 3300005546 Ga0070696_100888401 Ga0070696_1008884012 105
899 3300005548 Ga0070665_100182905 Ga0070665_1001829051 105
900 3300005548 Ga0070665_100459624 Ga0070665_1004596242 105
901 3300005548 Ga0070665_101412298 Ga0070665_1014122981 105
902 3300005548 Ga0070665_102298984 Ga0070665_1022989841 105
903 3300005549 Ga0070704_100018874 Ga0070704_1000188741 105
904 3300005549 Ga0070704_100138110 Ga0070704_1001381102 105
905 3300005563 Ga0068855_100485179 Ga0068855_1004851792 105
906 3300005564 Ga0070664_100001245 Ga0070664_10000124518 105
907 3300005564 Ga0070664_100265154 Ga0070664_1002651542 105
908 3300005577 Ga0068857_100113288 Ga0068857_1001132882 105
909 3300005577 Ga0068857_100567710 Ga0068857_1005677101 105
910 3300005577 Ga0068857_100918134 Ga0068857_1009181342 105
911 3300005578 Ga0068854_100053916 Ga0068854_1000539163 105
912 3300005615 Ga0070702_100010658 Ga0070702_1000106582 105
913 3300005615 Ga0070702_101740670 Ga0070702_1017406701 105
914 3300005617 Ga0068859_100006748 Ga0068859_1000067482 105
915 3300005617 Ga0068859_100383959 Ga0068859_1003839592 105
916 3300005617 Ga0068859_100385650 Ga0068859_1003856502 105
917 3300005618 Ga0068864_100005110 Ga0068864_1000051107 105
918 3300005718 Ga0068866_10014160 Ga0068866_100141602 105
919 3300005719 Ga0068861_100071052 Ga0068861_1000710522 105
920 3300005719 Ga0068861_100082512 Ga0068861_1000825122 105
921 3300005840 Ga0068870_10016521 Ga0068870_100165212 105
922 3300005841 Ga0068863_100102119 Ga0068863_1001021192 105
923 3300005842 Ga0068858_100717037 Ga0068858_1007170372 105
924 3300005843 Ga0068860_100312784 Ga0068860_1003127842 105
925 3300005844 Ga0068862_100381362 Ga0068862_1003813622 105
926 3300005844 Ga0068862_100418427 Ga0068862_1004184272 105
927 3300005937 Ga0081455_10436627 Ga0081455_104366272 105
928 3300005937 Ga0081455_10505365 Ga0081455_105053651 105
929 3300005981 Ga0081538_10088879 Ga0081538_100888792 105
930 3300005983 Ga0081540_1186417 Ga0081540_11864172 105
931 3300005985 Ga0081539_10059565 Ga0081539_100595652 105
932 3300006195 Ga0075366_10282760 Ga0075366_102827602 105
933 3300006237 Ga0097621_100041945 Ga0097621_1000419454 105
934 3300006237 Ga0097621_101223004 Ga0097621_1012230042 105
935 3300006358 Ga0068871_100117604 Ga0068871_1001176042 105
936 3300006844 Ga0075428_100002724 Ga0075428_10000272413 105
937 3300006844 Ga0075428_100006022 Ga0075428_10000602211 105
938 3300006844 Ga0075428_100012167 Ga0075428_1000121672 105
939 3300006844 Ga0075428_100026057 Ga0075428_1000260573 105
940 3300006844 Ga0075428_100040146 Ga0075428_1000401464 105
941 3300006844 Ga0075428_101316727 Ga0075428_1013167271 105
942 3300006846 Ga0075430_100005100 Ga0075430_1000051005 105
943 3300006846 Ga0075430_100046629 Ga0075430_1000466293 105
944 3300006846 Ga0075430_100137269 Ga0075430_1001372692 105
945 3300006846 Ga0075430_100271203 Ga0075430_1002712032 105
946 3300006846 Ga0075430_100860337 Ga0075430_1008603371 105
947 3300006847 Ga0075431_100005080 Ga0075431_10000508013 105
948 3300006847 Ga0075431_100028173 Ga0075431_1000281731 105
949 3300006847 Ga0075431_100039938 Ga0075431_1000399384 105
950 3300006847 Ga0075431_100063667 Ga0075431_1000636672 105
951 3300006847 Ga0075431_100437027 Ga0075431_1004370272 105
952 3300006852 Ga0075433_10039105 Ga0075433_100391053 105
953 3300006852 Ga0075433_10601384 Ga0075433_106013842 105
954 3300006871 Ga0075434_100207585 Ga0075434_1002075851 105
955 3300006871 Ga0075434_101333267 Ga0075434_1013332671 105
956 3300006880 Ga0075429_100006884 Ga0075429_1000068847 105
957 3300006880 Ga0075429_100013382 Ga0075429_1000133824 105
958 3300006880 Ga0075429_100336750 Ga0075429_1003367502 105
959 3300006881 Ga0068865_100030070 Ga0068865_1000300702 105
960 3300006914 Ga0075436_101035700 Ga0075436_1010357002 105
961 3300006931 Ga0097620_100006748 Ga0097620_1000067488 105
962 3300006931 Ga0097620_100383952 Ga0097620_1003839522 105
963 3300006931 Ga0097620_100385649 Ga0097620_1003856492 105
964 3300006948 Ga0099826_10115124 Ga0099826_101151243 105
965 3300007076 Ga0075435_100205340 Ga0075435_1002053402 105
966 3300009092 Ga0105250_10000006 Ga0105250_10000006109 105
967 3300009092 Ga0105250_10172474 Ga0105250_101724741 105
968 3300009094 Ga0111539_10407029 Ga0111539_104070292 105
969 3300009094 Ga0111539_10418179 Ga0111539_104181792 105
970 3300009094 Ga0111539_10429523 Ga0111539_104295232 105
971 3300009094 Ga0111539_10961665 Ga0111539_109616651 105
972 3300009098 Ga0105245_10745948 Ga0105245_107459481 105
973 3300009098 Ga0105245_11246612 Ga0105245_112466122 105
974 3300009101 Ga0105247_10187872 Ga0105247_101878722 105
975 3300009101 Ga0105247_10382702 Ga0105247_103827022 105
976 3300009147 Ga0114129_10002581 Ga0114129_100025818 105
977 3300009147 Ga0114129_10003487 Ga0114129_1000348716 105
978 3300009147 Ga0114129_10072430 Ga0114129_100724304 105
979 3300009147 Ga0114129_10516111 Ga0114129_105161112 105
980 3300009148 Ga0105243_10071523 Ga0105243_100715232 105
981 3300009148 Ga0105243_10077500 Ga0105243_100775002 105
982 3300009174 Ga0105241_10172527 Ga0105241_101725272 105
983 3300009176 Ga0105242_10845196 Ga0105242_108451961 105
984 3300009176 Ga0105242_11920094 Ga0105242_119200942 105
985 3300009177 Ga0105248_10003720 Ga0105248_100037209 105
986 3300009177 Ga0105248_10957965 Ga0105248_109579651 105
987 3300009551 Ga0105238_11741192 Ga0105238_117411921 105
988 3300009553 Ga0105249_10012111 Ga0105249_100121112 105
989 3300009553 Ga0105249_10484899 Ga0105249_104848992 105
990 3300010375 Ga0105239_11917209 Ga0105239_119172092 105
991 3300013100 Ga0157373_11173625 Ga0157373_111736251 105
992 3300013296 Ga0157374_11344532 Ga0157374_113445321 105
993 3300013297 Ga0157378_10364509 Ga0157378_103645092 105
994 3300013297 Ga0157378_12005042 Ga0157378_120050422 105
995 3300013306 Ga0163162_10075537 Ga0163162_100755372 105
996 3300013308 Ga0157375_10098970 Ga0157375_100989702 105
997 3300013308 Ga0157375_10246011 Ga0157375_102460112 105
998 3300014325 Ga0163163_10032681 Ga0163163_100326812 105
999 3300014326 Ga0157380_10002239 Ga0157380_100022392 105
1000 3300014326 Ga0157380_10046767 Ga0157380_100467673 105
1001 3300014745 Ga0157377_10000573 Ga0157377_100005737 105
1002 3300014745 Ga0157377_10192408 Ga0157377_101924083 105
1003 3300014968 Ga0157379_10005099 Ga0157379_100050992 105
1004 3300014968 Ga0157379_10369731 Ga0157379_103697312 105
1005 3300014968 Ga0157379_12215417 Ga0157379_122154171 105
1006 3300014968 Ga0157379_12439204 Ga0157379_124392042 105
1007 3300017792 Ga0163161_10215085 Ga0163161_102150852 105
1008 3300017792 Ga0163161_10690530 Ga0163161_106905302 105
1009 3300025711 Ga0207696_1000069 Ga0207696_1000069109 105
1010 3300025899 Ga0207642_10023405 Ga0207642_100234053 105
1011 3300025900 Ga0207710_10146178 Ga0207710_101461782 105
1012 3300025901 Ga0207688_10152762 Ga0207688_101527622 105
1013 3300025903 Ga0207680_10007410 Ga0207680_100074103 105
1014 3300025907 Ga0207645_10019333 Ga0207645_100193334 105
1015 3300025908 Ga0207643_10011560 Ga0207643_100115603 105
1016 3300025912 Ga0207707_10017238 Ga0207707_100172387 105
1017 3300025912 Ga0207707_10352986 Ga0207707_103529862 105
1018 3300025917 Ga0207660_10020538 Ga0207660_100205383 105
1019 3300025917 Ga0207660_10107625 Ga0207660_101076252 105
1020 3300025918 Ga0207662_10023021 Ga0207662_100230212 105
1021 3300025918 Ga0207662_10113852 Ga0207662_101138522 105
1022 3300025918 Ga0207662_10486512 Ga0207662_104865121 105
1023 3300025920 Ga0207649_10035110 Ga0207649_100351102 105
1024 3300025920 Ga0207649_10142705 Ga0207649_101427051 105
1025 3300025920 Ga0207649_10860208 Ga0207649_108602081 105
1026 3300025921 Ga0207652_10061066 Ga0207652_100610662 105
1027 3300025921 Ga0207652_10984970 Ga0207652_109849702 105
1028 3300025923 Ga0207681_11575731 Ga0207681_115757312 105
1029 3300025924 Ga0207694_11127558 Ga0207694_111275582 105
1030 3300025925 Ga0207650_10063279 Ga0207650_100632793 105
1031 3300025925 Ga0207650_11478566 Ga0207650_114785662 105
1032 3300025926 Ga0207659_10000855 Ga0207659_100008552 105
1033 3300025927 Ga0207687_10532577 Ga0207687_105325771 105
1034 3300025927 Ga0207687_10542716 Ga0207687_105427162 105
1035 3300025931 Ga0207644_10886574 Ga0207644_108865742 105
1036 3300025932 Ga0207690_10231659 Ga0207690_102316592 105
1037 3300025932 Ga0207690_10728854 Ga0207690_107288542 105
1038 3300025933 Ga0207706_10018342 Ga0207706_100183424 105
1039 3300025933 Ga0207706_10170095 Ga0207706_101700952 105
1040 3300025935 Ga0207709_10115227 Ga0207709_101152272 105
1041 3300025936 Ga0207670_10011250 Ga0207670_100112502 105
1042 3300025936 Ga0207670_10338893 Ga0207670_103388932 105
1043 3300025937 Ga0207669_10075740 Ga0207669_100757403 105
1044 3300025938 Ga0207704_10019200 Ga0207704_100192003 105
1045 3300025940 Ga0207691_10270868 Ga0207691_102708682 105
1046 3300025941 Ga0207711_10019102 Ga0207711_100191024 105
1047 3300025942 Ga0207689_10008645 Ga0207689_100086452 105
1048 3300025942 Ga0207689_10243733 Ga0207689_102437332 105
1049 3300025942 Ga0207689_10461316 Ga0207689_104613162 105
1050 3300025945 Ga0207679_10016535 Ga0207679_100165352 105
1051 3300025945 Ga0207679_11641116 Ga0207679_116411161 105
1052 3300025949 Ga0207667_10731544 Ga0207667_107315442 105
1053 3300025960 Ga0207651_10031275 Ga0207651_100312752 105
1054 3300025972 Ga0207668_10254718 Ga0207668_102547182 105
1055 3300025981 Ga0207640_10589952 Ga0207640_105899522 105
1056 3300025981 Ga0207640_11070477 Ga0207640_110704772 105
1057 3300025986 Ga0207658_10173765 Ga0207658_101737652 105
1058 3300026023 Ga0207677_10039225 Ga0207677_100392252 105
1059 3300026035 Ga0207703_10303736 Ga0207703_103037362 105
1060 3300026067 Ga0207678_10493584 Ga0207678_104935841 105
1061 3300026067 Ga0207678_11563075 Ga0207678_115630751 105
1062 3300026075 Ga0207708_10032419 Ga0207708_100324192 105
1063 3300026075 Ga0207708_10069706 Ga0207708_100697063 105
1064 3300026088 Ga0207641_10034075 Ga0207641_100340753 105
1065 3300026089 Ga0207648_10013598 Ga0207648_100135983 105
1066 3300026089 Ga0207648_10180849 Ga0207648_101808492 105
1067 3300026095 Ga0207676_10009829 Ga0207676_100098292 105
1068 3300026116 Ga0207674_10020693 Ga0207674_100206935 105
1069 3300026118 Ga0207675_100046452 Ga0207675_1000464522 105
1070 3300026118 Ga0207675_100907301 Ga0207675_1009073011 105
1071 3300026121 Ga0207683_10024420 Ga0207683_100244204 105
1072 3300027364 Ga0209967_1018162 Ga0209967_10181622 105
1073 3300027395 Ga0209996_1013832 Ga0209996_10138322 105
1074 3300027462 Ga0210000_1014248 Ga0210000_10142482 105
1075 3300027526 Ga0209968_1008141 Ga0209968_10081412 105
1076 3300027543 Ga0209999_1065856 Ga0209999_10658562 105
1077 3300027614 Ga0209970_1052455 Ga0209970_10524552 105
1078 3300027665 Ga0209983_1131258 Ga0209983_11312581 105
1079 3300027666 Ga0209282_1140900 Ga0209282_11409003 105
1080 3300027682 Ga0209971_1047697 Ga0209971_10476971 105
1081 3300027682 Ga0209971_1057339 Ga0209971_10573392 105
1082 3300027876 Ga0209974_10136706 Ga0209974_101367062 105
1083 3300027876 Ga0209974_10182486 Ga0209974_101824861 105
1084 3300027907 Ga0207428_10002594 Ga0207428_100025946 105
1085 3300027907 Ga0207428_10008559 Ga0207428_100085592 105
1086 3300027907 Ga0207428_10026062 Ga0207428_100260624 105
1087 3300028379 Ga0268266_10681221 Ga0268266_106812212 105
1088 3300028380 Ga0268265_10012234 Ga0268265_100122343 105
1089 3300028380 Ga0268265_10310624 Ga0268265_103106242 105
1090 3300028380 Ga0268265_10695224 Ga0268265_106952242 105
1091 3300028380 Ga0268265_11462624 Ga0268265_114626242 105
1092 3300028381 Ga0268264_10253325 Ga0268264_102533252 105
1093 3300028381 Ga0268264_11445173 Ga0268264_114451732 105
1094 3300031240 Ga0265320_10066967 Ga0265320_100669672 105
1095 3300031456 Ga0307513_10052634 Ga0307513_100526344 105
1096 3300031507 Ga0307509_10000189 Ga0307509_1000018979 105
1097 3300031548 Ga0307408_100053153 Ga0307408_1000531532 105
1098 3300031548 Ga0307408_100063217 Ga0307408_1000632172 105
1099 3300031548 Ga0307408_100790828 Ga0307408_1007908282 105
1100 3300031616 Ga0307508_10810086 Ga0307508_108100861 105
1101 3300031665 Ga0316575_10005089 Ga0316575_100050893 105
1102 3300031665 Ga0316575_10072461 Ga0316575_100724611 105
1103 3300031727 Ga0316576_10004557 Ga0316576_100045575 105
1104 3300031727 Ga0316576_10016705 Ga0316576_100167053 105
1105 3300031727 Ga0316576_10142303 Ga0316576_101423032 105
1106 3300031728 Ga0316578_10001021 Ga0316578_100010214 105
1107 3300031728 Ga0316578_10266878 Ga0316578_102668782 105
1108 3300031728 Ga0316578_10609616 Ga0316578_106096161 105
1109 3300031731 Ga0307405_10680904 Ga0307405_106809042 105
1110 3300031731 Ga0307405_10794564 Ga0307405_107945641 105
1111 3300031731 Ga0307405_10948993 Ga0307405_109489931 105
1112 3300031731 Ga0307405_11886814 Ga0307405_118868142 105
1113 3300031733 Ga0316577_10300597 Ga0316577_103005971 105
1114 3300031824 Ga0307413_10504397 Ga0307413_105043972 105
1115 3300031824 Ga0307413_11159904 Ga0307413_111599041 105
1116 3300031852 Ga0307410_10065142 Ga0307410_100651421 105
1117 3300031852 Ga0307410_10917774 Ga0307410_109177742 105
1118 3300031852 Ga0307410_11140255 Ga0307410_111402552 105
1119 3300031901 Ga0307406_10166578 Ga0307406_101665782 105
1120 3300031903 Ga0307407_10636375 Ga0307407_106363751 105
1121 3300031995 Ga0307409_100508564 Ga0307409_1005085642 105
1122 3300031995 Ga0307409_101768807 Ga0307409_1017688072 105
1123 3300031995 Ga0307409_101778524 Ga0307409_1017785242 105
1124 3300032002 Ga0307416_100278174 Ga0307416_1002781742 105
1125 3300032002 Ga0307416_100613069 Ga0307416_1006130691 105
1126 3300032002 Ga0307416_101648148 Ga0307416_1016481481 105
1127 3300032004 Ga0307414_10292001 Ga0307414_102920012 105
1128 3300032005 Ga0307411_10112106 Ga0307411_101121062 105
1129 3300032005 Ga0307411_10335631 Ga0307411_103356312 105
1130 3300032005 Ga0307411_10411779 Ga0307411_104117792 105
1131 3300032005 Ga0307411_11332163 Ga0307411_113321631 105
1132 3300032126 Ga0307415_100357894 Ga0307415_1003578941 105
1133 3300032126 Ga0307415_100748602 Ga0307415_1007486022 105
1134 3300032137 Ga0316585_10030383 Ga0316585_100303832 105
1135 3300032139 Ga0316580_10004948 Ga0316580_100049483 105
1136 3300034818 Ga0373950_0069518 Ga0373950_0069518_286_603 105
1137 3300034819 Ga0373958_0016754 Ga0373958_0016754_127_444 105
1138 3300034819 Ga0373958_0122642 Ga0373958_0122642_78_407 105
1139 3300034957 Ga0373938_0082633 Ga0373938_0082633_205_522 105
1140 3300035084 Ga0373928_0013841 Ga0373928_0013841_918_1235 105
1141 3300035085 Ga0373929_0099239 Ga0373929_0099239_74_391 105
1142 3300035086 Ga0373934_0185130 Ga0373934_0185130_84_401 105
1143 3300035088 Ga0373940_0071490 Ga0373940_0071490_170_487 105
1144 3300035090 Ga0373949_0039405 Ga0373949_0039405_95_412 105
1145 3300035091 Ga0373951_0082305 Ga0373951_0082305_283_600 105
1146 3300035112 Ga0373932_0113214 Ga0373932_0113214_252_569 105
1147 3300035114 Ga0373939_0047646 Ga0373939_0047646_481_798 105
1148 3300035115 Ga0373941_0060891 Ga0373941_0060891_609_926 105
1149 3300035207 Ga0373942_0189103 Ga0373942_0189103_321_638 105
1150 3300035398 Ga0316574_0000008 Ga0316574_0000008_4849_5166 105
1151 3300035398 Ga0316574_0004042 Ga0316574_0004042_5773_6102 105
1152 3300035398 Ga0316574_0036525 Ga0316574_0036525_1421_1738 105
1153 3300035398 Ga0316574_0077564 Ga0316574_0077564_147_476 105
1154 3300035398 Ga0316574_0335484 Ga0316574_0335484_147_476 105
1155 3300035398 Ga0316574_0481243 Ga0316574_0481243_193_510 105
1156 3300035398 Ga0316574_1000376 Ga0316574_1000376_115_444 105
1157 3300035691 Ga0373931_0525010 Ga0373931_0525010_325_642 105
1158 3300036401 Ga0373937_0016775 Ga0373937_0016775_4517_4834 105
1159 3300036647 Ga0316582_0014377 Ga0316582_0014377_885_1202 105
1160 3300036712 Ga0316584_0003999 Ga0316584_0003999_3320_3637 105
1161 3300036712 Ga0316584_0032987 Ga0316584_0032987_2053_2370 105
1162 3300036712 Ga0316584_0115800 Ga0316584_0115800_148_477 105
1163 3300036712 Ga0316584_0708044 Ga0316584_0708044_278_607 105
1164 3300037068 Ga0373925_1020664 Ga0373925_1020664_291_608 105
1165 3300037471 Ga0395905_0745292 Ga0395905_0745292_69_386 105
1166 3300041404 Ga0439436_0258204 Ga0439436_0258204_160_477 105
1167 3300041406 Ga0439439_0192470 Ga0439439_0192470_165_482 105
1168 3300041407 Ga0439447_142854 Ga0439447_142854_202_519 105
1169 3300041413 Ga0439465_0368206 Ga0439465_0368206_139_456 105
1170 3300041496 Ga0451839_1008795 Ga0451839_1008795_740_1057 105
1171 3300041498 Ga0451841_0425714 Ga0451841_0425714_292_609 105
1172 3300041502 Ga0451846_61009 Ga0451846_61009_127_444 105
1173 3300041506 Ga0451850_18457 Ga0451850_18457_238_555 105
1174 3300041507 Ga0451851_0921106 Ga0451851_0921106_1151_1468 105
1175 3300041512 Ga0451853_3268539 Ga0451853_3268539_196_513 105
1176 3300041907 Ga0452268_41072 Ga0452268_41072_168_485 105
1177 3300041916 Ga0452271_32386 Ga0452271_32386_126_443 105
1178 3300042002 Ga0439442_152000 Ga0439442_152000_152_469 105
1179 3300042005 Ga0439448_0213124 Ga0439448_0213124_73_390 105
1180 3300042007 Ga0439449_0098130 Ga0439449_0098130_193_510 105
1181 3300042009 Ga0439451_135894 Ga0439451_135894_33_350 105
1182 3300042014 Ga0439457_025299 Ga0439457_025299_614_931 105
1183 3300042015 Ga0439462_0138330 Ga0439462_0138330_263_580 105
1184 3300042016 Ga0439463_106383 Ga0439463_106383_263_580 105
1185 3300042118 Ga0450914_015638 Ga0450914_015638_261_578 105
1186 3300042125 Ga0450923_144706 Ga0450923_144706_176_505 105
1187 3300042126 Ga0450888_015764 Ga0450888_015764_451_768 105
1188 3300042128 Ga0450897_018552 Ga0450897_018552_98_415 105
1189 3300042130 Ga0450892_039091 Ga0450892_039091_119_436 105
1190 3300042131 Ga0450894_021638 Ga0450894_021638_430_747 105
1191 3300042132 Ga0450895_007763 Ga0450895_007763_194_511 105
1192 3300042136 Ga0450900_050043 Ga0450900_050043_174_491 105
1193 3300042145 Ga0450906_018003 Ga0450906_018003_819_1136 105
1194 3300042156 Ga0439446_0263132 Ga0439446_0263132_123_440 105
1195 3300042157 Ga0439458_0054890 Ga0439458_0054890_259_576 105
1196 3300042184 Ga0450908_059215 Ga0450908_059215_257_574 105
1197 3300042437 Ga0439444_0032882 Ga0439444_0032882_545_862 105
1198 3300042438 Ga0439459_0234918 Ga0439459_0234918_113_430 105
1199 3300042439 Ga0439464_0219560 Ga0439464_0219560_223_540 105
1200 3300042461 Ga0439460_0258504 Ga0439460_0258504_54_371 105
1201 3300042531 Ga0450918_066275 Ga0450918_066275_117_434 105
1202 3300042532 Ga0450893_0098607 Ga0450893_0098607_215_532 105
1203 3300042532 Ga0450893_0126900 Ga0450893_0126900_99_428 105
1204 3300042876 Ga0451577_0026508 Ga0451577_0026508_2357_2674 105
1205 3300042876 Ga0451577_0071068 Ga0451577_0071068_124_513 105
1206 3300042993 Ga0439440_0023912 Ga0439440_0023912_191_508 105
1207 3300044712 Ga0453684_0100243 Ga0453684_0100243_1109_1426 105
1208 3300044712 Ga0453684_0710947 Ga0453684_0710947_26_415 105
1209 3300045051 Ga0451576_0043483 Ga0451576_0043483_3425_3742 105
1210 3300045051 Ga0451576_0156108 Ga0451576_0156108_731_1048 105
1211 3300045051 Ga0451576_1150502 Ga0451576_1150502_284_601 105
1212 3300046460 Ga0495638_0090616 Ga0495638_0090616_1097_1414 105
1213 3300046471 Ga0495650_0004549 Ga0495650_0004549_6745_7062 105
1214 3300046475 Ga0495639_0403790 Ga0495639_0403790_290_607 105
1215 3300046492 Ga0495585_0251056 Ga0495585_0251056_484_801 105
1216 3300046519 Ga0495632_0037117 Ga0495632_0037117_2111_2428 105
1217 3300046519 Ga0495632_0268102 Ga0495632_0268102_44_361 105
1218 3300046526 Ga0495666_0231105 Ga0495666_0231105_401_718 105
1219 3300046530 Ga0495654_0411180 Ga0495654_0411180_140_457 105
1220 3300046535 Ga0495586_0092668 Ga0495586_0092668_431_748 105
1221 3300046535 Ga0495586_0445947 Ga0495586_0445947_349_666 105
1222 3300046616 Ga0495668_0136290 Ga0495668_0136290_714_1031 105
1223 3300046642 Ga0495634_0279558 Ga0495634_0279558_285_602 105
1224 3300046660 Ga0495625_0129979 Ga0495625_0129979_411_728 105
1225 3300046660 Ga0495625_0178817 Ga0495625_0178817_376_693 105
1226 3300046660 Ga0495625_0499700 Ga0495625_0499700_369_686 105
1227 3300046675 Ga0495657_0406019 Ga0495657_0406019_157_474 105
1228 3300046683 Ga0495658_0052808 Ga0495658_0052808_1463_1780 105
1229 3300046684 Ga0495669_0435268 Ga0495669_0435268_256_573 105
1230 3300046690 Ga0495624_0384492 Ga0495624_0384492_338_655 105
1231 3300047320 Ga0495672_0069285 Ga0495672_0069285_289_606 105
1232 3300047322 Ga0495680_0242678 Ga0495680_0242678_18_335 105
1233 3300048091 Ga0495626_0088816 Ga0495626_0088816_472_789 105
1234 3300048909 Ga0496106_0422504 Ga0496106_0422504_352_669 105
1235 3300048910 Ga0496107_0553541 Ga0496107_0553541_168_485 105
1236 3300048914 Ga0496111_0042076 Ga0496111_0042076_132_449 105
1237 3300048915 Ga0496112_0082474 Ga0496112_0082474_926_1243 105
1238 3300048916 Ga0496113_0146811 Ga0496113_0146811_554_871 105
1239 3300048917 Ga0496114_0149762 Ga0496114_0149762_16_333 105
1240 3300048917 Ga0496114_0277221 Ga0496114_0277221_372_689 105
1241 3300049127 Ga0501306_019749 Ga0501306_019749_48_365 105
1242 3300049514 Ga0501291_074711 Ga0501291_074711_137_454 105
1243 3300049515 Ga0501292_063228 Ga0501292_063228_124_441 105
1244 3300049517 Ga0501294_016082 Ga0501294_016082_207_524 105
1245 3300049518 Ga0501295_199824 Ga0501295_199824_167_484 105
1246 3300049522 Ga0501299_053130 Ga0501299_053130_465_782 105
1247 3300049522 Ga0501299_081347 Ga0501299_081347_162_479 105
1248 3300049523 Ga0501300_034043 Ga0501300_034043_13_330 105
1249 3300049524 Ga0501301_008534 Ga0501301_008534_308_625 105
1250 3300049569 Ga0501032_0401060 Ga0501032_0401060_464_793 105
1251 3300049571 Ga0501034_0136286 Ga0501034_0136286_231_548 105
1252 3300049572 Ga0501036_0444443 Ga0501036_0444443_380_709 105
1253 3300049575 Ga0501039_1048478 Ga0501039_1048478_284_613 105
1254 3300049575 Ga0501039_1218041 Ga0501039_1218041_56_385 105
1255 3300049576 Ga0501040_0624474 Ga0501040_0624474_281_610 105
1256 3300049577 Ga0501041_0177185 Ga0501041_0177185_727_1056 105
1257 3300049577 Ga0501041_1066210 Ga0501041_1066210_154_471 105
1258 3300049580 Ga0501046_0487364 Ga0501046_0487364_478_795 105
1259 3300049581 Ga0501047_0339511 Ga0501047_0339511_285_602 105
1260 3300049581 Ga0501047_1054888 Ga0501047_1054888_164_481 105
1261 3300049582 Ga0501048_1169945 Ga0501048_1169945_15_332 105
1262 3300049587 Ga0501071_0152726 Ga0501071_0152726_684_1013 105
1263 3300049587 Ga0501071_0213057 Ga0501071_0213057_960_1277 105
1264 3300049589 Ga0501073_0735081 Ga0501073_0735081_231_560 105
1265 3300049590 Ga0501074_0414237 Ga0501074_0414237_408_737 105
1266 3300049590 Ga0501074_0666513 Ga0501074_0666513_297_614 105
1267 3300049592 Ga0501076_0668716 Ga0501076_0668716_483_800 105
1268 3300049660 Ga0501216_028415 Ga0501216_028415_137_454 105
1269 3300049661 Ga0501217_067008 Ga0501217_067008_393_710 105
1270 3300049668 Ga0501233_080615 Ga0501233_080615_127_444 105
1271 3300049677 Ga0501247_089256 Ga0501247_089256_175_492 105
1272 3300049679 Ga0501249_064476 Ga0501249_064476_415_732 105
1273 3300049683 Ga0501253_058896 Ga0501253_058896_78_395 105
1274 3300049703 Ga0501219_016367 Ga0501219_016367_204_521 105
1275 3300049705 Ga0501225_0041457 Ga0501225_0041457_457_774 105
1276 3300049741 Ga0501079_0371358 Ga0501079_0371358_86_415 105
1277 3300049741 Ga0501079_1470233 Ga0501079_1470233_36_353 105
1278 3300049742 Ga0501080_0140864 Ga0501080_0140864_1806_2135 105
1279 3300049763 Ga0501266_014280 Ga0501266_014280_143_460 105
1280 3300049767 Ga0501270_027915 Ga0501270_027915_218_535 105
1281 3300049774 Ga0501278_014263 Ga0501278_014263_179_496 105
1282 3300049822 Ga0501035_0330726 Ga0501035_0330726_757_1086 105
1283 3300049824 Ga0501045_1284783 Ga0501045_1284783_36_365 105
1284 3300049851 Ga0501212_037303 Ga0501212_037303_331_648 105
1285 3300050507 nmdc:mga05p37_381673_c1 nmdc:mga05p37_381673_c1_702_1019 105
1286 3300050507 nmdc:mga05p37_662_c1 nmdc:mga05p37_662_c1_19739_20056 105
1287 3300050507 nmdc:mga05p37_8136_c1 nmdc:mga05p37_8136_c1_7437_7754 105
1288 3300050508 nmdc:mga09592_2530_c1 nmdc:mga09592_2530_c1_3145_3462 105
1289 3300050508 nmdc:mga09592_47268_c1 nmdc:mga09592_47268_c1_2615_2944 105
1290 3300050508 nmdc:mga09592_513_c1 nmdc:mga09592_513_c1_1638_1955 105
1291 3300050509 nmdc:mga0qj67_107101_c1 nmdc:mga0qj67_107101_c1_127_456 105
1292 3300050509 nmdc:mga0qj67_11050_c1 nmdc:mga0qj67_11050_c1_1462_1779 105
1293 3300050509 nmdc:mga0qj67_14416_c1 nmdc:mga0qj67_14416_c1_5110_5427 105
1294 3300050509 nmdc:mga0qj67_251514_c1 nmdc:mga0qj67_251514_c1_1058_1375 105
1295 3300050509 nmdc:mga0qj67_32544_c1 nmdc:mga0qj67_32544_c1_2532_2849 105
1296 3300050509 nmdc:mga0qj67_51822_c1 nmdc:mga0qj67_51822_c1_1171_1488 105
1297 3300050509 nmdc:mga0qj67_723954_c1 nmdc:mga0qj67_723954_c1_284_601 105
1298 3300050510 nmdc:mga06r32_19490_c1 nmdc:mga06r32_19490_c1_2962_3279 105
1299 3300050510 nmdc:mga06r32_2943_c1 nmdc:mga06r32_2943_c1_8298_8615 105
1300 3300050510 nmdc:mga06r32_772315_c1 nmdc:mga06r32_772315_c1_204_521 105
1301 3300050510 nmdc:mga06r32_93_c1 nmdc:mga06r32_93_c1_13390_13707 105
1302 3300050511 nmdc:mga08y16_11335_c1 nmdc:mga08y16_11335_c1_5841_6170 105
1303 3300050511 nmdc:mga08y16_30678_c1 nmdc:mga08y16_30678_c1_2285_2602 105
1304 3300050511 nmdc:mga08y16_541403_c1 nmdc:mga08y16_541403_c1_661_990 105
1305 3300050512 nmdc:mga0n895_1211928_c1 nmdc:mga0n895_1211928_c1_371_688 105
1306 3300050512 nmdc:mga0n895_198762_c1 nmdc:mga0n895_198762_c1_853_1170 105
1307 3300050513 nmdc:mga0rr50_262247_c1 nmdc:mga0rr50_262247_c1_486_815 105
1308 3300053079 Ga0500610_0347206 Ga0500610_0347206_257_574 105
1309 3300053087 Ga0500643_085723 Ga0500643_085723_437_754 105
1310 3300053088 Ga0500644_0218906 Ga0500644_0218906_244_561 105
1311 3300053092 Ga0500583_0144740 Ga0500583_0144740_101_418 105
1312 3300053092 Ga0500583_0188012 Ga0500583_0188012_290_607 105
1313 3300053096 Ga0500641_0002198 Ga0500641_0002198_3097_3426 105
1314 3300053098 Ga0500650_0032253 Ga0500650_0032253_627_944 105
1315 3300053104 Ga0500556_0042674 Ga0500556_0042674_573_890 105
1316 3300053108 Ga0500562_114712 Ga0500562_114712_216_533 105
1317 3300053124 Ga0500617_144670 Ga0500617_144670_148_465 105
1318 3300053130 Ga0500642_0152836 Ga0500642_0152836_541_858 105
1319 3300053134 Ga0500658_0055102 Ga0500658_0055102_655_972 105
1320 3300053134 Ga0500658_0126395 Ga0500658_0126395_318_635 105
1321 3300053139 Ga0500568_0038663 Ga0500568_0038663_705_1040 105
1322 3300053139 Ga0500568_0073441 Ga0500568_0073441_101_418 105
1323 3300053142 Ga0500577_0211746 Ga0500577_0211746_388_705 105
1324 3300053146 Ga0500588_0000825 Ga0500588_0000825_3153_3470 105
1325 3300053146 Ga0500588_0037797 Ga0500588_0037797_444_761 105
1326 3300053147 Ga0500589_063307 Ga0500589_063307_859_1176 105
1327 3300053147 Ga0500589_187897 Ga0500589_187897_187_504 105
1328 3300053151 Ga0500604_0069821 Ga0500604_0069821_354_671 105
1329 3300053156 Ga0500622_0000318 Ga0500622_0000318_28322_28639 105
1330 3300053156 Ga0500622_0003146 Ga0500622_0003146_931_1248 105
1331 3300053158 Ga0500627_0064483 Ga0500627_0064483_65_382 105
1332 3300053158 Ga0500627_0194676 Ga0500627_0194676_181_498 105
1333 3300053727 Ga0500611_120234 Ga0500611_120234_308_625 105
1334 3300054114 Ga0501084_1838453 Ga0501084_1838453_138_455 105
1335 3300061734 Ga0530510_0301529 Ga0530510_0301529_854_1183 105
1336 3300000546 LJNas_1005235 LJNas_10052352 106
1337 3300001977 JGI24746J21847_1038090 JGI24746J21847_10380901 106
1338 3300002239 JGI24034J26672_10044462 JGI24034J26672_100444621 106
1339 3300004798 Ga0058859_11646593 Ga0058859_116465932 106
1340 3300004801 Ga0058860_11393278 Ga0058860_113932781 106
1341 3300005288 Ga0065714_10207824 Ga0065714_102078241 106
1342 3300005290 Ga0065712_10216368 Ga0065712_102163682 106
1343 3300005295 Ga0065707_10067934 Ga0065707_100679341 106
1344 3300005327 Ga0070658_10830157 Ga0070658_108301572 106
1345 3300005334 Ga0068869_100610042 Ga0068869_1006100421 106
1346 3300005347 Ga0070668_100149836 Ga0070668_1001498362 106
1347 3300005347 Ga0070668_101163669 Ga0070668_1011636692 106
1348 3300005353 Ga0070669_100293528 Ga0070669_1002935282 106
1349 3300005355 Ga0070671_100253518 Ga0070671_1002535182 106
1350 3300005364 Ga0070673_100112326 Ga0070673_1001123263 106
1351 3300005364 Ga0070673_100921735 Ga0070673_1009217352 106
1352 3300005365 Ga0070688_100224277 Ga0070688_1002242771 106
1353 3300005366 Ga0070659_100804647 Ga0070659_1008046472 106
1354 3300005436 Ga0070713_100025052 Ga0070713_1000250522 106
1355 3300005439 Ga0070711_100056066 Ga0070711_1000560662 106
1356 3300005440 Ga0070705_100088221 Ga0070705_1000882212 106
1357 3300005444 Ga0070694_100442600 Ga0070694_1004426001 106
1358 3300005456 Ga0070678_100346570 Ga0070678_1003465701 106
1359 3300005458 Ga0070681_10101137 Ga0070681_101011372 106
1360 3300005458 Ga0070681_10421308 Ga0070681_104213082 106
1361 3300005545 Ga0070695_100821432 Ga0070695_1008214321 106
1362 3300005546 Ga0070696_100000793 Ga0070696_1000007939 106
1363 3300005546 Ga0070696_100768358 Ga0070696_1007683581 106
1364 3300005547 Ga0070693_100361855 Ga0070693_1003618552 106
1365 3300005549 Ga0070704_100016184 Ga0070704_1000161843 106
1366 3300005549 Ga0070704_100326746 Ga0070704_1003267462 106
1367 3300005563 Ga0068855_100308078 Ga0068855_1003080782 106
1368 3300005577 Ga0068857_100156726 Ga0068857_1001567262 106
1369 3300005617 Ga0068859_102050216 Ga0068859_1020502162 106
1370 3300005719 Ga0068861_100485387 Ga0068861_1004853872 106
1371 3300005844 Ga0068862_100823930 Ga0068862_1008239302 106
1372 3300006163 Ga0070715_10115736 Ga0070715_101157361 106
1373 3300006844 Ga0075428_100001284 Ga0075428_1000012844 106
1374 3300006846 Ga0075430_100775905 Ga0075430_1007759051 106
1375 3300006852 Ga0075433_10046168 Ga0075433_100461683 106
1376 3300006871 Ga0075434_100000591 Ga0075434_10000059117 106
1377 3300006880 Ga0075429_101724499 Ga0075429_1017244991 106
1378 3300006931 Ga0097620_102050421 Ga0097620_1020504212 106
1379 3300007265 Ga0099794_10051385 Ga0099794_100513851 106
1380 3300007265 Ga0099794_10163348 Ga0099794_101633482 106
1381 3300007788 Ga0099795_10000810 Ga0099795_100008102 106
1382 3300009036 Ga0105244_10163870 Ga0105244_101638701 106
1383 3300009094 Ga0111539_10007423 Ga0111539_1000742310 106
1384 3300009553 Ga0105249_11614564 Ga0105249_116145642 106
1385 3300010159 Ga0099796_10000821 Ga0099796_100008214 106
1386 3300010159 Ga0099796_10071209 Ga0099796_100712092 106
1387 3300013306 Ga0163162_10915917 Ga0163162_109159171 106
1388 3300014326 Ga0157380_10006793 Ga0157380_100067934 106
1389 3300014326 Ga0157380_10030001 Ga0157380_100300013 106
1390 3300014326 Ga0157380_11366724 Ga0157380_113667242 106
1391 3300024227 Ga0228598_1040600 Ga0228598_10406002 106
1392 3300025901 Ga0207688_10694336 Ga0207688_106943361 106
1393 3300025905 Ga0207685_10731805 Ga0207685_107318051 106
1394 3300025908 Ga0207643_10112736 Ga0207643_101127363 106
1395 3300025913 Ga0207695_10169571 Ga0207695_101695712 106
1396 3300025916 Ga0207663_10156363 Ga0207663_101563632 106
1397 3300025923 Ga0207681_10227255 Ga0207681_102272552 106
1398 3300025926 Ga0207659_10138710 Ga0207659_101387102 106
1399 3300025928 Ga0207700_10053646 Ga0207700_100536463 106
1400 3300025939 Ga0207665_10326527 Ga0207665_103265272 106
1401 3300025940 Ga0207691_10073207 Ga0207691_100732073 106
1402 3300025949 Ga0207667_10642504 Ga0207667_106425042 106
1403 3300025960 Ga0207651_10148309 Ga0207651_101483092 106
1404 3300025972 Ga0207668_11433202 Ga0207668_114332021 106
1405 3300026116 Ga0207674_10315664 Ga0207674_103156642 106
1406 3300026118 Ga0207675_100378465 Ga0207675_1003784652 106
1407 3300027395 Ga0209996_1026910 Ga0209996_10269102 106
1408 3300027512 Ga0209179_1001862 Ga0209179_10018622 106
1409 3300027671 Ga0209588_1058651 Ga0209588_10586512 106
1410 3300027695 Ga0209966_1056340 Ga0209966_10563401 106
1411 3300027717 Ga0209998_10002265 Ga0209998_100022654 106
1412 3300027876 Ga0209974_10123172 Ga0209974_101231722 106
1413 3300027907 Ga0207428_10006431 Ga0207428_100064314 106
1414 3300028016 Ga0265354_1002018 Ga0265354_10020182 106
1415 3300028017 Ga0265356_1017450 Ga0265356_10174502 106
1416 3300028017 Ga0265356_1029308 Ga0265356_10293081 106
1417 3300028023 Ga0265357_1000774 Ga0265357_10007742 106
1418 3300028036 Ga0265355_1001702 Ga0265355_10017022 106
1419 3300028800 Ga0265338_10421732 Ga0265338_104217322 106
1420 3300030760 Ga0265762_1150451 Ga0265762_11504511 106
1421 3300030878 Ga0265770_1001311 Ga0265770_10013113 106
1422 3300030879 Ga0265765_1032431 Ga0265765_10324312 106
1423 3300031010 Ga0265771_1010170 Ga0265771_10101702 106
1424 3300031018 Ga0265773_1003947 Ga0265773_10039472 106
1425 3300031090 Ga0265760_10001990 Ga0265760_100019903 106
1426 3300031090 Ga0265760_10016230 Ga0265760_100162302 106
1427 3300031344 Ga0265316_10169581 Ga0265316_101695812 106
1428 3300031548 Ga0307408_101432044 Ga0307408_1014320442 106
1429 3300031595 Ga0265313_10047515 Ga0265313_100475151 106
1430 3300031730 Ga0307516_10000423 Ga0307516_1000042337 106
1431 3300031731 Ga0307405_10024050 Ga0307405_100240503 106
1432 3300031824 Ga0307413_10229377 Ga0307413_102293772 106
1433 3300031852 Ga0307410_10063447 Ga0307410_100634472 106
1434 3300031901 Ga0307406_10723069 Ga0307406_107230692 106
1435 3300031903 Ga0307407_10260526 Ga0307407_102605261 106
1436 3300031911 Ga0307412_10214112 Ga0307412_102141122 106
1437 3300031911 Ga0307412_12083520 Ga0307412_120835201 106
1438 3300031995 Ga0307409_100185402 Ga0307409_1001854021 106
1439 3300032002 Ga0307416_100550973 Ga0307416_1005509732 106
1440 3300032004 Ga0307414_12032772 Ga0307414_120327722 106
1441 3300032005 Ga0307411_11057229 Ga0307411_110572292 106
1442 3300032126 Ga0307415_100001511 Ga0307415_1000015115 106
1443 3300033180 Ga0307510_10355367 Ga0307510_103553672 106
1444 3300033547 Ga0316212_1047236 Ga0316212_10472362 106
1445 3300035111 Ga0373923_0124926 Ga0373923_0124926_120_440 106
1446 3300035117 Ga0373953_0209399 Ga0373953_0209399_95_415 106
1447 3300035118 Ga0373954_0073506 Ga0373954_0073506_194_514 106
1448 3300035120 Ga0373957_0101976 Ga0373957_0101976_312_632 106
1449 3300035172 Ga0373955_0545013 Ga0373955_0545013_131_451 106
1450 3300035692 Ga0373935_0502596 Ga0373935_0502596_67_387 106
1451 3300036401 Ga0373937_0317423 Ga0373937_0317423_717_1037 106
1452 3300037068 Ga0373925_0024612 Ga0373925_0024612_293_613 106
1453 3300039437 Ga0436365_1891849 Ga0436365_1891849_240_560 106
1454 3300041407 Ga0439447_049395 Ga0439447_049395_389_748 106
1455 3300041410 Ga0439461_0119655 Ga0439461_0119655_123_452 106
1456 3300041997 Ga0439431_0083965 Ga0439431_0083965_504_833 106
1457 3300041999 Ga0439433_0040214 Ga0439433_0040214_55_384 106
1458 3300042001 Ga0439441_047092 Ga0439441_047092_394_753 106
1459 3300042003 Ga0439443_002397 Ga0439443_002397_382_741 106
1460 3300042013 Ga0439456_050303 Ga0439456_050303_335_694 106
1461 3300042116 Ga0450912_013395 Ga0450912_013395_22_351 106
1462 3300042121 Ga0450919_040162 Ga0450919_040162_59_388 106
1463 3300042122 Ga0450920_029397 Ga0450920_029397_453_812 106
1464 3300042123 Ga0450921_002385 Ga0450921_002385_863_1192 106
1465 3300042125 Ga0450923_075394 Ga0450923_075394_24_353 106
1466 3300042127 Ga0450890_013971 Ga0450890_013971_676_1035 106
1467 3300042127 Ga0450890_021116 Ga0450890_021116_99_428 106
1468 3300042132 Ga0450895_007646 Ga0450895_007646_105_434 106
1469 3300042133 Ga0450896_000823 Ga0450896_000823_1456_1785 106
1470 3300042133 Ga0450896_001057 Ga0450896_001057_819_1148 106
1471 3300042134 Ga0450898_005988 Ga0450898_005988_561_920 106
1472 3300042146 Ga0450907_021884 Ga0450907_021884_257_616 106
1473 3300042156 Ga0439446_0007988 Ga0439446_0007988_592_951 106
1474 3300042156 Ga0439446_0029029 Ga0439446_0029029_519_848 106
1475 3300042156 Ga0439446_0080440 Ga0439446_0080440_529_888 106
1476 3300042184 Ga0450908_000192 Ga0450908_000192_5818_6147 106
1477 3300042184 Ga0450908_008697 Ga0450908_008697_578_937 106
1478 3300042185 Ga0450909_010586 Ga0450909_010586_216_575 106
1479 3300042435 Ga0439434_0019108 Ga0439434_0019108_1354_1683 106
1480 3300042437 Ga0439444_0003242 Ga0439444_0003242_1741_2070 106
1481 3300042461 Ga0439460_0037722 Ga0439460_0037722_584_943 106
1482 3300042530 Ga0450916_107861 Ga0450916_107861_75_404 106
1483 3300042532 Ga0450893_0059821 Ga0450893_0059821_151_510 106
1484 3300044712 Ga0453684_0740785 Ga0453684_0740785_603_923 106
1485 3300045051 Ga0451576_0104353 Ga0451576_0104353_122_442 106
1486 3300046491 Ga0495584_0156842 Ga0495584_0156842_251_571 106
1487 3300046516 Ga0495628_1162360 Ga0495628_1162360_151_471 106
1488 3300046529 Ga0495652_0840483 Ga0495652_0840483_183_503 106
1489 3300046557 Ga0495622_0397610 Ga0495622_0397610_27_350 106
1490 3300047322 Ga0495680_0338892 Ga0495680_0338892_321_644 106
1491 3300048907 Ga0496104_0021988 Ga0496104_0021988_941_1261 106
1492 3300048908 Ga0496105_0014994 Ga0496105_0014994_4644_4964 106
1493 3300048910 Ga0496107_0129988 Ga0496107_0129988_446_766 106
1494 3300048917 Ga0496114_0009814 Ga0496114_0009814_4950_5270 106
1495 3300048918 Ga0496115_0443371 Ga0496115_0443371_138_458 106
1496 3300049568 Ga0501031_0100963 Ga0501031_0100963_136_465 106
1497 3300049568 Ga0501031_0319551 Ga0501031_0319551_29_349 106
1498 3300049569 Ga0501032_0028835 Ga0501032_0028835_988_1317 106
1499 3300049570 Ga0501033_0402185 Ga0501033_0402185_439_768 106
1500 3300049570 Ga0501033_0689557 Ga0501033_0689557_289_609 106
1501 3300049572 Ga0501036_0000947 Ga0501036_0000947_18826_19146 106
1502 3300049572 Ga0501036_0031170 Ga0501036_0031170_307_636 106
1503 3300049572 Ga0501036_0053598 Ga0501036_0053598_2164_2484 106
1504 3300049573 Ga0501037_0016924 Ga0501037_0016924_4723_5052 106
1505 3300049574 Ga0501038_0011051 Ga0501038_0011051_4067_4387 106
1506 3300049574 Ga0501038_0146197 Ga0501038_0146197_1055_1384 106
1507 3300049574 Ga0501038_0323332 Ga0501038_0323332_385_714 106
1508 3300049575 Ga0501039_0000322 Ga0501039_0000322_32571_32891 106
1509 3300049575 Ga0501039_0050028 Ga0501039_0050028_2688_3008 106
1510 3300049575 Ga0501039_0197629 Ga0501039_0197629_324_653 106
1511 3300049575 Ga0501039_0595879 Ga0501039_0595879_286_615 106
1512 3300049575 Ga0501039_0691882 Ga0501039_0691882_75_404 106
1513 3300049576 Ga0501040_0000188 Ga0501040_0000188_22_342 106
1514 3300049576 Ga0501040_0010458 Ga0501040_0010458_3477_3806 106
1515 3300049577 Ga0501041_0000269 Ga0501041_0000269_20170_20490 106
1516 3300049577 Ga0501041_0028556 Ga0501041_0028556_2515_2835 106
1517 3300049577 Ga0501041_0032199 Ga0501041_0032199_430_759 106
1518 3300049577 Ga0501041_0453293 Ga0501041_0453293_103_432 106
1519 3300049578 Ga0501042_0035564 Ga0501042_0035564_998_1318 106
1520 3300049578 Ga0501042_0196877 Ga0501042_0196877_382_711 106
1521 3300049579 Ga0501043_0008846 Ga0501043_0008846_5397_5717 106
1522 3300049579 Ga0501043_0228276 Ga0501043_0228276_522_851 106
1523 3300049580 Ga0501046_0032906 Ga0501046_0032906_2314_2643 106
1524 3300049580 Ga0501046_0065390 Ga0501046_0065390_2382_2702 106
1525 3300049580 Ga0501046_0567786 Ga0501046_0567786_18_338 106
1526 3300049581 Ga0501047_0560936 Ga0501047_0560936_337_666 106
1527 3300049582 Ga0501048_0002660 Ga0501048_0002660_12479_12799 106
1528 3300049582 Ga0501048_0036457 Ga0501048_0036457_788_1117 106
1529 3300049582 Ga0501048_0505723 Ga0501048_0505723_318_647 106
1530 3300049583 Ga0501067_0007150 Ga0501067_0007150_2264_2593 106
1531 3300049584 Ga0501068_0036761 Ga0501068_0036761_367_696 106
1532 3300049584 Ga0501068_0556078 Ga0501068_0556078_282_611 106
1533 3300049585 Ga0501069_0108047 Ga0501069_0108047_874_1203 106
1534 3300049586 Ga0501070_0582021 Ga0501070_0582021_142_471 106
1535 3300049587 Ga0501071_0014106 Ga0501071_0014106_2912_3232 106
1536 3300049587 Ga0501071_0025539 Ga0501071_0025539_1401_1721 106
1537 3300049587 Ga0501071_0121000 Ga0501071_0121000_666_995 106
1538 3300049587 Ga0501071_0310494 Ga0501071_0310494_612_941 106
1539 3300049587 Ga0501071_0374430 Ga0501071_0374430_741_1070 106
1540 3300049587 Ga0501071_0600918 Ga0501071_0600918_197_526 106
1541 3300049587 Ga0501071_1174680 Ga0501071_1174680_138_467 106
1542 3300049588 Ga0501072_0002259 Ga0501072_0002259_6144_6464 106
1543 3300049588 Ga0501072_0038934 Ga0501072_0038934_2314_2643 106
1544 3300049588 Ga0501072_0045324 Ga0501072_0045324_2707_3027 106
1545 3300049588 Ga0501072_0297632 Ga0501072_0297632_386_715 106
1546 3300049588 Ga0501072_0690634 Ga0501072_0690634_140_469 106
1547 3300049589 Ga0501073_0014788 Ga0501073_0014788_3970_4299 106
1548 3300049589 Ga0501073_0152515 Ga0501073_0152515_439_768 106
1549 3300049589 Ga0501073_0179814 Ga0501073_0179814_302_622 106
1550 3300049589 Ga0501073_0204240 Ga0501073_0204240_831_1160 106
1551 3300049590 Ga0501074_0534173 Ga0501074_0534173_120_449 106
1552 3300049591 Ga0501075_0000082 Ga0501075_0000082_2424_2744 106
1553 3300049591 Ga0501075_0042017 Ga0501075_0042017_439_759 106
1554 3300049591 Ga0501075_0143535 Ga0501075_0143535_735_1064 106
1555 3300049591 Ga0501075_0158999 Ga0501075_0158999_906_1235 106
1556 3300049591 Ga0501075_1521746 Ga0501075_1521746_167_496 106
1557 3300049592 Ga0501076_0006540 Ga0501076_0006540_8055_8375 106
1558 3300049592 Ga0501076_0006615 Ga0501076_0006615_302_622 106
1559 3300049592 Ga0501076_0030447 Ga0501076_0030447_268_597 106
1560 3300049592 Ga0501076_0047451 Ga0501076_0047451_1788_2108 106
1561 3300049592 Ga0501076_0052303 Ga0501076_0052303_2270_2599 106
1562 3300049592 Ga0501076_1409431 Ga0501076_1409431_115_444 106
1563 3300049593 Ga0501077_0010560 Ga0501077_0010560_917_1246 106
1564 3300049593 Ga0501077_0049066 Ga0501077_0049066_18_338 106
1565 3300049593 Ga0501077_0059394 Ga0501077_0059394_1097_1417 106
1566 3300049593 Ga0501077_0197227 Ga0501077_0197227_601_930 106
1567 3300049741 Ga0501079_0000290 Ga0501079_0000290_23121_23441 106
1568 3300049741 Ga0501079_0014415 Ga0501079_0014415_3020_3340 106
1569 3300049741 Ga0501079_0058865 Ga0501079_0058865_815_1144 106
1570 3300049741 Ga0501079_0773406 Ga0501079_0773406_106_435 106
1571 3300049741 Ga0501079_1606202 Ga0501079_1606202_142_471 106
1572 3300049742 Ga0501080_0009710 Ga0501080_0009710_8130_8459 106
1573 3300049742 Ga0501080_0158121 Ga0501080_0158121_157_477 106
1574 3300049742 Ga0501080_0337875 Ga0501080_0337875_192_521 106
1575 3300049743 Ga0501081_0000015 Ga0501081_0000015_34561_34881 106
1576 3300049743 Ga0501081_0006175 Ga0501081_0006175_6852_7181 106
1577 3300049743 Ga0501081_0050037 Ga0501081_0050037_2222_2542 106
1578 3300049743 Ga0501081_0426399 Ga0501081_0426399_151_480 106
1579 3300049743 Ga0501081_1025698 Ga0501081_1025698_82_411 106
1580 3300049743 Ga0501081_1049363 Ga0501081_1049363_152_481 106
1581 3300049822 Ga0501035_0235740 Ga0501035_0235740_414_734 106
1582 3300049822 Ga0501035_0307350 Ga0501035_0307350_460_789 106
1583 3300049822 Ga0501035_0715502 Ga0501035_0715502_366_686 106
1584 3300049824 Ga0501045_0000284 Ga0501045_0000284_29319_29639 106
1585 3300049824 Ga0501045_0016097 Ga0501045_0016097_2255_2575 106
1586 3300050508 nmdc:mga09592_1178559_c1 nmdc:mga09592_1178559_c1_236_565 106
1587 3300050511 nmdc:mga08y16_266615_c1 nmdc:mga08y16_266615_c1_855_1184 106
1588 3300050511 nmdc:mga08y16_9557_c1 nmdc:mga08y16_9557_c1_764_1093 106
1589 3300050512 nmdc:mga0n895_5728_c1 nmdc:mga0n895_5728_c1_1747_2076 106
1590 3300050513 nmdc:mga0rr50_228421_c1 nmdc:mga0rr50_228421_c1_63_392 106
1591 3300050515 nmdc:mga0a205_1357_c2 nmdc:mga0a205_1357_c2_8237_8566 106
1592 3300053077 Ga0495601_0156897 Ga0495601_0156897_971_1291 106
1593 3300053092 Ga0500583_0072418 Ga0500583_0072418_1245_1568 106
1594 3300053178 Ga0500637_0005251 Ga0500637_0005251_1387_1710 106
1595 3300054114 Ga0501084_0024614 Ga0501084_0024614_4341_4670 106
1596 3300054114 Ga0501084_0072927 Ga0501084_0072927_1820_2149 106
1597 3300054114 Ga0501084_0569580 Ga0501084_0569580_19_348 106
1598 3300054114 Ga0501084_0587161 Ga0501084_0587161_407_736 106
1599 3300060353 Ga0501082_0000222 Ga0501082_0000222_8909_9229 106
1600 3300060353 Ga0501082_0003441 Ga0501082_0003441_7815_8144 106
1601 3300060353 Ga0501082_0025636 Ga0501082_0025636_2186_2506 106
1602 3300060353 Ga0501082_0082626 Ga0501082_0082626_780_1109 106
1603 3300061734 Ga0530510_0001028 Ga0530510_0001028_2434_2754 106
1604 3300061734 Ga0530510_0019249 Ga0530510_0019249_1732_2052 106
1605 3300061734 Ga0530510_0166162 Ga0530510_0166162_780_1109 106
1606 3300061734 Ga0530510_0222252 Ga0530510_0222252_462_791 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

46

125

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dnj-assembly2.cif.gz_A the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide 0.9906 28 106
3g3p-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9897 25 106
3gq1-assembly2.cif.gz_B the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide 0.9844 23 106
2wa9-assembly2.cif.gz_B structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps - trp peptide structure 0.9806 23 106
3o1f-assembly2.cif.gz_B p1 crystal form of e. coli clps at 1.4 a resolution 0.9797 27 106
ID Description Score Start End Superfamily
af_P0A8Q6_1_106_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9821 22 106 3.30.1390.10
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9746 27 106 3.30.1390.10
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9618 24 106 3.30.1390.10
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9511 27 106 3.30.1390.10
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9508 24 106 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A5S5MC12-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9853 18 106 GO:0006508
GO:0008233
GO:0030163
AF-A0A2R7Q341-F1-model_v4 deleted 0.9834 20 106
AF-A0A381GJP6-F1-model_v4 deleted 0.9833 22 106
AF-A0A0L6JMT2-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9825 22 106 GO:0006508
GO:0008233
GO:0030163
AF-A0A4R3Z2M3-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9818 22 106 GO:0006508
GO:0008233
GO:0030163

Feature Viewer

pLDDT pTM Quality
86.93 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map