F493875

General Info

Members Datasets Scaffolds Average Seq Length
1427 504 2844 347

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100161247|Ga0070707_1001612472
Length 382
Sequence MITTIFSLNHMLTCRLKCLAVVNYIKSKKFFHFMKAAVFREYNKDPTRVVKIEDIDLPKLKPNEVLIKVDAASYNYNDLWAIWGEPIKTPLPHISGSDAAGSVVEVGEDVKKIKVGDRVVSHSNMSCRVCDMCTSGREYDCNDRTIWGFQTGPLWGAFAQYTRLPEVNVVKIPDNVSFNDAAAISMVGMTAWHMLVGRTKIKPGQTVLIMGGGSGVGMVGLQIAKLYNCNVIATAGNKDKMDKCIQLGADHVVNHREADWYKKVREITNKQGVDVVFEHIGKATFPQGVGLLKMGGTLVITGATTGYDSTIDLRYLFFRGTNLLGSTQGTKAELEQVIYWAGKGKIKPVIDTVLPFSDMVKGHVMMAEAQHFGKILTTPQKI

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
6 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
7 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
8 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
9 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
10 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
11 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
12 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
24 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
25 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
27 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
28 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
29 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
30 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
31 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
32 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
33 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
34 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
35 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
36 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
37 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
38 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
42 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
43 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
45 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
140 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
141 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
142 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
143 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
144 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
145 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
146 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
147 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
148 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
149 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
150 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
151 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
152 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
153 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
154 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
155 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
156 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
157 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
158 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
159 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
160 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
161 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
162 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
163 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
164 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
165 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
166 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
173 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
174 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
175 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
176 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
177 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
178 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
179 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
285 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
288 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
296 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
300 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
303 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
304 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
305 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
308 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
309 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
310 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
311 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
312 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
313 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
314 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
315 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
316 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
317 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
318 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
319 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
320 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
321 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
322 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
323 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
324 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
325 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
371 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
372 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
373 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
374 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
375 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
376 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
377 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
378 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
381 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
413 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
414 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
415 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
416 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
417 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
418 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
419 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
420 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
421 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
422 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
423 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
424 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
425 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
426 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
427 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
428 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
429 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
430 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
431 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
432 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
433 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
434 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
435 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
436 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
437 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
438 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
439 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
440 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
441 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
442 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
443 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
444 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
445 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
446 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
447 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
448 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
449 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
450 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
451 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
452 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
453 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
454 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
460 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
461 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
462 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
463 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
464 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
465 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
466 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
467 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
468 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
469 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
470 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
471 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
472 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
473 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
474 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
478 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
479 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
480 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
481 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
482 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
483 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
484 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
485 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
486 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
487 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
488 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
491 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
492 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
493 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
494 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
504 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 2.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.96
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100161247 3300005468 Archaea 2185
2 SwRhRL3b_contig_2974144 2162886006 Unclassified 1313
3 SwRhRL3b_contig_3448436 2162886006 Unclassified 1313
4 SwRhRL2b_contig_2818508 2162886007 Archaea 1368
5 MRS1b_contig_6683908 2162886011 Archaea 1932
6 MBSR1b_contig_4268051 2162886012 Archaea 1254
7 MBSR1b_contig_6032307 2162886012 Archaea 3037
8 MBSR1b_contig_7093716 2162886012 Archaea 1272
9 2214772978 2209111006 Archaea 12812
10 ARcpr5oldR_c000304 3300000041 Archaea 7175
11 ARcpr5oldR_c001276 3300000041 Archaea 2569
12 ARSoilYngRDRAFT_c00079 3300000042 Archaea 16101
13 ARSoilYngRDRAFT_c00082 3300000042 Archaea 15803
14 ARcpr5yngRDRAFT_c000604 3300000043 Archaea 4515
15 ARcpr5yngRDRAFT_c002333 3300000043 Archaea 1982
16 ARSoilOldRDRAFT_c000733 3300000044 Archaea 3364
17 ARSoilOldRDRAFT_c001375 3300000044 Archaea 2265
18 ARSoilOldRDRAFT_c003217 3300000044 Archaea 1411
19 ARCol0oldRDRAFT_c00007 3300000045 Archaea 17613
20 ARCol0oldRDRAFT_c00498 3300000045 Archaea 3614
21 ARCol0yngRDRAFT_1000090 3300000652 Archaea 16966
22 JGI24736J21556_1001046 3300001904 Archaea 5044
23 JGI24746J21847_1001064 3300001977 Archaea 4309
24 JGI24746J21847_1001913 3300001977 Archaea 3319
25 JGI24739J22299_10004350 3300001989 Archaea 5425
26 JGI24737J22298_10009108 3300001990 Archaea 3308
27 JGI24745J21846_1000096 3300002073 Archaea 6531
28 JGI24033J26618_1004215 3300002155 Archaea 1545
29 JGI24033J26618_1005080 3300002155 Archaea 1441
30 JGI24033J26618_1007366 3300002155 Archaea 1250
31 JGI24742J22300_10002663 3300002244 Archaea 2864
32 JGI24742J22300_10008278 3300002244 Archaea 1715
33 JGI24751J29686_10023510 3300002459 Unclassified 1278
34 Ga0006759J45824_1027201 3300003163 Archaea 2811
35 rootL2_10253527 3300003322 Archaea 1981
36 rootL2_10291427 3300003322 Unclassified 1858
37 JGI26129J50193_1000075 3300003349 Archaea 5813
38 JGI26129J50193_1000379 3300003349 Archaea 2769
39 JGI26145J50221_1000185 3300003371 Archaea 5226
40 JGI26145J50221_1000403 3300003371 Archaea 3779
41 JGI25407J50210_10001374 3300003373 Archaea 5512
42 JGI26142J50222_100012 3300003379 Archaea 9241
43 JGI26144J50225_100080 3300003380 Archaea 4354
44 JGI26144J50225_100491 3300003380 Archaea 1478
45 JGI26139J50223_100004 3300003382 Archaea 13797
46 JGI26140J50224_100002 3300003383 Archaea 21240
47 JGI26140J50224_100177 3300003383 Archaea 3783
48 JGI26134J50242_100017 3300003392 Archaea 10125
49 JGI26137J50245_100106 3300003396 Archaea 3945
50 JGI26130J50248_100132 3300003398 Archaea 3696
51 JGI26136J50244_100060 3300003399 Archaea 4222
52 JGI26131J50246_100004 3300003400 Archaea 23494
53 JGI26131J50246_100392 3300003400 Archaea 1638
54 JGI26143J51219_1000027 3300003502 Archaea 6181
55 JGI26141J51220_1000002 3300003503 Archaea 16951
56 JGI26138J51218_100003 3300003504 Archaea 10665
57 Ga0032354_1035073 3300003693 Archaea 2814
58 Ga0006780_1021405 3300003735 Archaea 2772
59 JGI25405J52794_10000031 3300003911 Archaea 15221
60 JGI25405J52794_10000734 3300003911 Archaea 5013
61 Ga0058859_11815034 3300004798 Archaea 2735
62 Ga0058860_10043204 3300004801 Archaea 2226
63 Ga0058862_10279358 3300004803 Unclassified 2351
64 Ga0065717_1000094 3300005276 Archaea 2939
65 Ga0065717_1000281 3300005276 Archaea 1432
66 Ga0065716_1003128 3300005277 Archaea 1340
67 Ga0065704_10003714 3300005289 Archaea 8322
68 Ga0065704_10004404 3300005289 Archaea 3390
69 Ga0065704_10032533 3300005289 Archaea 2546
70 Ga0065704_10123090 3300005289 Archaea 1725
71 Ga0065712_10000407 3300005290 Archaea 11648
72 Ga0065712_10000872 3300005290 Archaea 12743
73 Ga0065715_10000173 3300005293 Archaea 47106
74 Ga0065715_10000255 3300005293 Archaea 19394
75 Ga0065715_10000274 3300005293 Archaea 30702
76 Ga0065715_10004143 3300005293 Archaea 5871
77 Ga0065707_10001973 3300005295 Archaea 9614
78 Ga0065707_10092082 3300005295 Archaea 3788
79 Ga0070676_10000851 3300005328 Archaea 15099
80 Ga0070676_10000856 3300005328 Archaea 14994
81 Ga0070676_10001370 3300005328 Archaea 12271
82 Ga0070676_10006462 3300005328 Archaea 6264
83 Ga0070676_10012952 3300005328 Unclassified 4569
84 Ga0070676_10024009 3300005328 Archaea 3431
85 Ga0070676_10031473 3300005328 Unclassified 3032
86 Ga0070683_100015900 3300005329 Archaea 6621
87 Ga0070683_100141696 3300005329 Archaea 2278
88 Ga0070683_100250916 3300005329 Archaea 1683
89 Ga0070670_100011094 3300005331 Archaea 7698
90 Ga0070670_100023857 3300005331 Archaea 5263
91 Ga0070670_100170509 3300005331 Unclassified 1887
92 Ga0070677_10049221 3300005333 Archaea 1696
93 Ga0068869_100001240 3300005334 Archaea 15053
94 Ga0068869_100004670 3300005334 Archaea 8545
95 Ga0068869_100010663 3300005334 Archaea 5998
96 Ga0070680_100002310 3300005336 Archaea 14085
97 Ga0070680_100022182 3300005336 Archaea 5052
98 Ga0070680_100102343 3300005336 Archaea 2379
99 Ga0070680_100181193 3300005336 Unclassified 1774
100 Ga0070680_100190777 3300005336 Archaea 1726
101 Ga0070680_100227543 3300005336 Archaea 1575
102 Ga0070682_100000372 3300005337 Archaea 30121
103 Ga0070682_100005458 3300005337 Archaea 7079
104 Ga0068868_100000911 3300005338 Archaea 20097
105 Ga0068868_100014327 3300005338 Archaea 5842
106 Ga0068868_100019332 3300005338 Archaea 5103
107 Ga0068868_100022428 3300005338 Archaea 4764
108 Ga0068868_100056839 3300005338 Archaea 3090
109 Ga0068868_100090299 3300005338 Archaea 2467
110 Ga0068868_100090863 3300005338 Archaea 2460
111 Ga0068868_100164364 3300005338 Archaea 1835
112 Ga0070689_100168469 3300005340 Archaea 1774
113 Ga0070689_100257351 3300005340 Unclassified 1442
114 Ga0070689_100388988 3300005340 Archaea 1177
115 Ga0070687_100000818 3300005343 Archaea 10364
116 Ga0070687_100048793 3300005343 Archaea 2178
117 Ga0070692_10006121 3300005345 Archaea 5199
118 Ga0070692_10027013 3300005345 Archaea 2841
119 Ga0070692_10030277 3300005345 Archaea 2705
120 Ga0070692_10041669 3300005345 Archaea 2353
121 Ga0070668_100075187 3300005347 Archaea 2637
122 Ga0070669_100001391 3300005353 Archaea 17449
123 Ga0070675_100006801 3300005354 Archaea 8782
124 Ga0070675_100199391 3300005354 Archaea 1737
125 Ga0070671_100140069 3300005355 Archaea 2041
126 Ga0070671_100153728 3300005355 Archaea 1943
127 Ga0070671_100361618 3300005355 Archaea 1239
128 Ga0070674_100009051 3300005356 Archaea 5951
129 Ga0070674_100108685 3300005356 Archaea 2033
130 Ga0070673_100012125 3300005364 Archaea 5908
131 Ga0070673_100026002 3300005364 Archaea 4317
132 Ga0070688_100293438 3300005365 Archaea 1173
133 Ga0070659_100055984 3300005366 Archaea 3109
134 Ga0070659_100076701 3300005366 Archaea 2665
135 Ga0070659_100432960 3300005366 Archaea 1113
136 Ga0070667_100002370 3300005367 Archaea 16506
137 Ga0070667_100052824 3300005367 Archaea 3429
138 Ga0070709_10001477 3300005434 Archaea 12690
139 Ga0070709_10003040 3300005434 Archaea 9007
140 Ga0070709_10067592 3300005434 Archaea 2295
141 Ga0070709_10087950 3300005434 Archaea 2042
142 Ga0070709_10104686 3300005434 Archaea 1891
143 Ga0070714_100011806 3300005435 Archaea 6944
144 Ga0070714_100259358 3300005435 Archaea 1609
145 Ga0070713_100038747 3300005436 Archaea 3865
146 Ga0070713_100223118 3300005436 Archaea 1710
147 Ga0070710_10040632 3300005437 Archaea 2564
148 Ga0070710_10050183 3300005437 Archaea 2338
149 Ga0070710_10103508 3300005437 Archaea 1699
150 Ga0070701_10004097 3300005438 Archaea 5850
151 Ga0070711_100000459 3300005439 Archaea 21324
152 Ga0070711_100002070 3300005439 Archaea 11321
153 Ga0070711_100004650 3300005439 Archaea 8125
154 Ga0070711_100033190 3300005439 Archaea 3436
155 Ga0070705_100002612 3300005440 Archaea 9028
156 Ga0070705_100002797 3300005440 Archaea 8692
157 Ga0070705_100100777 3300005440 Unclassified 1823
158 Ga0070700_100002144 3300005441 Archaea 10006
159 Ga0070700_100013876 3300005441 Archaea 4535
160 Ga0070700_100016839 3300005441 Unclassified 4169
161 Ga0070700_100097245 3300005441 Archaea 1933
162 Ga0070700_100136137 3300005441 Unclassified 1663
163 Ga0070694_100000053 3300005444 Archaea 54065
164 Ga0070694_100006807 3300005444 Archaea 6944
165 Ga0070694_100011040 3300005444 Archaea 5589
166 Ga0070708_100178625 3300005445 Archaea 1983
167 Ga0070663_100263084 3300005455 Archaea 1369
168 Ga0070663_100328978 3300005455 Archaea 1231
169 Ga0070663_100407544 3300005455 Archaea 1113
170 Ga0070678_100007450 3300005456 Archaea 6496
171 Ga0070662_100006220 3300005457 Archaea 7691
172 Ga0070662_100023085 3300005457 Archaea 4269
173 Ga0070662_100038304 3300005457 Archaea 3405
174 Ga0070662_100164925 3300005457 Archaea 1735
175 Ga0070681_10031694 3300005458 Archaea 5307
176 Ga0070681_10035590 3300005458 Archaea 5002
177 Ga0070681_10083415 3300005458 Archaea 3149
178 Ga0070681_10098023 3300005458 Archaea 2877
179 Ga0068867_100002066 3300005459 Archaea 14076
180 Ga0068867_100002176 3300005459 Archaea 13759
181 Ga0068867_100008640 3300005459 Archaea 7192
182 Ga0068867_100316558 3300005459 Archaea 1291
183 Ga0070706_100259481 3300005467 Archaea 1622
184 Ga0070707_100053831 3300005468 Archaea 3858
185 Ga0070707_100390266 3300005468 Archaea 1352
186 Ga0070698_100003950 3300005471 Archaea 16308
187 Ga0070698_100015221 3300005471 Archaea 8134
188 Ga0070698_100320498 3300005471 Archaea 1481
189 Ga0070699_100045390 3300005518 Unclassified 3803
190 Ga0070699_100079233 3300005518 Archaea 2861
191 Ga0070699_100157616 3300005518 Unclassified 2009
192 Ga0070699_100276766 3300005518 Archaea 1503
193 Ga0070679_100082268 3300005530 Archaea 3209
194 Ga0070679_100148115 3300005530 Archaea 2325
195 Ga0070679_100209300 3300005530 Bacteria 1914
196 Ga0070684_100005488 3300005535 Archaea 9718
197 Ga0070684_100154040 3300005535 Archaea 2083
198 Ga0070684_100233747 3300005535 Archaea 1679
199 Ga0070697_100004334 3300005536 Archaea 10886
200 Ga0070697_100125329 3300005536 Archaea 2151
201 Ga0070697_100187367 3300005536 Archaea 1755
202 Ga0070672_100000958 3300005543 Archaea 17413
203 Ga0070672_100003020 3300005543 Archaea 10839
204 Ga0070672_100007776 3300005543 Archaea 7311
205 Ga0070672_100229085 3300005543 Archaea 1561
206 Ga0070686_100005242 3300005544 Archaea 7159
207 Ga0070686_100130950 3300005544 Archaea 1734
208 Ga0070695_100001979 3300005545 Archaea 11649
209 Ga0070695_100011084 3300005545 Archaea 5389
210 Ga0070695_100012813 3300005545 Archaea 5033
211 Ga0070695_100025362 3300005545 Archaea 3661
212 Ga0070696_100033630 3300005546 Archaea 3524
213 Ga0070696_100041236 3300005546 Archaea 3189
214 Ga0070696_100069313 3300005546 Archaea 2478
215 Ga0070693_100068639 3300005547 Archaea 2081
216 Ga0070693_100079735 3300005547 Archaea 1949
217 Ga0070693_100131740 3300005547 Bacteria 1564
218 Ga0070704_100001207 3300005549 Archaea 13559
219 Ga0070704_100023278 3300005549 Archaea 4042
220 Ga0070704_100033321 3300005549 Archaea 3481
221 Ga0070664_100097745 3300005564 Archaea 2549
222 Ga0070664_100122779 3300005564 Unclassified 2275
223 Ga0070664_100150532 3300005564 Archaea 2054
224 Ga0070664_100223414 3300005564 Unclassified 1686
225 Ga0070664_100408142 3300005564 Unclassified 1243
226 Ga0068857_100200436 3300005577 Unclassified 1819
227 Ga0068854_100014044 3300005578 Archaea 5272
228 Ga0068854_100138591 3300005578 Bacteria 1864
229 Ga0068856_100001291 3300005614 Archaea 26372
230 Ga0068856_100151997 3300005614 Bacteria 2324
231 Ga0070702_100004074 3300005615 Archaea 6627
232 Ga0070702_100010383 3300005615 Archaea 4584
233 Ga0070702_100025454 3300005615 Archaea 3171
234 Ga0070702_100042792 3300005615 Archaea 2548
235 Ga0070702_100059025 3300005615 Archaea 2225
236 Ga0070702_100080495 3300005615 Bacteria 1949
237 Ga0070702_100114875 3300005615 Archaea 1675
238 Ga0068852_100029666 3300005616 Unclassified 4496
239 Ga0068852_100051951 3300005616 Archaea 3521
240 Ga0068852_100064965 3300005616 Archaea 3182
241 Ga0068859_100210213 3300005617 Archaea 2032
242 Ga0068864_100030074 3300005618 Archaea 4603
243 Ga0068864_100039781 3300005618 Archaea 4019
244 Ga0068864_100135658 3300005618 Archaea 2216
245 Ga0068866_10099458 3300005718 Archaea 1602
246 Ga0068866_10109043 3300005718 Archaea 1541
247 Ga0068870_10001540 3300005840 Archaea 9361
248 Ga0068870_10002813 3300005840 Archaea 7317
249 Ga0068870_10003250 3300005840 Unclassified 6859
250 Ga0068870_10023078 3300005840 Archaea 3064
251 Ga0068870_10043425 3300005840 Unclassified 2345
252 Ga0068860_100002755 3300005843 Archaea 18289
253 Ga0068860_100013921 3300005843 Archaea 7885
254 Ga0068860_100026229 3300005843 Archaea 5618
255 Ga0068862_100025861 3300005844 Archaea 4930
256 Ga0068862_100087832 3300005844 Archaea 2704
257 Ga0068862_100179476 3300005844 Archaea 1899
258 Ga0081455_10002515 3300005937 Archaea 21762
259 Ga0081455_10002619 3300005937 Archaea 21327
260 Ga0081455_10008896 3300005937 Archaea 10384
261 Ga0081455_10015249 3300005937 Archaea 7474
262 Ga0081538_10000374 3300005981 Archaea 51036
263 Ga0081538_10000668 3300005981 Archaea 37737
264 Ga0081538_10003188 3300005981 Archaea 15574
265 Ga0081538_10019014 3300005981 Archaea 5129
266 Ga0081538_10045428 3300005981 Archaea 2723
267 Ga0070717_10051397 3300006028 Archaea 3392
268 Ga0075432_10002560 3300006058 Archaea 6064
269 Ga0075432_10012699 3300006058 Archaea 2860
270 Ga0075432_10028399 3300006058 Archaea 1930
271 Ga0075432_10078689 3300006058 Archaea 1193
272 Ga0070715_10000725 3300006163 Archaea 8898
273 Ga0070715_10056176 3300006163 Archaea 1712
274 Ga0070715_10064248 3300006163 Archaea 1620
275 Ga0070715_10075098 3300006163 Archaea 1520
276 Ga0070716_100000537 3300006173 Archaea 15868
277 Ga0070716_100001237 3300006173 Archaea 11259
278 Ga0070716_100045447 3300006173 Archaea 2465
279 Ga0070716_100182661 3300006173 Archaea 1378
280 Ga0070712_100002663 3300006175 Archaea 11020
281 Ga0070712_100003553 3300006175 Archaea 9599
282 Ga0070712_100087693 3300006175 Archaea 2271
283 Ga0097621_100003581 3300006237 Archaea 10732
284 Ga0097621_100093503 3300006237 Archaea 2520
285 Ga0097621_100130591 3300006237 Bacteria 2138
286 Ga0068871_100020534 3300006358 Unclassified 5062
287 Ga0068871_100023728 3300006358 Archaea 4749
288 Ga0068871_100194181 3300006358 Archaea 1750
289 Ga0075428_100000854 3300006844 Archaea 32055
290 Ga0075428_100004403 3300006844 Archaea 15546
291 Ga0075428_100055982 3300006844 Archaea 4320
292 Ga0075428_100092856 3300006844 Archaea 3290
293 Ga0075428_100094525 3300006844 Archaea 3259
294 Ga0075428_100128555 3300006844 Archaea 2756
295 Ga0075428_100218340 3300006844 Archaea 2059
296 Ga0075428_100278602 3300006844 Archaea 1799
297 Ga0075430_100000559 3300006846 Archaea 28267
298 Ga0075430_100004617 3300006846 Archaea 11592
299 Ga0075430_100004867 3300006846 Archaea 11301
300 Ga0075430_100006477 3300006846 Archaea 9867
301 Ga0075430_100013795 3300006846 Bacteria 6885
302 Ga0075430_100031557 3300006846 Archaea 4497
303 Ga0075430_100400764 3300006846 Archaea 1132
304 Ga0075431_100000588 3300006847 Archaea 30891
305 Ga0075431_100002796 3300006847 Archaea 16910
306 Ga0075431_100044419 3300006847 Archaea 4584
307 Ga0075431_100108606 3300006847 Unclassified 2863
308 Ga0075431_100138530 3300006847 Archaea 2508
309 Ga0075431_100231014 3300006847 Archaea 1885
310 Ga0075431_100231918 3300006847 Archaea 1880
311 Ga0075431_100250245 3300006847 Archaea 1800
312 Ga0075431_100294221 3300006847 Archaea 1641
313 Ga0075433_10001686 3300006852 Archaea 16451
314 Ga0075433_10005225 3300006852 Archaea 10173
315 Ga0075433_10018402 3300006852 Archaea 5807
316 Ga0075433_10019774 3300006852 Archaea 5619
317 Ga0075433_10093880 3300006852 Archaea 2655
318 Ga0075433_10174372 3300006852 Bacteria 1913
319 Ga0075434_100009869 3300006871 Archaea 8929
320 Ga0075434_100010099 3300006871 Archaea 8841
321 Ga0075434_100025109 3300006871 Archaea 5830
322 Ga0075434_100031185 3300006871 Archaea 5254
323 Ga0075434_100066175 3300006871 Archaea 3599
324 Ga0075434_100117392 3300006871 Unclassified 2674
325 Ga0075434_100202322 3300006871 Archaea 2006
326 Ga0075429_100001072 3300006880 Archaea 21936
327 Ga0075429_100001842 3300006880 Archaea 17556
328 Ga0075429_100002901 3300006880 Archaea 14536
329 Ga0075429_100027610 3300006880 Archaea 4927
330 Ga0075429_100032206 3300006880 Archaea 4556
331 Ga0075429_100091645 3300006880 Archaea 2651
332 Ga0068865_100002349 3300006881 Archaea 11157
333 Ga0068865_100067239 3300006881 Archaea 2531
334 Ga0068865_100128681 3300006881 Archaea 1894
335 Ga0068865_100300484 3300006881 Archaea 1285
336 Ga0075436_100001397 3300006914 Archaea 16410
337 Ga0075436_100005019 3300006914 Archaea 9095
338 Ga0075436_100007938 3300006914 Archaea 7267
339 Ga0075436_100093759 3300006914 Unclassified 2088
340 Ga0075436_100125676 3300006914 Archaea 1796
341 Ga0097620_100210207 3300006931 Archaea 2032
342 Ga0075435_100007982 3300007076 Archaea 7576
343 Ga0075435_100014606 3300007076 Archaea 5877
344 Ga0075435_100037867 3300007076 Archaea 3843
345 Ga0075435_100067400 3300007076 Archaea 2914
346 Ga0075435_100089757 3300007076 Archaea 2534
347 Ga0075435_100158028 3300007076 Archaea 1908
348 Ga0075435_100206941 3300007076 Unclassified 1663
349 Ga0105244_10071632 3300009036 Archaea 1728
350 Ga0105240_10256971 3300009093 Archaea 2017
351 Ga0105240_10267757 3300009093 Archaea 1969
352 Ga0111539_10001403 3300009094 Archaea 32085
353 Ga0111539_10005438 3300009094 Archaea 16471
354 Ga0111539_10005556 3300009094 Archaea 16301
355 Ga0111539_10006237 3300009094 Archaea 15388
356 Ga0111539_10058247 3300009094 Archaea 4584
357 Ga0111539_10082375 3300009094 Archaea 3784
358 Ga0111539_10083799 3300009094 Archaea 3749
359 Ga0111539_10114708 3300009094 Archaea 3160
360 Ga0111539_10244021 3300009094 Bacteria 2091
361 Ga0111539_10343962 3300009094 Archaea 1736
362 Ga0111539_10374059 3300009094 Archaea 1658
363 Ga0105245_10429859 3300009098 Archaea 1325
364 Ga0114129_10001003 3300009147 Archaea 36828
365 Ga0114129_10001449 3300009147 Archaea 32006
366 Ga0114129_10002147 3300009147 Archaea 27177
367 Ga0114129_10002227 3300009147 Archaea 26748
368 Ga0114129_10002527 3300009147 Archaea 25404
369 Ga0114129_10006019 3300009147 Archaea 17193
370 Ga0114129_10011884 3300009147 Archaea 12385
371 Ga0114129_10077443 3300009147 Archaea 4625
372 Ga0114129_10165983 3300009147 Archaea 3013
373 Ga0114129_10235993 3300009147 Unclassified 2461
374 Ga0114129_10361290 3300009147 Unclassified 1921
375 Ga0114129_10444988 3300009147 Unclassified 1700
376 Ga0105241_10045925 3300009174 Archaea 3315
377 Ga0105241_10094374 3300009174 Bacteria 2366
378 Ga0105241_10148368 3300009174 Archaea 1916
379 Ga0105242_10026118 3300009176 Archaea 4627
380 Ga0105242_10090298 3300009176 Archaea 2577
381 Ga0105242_10139070 3300009176 Archaea 2105
382 Ga0105237_10010420 3300009545 Archaea 9890
383 Ga0105237_10124532 3300009545 Archaea 2572
384 Ga0105249_10003418 3300009553 Archaea 13743
385 Ga0105249_10036546 3300009553 Archaea 4456
386 Ga0105249_10046426 3300009553 Archaea 3953
387 Ga0105249_10092966 3300009553 Unclassified 2824
388 Ga0105249_10135095 3300009553 Archaea 2359
389 Ga0105249_10288688 3300009553 Archaea 1641
390 Ga0105249_10321824 3300009553 Archaea 1558
391 Ga0105239_10004063 3300010375 Archaea 17667
392 Ga0105239_10062724 3300010375 Unclassified 4079
393 Ga0105239_10145343 3300010375 Archaea 2644
394 Ga0105239_10163086 3300010375 Archaea 2491
395 Ga0105246_10001564 3300011119 Archaea 13621
396 Ga0105246_10007595 3300011119 Archaea 6649
397 Ga0105246_10010548 3300011119 Unclassified 5724
398 Ga0105246_10019987 3300011119 Unclassified 4292
399 Ga0105246_10055829 3300011119 Archaea 2727
400 Ga0105246_10204776 3300011119 Archaea 1536
401 Ga0157317_1001252 3300012475 Archaea 1335
402 Ga0157344_1000580 3300012476 Archaea 1474
403 Ga0157336_1000228 3300012477 Archaea 2468
404 Ga0157328_1000010 3300012478 Archaea 5334
405 Ga0157318_1000001 3300012482 Archaea 7868
406 Ga0157318_1000333 3300012482 Archaea 1913
407 Ga0157337_1000004 3300012483 Archaea 11218
408 Ga0157325_1000014 3300012485 Archaea 7425
409 Ga0157321_1000002 3300012487 Archaea 11577
410 Ga0157343_1000372 3300012488 Archaea 1763
411 Ga0157329_1000021 3300012491 Archaea 3150
412 Ga0157335_1000144 3300012492 Archaea 2821
413 Ga0157341_1000002 3300012494 Archaea 13340
414 Ga0157323_1000014 3300012495 Archaea 7783
415 Ga0157323_1000684 3300012495 Archaea 1523
416 Ga0157319_1000095 3300012497 Archaea 4720
417 Ga0157345_1000179 3300012498 Archaea 10076
418 Ga0157314_1001081 3300012500 Archaea 2072
419 Ga0157347_1000046 3300012502 Archaea 4926
420 Ga0157347_1001475 3300012502 Archaea 1853
421 Ga0157313_1000028 3300012503 Archaea 6041
422 Ga0157339_1000005 3300012505 Archaea 11547
423 Ga0157324_1000076 3300012506 Archaea 4589
424 Ga0157324_1000434 3300012506 Archaea 1966
425 Ga0157342_1000006 3300012507 Archaea 9174
426 Ga0157342_1000434 3300012507 Archaea 2519
427 Ga0157315_1000045 3300012508 Archaea 5088
428 Ga0157316_1000008 3300012510 Archaea 9063
429 Ga0157316_1000357 3300012510 Archaea 2315
430 Ga0157327_1000217 3300012512 Archaea 2879
431 Ga0157326_1000754 3300012513 Archaea 3790
432 Ga0157338_1000017 3300012515 Archaea 7323
433 Ga0157373_10086833 3300013100 Archaea 2204
434 Ga0157371_10004568 3300013102 Unclassified 12044
435 Ga0157371_10005345 3300013102 Archaea 10857
436 Ga0157371_10067534 3300013102 Archaea 2531
437 Ga0157371_10222016 3300013102 Archaea 1357
438 Ga0157369_10166201 3300013105 Bacteria 2327
439 Ga0157369_10249206 3300013105 Archaea 1854
440 Ga0157374_10000398 3300013296 Archaea 39435
441 Ga0157374_10007509 3300013296 Archaea 9299
442 Ga0157374_10051982 3300013296 Archaea 3814
443 Ga0157374_10168813 3300013296 Bacteria 2134
444 Ga0157378_10000761 3300013297 Archaea 30131
445 Ga0157378_10000881 3300013297 Archaea 27715
446 Ga0157378_10001985 3300013297 Archaea 18311
447 Ga0157378_10006088 3300013297 Archaea 10568
448 Ga0157378_10010145 3300013297 Archaea 8214
449 Ga0157378_10054015 3300013297 Archaea 3577
450 Ga0157378_10329783 3300013297 Archaea 1485
451 Ga0157378_10433981 3300013297 Archaea 1301
452 Ga0163162_10006670 3300013306 Archaea 11197
453 Ga0157372_10017856 3300013307 Archaea 7621
454 Ga0157372_10021602 3300013307 Unclassified 6955
455 Ga0157372_10030750 3300013307 Archaea 5875
456 Ga0157372_10151217 3300013307 Archaea 2679
457 Ga0157375_10003325 3300013308 Archaea 13923
458 Ga0157375_10103839 3300013308 Archaea 2930
459 Ga0157375_10249537 3300013308 Archaea 1935
460 Ga0163163_10257687 3300014325 Archaea 1795
461 Ga0157380_10033644 3300014326 Archaea 3948
462 Ga0157380_10161198 3300014326 Archaea 1950
463 Ga0182008_10009590 3300014497 Archaea 5215
464 Ga0182008_10009908 3300014497 Archaea 5124
465 Ga0182008_10034459 3300014497 Archaea 2538
466 Ga0182008_10040973 3300014497 Archaea 2311
467 Ga0182008_10087113 3300014497 Archaea 1538
468 Ga0157377_10001147 3300014745 Archaea 11249
469 Ga0157377_10007364 3300014745 Archaea 5311
470 Ga0157377_10011782 3300014745 Archaea 4374
471 Ga0157377_10027829 3300014745 Archaea 3038
472 Ga0157377_10188242 3300014745 Archaea 1303
473 Ga0157377_10204069 3300014745 Archaea 1257
474 Ga0157379_10067472 3300014968 Archaea 3197
475 Ga0157379_10133110 3300014968 Archaea 2239
476 Ga0157376_10006283 3300014969 Unclassified 8384
477 Ga0157376_10126185 3300014969 Archaea 2276
478 Ga0157376_10300208 3300014969 Archaea 1520
479 Ga0157376_10338914 3300014969 Archaea 1435
480 Ga0182006_1027831 3300015261 Archaea 2304
481 Ga0163161_10003494 3300017792 Archaea 11005
482 Ga0197907_10034451 3300020069 Archaea 3511
483 Ga0197907_10607682 3300020069 Unclassified 3206
484 Ga0206356_10500690 3300020070 Archaea 4004
485 Ga0206351_10347377 3300020077 Unclassified 2162
486 Ga0206352_10400749 3300020078 Bacteria 1415
487 Ga0206350_10223576 3300020080 Archaea 1462
488 Ga0206354_11306581 3300020081 Archaea 2037
489 Ga0154015_1270599 3300020610 Archaea 2233
490 Ga0224712_10100097 3300022467 Archaea 1228
491 Ga0207673_1003623 3300025290 Archaea 1816
492 Ga0207697_10000182 3300025315 Archaea 32577
493 Ga0207697_10006369 3300025315 Archaea 5347
494 Ga0207653_10011067 3300025885 Archaea 2817
495 Ga0207682_10013270 3300025893 Archaea 3210
496 Ga0207682_10020924 3300025893 Archaea 2572
497 Ga0207692_10002950 3300025898 Archaea 6590
498 Ga0207642_10116968 3300025899 Archaea 1368
499 Ga0207688_10000151 3300025901 Archaea 29804
500 Ga0207688_10008768 3300025901 Archaea 5503
501 Ga0207688_10016312 3300025901 Archaea 4028
502 Ga0207688_10026459 3300025901 Archaea 3189
503 Ga0207688_10176027 3300025901 Archaea 1274
504 Ga0207647_10003845 3300025904 Archaea 11231
505 Ga0207647_10038685 3300025904 Archaea 3015
506 Ga0207647_10126622 3300025904 Archaea 1503
507 Ga0207685_10003090 3300025905 Unclassified 3974
508 Ga0207685_10024546 3300025905 Archaea 2069
509 Ga0207699_10001845 3300025906 Archaea 9971
510 Ga0207699_10002196 3300025906 Archaea 9207
511 Ga0207699_10226705 3300025906 Archaea 1278
512 Ga0207645_10000724 3300025907 Archaea 27483
513 Ga0207645_10002427 3300025907 Archaea 14672
514 Ga0207645_10004235 3300025907 Archaea 10649
515 Ga0207645_10005889 3300025907 Archaea 8832
516 Ga0207645_10013535 3300025907 Unclassified 5494
517 Ga0207645_10015469 3300025907 Archaea 5066
518 Ga0207643_10000552 3300025908 Archaea 23933
519 Ga0207643_10000687 3300025908 Archaea 21132
520 Ga0207643_10002217 3300025908 Archaea 10595
521 Ga0207643_10010025 3300025908 Archaea 5093
522 Ga0207643_10012184 3300025908 Archaea 4649
523 Ga0207643_10037648 3300025908 Archaea 2714
524 Ga0207707_10042740 3300025912 Archaea 3954
525 Ga0207707_10088581 3300025912 Archaea 2704
526 Ga0207707_10199705 3300025912 Archaea 1744
527 Ga0207671_10063726 3300025914 Archaea 2739
528 Ga0207671_10106103 3300025914 Archaea 2132
529 Ga0207693_10000345 3300025915 Archaea 42913
530 Ga0207693_10005356 3300025915 Archaea 10718
531 Ga0207693_10035589 3300025915 Archaea 3925
532 Ga0207693_10099212 3300025915 Archaea 2284
533 Ga0207663_10000208 3300025916 Archaea 26193
534 Ga0207663_10000289 3300025916 Archaea 21908
535 Ga0207663_10006734 3300025916 Archaea 5907
536 Ga0207663_10007884 3300025916 Archaea 5552
537 Ga0207663_10008906 3300025916 Archaea 5278
538 Ga0207663_10017183 3300025916 Archaea 4025
539 Ga0207660_10005278 3300025917 Archaea 8404
540 Ga0207660_10063500 3300025917 Unclassified 2663
541 Ga0207660_10072806 3300025917 Archaea 2503
542 Ga0207660_10118884 3300025917 Archaea 1999
543 Ga0207660_10141572 3300025917 Archaea 1839
544 Ga0207662_10000174 3300025918 Archaea 30646
545 Ga0207662_10001402 3300025918 Archaea 11659
546 Ga0207662_10009321 3300025918 Archaea 5397
547 Ga0207657_10041772 3300025919 Archaea 4052
548 Ga0207649_10024941 3300025920 Archaea 3481
549 Ga0207649_10034181 3300025920 Unclassified 3043
550 Ga0207646_10009718 3300025922 Archaea 9483
551 Ga0207681_10000728 3300025923 Archaea 21620
552 Ga0207681_10002752 3300025923 Archaea 11125
553 Ga0207681_10012424 3300025923 Archaea 5256
554 Ga0207650_10011000 3300025925 Archaea 6222
555 Ga0207650_10033482 3300025925 Archaea 3722
556 Ga0207650_10069475 3300025925 Unclassified 2646
557 Ga0207659_10000561 3300025926 Archaea 22312
558 Ga0207659_10066443 3300025926 Archaea 2617
559 Ga0207659_10232813 3300025926 Archaea 1487
560 Ga0207700_10014964 3300025928 Archaea 5100
561 Ga0207700_10192490 3300025928 Archaea 1714
562 Ga0207664_10040361 3300025929 Archaea 3629
563 Ga0207664_10114216 3300025929 Archaea 2250
564 Ga0207664_10126752 3300025929 Archaea 2144
565 Ga0207690_10082413 3300025932 Archaea 2250
566 Ga0207690_10121509 3300025932 Archaea 1898
567 Ga0207690_10207407 3300025932 Archaea 1492
568 Ga0207706_10000979 3300025933 Archaea 29120
569 Ga0207706_10011558 3300025933 Archaea 8038
570 Ga0207706_10012661 3300025933 Archaea 7677
571 Ga0207706_10232988 3300025933 Archaea 1611
572 Ga0207686_10097151 3300025934 Archaea 1959
573 Ga0207669_10053093 3300025937 Archaea 2439
574 Ga0207704_10001275 3300025938 Archaea 11278
575 Ga0207704_10012836 3300025938 Archaea 4169
576 Ga0207704_10077757 3300025938 Archaea 2131
577 Ga0207704_10096939 3300025938 Archaea 1954
578 Ga0207704_10112553 3300025938 Archaea 1844
579 Ga0207665_10000151 3300025939 Archaea 46922
580 Ga0207665_10001902 3300025939 Archaea 14067
581 Ga0207665_10003049 3300025939 Archaea 11238
582 Ga0207691_10001719 3300025940 Archaea 21567
583 Ga0207691_10012809 3300025940 Archaea 8026
584 Ga0207691_10093847 3300025940 Archaea 2686
585 Ga0207689_10000710 3300025942 Archaea 31864
586 Ga0207689_10001268 3300025942 Archaea 24355
587 Ga0207689_10006339 3300025942 Archaea 10478
588 Ga0207689_10014680 3300025942 Archaea 6651
589 Ga0207661_10015780 3300025944 Archaea 5563
590 Ga0207661_10090262 3300025944 Archaea 2551
591 Ga0207661_10217427 3300025944 Bacteria 1687
592 Ga0207679_10007744 3300025945 Archaea 6825
593 Ga0207679_10062217 3300025945 Archaea 2780
594 Ga0207679_10075252 3300025945 Unclassified 2561
595 Ga0207679_10442035 3300025945 Archaea 1152
596 Ga0207651_10018000 3300025960 Archaea 4191
597 Ga0207651_10371787 3300025960 Archaea 1209
598 Ga0207712_10003114 3300025961 Archaea 10583
599 Ga0207712_10114906 3300025961 Archaea 2025
600 Ga0207712_10122437 3300025961 Archaea 1970
601 Ga0207668_10003438 3300025972 Archaea 9291
602 Ga0207640_10010366 3300025981 Archaea 5248
603 Ga0207658_10021666 3300025986 Archaea 4464
604 Ga0207658_10039017 3300025986 Archaea 3425
605 Ga0207677_10000611 3300026023 Archaea 21969
606 Ga0207677_10018350 3300026023 Archaea 4196
607 Ga0207677_10117642 3300026023 Archaea 1992
608 Ga0207708_10000406 3300026075 Archaea 34046
609 Ga0207708_10001636 3300026075 Archaea 16677
610 Ga0207708_10031498 3300026075 Archaea 4025
611 Ga0207708_10035168 3300026075 Archaea 3812
612 Ga0207708_10088846 3300026075 Unclassified 2381
613 Ga0207708_10096511 3300026075 Archaea 2284
614 Ga0207708_10174862 3300026075 Archaea 1702
615 Ga0207708_10229302 3300026075 Archaea 1491
616 Ga0207708_10229769 3300026075 Archaea 1489
617 Ga0207708_10311887 3300026075 Archaea 1282
618 Ga0207702_10021903 3300026078 Unclassified 5293
619 Ga0207702_10121822 3300026078 Bacteria 2335
620 Ga0207648_10002145 3300026089 Archaea 21448
621 Ga0207648_10002982 3300026089 Archaea 17886
622 Ga0207648_10004606 3300026089 Archaea 14140
623 Ga0207648_10005952 3300026089 Archaea 12203
624 Ga0207648_10006812 3300026089 Archaea 11323
625 Ga0207648_10006842 3300026089 Archaea 11299
626 Ga0207648_10067141 3300026089 Archaea 3127
627 Ga0207648_10356416 3300026089 Archaea 1319
628 Ga0207676_10017668 3300026095 Archaea 5173
629 Ga0207676_10081455 3300026095 Archaea 2630
630 Ga0207676_10181494 3300026095 Archaea 1843
631 Ga0207676_10244350 3300026095 Archaea 1612
632 Ga0207674_10045126 3300026116 Archaea 4535
633 Ga0207674_10059348 3300026116 Archaea 3871
634 Ga0207674_10153917 3300026116 Unclassified 2255
635 Ga0207675_100037209 3300026118 Archaea 4540
636 Ga0207675_100060306 3300026118 Archaea 3542
637 Ga0207683_10072636 3300026121 Unclassified 3043
638 Ga0207683_10201308 3300026121 Archaea 1810
639 Ga0207683_10247931 3300026121 Archaea 1625
640 Ga0207683_10255222 3300026121 Archaea 1600
641 Ga0207698_10029513 3300026142 Archaea 3930
642 Ga0207698_10293086 3300026142 Archaea 1511
643 Ga0209973_1000122 3300027252 Archaea 4655
644 Ga0209973_1000307 3300027252 Archaea 3482
645 Ga0209969_1000038 3300027360 Archaea 15300
646 Ga0209969_1001045 3300027360 Archaea 3781
647 Ga0209969_1003890 3300027360 Archaea 2080
648 Ga0209967_1000009 3300027364 Archaea 25121
649 Ga0209967_1000881 3300027364 Archaea 3860
650 Ga0209967_1002373 3300027364 Archaea 2437
651 Ga0209981_1000090 3300027378 Archaea 10171
652 Ga0209981_1001413 3300027378 Archaea 3039
653 Ga0209996_1000069 3300027395 Archaea 14345
654 Ga0209996_1000424 3300027395 Archaea 5107
655 Ga0209984_1000004 3300027424 Archaea 25468
656 Ga0209984_1000045 3300027424 Archaea 12932
657 Ga0210000_1000178 3300027462 Archaea 9207
658 Ga0210000_1000553 3300027462 Archaea 5098
659 Ga0209995_1000014 3300027471 Archaea 26776
660 Ga0209968_1000500 3300027526 Archaea 6217
661 Ga0209968_1001420 3300027526 Archaea 3628
662 Ga0209999_1000554 3300027543 Archaea 5869
663 Ga0209982_1000088 3300027552 Archaea 9212
664 Ga0209982_1001818 3300027552 Archaea 2944
665 Ga0209982_1011782 3300027552 Unclassified 1307
666 Ga0209970_1000037 3300027614 Archaea 17174
667 Ga0209970_1000331 3300027614 Archaea 7906
668 Ga0209970_1001411 3300027614 Archaea 4198
669 Ga0210002_1000080 3300027617 Archaea 14951
670 Ga0210002_1001077 3300027617 Archaea 3781
671 Ga0210002_1002599 3300027617 Archaea 2612
672 Ga0210002_1013972 3300027617 Archaea 1257
673 Ga0209983_1000602 3300027665 Archaea 7725
674 Ga0209983_1008533 3300027665 Archaea 2095
675 Ga0209971_1011498 3300027682 Archaea 2097
676 Ga0209971_1018355 3300027682 Unclassified 1659
677 Ga0209966_1000157 3300027695 Archaea 28629
678 Ga0209966_1000558 3300027695 Archaea 9327
679 Ga0209998_10000258 3300027717 Archaea 17348
680 Ga0209998_10000656 3300027717 Archaea 9270
681 Ga0209998_10023905 3300027717 Archaea 1323
682 Ga0209974_10000630 3300027876 Archaea 11880
683 Ga0209974_10001895 3300027876 Archaea 7642
684 Ga0209974_10007416 3300027876 Archaea 3781
685 Ga0209974_10008387 3300027876 Archaea 3534
686 Ga0207428_10000088 3300027907 Archaea 127963
687 Ga0207428_10000166 3300027907 Archaea 91456
688 Ga0207428_10000210 3300027907 Archaea 81632
689 Ga0207428_10000225 3300027907 Archaea 78396
690 Ga0207428_10000366 3300027907 Archaea 57969
691 Ga0207428_10001197 3300027907 Archaea 27829
692 Ga0207428_10005155 3300027907 Archaea 12237
693 Ga0207428_10006598 3300027907 Archaea 10684
694 Ga0207428_10013032 3300027907 Archaea 7281
695 Ga0207428_10024792 3300027907 Archaea 5034
696 Ga0207428_10171653 3300027907 Archaea 1642
697 Ga0268265_10007760 3300028380 Archaea 7243
698 Ga0268265_10014246 3300028380 Archaea 5416
699 Ga0268264_10004630 3300028381 Archaea 11684
700 Ga0268264_10035429 3300028381 Archaea 4109
701 Ga0307408_100006175 3300031548 Archaea 7954
702 Ga0307408_100018304 3300031548 Archaea 4701
703 Ga0307408_100384098 3300031548 Bacteria 1201
704 Ga0316575_10002527 3300031665 Bacteria 6160
705 Ga0307405_10010980 3300031731 Archaea 4722
706 Ga0307405_10018343 3300031731 Archaea 3857
707 Ga0307413_10008343 3300031824 Archaea 4885
708 Ga0307413_10108751 3300031824 Archaea 1851
709 Ga0307410_10000131 3300031852 Archaea 26995
710 Ga0307410_10031419 3300031852 Archaea 3407
711 Ga0307407_10000340 3300031903 Archaea 14051
712 Ga0307407_10024665 3300031903 Archaea 3157
713 Ga0307407_10051287 3300031903 Archaea 2364
714 Ga0307412_10085752 3300031911 Archaea 2190
715 Ga0307409_100001268 3300031995 Archaea 12186
716 Ga0307409_100031111 3300031995 Archaea 3846
717 Ga0307409_100062685 3300031995 Archaea 2912
718 Ga0307409_100111598 3300031995 Archaea 2294
719 Ga0307409_100123168 3300031995 Archaea 2200
720 Ga0307409_100323821 3300031995 Archaea 1444
721 Ga0307416_100047707 3300032002 Unclassified 3392
722 Ga0307416_100109625 3300032002 Archaea 2428
723 Ga0307414_10004825 3300032004 Archaea 7363
724 Ga0307414_10013683 3300032004 Archaea 4839
725 Ga0307411_10005909 3300032005 Archaea 6074
726 Ga0307411_10016355 3300032005 Archaea 4196
727 Ga0307411_10080233 3300032005 Unclassified 2243
728 Ga0307411_10137966 3300032005 Archaea 1794
729 Ga0307415_100000601 3300032126 Archaea 15755
730 Ga0307415_100026356 3300032126 Archaea 3665
731 Ga0307415_100036326 3300032126 Unclassified 3227
732 Ga0373934_0027356 3300035086 Archaea 2215
733 Ga0373940_0046383 3300035088 Archaea 1209
734 Ga0373949_0006410 3300035090 Archaea 2587
735 Ga0373949_0011763 3300035090 Archaea 1931
736 Ga0373936_0029043 3300035113 Archaea 2176
737 Ga0373939_0001743 3300035114 Archaea 5241
738 Ga0373939_0003451 3300035114 Archaea 3707
739 Ga0373939_0059514 3300035114 Archaea 1212
740 Ga0373953_0000231 3300035117 Archaea 15227
741 Ga0373953_0001350 3300035117 Archaea 7053
742 Ga0373954_0010366 3300035118 Archaea 4112
743 Ga0373954_0011658 3300035118 Archaea 3900
744 Ga0373956_0000998 3300035119 Archaea 11704
745 Ga0373957_0003649 3300035120 Archaea 4587
746 Ga0373960_0001493 3300035121 Archaea 5194
747 Ga0373960_0014604 3300035121 Archaea 1992
748 Ga0373946_0107064 3300035171 Archaea 1261
749 Ga0373955_0000483 3300035172 Archaea 16857
750 Ga0373955_0000868 3300035172 Archaea 12956
751 Ga0373942_0002907 3300035207 Archaea 4061
752 Ga0373961_0000369 3300035241 Archaea 19291
753 Ga0373961_0011853 3300035241 Archaea 2171
754 Ga0373961_0017254 3300035241 Archaea 1870
755 Ga0373961_0020856 3300035241 Archaea 1738
756 Ga0373962_0019989 3300035242 Archaea 1755
757 Ga0316574_0015535 3300035398 Bacteria 4419
758 Ga0373924_0005821 3300035410 Archaea 4388
759 Ga0373931_0001363 3300035691 Archaea 10440
760 Ga0373931_0038282 3300035691 Archaea 2508
761 Ga0373935_0135710 3300035692 Archaea 1657
762 Ga0373933_0000214 3300035724 Archaea 38397
763 Ga0373933_0001906 3300035724 Archaea 12035
764 Ga0373947_0200177 3300035725 Archaea 1306
765 Ga0373947_0245764 3300035725 Archaea 1182
766 Ga0373937_0000286 3300036401 Archaea 48431
767 Ga0373937_0000348 3300036401 Archaea 43669
768 Ga0373925_0165219 3300037068 Archaea 1745
769 Ga0242419_001428 3300038698 Archaea 1468
770 Ga0242420_000905 3300038996 Archaea 3693
771 Ga0242420_002115 3300038996 Archaea 2791
772 Ga0242420_008242 3300038996 Archaea 1686
773 Ga0436365_1341075 3300039437 Unclassified 2457
774 Ga0436361_0774597 3300039447 Archaea 1803
775 Ga0436362_0163595 3300039453 Archaea 1921
776 Ga0439439_0012360 3300041406 Archaea 2064
777 Ga0439453_0001286 3300041408 Archaea 3184
778 Ga0439461_0004139 3300041410 Archaea 2411
779 Ga0439461_0005027 3300041410 Archaea 2236
780 Ga0439437_000122 3300042000 Archaea 6154
781 Ga0439441_000046 3300042001 Archaea 8879
782 Ga0439443_009800 3300042003 Archaea 1381
783 Ga0439448_0053986 3300042005 Archaea 1320
784 Ga0439450_001133 3300042008 Archaea 3787
785 Ga0439450_001957 3300042008 Archaea 3139
786 Ga0439451_006479 3300042009 Archaea 2393
787 Ga0439452_005851 3300042010 Archaea 3918
788 Ga0439452_038850 3300042010 Archaea 1128
789 Ga0439455_0002582 3300042012 Archaea 3320
790 Ga0439456_001014 3300042013 Archaea 5589
791 Ga0439463_001763 3300042016 Archaea 5621
792 Ga0450923_000131 3300042125 Archaea 6480
793 Ga0450923_003151 3300042125 Archaea 2455
794 Ga0450888_004357 3300042126 Archaea 1474
795 Ga0450890_007727 3300042127 Unclassified 1375
796 Ga0450906_000143 3300042145 Archaea 13096
797 Ga0439446_0006522 3300042156 Archaea 3046
798 Ga0439434_0018955 3300042435 Archaea 2062
799 Ga0439434_0021382 3300042435 Archaea 1943
800 Ga0439435_0000428 3300042436 Archaea 6568
801 Ga0439435_0043912 3300042436 Unclassified 1259
802 Ga0439444_0001138 3300042437 Archaea 3338
803 Ga0439444_0010230 3300042437 Unclassified 1496
804 Ga0439464_0000675 3300042439 Archaea 7348
805 Ga0439464_0022930 3300042439 Archaea 1722
806 Ga0439460_0005538 3300042461 Archaea 3104
807 Ga0439460_0011404 3300042461 Archaea 2291
808 Ga0450893_0001278 3300042532 Archaea 3806
809 Ga0451577_0164115 3300042876 Archaea 2001
810 Ga0439440_0003976 3300042993 Archaea 2883
811 Ga0439440_0031428 3300042993 Archaea 1255
812 Ga0453683_0205549 3300044673 Archaea 1250
813 Ga0453684_0023417 3300044712 Archaea 9099
814 Ga0453684_0046624 3300044712 Archaea 5761
815 Ga0451576_0009155 3300045051 Archaea 11507
816 Ga0451576_0113787 3300045051 Archaea 2816
817 Ga0466967_0326602 3300045976 Archaea 1481
818 Ga0495592_0004517 3300046454 Archaea 10189
819 Ga0495592_0018809 3300046454 Archaea 5260
820 Ga0495651_0000164 3300046462 Archaea 48787
821 Ga0495653_0015374 3300046463 Archaea 6237
822 Ga0495608_0036652 3300046511 Archaea 3301
823 Ga0495628_0015015 3300046516 Archaea 6472
824 Ga0495652_0003091 3300046529 Archaea 16645
825 Ga0495652_0133305 3300046529 Archaea 1963
826 Ga0495587_0000551 3300046536 Archaea 25965
827 Ga0495587_0057228 3300046536 Archaea 2292
828 Ga0495645_0017653 3300046543 Archaea 5114
829 Ga0495667_0005976 3300046559 Archaea 8232
830 Ga0495667_0006078 3300046559 Archaea 8173
831 Ga0495656_0082158 3300046615 Archaea 1456
832 Ga0495659_0049343 3300046664 Archaea 1528
833 Ga0495657_0076786 3300046675 Archaea 2169
834 Ga0495599_0001155 3300046678 Archaea 14972
835 Ga0495623_0038719 3300046679 Archaea 3049
836 Ga0495623_0076941 3300046679 Archaea 2070
837 Ga0495646_0006407 3300046680 Archaea 7466
838 Ga0495646_0010834 3300046680 Archaea 5793
839 Ga0495613_0246889 3300046689 Archaea 1247
840 Ga0495600_0023215 3300046809 Archaea 3990
841 Ga0495600_0048181 3300046809 Archaea 2780
842 Ga0495604_0010964 3300047317 Archaea 7195
843 Ga0495604_0011775 3300047317 Archaea 6954
844 Ga0495674_0119809 3300047319 Archaea 2224
845 Ga0495680_0052772 3300047322 Archaea 3168
846 Ga0495675_0041590 3300047444 Archaea 2929
847 Ga0495602_0000149 3300048088 Archaea 64899
848 Ga0495602_0000254 3300048088 Archaea 50045
849 Ga0496100_0030173 3300048903 Archaea 3361
850 Ga0496100_0032564 3300048903 Archaea 3253
851 Ga0496100_0143804 3300048903 Archaea 1694
852 Ga0496101_0143789 3300048904 Archaea 1820
853 Ga0496102_0004939 3300048905 Archaea 11297
854 Ga0496102_0110846 3300048905 Archaea 2558
855 Ga0496102_0154298 3300048905 Archaea 2158
856 Ga0496102_0285702 3300048905 Archaea 1555
857 Ga0496103_0029586 3300048906 Archaea 3330
858 Ga0496104_0018137 3300048907 Archaea 6418
859 Ga0496104_0488405 3300048907 Unclassified 1143
860 Ga0496106_0005999 3300048909 Archaea 8985
861 Ga0496106_0008770 3300048909 Archaea 7471
862 Ga0496106_0047289 3300048909 Archaea 3237
863 Ga0496106_0064137 3300048909 Archaea 2794
864 Ga0496106_0080180 3300048909 Archaea 2506
865 Ga0496106_0169778 3300048909 Unclassified 1728
866 Ga0496106_0298636 3300048909 Archaea 1291
867 Ga0496106_0312055 3300048909 Archaea 1262
868 Ga0496107_0085392 3300048910 Archaea 2303
869 Ga0496108_0036407 3300048911 Archaea 4094
870 Ga0496108_0121097 3300048911 Archaea 2244
871 Ga0496109_0091670 3300048912 Archaea 2811
872 Ga0496111_0006149 3300048914 Archaea 7770
873 Ga0496113_0073812 3300048916 Archaea 2600
874 Ga0496114_0246779 3300048917 Archaea 1571
875 Ga0496114_0265913 3300048917 Archaea 1511
876 Ga0496114_0290922 3300048917 Archaea 1441
877 Ga0501306_006546 3300049127 Archaea 1370
878 Ga0501308_004370 3300049128 Archaea 1359
879 Ga0501309_009207 3300049129 Archaea 1257
880 Ga0501310_004697 3300049130 Archaea 1380
881 Ga0501305_015414 3300049161 Archaea 1079
882 Ga0501307_009294 3300049162 Archaea 1122
883 Ga0501290_000697 3300049513 Archaea 4999
884 Ga0501291_000395 3300049514 Archaea 5271
885 Ga0501291_002008 3300049514 Archaea 2397
886 Ga0501291_005215 3300049514 Archaea 1688
887 Ga0501292_000259 3300049515 Archaea 7710
888 Ga0501293_000043 3300049516 Archaea 7728
889 Ga0501294_001037 3300049517 Archaea 2935
890 Ga0501295_001128 3300049518 Archaea 2642
891 Ga0501295_002106 3300049518 Archaea 2201
892 Ga0501296_001755 3300049519 Archaea 2205
893 Ga0501297_000523 3300049520 Archaea 3461
894 Ga0501297_003519 3300049520 Archaea 1565
895 Ga0501298_000560 3300049521 Archaea 5070
896 Ga0501298_001533 3300049521 Archaea 3405
897 Ga0501299_000205 3300049522 Archaea 6720
898 Ga0501300_001108 3300049523 Archaea 4078
899 Ga0501300_004132 3300049523 Archaea 2158
900 Ga0501311_007612 3300049527 Archaea 1251
901 Ga0501321_003110 3300049537 Archaea 1496
902 Ga0501323_007152 3300049539 Archaea 1266
903 Ga0501324_003091 3300049540 Archaea 1254
904 Ga0501325_001966 3300049541 Archaea 1348
905 Ga0501327_00625 3300049543 Archaea 1500
906 Ga0501031_0002492 3300049568 Archaea 11746
907 Ga0501031_0015824 3300049568 Archaea 4896
908 Ga0501031_0028577 3300049568 Archaea 3635
909 Ga0501031_0029992 3300049568 Unclassified 3548
910 Ga0501031_0036874 3300049568 Unclassified 3190
911 Ga0501031_0076308 3300049568 Archaea 2182
912 Ga0501031_0084854 3300049568 Unclassified 2064
913 Ga0501031_0101879 3300049568 Archaea 1873
914 Ga0501031_0238828 3300049568 Archaea 1181
915 Ga0501032_0005578 3300049569 Archaea 9332
916 Ga0501032_0007837 3300049569 Archaea 7780
917 Ga0501032_0016992 3300049569 Archaea 5112
918 Ga0501032_0030798 3300049569 Unclassified 3681
919 Ga0501032_0060562 3300049569 Archaea 2539
920 Ga0501032_0256466 3300049569 Unclassified 1134
921 Ga0501033_0003203 3300049570 Archaea 13551
922 Ga0501033_0029347 3300049570 Archaea 4134
923 Ga0501033_0040244 3300049570 Archaea 3490
924 Ga0501033_0049154 3300049570 Unclassified 3131
925 Ga0501033_0097411 3300049570 Archaea 2149
926 Ga0501033_0237066 3300049570 Archaea 1295
927 Ga0501034_0004680 3300049571 Archaea 15150
928 Ga0501034_0483645 3300049571 Archaea 1153
929 Ga0501036_0002476 3300049572 Archaea 14477
930 Ga0501036_0004575 3300049572 Archaea 11171
931 Ga0501036_0004615 3300049572 Archaea 11133
932 Ga0501036_0006456 3300049572 Archaea 9525
933 Ga0501036_0018609 3300049572 Archaea 5824
934 Ga0501036_0021048 3300049572 Archaea 5477
935 Ga0501036_0026243 3300049572 Archaea 4916
936 Ga0501036_0033485 3300049572 Archaea 4346
937 Ga0501036_0040415 3300049572 Unclassified 3945
938 Ga0501036_0078384 3300049572 Archaea 2794
939 Ga0501036_0092255 3300049572 Archaea 2558
940 Ga0501036_0097466 3300049572 Archaea 2485
941 Ga0501037_0004069 3300049573 Archaea 10602
942 Ga0501037_0017128 3300049573 Archaea 5332
943 Ga0501037_0017833 3300049573 Unclassified 5226
944 Ga0501037_0018023 3300049573 Archaea 5199
945 Ga0501037_0020982 3300049573 Unclassified 4827
946 Ga0501037_0086344 3300049573 Archaea 2271
947 Ga0501037_0104790 3300049573 Archaea 2039
948 Ga0501037_0205825 3300049573 Unclassified 1389
949 Ga0501037_0287984 3300049573 Archaea 1143
950 Ga0501038_0000836 3300049574 Archaea 27412
951 Ga0501038_0025456 3300049574 Archaea 5275
952 Ga0501038_0052702 3300049574 Archaea 3506
953 Ga0501038_0060743 3300049574 Unclassified 3234
954 Ga0501038_0099127 3300049574 Unclassified 2429
955 Ga0501038_0178340 3300049574 Archaea 1716
956 Ga0501038_0233148 3300049574 Archaea 1464
957 Ga0501038_0247124 3300049574 Archaea 1414
958 Ga0501039_0000893 3300049575 Archaea 21703
959 Ga0501039_0002204 3300049575 Archaea 14417
960 Ga0501039_0004145 3300049575 Archaea 10908
961 Ga0501039_0004679 3300049575 Archaea 10353
962 Ga0501039_0006115 3300049575 Archaea 9139
963 Ga0501039_0011768 3300049575 Archaea 6663
964 Ga0501039_0016065 3300049575 Archaea 5734
965 Ga0501039_0023115 3300049575 Archaea 4769
966 Ga0501039_0034468 3300049575 Archaea 3906
967 Ga0501039_0059872 3300049575 Archaea 2949
968 Ga0501039_0107620 3300049575 Archaea 2178
969 Ga0501039_0124246 3300049575 Archaea 2023
970 Ga0501039_0148190 3300049575 Archaea 1844
971 Ga0501039_0262910 3300049575 Archaea 1356
972 Ga0501040_0000386 3300049576 Archaea 25949
973 Ga0501040_0000419 3300049576 Archaea 25136
974 Ga0501040_0002143 3300049576 Archaea 12742
975 Ga0501040_0002780 3300049576 Archaea 11284
976 Ga0501040_0002813 3300049576 Archaea 11227
977 Ga0501040_0004072 3300049576 Archaea 9498
978 Ga0501040_0005902 3300049576 Archaea 7926
979 Ga0501040_0013493 3300049576 Archaea 5371
980 Ga0501040_0024132 3300049576 Archaea 4080
981 Ga0501040_0044328 3300049576 Archaea 3032
982 Ga0501040_0114532 3300049576 Archaea 1887
983 Ga0501040_0131009 3300049576 Archaea 1763
984 Ga0501040_0163793 3300049576 Unclassified 1573
985 Ga0501041_0000026 3300049577 Archaea 47171
986 Ga0501041_0001406 3300049577 Archaea 13315
987 Ga0501041_0002199 3300049577 Archaea 11013
988 Ga0501041_0006204 3300049577 Archaea 6987
989 Ga0501041_0012077 3300049577 Archaea 5113
990 Ga0501041_0016900 3300049577 Archaea 4340
991 Ga0501041_0017861 3300049577 Archaea 4221
992 Ga0501041_0029400 3300049577 Archaea 3315
993 Ga0501041_0031282 3300049577 Archaea 3215
994 Ga0501041_0041445 3300049577 Unclassified 2797
995 Ga0501041_0062409 3300049577 Archaea 2281
996 Ga0501041_0192291 3300049577 Archaea 1278
997 Ga0501041_0227650 3300049577 Archaea 1170
998 Ga0501042_0001002 3300049578 Archaea 16037
999 Ga0501042_0003153 3300049578 Archaea 10277
1000 Ga0501042_0004992 3300049578 Archaea 8499
1001 Ga0501042_0004999 3300049578 Archaea 8495
1002 Ga0501042_0008707 3300049578 Archaea 6729
1003 Ga0501042_0011777 3300049578 Archaea 5909
1004 Ga0501042_0021541 3300049578 Unclassified 4494
1005 Ga0501042_0033190 3300049578 Archaea 3658
1006 Ga0501042_0035180 3300049578 Archaea 3553
1007 Ga0501042_0037009 3300049578 Archaea 3462
1008 Ga0501042_0037634 3300049578 Archaea 3434
1009 Ga0501042_0059193 3300049578 Archaea 2735
1010 Ga0501042_0091904 3300049578 Archaea 2178
1011 Ga0501042_0117087 3300049578 Archaea 1918
1012 Ga0501042_0120588 3300049578 Archaea 1888
1013 Ga0501042_0196471 3300049578 Archaea 1455
1014 Ga0501043_0003127 3300049579 Archaea 13726
1015 Ga0501043_0009635 3300049579 Archaea 7571
1016 Ga0501043_0009948 3300049579 Archaea 7457
1017 Ga0501043_0017205 3300049579 Unclassified 5671
1018 Ga0501043_0042197 3300049579 Archaea 3584
1019 Ga0501043_0054760 3300049579 Unclassified 3133
1020 Ga0501043_0254087 3300049579 Archaea 1353
1021 Ga0501046_0008285 3300049580 Archaea 9076
1022 Ga0501046_0008918 3300049580 Archaea 8706
1023 Ga0501046_0009736 3300049580 Archaea 8288
1024 Ga0501046_0015828 3300049580 Archaea 6329
1025 Ga0501046_0017967 3300049580 Archaea 5894
1026 Ga0501046_0064045 3300049580 Archaea 2870
1027 Ga0501046_0065485 3300049580 Archaea 2835
1028 Ga0501046_0117402 3300049580 Archaea 2027
1029 Ga0501046_0170556 3300049580 Archaea 1633
1030 Ga0501047_0019879 3300049581 Archaea 6446
1031 Ga0501047_0123216 3300049581 Archaea 2473
1032 Ga0501048_0000540 3300049582 Archaea 26589
1033 Ga0501048_0000657 3300049582 Archaea 24900
1034 Ga0501048_0003597 3300049582 Bacteria 11804
1035 Ga0501048_0005474 3300049582 Archaea 9663
1036 Ga0501048_0007631 3300049582 Archaea 8200
1037 Ga0501048_0014548 3300049582 Archaea 5822
1038 Ga0501048_0016470 3300049582 Archaea 5449
1039 Ga0501048_0049402 3300049582 Archaea 2997
1040 Ga0501048_0057674 3300049582 Archaea 2753
1041 Ga0501048_0078674 3300049582 Archaea 2327
1042 Ga0501048_0110966 3300049582 Archaea 1936
1043 Ga0501048_0145130 3300049582 Archaea 1679
1044 Ga0501048_0152553 3300049582 Archaea 1634
1045 Ga0501067_0091399 3300049583 Archaea 1690
1046 Ga0501068_0001143 3300049584 Archaea 14053
1047 Ga0501068_0190611 3300049584 Unclassified 1298
1048 Ga0501069_0058893 3300049585 Archaea 2143
1049 Ga0501069_0078086 3300049585 Archaea 1861
1050 Ga0501069_0126652 3300049585 Archaea 1461
1051 Ga0501070_0204936 3300049586 Archaea 1620
1052 Ga0501070_0233338 3300049586 Archaea 1507
1053 Ga0501070_0246387 3300049586 Archaea 1462
1054 Ga0501070_0379391 3300049586 Archaea 1145
1055 Ga0501071_0000112 3300049587 Archaea 31959
1056 Ga0501071_0000544 3300049587 Archaea 19389
1057 Ga0501071_0001251 3300049587 Archaea 14383
1058 Ga0501071_0003955 3300049587 Archaea 9345
1059 Ga0501071_0007341 3300049587 Archaea 7226
1060 Ga0501071_0009530 3300049587 Archaea 6472
1061 Ga0501071_0014947 3300049587 Archaea 5318
1062 Ga0501071_0017450 3300049587 Archaea 4950
1063 Ga0501071_0023844 3300049587 Archaea 4276
1064 Ga0501071_0051923 3300049587 Unclassified 2955
1065 Ga0501071_0064501 3300049587 Archaea 2657
1066 Ga0501071_0067653 3300049587 Archaea 2598
1067 Ga0501071_0095169 3300049587 Archaea 2191
1068 Ga0501071_0253479 3300049587 Archaea 1329
1069 Ga0501071_0277096 3300049587 Archaea 1269
1070 Ga0501071_0291844 3300049587 Archaea 1235
1071 Ga0501072_0000372 3300049588 Archaea 31974
1072 Ga0501072_0000621 3300049588 Archaea 25505
1073 Ga0501072_0000825 3300049588 Archaea 22815
1074 Ga0501072_0004343 3300049588 Archaea 10758
1075 Ga0501072_0004506 3300049588 Archaea 10588
1076 Ga0501072_0020968 3300049588 Archaea 5067
1077 Ga0501072_0028479 3300049588 Archaea 4361
1078 Ga0501072_0042817 3300049588 Archaea 3557
1079 Ga0501072_0043668 3300049588 Archaea 3523
1080 Ga0501072_0044348 3300049588 Archaea 3497
1081 Ga0501072_0082424 3300049588 Archaea 2550
1082 Ga0501072_0121907 3300049588 Archaea 2077
1083 Ga0501072_0138618 3300049588 Archaea 1939
1084 Ga0501072_0270836 3300049588 Archaea 1351
1085 Ga0501072_0275200 3300049588 Unclassified 1339
1086 Ga0501073_0012081 3300049589 Archaea 6304
1087 Ga0501073_0145172 3300049589 Archaea 1644
1088 Ga0501073_0203935 3300049589 Archaea 1367
1089 Ga0501073_0223713 3300049589 Archaea 1300
1090 Ga0501074_0002126 3300049590 Archaea 13688
1091 Ga0501074_0018734 3300049590 Archaea 5029
1092 Ga0501074_0029646 3300049590 Unclassified 3964
1093 Ga0501074_0049371 3300049590 Archaea 3038
1094 Ga0501074_0079724 3300049590 Unclassified 2349
1095 Ga0501074_0083427 3300049590 Archaea 2291
1096 Ga0501074_0172248 3300049590 Archaea 1545
1097 Ga0501075_0000958 3300049591 Archaea 18382
1098 Ga0501075_0004348 3300049591 Archaea 9585
1099 Ga0501075_0004803 3300049591 Archaea 9191
1100 Ga0501075_0004854 3300049591 Archaea 9153
1101 Ga0501075_0008384 3300049591 Archaea 7209
1102 Ga0501075_0010778 3300049591 Unclassified 6439
1103 Ga0501075_0011640 3300049591 Archaea 6231
1104 Ga0501075_0017052 3300049591 Archaea 5240
1105 Ga0501075_0025001 3300049591 Archaea 4385
1106 Ga0501075_0030978 3300049591 Unclassified 3967
1107 Ga0501075_0031770 3300049591 Archaea 3921
1108 Ga0501075_0043052 3300049591 Archaea 3387
1109 Ga0501075_0050801 3300049591 Archaea 3117
1110 Ga0501075_0088170 3300049591 Archaea 2352
1111 Ga0501075_0116067 3300049591 Archaea 2035
1112 Ga0501075_0250973 3300049591 Archaea 1348
1113 Ga0501076_0000721 3300049592 Archaea 21365
1114 Ga0501076_0001201 3300049592 Archaea 17191
1115 Ga0501076_0003036 3300049592 Archaea 11668
1116 Ga0501076_0003497 3300049592 Archaea 11037
1117 Ga0501076_0005003 3300049592 Archaea 9487
1118 Ga0501076_0007966 3300049592 Archaea 7731
1119 Ga0501076_0013542 3300049592 Archaea 6114
1120 Ga0501076_0016764 3300049592 Archaea 5559
1121 Ga0501076_0017783 3300049592 Archaea 5404
1122 Ga0501076_0037772 3300049592 Archaea 3789
1123 Ga0501076_0048312 3300049592 Archaea 3364
1124 Ga0501076_0048560 3300049592 Archaea 3354
1125 Ga0501076_0070983 3300049592 Archaea 2785
1126 Ga0501076_0079396 3300049592 Unclassified 2633
1127 Ga0501076_0123651 3300049592 Archaea 2095
1128 Ga0501076_0131276 3300049592 Archaea 2031
1129 Ga0501076_0137650 3300049592 Archaea 1983
1130 Ga0501076_0138744 3300049592 Archaea 1975
1131 Ga0501076_0170029 3300049592 Archaea 1776
1132 Ga0501076_0174505 3300049592 Unclassified 1752
1133 Ga0501077_0000883 3300049593 Archaea 18021
1134 Ga0501077_0003279 3300049593 Archaea 9746
1135 Ga0501077_0003669 3300049593 Archaea 9238
1136 Ga0501077_0015143 3300049593 Unclassified 4849
1137 Ga0501077_0017053 3300049593 Archaea 4580
1138 Ga0501077_0032160 3300049593 Unclassified 3339
1139 Ga0501077_0039486 3300049593 Archaea 3007
1140 Ga0501077_0053024 3300049593 Archaea 2575
1141 Ga0501077_0068510 3300049593 Archaea 2249
1142 Ga0501077_0094335 3300049593 Archaea 1897
1143 Ga0501077_0111592 3300049593 Archaea 1733
1144 Ga0501077_0120087 3300049593 Archaea 1665
1145 Ga0501077_0157608 3300049593 Unclassified 1441
1146 Ga0501198_000243 3300049649 Archaea 6984
1147 Ga0501199_000133 3300049650 Archaea 5740
1148 Ga0501199_002738 3300049650 Archaea 1665
1149 Ga0501201_000792 3300049651 Archaea 2960
1150 Ga0501202_000087 3300049652 Archaea 10037
1151 Ga0501202_003700 3300049652 Archaea 2633
1152 Ga0501202_010328 3300049652 Archaea 1730
1153 Ga0501202_015859 3300049652 Archaea 1456
1154 Ga0501206_000029 3300049653 Archaea 13173
1155 Ga0501207_000265 3300049654 Archaea 5440
1156 Ga0501207_002557 3300049654 Unclassified 2362
1157 Ga0501208_000051 3300049655 Archaea 6529
1158 Ga0501209_000077 3300049656 Archaea 9732
1159 Ga0501209_008560 3300049656 Archaea 2023
1160 Ga0501209_010862 3300049656 Archaea 1888
1161 Ga0501211_000744 3300049658 Archaea 3328
1162 Ga0501214_000033 3300049659 Archaea 8491
1163 Ga0501216_000169 3300049660 Archaea 6956
1164 Ga0501217_000234 3300049661 Archaea 8472
1165 Ga0501217_019878 3300049661 Archaea 1572
1166 Ga0501217_022596 3300049661 Archaea 1493
1167 Ga0501222_003412 3300049662 Archaea 2173
1168 Ga0501223_003152 3300049663 Archaea 3605
1169 Ga0501224_000331 3300049664 Archaea 5534
1170 Ga0501227_000080 3300049665 Archaea 15155
1171 Ga0501227_044706 3300049665 Archaea 1103
1172 Ga0501228_000036 3300049666 Archaea 6926
1173 Ga0501230_000517 3300049667 Archaea 3917
1174 Ga0501233_000226 3300049668 Archaea 8431
1175 Ga0501235_000320 3300049669 Archaea 9125
1176 Ga0501238_002119 3300049671 Archaea 2341
1177 Ga0501239_003509 3300049672 Archaea 1495
1178 Ga0501242_000117 3300049674 Archaea 5502
1179 Ga0501243_000077 3300049675 Archaea 9794
1180 Ga0501243_002760 3300049675 Archaea 2586
1181 Ga0501243_004776 3300049675 Archaea 2036
1182 Ga0501243_013641 3300049675 Archaea 1293
1183 Ga0501243_015727 3300049675 Archaea 1218
1184 Ga0501246_002750 3300049676 Archaea 1394
1185 Ga0501247_001269 3300049677 Archaea 2380
1186 Ga0501248_001238 3300049678 Archaea 1585
1187 Ga0501249_012602 3300049679 Archaea 1788
1188 Ga0501251_000072 3300049681 Archaea 7674
1189 Ga0501252_000670 3300049682 Archaea 2765
1190 Ga0501253_000060 3300049683 Archaea 7526
1191 Ga0501255_000161 3300049684 Archaea 3975
1192 Ga0501257_021280 3300049686 Archaea 1528
1193 Ga0501259_001003 3300049688 Archaea 4689
1194 Ga0501260_000665 3300049689 Archaea 2675
1195 Ga0501261_000403 3300049690 Archaea 5658
1196 Ga0501219_001796 3300049703 Unclassified 1855
1197 Ga0501221_001089 3300049704 Archaea 4462
1198 Ga0501225_0000341 3300049705 Archaea 14700
1199 Ga0501225_0011189 3300049705 Archaea 2527
1200 Ga0501229_000781 3300049706 Archaea 3592
1201 Ga0501234_000097 3300049707 Archaea 10905
1202 Ga0501245_000062 3300049708 Archaea 10093
1203 Ga0501079_0001519 3300049741 Archaea 16421
1204 Ga0501079_0002003 3300049741 Archaea 14561
1205 Ga0501079_0003062 3300049741 Archaea 12237
1206 Ga0501079_0003557 3300049741 Archaea 11456
1207 Ga0501079_0005072 3300049741 Archaea 9780
1208 Ga0501079_0005238 3300049741 Archaea 9637
1209 Ga0501079_0010437 3300049741 Archaea 7061
1210 Ga0501079_0011223 3300049741 Archaea 6835
1211 Ga0501079_0074919 3300049741 Archaea 2617
1212 Ga0501079_0115107 3300049741 Archaea 2090
1213 Ga0501079_0125493 3300049741 Archaea 1997
1214 Ga0501079_0275381 3300049741 Archaea 1316
1215 Ga0501080_0003695 3300049742 Archaea 13505
1216 Ga0501080_0005827 3300049742 Archaea 11031
1217 Ga0501080_0006679 3300049742 Archaea 10383
1218 Ga0501080_0006753 3300049742 Archaea 10338
1219 Ga0501080_0009565 3300049742 Archaea 8849
1220 Ga0501080_0025576 3300049742 Archaea 5481
1221 Ga0501080_0071867 3300049742 Unclassified 3219
1222 Ga0501080_0154203 3300049742 Unclassified 2122
1223 Ga0501080_0207944 3300049742 Archaea 1794
1224 Ga0501081_0000024 3300049743 Archaea 55006
1225 Ga0501081_0001209 3300049743 Archaea 15697
1226 Ga0501081_0003817 3300049743 Archaea 9650
1227 Ga0501081_0006862 3300049743 Unclassified 7403
1228 Ga0501081_0008921 3300049743 Archaea 6517
1229 Ga0501081_0010039 3300049743 Archaea 6174
1230 Ga0501081_0010248 3300049743 Unclassified 6119
1231 Ga0501081_0028683 3300049743 Archaea 3757
1232 Ga0501081_0048974 3300049743 Archaea 2908
1233 Ga0501081_0054413 3300049743 Archaea 2765
1234 Ga0501081_0123935 3300049743 Archaea 1842
1235 Ga0501081_0163115 3300049743 Archaea 1607
1236 Ga0501081_0211491 3300049743 Archaea 1408
1237 Ga0501083_0042263 3300049744 Archaea 3091
1238 Ga0501083_0069384 3300049744 Archaea 2345
1239 Ga0501083_0138489 3300049744 Archaea 1594
1240 Ga0501232_000020 3300049757 Archaea 9174
1241 Ga0501241_003411 3300049758 Archaea 2999
1242 Ga0501265_000127 3300049762 Archaea 6824
1243 Ga0501267_003709 3300049764 Archaea 1401
1244 Ga0501268_009466 3300049765 Archaea 1498
1245 Ga0501270_000590 3300049767 Archaea 3146
1246 Ga0501271_000211 3300049768 Archaea 4969
1247 Ga0501271_004398 3300049768 Archaea 1334
1248 Ga0501274_000166 3300049771 Archaea 4141
1249 Ga0501275_000389 3300049772 Archaea 5007
1250 Ga0501276_000086 3300049773 Archaea 4725
1251 Ga0501278_000156 3300049774 Archaea 5171
1252 Ga0501279_000138 3300049775 Archaea 10400
1253 Ga0501279_002994 3300049775 Archaea 2197
1254 Ga0501280_001754 3300049776 Archaea 3817
1255 Ga0501282_001287 3300049778 Archaea 2802
1256 Ga0501283_000208 3300049779 Archaea 7752
1257 Ga0501035_0009232 3300049822 Archaea 9170
1258 Ga0501035_0014241 3300049822 Archaea 7341
1259 Ga0501035_0017908 3300049822 Unclassified 6533
1260 Ga0501035_0021955 3300049822 Archaea 5864
1261 Ga0501035_0092452 3300049822 Archaea 2662
1262 Ga0501035_0241548 3300049822 Archaea 1536
1263 Ga0501044_0004369 3300049823 Archaea 15821
1264 Ga0501044_0059758 3300049823 Archaea 3905
1265 Ga0501044_0147791 3300049823 Archaea 2334
1266 Ga0501044_0270985 3300049823 Archaea 1633
1267 Ga0501045_0000368 3300049824 Archaea 27039
1268 Ga0501045_0000728 3300049824 Archaea 20974
1269 Ga0501045_0000863 3300049824 Archaea 19685
1270 Ga0501045_0001561 3300049824 Archaea 15250
1271 Ga0501045_0001765 3300049824 Archaea 14594
1272 Ga0501045_0002293 3300049824 Archaea 12971
1273 Ga0501045_0007175 3300049824 Archaea 7729
1274 Ga0501045_0018257 3300049824 Archaea 4988
1275 Ga0501045_0041376 3300049824 Archaea 3353
1276 Ga0501045_0046345 3300049824 Unclassified 3166
1277 Ga0501045_0059126 3300049824 Unclassified 2807
1278 Ga0501045_0077961 3300049824 Archaea 2442
1279 Ga0501045_0105305 3300049824 Unclassified 2090
1280 Ga0501045_0313288 3300049824 Archaea 1168
1281 Ga0501204_000069 3300049850 Archaea 7572
1282 Ga0501212_000632 3300049851 Archaea 3536
1283 nmdc:mga05p37_11861_c1 3300050507 Archaea 10389
1284 nmdc:mga05p37_16949_c1 3300050507 Archaea 8787
1285 nmdc:mga05p37_174379_c1 3300050507 Archaea 2621
1286 nmdc:mga05p37_218547_c1 3300050507 Unclassified 2301
1287 nmdc:mga05p37_27736_c1 3300050507 Archaea 6899
1288 nmdc:mga05p37_301927_c1 3300050507 Unclassified 1902
1289 nmdc:mga05p37_34947_c1 3300050507 Archaea 6160
1290 nmdc:mga05p37_3755_c1 3300050507 Archaea 17774
1291 nmdc:mga05p37_396024_c1 3300050507 Archaea 1614
1292 nmdc:mga05p37_443096_c1 3300050507 Archaea 1506
1293 nmdc:mga05p37_47300_c1 3300050507 Archaea 5291
1294 nmdc:mga05p37_516989_c1 3300050507 Archaea 1366
1295 nmdc:mga05p37_54341_c1 3300050507 Archaea 4927
1296 nmdc:mga05p37_88117_c1 3300050507 Archaea 3826
1297 nmdc:mga09592_130759_c1 3300050508 Archaea 2160
1298 nmdc:mga09592_132227_c1 3300050508 Archaea 2148
1299 nmdc:mga09592_14000_c1 3300050508 Archaea 6549
1300 nmdc:mga09592_171078_c1 3300050508 Archaea 1879
1301 nmdc:mga09592_1748_c1 3300050508 Archaea 17460
1302 nmdc:mga09592_20970_c1 3300050508 Archaea 5380
1303 nmdc:mga09592_252560_c1 3300050508 Archaea 1528
1304 nmdc:mga09592_261157_c1 3300050508 Archaea 1502
1305 nmdc:mga09592_3905_c1 3300050508 Archaea 12004
1306 nmdc:mga09592_75667_c1 3300050508 Archaea 2863
1307 nmdc:mga0qj67_15975_c1 3300050509 Archaea 5684
1308 nmdc:mga0qj67_189842_c1 3300050509 Archaea 1670
1309 nmdc:mga0qj67_2175_c1 3300050509 Archaea 13941
1310 nmdc:mga0qj67_281220_c1 3300050509 Archaea 1349
1311 nmdc:mga0qj67_367961_c1 3300050509 Archaea 1161
1312 nmdc:mga0qj67_442_c1 3300050509 Archaea 28297
1313 nmdc:mga0qj67_6478_c1 3300050509 Archaea 8605
1314 nmdc:mga06r32_113034_c1 3300050510 Archaea 2672
1315 nmdc:mga06r32_123268_c1 3300050510 Archaea 2558
1316 nmdc:mga06r32_130632_c1 3300050510 Archaea 2484
1317 nmdc:mga06r32_14515_c1 3300050510 Archaea 7150
1318 nmdc:mga06r32_152348_c1 3300050510 Unclassified 2291
1319 nmdc:mga06r32_184560_c1 3300050510 Archaea 2072
1320 nmdc:mga06r32_275177_c1 3300050510 Archaea 1671
1321 nmdc:mga06r32_28089_c1 3300050510 Archaea 5262
1322 nmdc:mga06r32_29341_c1 3300050510 Archaea 5154
1323 nmdc:mga06r32_342088_c1 3300050510 Archaea 1481
1324 nmdc:mga06r32_752_c1 3300050510 Archaea 28486
1325 nmdc:mga08y16_113_c1 3300050511 Archaea 68903
1326 nmdc:mga08y16_132199_c1 3300050511 Archaea 2595
1327 nmdc:mga08y16_18022_c1 3300050511 Archaea 7438
1328 nmdc:mga08y16_18885_c1 3300050511 Archaea 7262
1329 nmdc:mga08y16_18911_c1 3300050511 Archaea 7254
1330 nmdc:mga08y16_270173_c1 3300050511 Bacteria 1755
1331 nmdc:mga08y16_2805_c1 3300050511 Archaea 17880
1332 nmdc:mga08y16_305659_c1 3300050511 Archaea 1639
1333 nmdc:mga08y16_34551_c1 3300050511 Archaea 5311
1334 nmdc:mga08y16_3798_c1 3300050511 Archaea 15728
1335 nmdc:mga08y16_61256_c1 3300050511 Archaea 3930
1336 nmdc:mga08y16_923_c1 3300050511 Archaea 28516
1337 nmdc:mga0n895_10176_c1 3300050512 Archaea 8284
1338 nmdc:mga0n895_107101_c1 3300050512 Archaea 2809
1339 nmdc:mga0n895_114215_c1 3300050512 Unclassified 2718
1340 nmdc:mga0n895_170395_c1 3300050512 Archaea 2209
1341 nmdc:mga0n895_186467_c1 3300050512 Archaea 2106
1342 nmdc:mga0n895_197644_c1 3300050512 Archaea 2042
1343 nmdc:mga0n895_23331_c1 3300050512 Archaea 5814
1344 nmdc:mga0n895_315351_c1 3300050512 Archaea 1585
1345 nmdc:mga0n895_39636_c1 3300050512 Archaea 4572
1346 nmdc:mga0n895_398179_c1 3300050512 Archaea 1393
1347 nmdc:mga0n895_5_c2 3300050512 Archaea 103942
1348 nmdc:mga0rr50_23312_c1 3300050513 Archaea 4266
1349 nmdc:mga0rr50_262_c1 3300050513 Archaea 28415
1350 nmdc:mga0rr50_40196_c1 3300050513 Archaea 3399
1351 nmdc:mga0rr50_72332_c1 3300050513 Archaea 2633
1352 nmdc:mga08x19_20899_c1 3300050514 Archaea 4035
1353 nmdc:mga08x19_58974_c1 3300050514 Unclassified 2484
1354 nmdc:mga08x19_86621_c1 3300050514 Archaea 2063
1355 nmdc:mga0a205_144285_c1 3300050515 Archaea 2281
1356 nmdc:mga0a205_205312_c1 3300050515 Archaea 1860
1357 nmdc:mga0a205_2693_c1 3300050515 Archaea 15697
1358 nmdc:mga0a205_4186_c1 3300050515 Archaea 12933
1359 nmdc:mga0a205_49585_c1 3300050515 Archaea 4053
1360 nmdc:mga0a205_9532_c1 3300050515 Archaea 8882
1361 Ga0495612_0114496 3300053078 Archaea 1157
1362 Ga0495619_0000162 3300053085 Archaea 49208
1363 Ga0501084_0000881 3300054114 Archaea 23201
1364 Ga0501084_0001420 3300054114 Archaea 18983
1365 Ga0501084_0002713 3300054114 Archaea 14259
1366 Ga0501084_0006020 3300054114 Archaea 9972
1367 Ga0501084_0011192 3300054114 Archaea 7432
1368 Ga0501084_0019039 3300054114 Archaea 5717
1369 Ga0501084_0019789 3300054114 Archaea 5610
1370 Ga0501084_0045788 3300054114 Archaea 3662
1371 Ga0501084_0053056 3300054114 Archaea 3391
1372 Ga0501084_0053580 3300054114 Archaea 3374
1373 Ga0501084_0061222 3300054114 Archaea 3151
1374 Ga0501084_0067319 3300054114 Archaea 2998
1375 Ga0501084_0131708 3300054114 Archaea 2105
1376 Ga0501084_0274494 3300054114 Archaea 1423
1377 Ga0501084_0383682 3300054114 Archaea 1187
1378 Ga0590071_000984 3300059421 Archaea 7796
1379 Ga0590075_001782 3300059424 Archaea 5275
1380 Ga0590075_003126 3300059424 Archaea 3935
1381 Ga0590075_011882 3300059424 Archaea 2109
1382 Ga0590077_002187 3300059426 Archaea 4266
1383 Ga0587066_005565 3300059490 Archaea 1619
1384 Ga0587070_007024 3300059491 Archaea 1543
1385 Ga0587073_0003865 3300059492 Archaea 2099
1386 Ga0587073_0023035 3300059492 Archaea 1215
1387 Ga0587082_000776 3300059504 Archaea 2942
1388 Ga0587067_015204 3300059640 Archaea 1245
1389 Ga0587069_000741 3300059642 Archaea 2665
1390 Ga0587075_001336 3300059644 Archaea 2349
1391 Ga0587075_005130 3300059644 Archaea 1555
1392 Ga0587076_001323 3300059645 Archaea 2487
1393 Ga0587076_019527 3300059645 Archaea 1103
1394 Ga0587071_004678 3300060344 Archaea 2056
1395 Ga0501082_0006300 3300060353 Archaea 10290
1396 Ga0501082_0006719 3300060353 Archaea 9946
1397 Ga0501082_0012116 3300060353 Archaea 7409
1398 Ga0501082_0014761 3300060353 Archaea 6727
1399 Ga0501082_0018166 3300060353 Archaea 6056
1400 Ga0501082_0021853 3300060353 Archaea 5515
1401 Ga0501082_0033736 3300060353 Unclassified 4415
1402 Ga0501082_0042101 3300060353 Archaea 3937
1403 Ga0501082_0050226 3300060353 Archaea 3597
1404 Ga0501082_0061343 3300060353 Archaea 3237
1405 Ga0501082_0077277 3300060353 Archaea 2870
1406 Ga0501082_0206969 3300060353 Archaea 1707
1407 Ga0501082_0255069 3300060353 Archaea 1526
1408 Ga0530510_0001848 3300061734 Archaea 14460
1409 Ga0530510_0004575 3300061734 Archaea 9570
1410 Ga0530510_0005636 3300061734 Archaea 8677
1411 Ga0530510_0015871 3300061734 Archaea 5325
1412 Ga0530510_0016377 3300061734 Archaea 5247
1413 Ga0530510_0019716 3300061734 Archaea 4789
1414 Ga0530510_0025965 3300061734 Archaea 4189
1415 Ga0530510_0048656 3300061734 Unclassified 3065
1416 Ga0530510_0064507 3300061734 Unclassified 2652
1417 Ga0530510_0065030 3300061734 Archaea 2642
1418 Ga0530510_0072999 3300061734 Archaea 2490
1419 Ga0530510_0094051 3300061734 Archaea 2189
1420 Ga0530510_0106429 3300061734 Archaea 2053
1421 Ga0530510_0122548 3300061734 Archaea 1909
1422 Ga0530510_0147406 3300061734 Archaea 1736
1423 Ga0070707_100161247
1424 SwRhRL3b_contig_2974144
1425 SwRhRL3b_contig_3448436
1426 SwRhRL2b_contig_2818508
1427 MRS1b_contig_6683908
1428 MBSR1b_contig_4268051
1429 MBSR1b_contig_6032307
1430 MBSR1b_contig_7093716
1431 2214772978
1432 ARcpr5oldR_c000304
1433 ARcpr5oldR_c001276
1434 ARSoilYngRDRAFT_c00079
1435 ARSoilYngRDRAFT_c00082
1436 ARcpr5yngRDRAFT_c000604
1437 ARcpr5yngRDRAFT_c002333
1438 ARSoilOldRDRAFT_c000733
1439 ARSoilOldRDRAFT_c001375
1440 ARSoilOldRDRAFT_c003217
1441 ARCol0oldRDRAFT_c00007
1442 ARCol0oldRDRAFT_c00498
1443 ARCol0yngRDRAFT_1000090
1444 JGI24736J21556_1001046
1445 JGI24746J21847_1001064
1446 JGI24746J21847_1001913
1447 JGI24739J22299_10004350
1448 JGI24737J22298_10009108
1449 JGI24745J21846_1000096
1450 JGI24033J26618_1004215
1451 JGI24033J26618_1005080
1452 JGI24033J26618_1007366
1453 JGI24742J22300_10002663
1454 JGI24742J22300_10008278
1455 JGI24751J29686_10023510
1456 Ga0006759J45824_1027201
1457 rootL2_10253527
1458 rootL2_10291427
1459 JGI26129J50193_1000075
1460 JGI26129J50193_1000379
1461 JGI26145J50221_1000185
1462 JGI26145J50221_1000403
1463 JGI25407J50210_10001374
1464 JGI26142J50222_100012
1465 JGI26144J50225_100080
1466 JGI26144J50225_100491
1467 JGI26139J50223_100004
1468 JGI26140J50224_100002
1469 JGI26140J50224_100177
1470 JGI26134J50242_100017
1471 JGI26137J50245_100106
1472 JGI26130J50248_100132
1473 JGI26136J50244_100060
1474 JGI26131J50246_100004
1475 JGI26131J50246_100392
1476 JGI26143J51219_1000027
1477 JGI26141J51220_1000002
1478 JGI26138J51218_100003
1479 Ga0032354_1035073
1480 Ga0006780_1021405
1481 JGI25405J52794_10000031
1482 JGI25405J52794_10000734
1483 Ga0058859_11815034
1484 Ga0058860_10043204
1485 Ga0058862_10279358
1486 Ga0065717_1000094
1487 Ga0065717_1000281
1488 Ga0065716_1003128
1489 Ga0065704_10003714
1490 Ga0065704_10004404
1491 Ga0065704_10032533
1492 Ga0065704_10123090
1493 Ga0065712_10000407
1494 Ga0065712_10000872
1495 Ga0065715_10000173
1496 Ga0065715_10000255
1497 Ga0065715_10000274
1498 Ga0065715_10004143
1499 Ga0065707_10001973
1500 Ga0065707_10092082
1501 Ga0070676_10000851
1502 Ga0070676_10000856
1503 Ga0070676_10001370
1504 Ga0070676_10006462
1505 Ga0070676_10012952
1506 Ga0070676_10024009
1507 Ga0070676_10031473
1508 Ga0070683_100015900
1509 Ga0070683_100141696
1510 Ga0070683_100250916
1511 Ga0070670_100011094
1512 Ga0070670_100023857
1513 Ga0070670_100170509
1514 Ga0070677_10049221
1515 Ga0068869_100001240
1516 Ga0068869_100004670
1517 Ga0068869_100010663
1518 Ga0070680_100002310
1519 Ga0070680_100022182
1520 Ga0070680_100102343
1521 Ga0070680_100181193
1522 Ga0070680_100190777
1523 Ga0070680_100227543
1524 Ga0070682_100000372
1525 Ga0070682_100005458
1526 Ga0068868_100000911
1527 Ga0068868_100014327
1528 Ga0068868_100019332
1529 Ga0068868_100022428
1530 Ga0068868_100056839
1531 Ga0068868_100090299
1532 Ga0068868_100090863
1533 Ga0068868_100164364
1534 Ga0070689_100168469
1535 Ga0070689_100257351
1536 Ga0070689_100388988
1537 Ga0070687_100000818
1538 Ga0070687_100048793
1539 Ga0070692_10006121
1540 Ga0070692_10027013
1541 Ga0070692_10030277
1542 Ga0070692_10041669
1543 Ga0070668_100075187
1544 Ga0070669_100001391
1545 Ga0070675_100006801
1546 Ga0070675_100199391
1547 Ga0070671_100140069
1548 Ga0070671_100153728
1549 Ga0070671_100361618
1550 Ga0070674_100009051
1551 Ga0070674_100108685
1552 Ga0070673_100012125
1553 Ga0070673_100026002
1554 Ga0070688_100293438
1555 Ga0070659_100055984
1556 Ga0070659_100076701
1557 Ga0070659_100432960
1558 Ga0070667_100002370
1559 Ga0070667_100052824
1560 Ga0070709_10001477
1561 Ga0070709_10003040
1562 Ga0070709_10067592
1563 Ga0070709_10087950
1564 Ga0070709_10104686
1565 Ga0070714_100011806
1566 Ga0070714_100259358
1567 Ga0070713_100038747
1568 Ga0070713_100223118
1569 Ga0070710_10040632
1570 Ga0070710_10050183
1571 Ga0070710_10103508
1572 Ga0070701_10004097
1573 Ga0070711_100000459
1574 Ga0070711_100002070
1575 Ga0070711_100004650
1576 Ga0070711_100033190
1577 Ga0070705_100002612
1578 Ga0070705_100002797
1579 Ga0070705_100100777
1580 Ga0070700_100002144
1581 Ga0070700_100013876
1582 Ga0070700_100016839
1583 Ga0070700_100097245
1584 Ga0070700_100136137
1585 Ga0070694_100000053
1586 Ga0070694_100006807
1587 Ga0070694_100011040
1588 Ga0070708_100178625
1589 Ga0070663_100263084
1590 Ga0070663_100328978
1591 Ga0070663_100407544
1592 Ga0070678_100007450
1593 Ga0070662_100006220
1594 Ga0070662_100023085
1595 Ga0070662_100038304
1596 Ga0070662_100164925
1597 Ga0070681_10031694
1598 Ga0070681_10035590
1599 Ga0070681_10083415
1600 Ga0070681_10098023
1601 Ga0068867_100002066
1602 Ga0068867_100002176
1603 Ga0068867_100008640
1604 Ga0068867_100316558
1605 Ga0070706_100259481
1606 Ga0070707_100053831
1607 Ga0070707_100390266
1608 Ga0070698_100003950
1609 Ga0070698_100015221
1610 Ga0070698_100320498
1611 Ga0070699_100045390
1612 Ga0070699_100079233
1613 Ga0070699_100157616
1614 Ga0070699_100276766
1615 Ga0070679_100082268
1616 Ga0070679_100148115
1617 Ga0070679_100209300
1618 Ga0070684_100005488
1619 Ga0070684_100154040
1620 Ga0070684_100233747
1621 Ga0070697_100004334
1622 Ga0070697_100125329
1623 Ga0070697_100187367
1624 Ga0070672_100000958
1625 Ga0070672_100003020
1626 Ga0070672_100007776
1627 Ga0070672_100229085
1628 Ga0070686_100005242
1629 Ga0070686_100130950
1630 Ga0070695_100001979
1631 Ga0070695_100011084
1632 Ga0070695_100012813
1633 Ga0070695_100025362
1634 Ga0070696_100033630
1635 Ga0070696_100041236
1636 Ga0070696_100069313
1637 Ga0070693_100068639
1638 Ga0070693_100079735
1639 Ga0070693_100131740
1640 Ga0070704_100001207
1641 Ga0070704_100023278
1642 Ga0070704_100033321
1643 Ga0070664_100097745
1644 Ga0070664_100122779
1645 Ga0070664_100150532
1646 Ga0070664_100223414
1647 Ga0070664_100408142
1648 Ga0068857_100200436
1649 Ga0068854_100014044
1650 Ga0068854_100138591
1651 Ga0068856_100001291
1652 Ga0068856_100151997
1653 Ga0070702_100004074
1654 Ga0070702_100010383
1655 Ga0070702_100025454
1656 Ga0070702_100042792
1657 Ga0070702_100059025
1658 Ga0070702_100080495
1659 Ga0070702_100114875
1660 Ga0068852_100029666
1661 Ga0068852_100051951
1662 Ga0068852_100064965
1663 Ga0068859_100210213
1664 Ga0068864_100030074
1665 Ga0068864_100039781
1666 Ga0068864_100135658
1667 Ga0068866_10099458
1668 Ga0068866_10109043
1669 Ga0068870_10001540
1670 Ga0068870_10002813
1671 Ga0068870_10003250
1672 Ga0068870_10023078
1673 Ga0068870_10043425
1674 Ga0068860_100002755
1675 Ga0068860_100013921
1676 Ga0068860_100026229
1677 Ga0068862_100025861
1678 Ga0068862_100087832
1679 Ga0068862_100179476
1680 Ga0081455_10002515
1681 Ga0081455_10002619
1682 Ga0081455_10008896
1683 Ga0081455_10015249
1684 Ga0081538_10000374
1685 Ga0081538_10000668
1686 Ga0081538_10003188
1687 Ga0081538_10019014
1688 Ga0081538_10045428
1689 Ga0070717_10051397
1690 Ga0075432_10002560
1691 Ga0075432_10012699
1692 Ga0075432_10028399
1693 Ga0075432_10078689
1694 Ga0070715_10000725
1695 Ga0070715_10056176
1696 Ga0070715_10064248
1697 Ga0070715_10075098
1698 Ga0070716_100000537
1699 Ga0070716_100001237
1700 Ga0070716_100045447
1701 Ga0070716_100182661
1702 Ga0070712_100002663
1703 Ga0070712_100003553
1704 Ga0070712_100087693
1705 Ga0097621_100003581
1706 Ga0097621_100093503
1707 Ga0097621_100130591
1708 Ga0068871_100020534
1709 Ga0068871_100023728
1710 Ga0068871_100194181
1711 Ga0075428_100000854
1712 Ga0075428_100004403
1713 Ga0075428_100055982
1714 Ga0075428_100092856
1715 Ga0075428_100094525
1716 Ga0075428_100128555
1717 Ga0075428_100218340
1718 Ga0075428_100278602
1719 Ga0075430_100000559
1720 Ga0075430_100004617
1721 Ga0075430_100004867
1722 Ga0075430_100006477
1723 Ga0075430_100013795
1724 Ga0075430_100031557
1725 Ga0075430_100400764
1726 Ga0075431_100000588
1727 Ga0075431_100002796
1728 Ga0075431_100044419
1729 Ga0075431_100108606
1730 Ga0075431_100138530
1731 Ga0075431_100231014
1732 Ga0075431_100231918
1733 Ga0075431_100250245
1734 Ga0075431_100294221
1735 Ga0075433_10001686
1736 Ga0075433_10005225
1737 Ga0075433_10018402
1738 Ga0075433_10019774
1739 Ga0075433_10093880
1740 Ga0075433_10174372
1741 Ga0075434_100009869
1742 Ga0075434_100010099
1743 Ga0075434_100025109
1744 Ga0075434_100031185
1745 Ga0075434_100066175
1746 Ga0075434_100117392
1747 Ga0075434_100202322
1748 Ga0075429_100001072
1749 Ga0075429_100001842
1750 Ga0075429_100002901
1751 Ga0075429_100027610
1752 Ga0075429_100032206
1753 Ga0075429_100091645
1754 Ga0068865_100002349
1755 Ga0068865_100067239
1756 Ga0068865_100128681
1757 Ga0068865_100300484
1758 Ga0075436_100001397
1759 Ga0075436_100005019
1760 Ga0075436_100007938
1761 Ga0075436_100093759
1762 Ga0075436_100125676
1763 Ga0097620_100210207
1764 Ga0075435_100007982
1765 Ga0075435_100014606
1766 Ga0075435_100037867
1767 Ga0075435_100067400
1768 Ga0075435_100089757
1769 Ga0075435_100158028
1770 Ga0075435_100206941
1771 Ga0105244_10071632
1772 Ga0105240_10256971
1773 Ga0105240_10267757
1774 Ga0111539_10001403
1775 Ga0111539_10005438
1776 Ga0111539_10005556
1777 Ga0111539_10006237
1778 Ga0111539_10058247
1779 Ga0111539_10082375
1780 Ga0111539_10083799
1781 Ga0111539_10114708
1782 Ga0111539_10244021
1783 Ga0111539_10343962
1784 Ga0111539_10374059
1785 Ga0105245_10429859
1786 Ga0114129_10001003
1787 Ga0114129_10001449
1788 Ga0114129_10002147
1789 Ga0114129_10002227
1790 Ga0114129_10002527
1791 Ga0114129_10006019
1792 Ga0114129_10011884
1793 Ga0114129_10077443
1794 Ga0114129_10165983
1795 Ga0114129_10235993
1796 Ga0114129_10361290
1797 Ga0114129_10444988
1798 Ga0105241_10045925
1799 Ga0105241_10094374
1800 Ga0105241_10148368
1801 Ga0105242_10026118
1802 Ga0105242_10090298
1803 Ga0105242_10139070
1804 Ga0105237_10010420
1805 Ga0105237_10124532
1806 Ga0105249_10003418
1807 Ga0105249_10036546
1808 Ga0105249_10046426
1809 Ga0105249_10092966
1810 Ga0105249_10135095
1811 Ga0105249_10288688
1812 Ga0105249_10321824
1813 Ga0105239_10004063
1814 Ga0105239_10062724
1815 Ga0105239_10145343
1816 Ga0105239_10163086
1817 Ga0105246_10001564
1818 Ga0105246_10007595
1819 Ga0105246_10010548
1820 Ga0105246_10019987
1821 Ga0105246_10055829
1822 Ga0105246_10204776
1823 Ga0157317_1001252
1824 Ga0157344_1000580
1825 Ga0157336_1000228
1826 Ga0157328_1000010
1827 Ga0157318_1000001
1828 Ga0157318_1000333
1829 Ga0157337_1000004
1830 Ga0157325_1000014
1831 Ga0157321_1000002
1832 Ga0157343_1000372
1833 Ga0157329_1000021
1834 Ga0157335_1000144
1835 Ga0157341_1000002
1836 Ga0157323_1000014
1837 Ga0157323_1000684
1838 Ga0157319_1000095
1839 Ga0157345_1000179
1840 Ga0157314_1001081
1841 Ga0157347_1000046
1842 Ga0157347_1001475
1843 Ga0157313_1000028
1844 Ga0157339_1000005
1845 Ga0157324_1000076
1846 Ga0157324_1000434
1847 Ga0157342_1000006
1848 Ga0157342_1000434
1849 Ga0157315_1000045
1850 Ga0157316_1000008
1851 Ga0157316_1000357
1852 Ga0157327_1000217
1853 Ga0157326_1000754
1854 Ga0157338_1000017
1855 Ga0157373_10086833
1856 Ga0157371_10004568
1857 Ga0157371_10005345
1858 Ga0157371_10067534
1859 Ga0157371_10222016
1860 Ga0157369_10166201
1861 Ga0157369_10249206
1862 Ga0157374_10000398
1863 Ga0157374_10007509
1864 Ga0157374_10051982
1865 Ga0157374_10168813
1866 Ga0157378_10000761
1867 Ga0157378_10000881
1868 Ga0157378_10001985
1869 Ga0157378_10006088
1870 Ga0157378_10010145
1871 Ga0157378_10054015
1872 Ga0157378_10329783
1873 Ga0157378_10433981
1874 Ga0163162_10006670
1875 Ga0157372_10017856
1876 Ga0157372_10021602
1877 Ga0157372_10030750
1878 Ga0157372_10151217
1879 Ga0157375_10003325
1880 Ga0157375_10103839
1881 Ga0157375_10249537
1882 Ga0163163_10257687
1883 Ga0157380_10033644
1884 Ga0157380_10161198
1885 Ga0182008_10009590
1886 Ga0182008_10009908
1887 Ga0182008_10034459
1888 Ga0182008_10040973
1889 Ga0182008_10087113
1890 Ga0157377_10001147
1891 Ga0157377_10007364
1892 Ga0157377_10011782
1893 Ga0157377_10027829
1894 Ga0157377_10188242
1895 Ga0157377_10204069
1896 Ga0157379_10067472
1897 Ga0157379_10133110
1898 Ga0157376_10006283
1899 Ga0157376_10126185
1900 Ga0157376_10300208
1901 Ga0157376_10338914
1902 Ga0182006_1027831
1903 Ga0163161_10003494
1904 Ga0197907_10034451
1905 Ga0197907_10607682
1906 Ga0206356_10500690
1907 Ga0206351_10347377
1908 Ga0206352_10400749
1909 Ga0206350_10223576
1910 Ga0206354_11306581
1911 Ga0154015_1270599
1912 Ga0224712_10100097
1913 Ga0207673_1003623
1914 Ga0207697_10000182
1915 Ga0207697_10006369
1916 Ga0207653_10011067
1917 Ga0207682_10013270
1918 Ga0207682_10020924
1919 Ga0207692_10002950
1920 Ga0207642_10116968
1921 Ga0207688_10000151
1922 Ga0207688_10008768
1923 Ga0207688_10016312
1924 Ga0207688_10026459
1925 Ga0207688_10176027
1926 Ga0207647_10003845
1927 Ga0207647_10038685
1928 Ga0207647_10126622
1929 Ga0207685_10003090
1930 Ga0207685_10024546
1931 Ga0207699_10001845
1932 Ga0207699_10002196
1933 Ga0207699_10226705
1934 Ga0207645_10000724
1935 Ga0207645_10002427
1936 Ga0207645_10004235
1937 Ga0207645_10005889
1938 Ga0207645_10013535
1939 Ga0207645_10015469
1940 Ga0207643_10000552
1941 Ga0207643_10000687
1942 Ga0207643_10002217
1943 Ga0207643_10010025
1944 Ga0207643_10012184
1945 Ga0207643_10037648
1946 Ga0207707_10042740
1947 Ga0207707_10088581
1948 Ga0207707_10199705
1949 Ga0207671_10063726
1950 Ga0207671_10106103
1951 Ga0207693_10000345
1952 Ga0207693_10005356
1953 Ga0207693_10035589
1954 Ga0207693_10099212
1955 Ga0207663_10000208
1956 Ga0207663_10000289
1957 Ga0207663_10006734
1958 Ga0207663_10007884
1959 Ga0207663_10008906
1960 Ga0207663_10017183
1961 Ga0207660_10005278
1962 Ga0207660_10063500
1963 Ga0207660_10072806
1964 Ga0207660_10118884
1965 Ga0207660_10141572
1966 Ga0207662_10000174
1967 Ga0207662_10001402
1968 Ga0207662_10009321
1969 Ga0207657_10041772
1970 Ga0207649_10024941
1971 Ga0207649_10034181
1972 Ga0207646_10009718
1973 Ga0207681_10000728
1974 Ga0207681_10002752
1975 Ga0207681_10012424
1976 Ga0207650_10011000
1977 Ga0207650_10033482
1978 Ga0207650_10069475
1979 Ga0207659_10000561
1980 Ga0207659_10066443
1981 Ga0207659_10232813
1982 Ga0207700_10014964
1983 Ga0207700_10192490
1984 Ga0207664_10040361
1985 Ga0207664_10114216
1986 Ga0207664_10126752
1987 Ga0207690_10082413
1988 Ga0207690_10121509
1989 Ga0207690_10207407
1990 Ga0207706_10000979
1991 Ga0207706_10011558
1992 Ga0207706_10012661
1993 Ga0207706_10232988
1994 Ga0207686_10097151
1995 Ga0207669_10053093
1996 Ga0207704_10001275
1997 Ga0207704_10012836
1998 Ga0207704_10077757
1999 Ga0207704_10096939
2000 Ga0207704_10112553
2001 Ga0207665_10000151
2002 Ga0207665_10001902
2003 Ga0207665_10003049
2004 Ga0207691_10001719
2005 Ga0207691_10012809
2006 Ga0207691_10093847
2007 Ga0207689_10000710
2008 Ga0207689_10001268
2009 Ga0207689_10006339
2010 Ga0207689_10014680
2011 Ga0207661_10015780
2012 Ga0207661_10090262
2013 Ga0207661_10217427
2014 Ga0207679_10007744
2015 Ga0207679_10062217
2016 Ga0207679_10075252
2017 Ga0207679_10442035
2018 Ga0207651_10018000
2019 Ga0207651_10371787
2020 Ga0207712_10003114
2021 Ga0207712_10114906
2022 Ga0207712_10122437
2023 Ga0207668_10003438
2024 Ga0207640_10010366
2025 Ga0207658_10021666
2026 Ga0207658_10039017
2027 Ga0207677_10000611
2028 Ga0207677_10018350
2029 Ga0207677_10117642
2030 Ga0207708_10000406
2031 Ga0207708_10001636
2032 Ga0207708_10031498
2033 Ga0207708_10035168
2034 Ga0207708_10088846
2035 Ga0207708_10096511
2036 Ga0207708_10174862
2037 Ga0207708_10229302
2038 Ga0207708_10229769
2039 Ga0207708_10311887
2040 Ga0207702_10021903
2041 Ga0207702_10121822
2042 Ga0207648_10002145
2043 Ga0207648_10002982
2044 Ga0207648_10004606
2045 Ga0207648_10005952
2046 Ga0207648_10006812
2047 Ga0207648_10006842
2048 Ga0207648_10067141
2049 Ga0207648_10356416
2050 Ga0207676_10017668
2051 Ga0207676_10081455
2052 Ga0207676_10181494
2053 Ga0207676_10244350
2054 Ga0207674_10045126
2055 Ga0207674_10059348
2056 Ga0207674_10153917
2057 Ga0207675_100037209
2058 Ga0207675_100060306
2059 Ga0207683_10072636
2060 Ga0207683_10201308
2061 Ga0207683_10247931
2062 Ga0207683_10255222
2063 Ga0207698_10029513
2064 Ga0207698_10293086
2065 Ga0209973_1000122
2066 Ga0209973_1000307
2067 Ga0209969_1000038
2068 Ga0209969_1001045
2069 Ga0209969_1003890
2070 Ga0209967_1000009
2071 Ga0209967_1000881
2072 Ga0209967_1002373
2073 Ga0209981_1000090
2074 Ga0209981_1001413
2075 Ga0209996_1000069
2076 Ga0209996_1000424
2077 Ga0209984_1000004
2078 Ga0209984_1000045
2079 Ga0210000_1000178
2080 Ga0210000_1000553
2081 Ga0209995_1000014
2082 Ga0209968_1000500
2083 Ga0209968_1001420
2084 Ga0209999_1000554
2085 Ga0209982_1000088
2086 Ga0209982_1001818
2087 Ga0209982_1011782
2088 Ga0209970_1000037
2089 Ga0209970_1000331
2090 Ga0209970_1001411
2091 Ga0210002_1000080
2092 Ga0210002_1001077
2093 Ga0210002_1002599
2094 Ga0210002_1013972
2095 Ga0209983_1000602
2096 Ga0209983_1008533
2097 Ga0209971_1011498
2098 Ga0209971_1018355
2099 Ga0209966_1000157
2100 Ga0209966_1000558
2101 Ga0209998_10000258
2102 Ga0209998_10000656
2103 Ga0209998_10023905
2104 Ga0209974_10000630
2105 Ga0209974_10001895
2106 Ga0209974_10007416
2107 Ga0209974_10008387
2108 Ga0207428_10000088
2109 Ga0207428_10000166
2110 Ga0207428_10000210
2111 Ga0207428_10000225
2112 Ga0207428_10000366
2113 Ga0207428_10001197
2114 Ga0207428_10005155
2115 Ga0207428_10006598
2116 Ga0207428_10013032
2117 Ga0207428_10024792
2118 Ga0207428_10171653
2119 Ga0268265_10007760
2120 Ga0268265_10014246
2121 Ga0268264_10004630
2122 Ga0268264_10035429
2123 Ga0307408_100006175
2124 Ga0307408_100018304
2125 Ga0307408_100384098
2126 Ga0316575_10002527
2127 Ga0307405_10010980
2128 Ga0307405_10018343
2129 Ga0307413_10008343
2130 Ga0307413_10108751
2131 Ga0307410_10000131
2132 Ga0307410_10031419
2133 Ga0307407_10000340
2134 Ga0307407_10024665
2135 Ga0307407_10051287
2136 Ga0307412_10085752
2137 Ga0307409_100001268
2138 Ga0307409_100031111
2139 Ga0307409_100062685
2140 Ga0307409_100111598
2141 Ga0307409_100123168
2142 Ga0307409_100323821
2143 Ga0307416_100047707
2144 Ga0307416_100109625
2145 Ga0307414_10004825
2146 Ga0307414_10013683
2147 Ga0307411_10005909
2148 Ga0307411_10016355
2149 Ga0307411_10080233
2150 Ga0307411_10137966
2151 Ga0307415_100000601
2152 Ga0307415_100026356
2153 Ga0307415_100036326
2154 Ga0373934_0027356
2155 Ga0373940_0046383
2156 Ga0373949_0006410
2157 Ga0373949_0011763
2158 Ga0373936_0029043
2159 Ga0373939_0001743
2160 Ga0373939_0003451
2161 Ga0373939_0059514
2162 Ga0373953_0000231
2163 Ga0373953_0001350
2164 Ga0373954_0010366
2165 Ga0373954_0011658
2166 Ga0373956_0000998
2167 Ga0373957_0003649
2168 Ga0373960_0001493
2169 Ga0373960_0014604
2170 Ga0373946_0107064
2171 Ga0373955_0000483
2172 Ga0373955_0000868
2173 Ga0373942_0002907
2174 Ga0373961_0000369
2175 Ga0373961_0011853
2176 Ga0373961_0017254
2177 Ga0373961_0020856
2178 Ga0373962_0019989
2179 Ga0316574_0015535
2180 Ga0373924_0005821
2181 Ga0373931_0001363
2182 Ga0373931_0038282
2183 Ga0373935_0135710
2184 Ga0373933_0000214
2185 Ga0373933_0001906
2186 Ga0373947_0200177
2187 Ga0373947_0245764
2188 Ga0373937_0000286
2189 Ga0373937_0000348
2190 Ga0373925_0165219
2191 Ga0242419_001428
2192 Ga0242420_000905
2193 Ga0242420_002115
2194 Ga0242420_008242
2195 Ga0436365_1341075
2196 Ga0436361_0774597
2197 Ga0436362_0163595
2198 Ga0439439_0012360
2199 Ga0439453_0001286
2200 Ga0439461_0004139
2201 Ga0439461_0005027
2202 Ga0439437_000122
2203 Ga0439441_000046
2204 Ga0439443_009800
2205 Ga0439448_0053986
2206 Ga0439450_001133
2207 Ga0439450_001957
2208 Ga0439451_006479
2209 Ga0439452_005851
2210 Ga0439452_038850
2211 Ga0439455_0002582
2212 Ga0439456_001014
2213 Ga0439463_001763
2214 Ga0450923_000131
2215 Ga0450923_003151
2216 Ga0450888_004357
2217 Ga0450890_007727
2218 Ga0450906_000143
2219 Ga0439446_0006522
2220 Ga0439434_0018955
2221 Ga0439434_0021382
2222 Ga0439435_0000428
2223 Ga0439435_0043912
2224 Ga0439444_0001138
2225 Ga0439444_0010230
2226 Ga0439464_0000675
2227 Ga0439464_0022930
2228 Ga0439460_0005538
2229 Ga0439460_0011404
2230 Ga0450893_0001278
2231 Ga0451577_0164115
2232 Ga0439440_0003976
2233 Ga0439440_0031428
2234 Ga0453683_0205549
2235 Ga0453684_0023417
2236 Ga0453684_0046624
2237 Ga0451576_0009155
2238 Ga0451576_0113787
2239 Ga0466967_0326602
2240 Ga0495592_0004517
2241 Ga0495592_0018809
2242 Ga0495651_0000164
2243 Ga0495653_0015374
2244 Ga0495608_0036652
2245 Ga0495628_0015015
2246 Ga0495652_0003091
2247 Ga0495652_0133305
2248 Ga0495587_0000551
2249 Ga0495587_0057228
2250 Ga0495645_0017653
2251 Ga0495667_0005976
2252 Ga0495667_0006078
2253 Ga0495656_0082158
2254 Ga0495659_0049343
2255 Ga0495657_0076786
2256 Ga0495599_0001155
2257 Ga0495623_0038719
2258 Ga0495623_0076941
2259 Ga0495646_0006407
2260 Ga0495646_0010834
2261 Ga0495613_0246889
2262 Ga0495600_0023215
2263 Ga0495600_0048181
2264 Ga0495604_0010964
2265 Ga0495604_0011775
2266 Ga0495674_0119809
2267 Ga0495680_0052772
2268 Ga0495675_0041590
2269 Ga0495602_0000149
2270 Ga0495602_0000254
2271 Ga0496100_0030173
2272 Ga0496100_0032564
2273 Ga0496100_0143804
2274 Ga0496101_0143789
2275 Ga0496102_0004939
2276 Ga0496102_0110846
2277 Ga0496102_0154298
2278 Ga0496102_0285702
2279 Ga0496103_0029586
2280 Ga0496104_0018137
2281 Ga0496104_0488405
2282 Ga0496106_0005999
2283 Ga0496106_0008770
2284 Ga0496106_0047289
2285 Ga0496106_0064137
2286 Ga0496106_0080180
2287 Ga0496106_0169778
2288 Ga0496106_0298636
2289 Ga0496106_0312055
2290 Ga0496107_0085392
2291 Ga0496108_0036407
2292 Ga0496108_0121097
2293 Ga0496109_0091670
2294 Ga0496111_0006149
2295 Ga0496113_0073812
2296 Ga0496114_0246779
2297 Ga0496114_0265913
2298 Ga0496114_0290922
2299 Ga0501306_006546
2300 Ga0501308_004370
2301 Ga0501309_009207
2302 Ga0501310_004697
2303 Ga0501305_015414
2304 Ga0501307_009294
2305 Ga0501290_000697
2306 Ga0501291_000395
2307 Ga0501291_002008
2308 Ga0501291_005215
2309 Ga0501292_000259
2310 Ga0501293_000043
2311 Ga0501294_001037
2312 Ga0501295_001128
2313 Ga0501295_002106
2314 Ga0501296_001755
2315 Ga0501297_000523
2316 Ga0501297_003519
2317 Ga0501298_000560
2318 Ga0501298_001533
2319 Ga0501299_000205
2320 Ga0501300_001108
2321 Ga0501300_004132
2322 Ga0501311_007612
2323 Ga0501321_003110
2324 Ga0501323_007152
2325 Ga0501324_003091
2326 Ga0501325_001966
2327 Ga0501327_00625
2328 Ga0501031_0002492
2329 Ga0501031_0015824
2330 Ga0501031_0028577
2331 Ga0501031_0029992
2332 Ga0501031_0036874
2333 Ga0501031_0076308
2334 Ga0501031_0084854
2335 Ga0501031_0101879
2336 Ga0501031_0238828
2337 Ga0501032_0005578
2338 Ga0501032_0007837
2339 Ga0501032_0016992
2340 Ga0501032_0030798
2341 Ga0501032_0060562
2342 Ga0501032_0256466
2343 Ga0501033_0003203
2344 Ga0501033_0029347
2345 Ga0501033_0040244
2346 Ga0501033_0049154
2347 Ga0501033_0097411
2348 Ga0501033_0237066
2349 Ga0501034_0004680
2350 Ga0501034_0483645
2351 Ga0501036_0002476
2352 Ga0501036_0004575
2353 Ga0501036_0004615
2354 Ga0501036_0006456
2355 Ga0501036_0018609
2356 Ga0501036_0021048
2357 Ga0501036_0026243
2358 Ga0501036_0033485
2359 Ga0501036_0040415
2360 Ga0501036_0078384
2361 Ga0501036_0092255
2362 Ga0501036_0097466
2363 Ga0501037_0004069
2364 Ga0501037_0017128
2365 Ga0501037_0017833
2366 Ga0501037_0018023
2367 Ga0501037_0020982
2368 Ga0501037_0086344
2369 Ga0501037_0104790
2370 Ga0501037_0205825
2371 Ga0501037_0287984
2372 Ga0501038_0000836
2373 Ga0501038_0025456
2374 Ga0501038_0052702
2375 Ga0501038_0060743
2376 Ga0501038_0099127
2377 Ga0501038_0178340
2378 Ga0501038_0233148
2379 Ga0501038_0247124
2380 Ga0501039_0000893
2381 Ga0501039_0002204
2382 Ga0501039_0004145
2383 Ga0501039_0004679
2384 Ga0501039_0006115
2385 Ga0501039_0011768
2386 Ga0501039_0016065
2387 Ga0501039_0023115
2388 Ga0501039_0034468
2389 Ga0501039_0059872
2390 Ga0501039_0107620
2391 Ga0501039_0124246
2392 Ga0501039_0148190
2393 Ga0501039_0262910
2394 Ga0501040_0000386
2395 Ga0501040_0000419
2396 Ga0501040_0002143
2397 Ga0501040_0002780
2398 Ga0501040_0002813
2399 Ga0501040_0004072
2400 Ga0501040_0005902
2401 Ga0501040_0013493
2402 Ga0501040_0024132
2403 Ga0501040_0044328
2404 Ga0501040_0114532
2405 Ga0501040_0131009
2406 Ga0501040_0163793
2407 Ga0501041_0000026
2408 Ga0501041_0001406
2409 Ga0501041_0002199
2410 Ga0501041_0006204
2411 Ga0501041_0012077
2412 Ga0501041_0016900
2413 Ga0501041_0017861
2414 Ga0501041_0029400
2415 Ga0501041_0031282
2416 Ga0501041_0041445
2417 Ga0501041_0062409
2418 Ga0501041_0192291
2419 Ga0501041_0227650
2420 Ga0501042_0001002
2421 Ga0501042_0003153
2422 Ga0501042_0004992
2423 Ga0501042_0004999
2424 Ga0501042_0008707
2425 Ga0501042_0011777
2426 Ga0501042_0021541
2427 Ga0501042_0033190
2428 Ga0501042_0035180
2429 Ga0501042_0037009
2430 Ga0501042_0037634
2431 Ga0501042_0059193
2432 Ga0501042_0091904
2433 Ga0501042_0117087
2434 Ga0501042_0120588
2435 Ga0501042_0196471
2436 Ga0501043_0003127
2437 Ga0501043_0009635
2438 Ga0501043_0009948
2439 Ga0501043_0017205
2440 Ga0501043_0042197
2441 Ga0501043_0054760
2442 Ga0501043_0254087
2443 Ga0501046_0008285
2444 Ga0501046_0008918
2445 Ga0501046_0009736
2446 Ga0501046_0015828
2447 Ga0501046_0017967
2448 Ga0501046_0064045
2449 Ga0501046_0065485
2450 Ga0501046_0117402
2451 Ga0501046_0170556
2452 Ga0501047_0019879
2453 Ga0501047_0123216
2454 Ga0501048_0000540
2455 Ga0501048_0000657
2456 Ga0501048_0003597
2457 Ga0501048_0005474
2458 Ga0501048_0007631
2459 Ga0501048_0014548
2460 Ga0501048_0016470
2461 Ga0501048_0049402
2462 Ga0501048_0057674
2463 Ga0501048_0078674
2464 Ga0501048_0110966
2465 Ga0501048_0145130
2466 Ga0501048_0152553
2467 Ga0501067_0091399
2468 Ga0501068_0001143
2469 Ga0501068_0190611
2470 Ga0501069_0058893
2471 Ga0501069_0078086
2472 Ga0501069_0126652
2473 Ga0501070_0204936
2474 Ga0501070_0233338
2475 Ga0501070_0246387
2476 Ga0501070_0379391
2477 Ga0501071_0000112
2478 Ga0501071_0000544
2479 Ga0501071_0001251
2480 Ga0501071_0003955
2481 Ga0501071_0007341
2482 Ga0501071_0009530
2483 Ga0501071_0014947
2484 Ga0501071_0017450
2485 Ga0501071_0023844
2486 Ga0501071_0051923
2487 Ga0501071_0064501
2488 Ga0501071_0067653
2489 Ga0501071_0095169
2490 Ga0501071_0253479
2491 Ga0501071_0277096
2492 Ga0501071_0291844
2493 Ga0501072_0000372
2494 Ga0501072_0000621
2495 Ga0501072_0000825
2496 Ga0501072_0004343
2497 Ga0501072_0004506
2498 Ga0501072_0020968
2499 Ga0501072_0028479
2500 Ga0501072_0042817
2501 Ga0501072_0043668
2502 Ga0501072_0044348
2503 Ga0501072_0082424
2504 Ga0501072_0121907
2505 Ga0501072_0138618
2506 Ga0501072_0270836
2507 Ga0501072_0275200
2508 Ga0501073_0012081
2509 Ga0501073_0145172
2510 Ga0501073_0203935
2511 Ga0501073_0223713
2512 Ga0501074_0002126
2513 Ga0501074_0018734
2514 Ga0501074_0029646
2515 Ga0501074_0049371
2516 Ga0501074_0079724
2517 Ga0501074_0083427
2518 Ga0501074_0172248
2519 Ga0501075_0000958
2520 Ga0501075_0004348
2521 Ga0501075_0004803
2522 Ga0501075_0004854
2523 Ga0501075_0008384
2524 Ga0501075_0010778
2525 Ga0501075_0011640
2526 Ga0501075_0017052
2527 Ga0501075_0025001
2528 Ga0501075_0030978
2529 Ga0501075_0031770
2530 Ga0501075_0043052
2531 Ga0501075_0050801
2532 Ga0501075_0088170
2533 Ga0501075_0116067
2534 Ga0501075_0250973
2535 Ga0501076_0000721
2536 Ga0501076_0001201
2537 Ga0501076_0003036
2538 Ga0501076_0003497
2539 Ga0501076_0005003
2540 Ga0501076_0007966
2541 Ga0501076_0013542
2542 Ga0501076_0016764
2543 Ga0501076_0017783
2544 Ga0501076_0037772
2545 Ga0501076_0048312
2546 Ga0501076_0048560
2547 Ga0501076_0070983
2548 Ga0501076_0079396
2549 Ga0501076_0123651
2550 Ga0501076_0131276
2551 Ga0501076_0137650
2552 Ga0501076_0138744
2553 Ga0501076_0170029
2554 Ga0501076_0174505
2555 Ga0501077_0000883
2556 Ga0501077_0003279
2557 Ga0501077_0003669
2558 Ga0501077_0015143
2559 Ga0501077_0017053
2560 Ga0501077_0032160
2561 Ga0501077_0039486
2562 Ga0501077_0053024
2563 Ga0501077_0068510
2564 Ga0501077_0094335
2565 Ga0501077_0111592
2566 Ga0501077_0120087
2567 Ga0501077_0157608
2568 Ga0501198_000243
2569 Ga0501199_000133
2570 Ga0501199_002738
2571 Ga0501201_000792
2572 Ga0501202_000087
2573 Ga0501202_003700
2574 Ga0501202_010328
2575 Ga0501202_015859
2576 Ga0501206_000029
2577 Ga0501207_000265
2578 Ga0501207_002557
2579 Ga0501208_000051
2580 Ga0501209_000077
2581 Ga0501209_008560
2582 Ga0501209_010862
2583 Ga0501211_000744
2584 Ga0501214_000033
2585 Ga0501216_000169
2586 Ga0501217_000234
2587 Ga0501217_019878
2588 Ga0501217_022596
2589 Ga0501222_003412
2590 Ga0501223_003152
2591 Ga0501224_000331
2592 Ga0501227_000080
2593 Ga0501227_044706
2594 Ga0501228_000036
2595 Ga0501230_000517
2596 Ga0501233_000226
2597 Ga0501235_000320
2598 Ga0501238_002119
2599 Ga0501239_003509
2600 Ga0501242_000117
2601 Ga0501243_000077
2602 Ga0501243_002760
2603 Ga0501243_004776
2604 Ga0501243_013641
2605 Ga0501243_015727
2606 Ga0501246_002750
2607 Ga0501247_001269
2608 Ga0501248_001238
2609 Ga0501249_012602
2610 Ga0501251_000072
2611 Ga0501252_000670
2612 Ga0501253_000060
2613 Ga0501255_000161
2614 Ga0501257_021280
2615 Ga0501259_001003
2616 Ga0501260_000665
2617 Ga0501261_000403
2618 Ga0501219_001796
2619 Ga0501221_001089
2620 Ga0501225_0000341
2621 Ga0501225_0011189
2622 Ga0501229_000781
2623 Ga0501234_000097
2624 Ga0501245_000062
2625 Ga0501079_0001519
2626 Ga0501079_0002003
2627 Ga0501079_0003062
2628 Ga0501079_0003557
2629 Ga0501079_0005072
2630 Ga0501079_0005238
2631 Ga0501079_0010437
2632 Ga0501079_0011223
2633 Ga0501079_0074919
2634 Ga0501079_0115107
2635 Ga0501079_0125493
2636 Ga0501079_0275381
2637 Ga0501080_0003695
2638 Ga0501080_0005827
2639 Ga0501080_0006679
2640 Ga0501080_0006753
2641 Ga0501080_0009565
2642 Ga0501080_0025576
2643 Ga0501080_0071867
2644 Ga0501080_0154203
2645 Ga0501080_0207944
2646 Ga0501081_0000024
2647 Ga0501081_0001209
2648 Ga0501081_0003817
2649 Ga0501081_0006862
2650 Ga0501081_0008921
2651 Ga0501081_0010039
2652 Ga0501081_0010248
2653 Ga0501081_0028683
2654 Ga0501081_0048974
2655 Ga0501081_0054413
2656 Ga0501081_0123935
2657 Ga0501081_0163115
2658 Ga0501081_0211491
2659 Ga0501083_0042263
2660 Ga0501083_0069384
2661 Ga0501083_0138489
2662 Ga0501232_000020
2663 Ga0501241_003411
2664 Ga0501265_000127
2665 Ga0501267_003709
2666 Ga0501268_009466
2667 Ga0501270_000590
2668 Ga0501271_000211
2669 Ga0501271_004398
2670 Ga0501274_000166
2671 Ga0501275_000389
2672 Ga0501276_000086
2673 Ga0501278_000156
2674 Ga0501279_000138
2675 Ga0501279_002994
2676 Ga0501280_001754
2677 Ga0501282_001287
2678 Ga0501283_000208
2679 Ga0501035_0009232
2680 Ga0501035_0014241
2681 Ga0501035_0017908
2682 Ga0501035_0021955
2683 Ga0501035_0092452
2684 Ga0501035_0241548
2685 Ga0501044_0004369
2686 Ga0501044_0059758
2687 Ga0501044_0147791
2688 Ga0501044_0270985
2689 Ga0501045_0000368
2690 Ga0501045_0000728
2691 Ga0501045_0000863
2692 Ga0501045_0001561
2693 Ga0501045_0001765
2694 Ga0501045_0002293
2695 Ga0501045_0007175
2696 Ga0501045_0018257
2697 Ga0501045_0041376
2698 Ga0501045_0046345
2699 Ga0501045_0059126
2700 Ga0501045_0077961
2701 Ga0501045_0105305
2702 Ga0501045_0313288
2703 Ga0501204_000069
2704 Ga0501212_000632
2705 nmdc:mga05p37_11861_c1
2706 nmdc:mga05p37_16949_c1
2707 nmdc:mga05p37_174379_c1
2708 nmdc:mga05p37_218547_c1
2709 nmdc:mga05p37_27736_c1
2710 nmdc:mga05p37_301927_c1
2711 nmdc:mga05p37_34947_c1
2712 nmdc:mga05p37_3755_c1
2713 nmdc:mga05p37_396024_c1
2714 nmdc:mga05p37_443096_c1
2715 nmdc:mga05p37_47300_c1
2716 nmdc:mga05p37_516989_c1
2717 nmdc:mga05p37_54341_c1
2718 nmdc:mga05p37_88117_c1
2719 nmdc:mga09592_130759_c1
2720 nmdc:mga09592_132227_c1
2721 nmdc:mga09592_14000_c1
2722 nmdc:mga09592_171078_c1
2723 nmdc:mga09592_1748_c1
2724 nmdc:mga09592_20970_c1
2725 nmdc:mga09592_252560_c1
2726 nmdc:mga09592_261157_c1
2727 nmdc:mga09592_3905_c1
2728 nmdc:mga09592_75667_c1
2729 nmdc:mga0qj67_15975_c1
2730 nmdc:mga0qj67_189842_c1
2731 nmdc:mga0qj67_2175_c1
2732 nmdc:mga0qj67_281220_c1
2733 nmdc:mga0qj67_367961_c1
2734 nmdc:mga0qj67_442_c1
2735 nmdc:mga0qj67_6478_c1
2736 nmdc:mga06r32_113034_c1
2737 nmdc:mga06r32_123268_c1
2738 nmdc:mga06r32_130632_c1
2739 nmdc:mga06r32_14515_c1
2740 nmdc:mga06r32_152348_c1
2741 nmdc:mga06r32_184560_c1
2742 nmdc:mga06r32_275177_c1
2743 nmdc:mga06r32_28089_c1
2744 nmdc:mga06r32_29341_c1
2745 nmdc:mga06r32_342088_c1
2746 nmdc:mga06r32_752_c1
2747 nmdc:mga08y16_113_c1
2748 nmdc:mga08y16_132199_c1
2749 nmdc:mga08y16_18022_c1
2750 nmdc:mga08y16_18885_c1
2751 nmdc:mga08y16_18911_c1
2752 nmdc:mga08y16_270173_c1
2753 nmdc:mga08y16_2805_c1
2754 nmdc:mga08y16_305659_c1
2755 nmdc:mga08y16_34551_c1
2756 nmdc:mga08y16_3798_c1
2757 nmdc:mga08y16_61256_c1
2758 nmdc:mga08y16_923_c1
2759 nmdc:mga0n895_10176_c1
2760 nmdc:mga0n895_107101_c1
2761 nmdc:mga0n895_114215_c1
2762 nmdc:mga0n895_170395_c1
2763 nmdc:mga0n895_186467_c1
2764 nmdc:mga0n895_197644_c1
2765 nmdc:mga0n895_23331_c1
2766 nmdc:mga0n895_315351_c1
2767 nmdc:mga0n895_39636_c1
2768 nmdc:mga0n895_398179_c1
2769 nmdc:mga0n895_5_c2
2770 nmdc:mga0rr50_23312_c1
2771 nmdc:mga0rr50_262_c1
2772 nmdc:mga0rr50_40196_c1
2773 nmdc:mga0rr50_72332_c1
2774 nmdc:mga08x19_20899_c1
2775 nmdc:mga08x19_58974_c1
2776 nmdc:mga08x19_86621_c1
2777 nmdc:mga0a205_144285_c1
2778 nmdc:mga0a205_205312_c1
2779 nmdc:mga0a205_2693_c1
2780 nmdc:mga0a205_4186_c1
2781 nmdc:mga0a205_49585_c1
2782 nmdc:mga0a205_9532_c1
2783 Ga0495612_0114496
2784 Ga0495619_0000162
2785 Ga0501084_0000881
2786 Ga0501084_0001420
2787 Ga0501084_0002713
2788 Ga0501084_0006020
2789 Ga0501084_0011192
2790 Ga0501084_0019039
2791 Ga0501084_0019789
2792 Ga0501084_0045788
2793 Ga0501084_0053056
2794 Ga0501084_0053580
2795 Ga0501084_0061222
2796 Ga0501084_0067319
2797 Ga0501084_0131708
2798 Ga0501084_0274494
2799 Ga0501084_0383682
2800 Ga0590071_000984
2801 Ga0590075_001782
2802 Ga0590075_003126
2803 Ga0590075_011882
2804 Ga0590077_002187
2805 Ga0587066_005565
2806 Ga0587070_007024
2807 Ga0587073_0003865
2808 Ga0587073_0023035
2809 Ga0587082_000776
2810 Ga0587067_015204
2811 Ga0587069_000741
2812 Ga0587075_001336
2813 Ga0587075_005130
2814 Ga0587076_001323
2815 Ga0587076_019527
2816 Ga0587071_004678
2817 Ga0501082_0006300
2818 Ga0501082_0006719
2819 Ga0501082_0012116
2820 Ga0501082_0014761
2821 Ga0501082_0018166
2822 Ga0501082_0021853
2823 Ga0501082_0033736
2824 Ga0501082_0042101
2825 Ga0501082_0050226
2826 Ga0501082_0061343
2827 Ga0501082_0077277
2828 Ga0501082_0206969
2829 Ga0501082_0255069
2830 Ga0530510_0001848
2831 Ga0530510_0004575
2832 Ga0530510_0005636
2833 Ga0530510_0015871
2834 Ga0530510_0016377
2835 Ga0530510_0019716
2836 Ga0530510_0025965
2837 Ga0530510_0048656
2838 Ga0530510_0064507
2839 Ga0530510_0065030
2840 Ga0530510_0072999
2841 Ga0530510_0094051
2842 Ga0530510_0106429
2843 Ga0530510_0122548
2844 Ga0530510_0147406

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

215

343

0.95

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

61

174

0.93

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

247

376

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9131 1 328
4a0s-assembly1.cif.gz_D structure of the 2-octenoyl-coa carboxylase reductase cinf in complex with nadp and 2-octenoyl-coa 0.9093 2 328
5k1s-assembly2.cif.gz_C crystal structure of aibc 0.9059 2 328
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9043 2 329
3krt-assembly1.cif.gz_D crystal structure of putative crotonyl coa reductase from streptomyces coelicolor a3(2) 0.9033 2 328
ID Description Score Start End Superfamily
af_Q869N7_2_119_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9469 1 128 3.90.180.10
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 137 277 3.40.50.720
af_O74489_2_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9416 2 128 3.90.180.10
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9383 137 275 3.40.50.720
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 140 276 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9S5C6-F1-model_v4 Alcohol dehydrogenase 0.9709 129 328 GO:0016491
AF-A0A6B1FE41-F1-model_v4 Zinc-binding dehydrogenase 0.9667 114 329 GO:0016491
AF-X0UTV7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9637 114 329 GO:0016491
AF-A0A2V9S5C6-F1-model_v4 Alcohol dehydrogenase 0.9615 129 328 GO:0016491
AF-A0A3L7X112-F1-model_v4 Quinone oxidoreductase 0.9596 1 196 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402

Map