F488956

General Info

Members Datasets Scaffolds Average Seq Length
1046 489 2092 281

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100062404|Ga0075431_1000624045
Length 317
Sequence MAIISNLVFNHSLLVKTNKILLKRNAAYSHNMSTMKYIQLEPQGDIAILRINRPEALNAMNVDVISELSKMLDILAADDSIKAVVITGAGERSFCAGADISYMVNIDPMQAERYATSAQDVINRIDRLEKPVIAAVNGFALGGGCELAMACDIRIASSNAKMGQPEVTIGIPPGWGGTQRLTRLVGPAKAKELIFTGKMITADEAYPIGLVNKVISLGSDDKLPPEAPKGDTVKEKERASEVAKILNKKLMDECIALAKEIAKNSFVAVKVSKKLINRGMDTDLETGLRLEIYGWALCFAHEDRQKMMSAFLNKSKK

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
16 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
17 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
18 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
19 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
20 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
21 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
22 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
23 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
24 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
25 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
26 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
34 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
126 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
127 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
128 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
129 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
130 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
131 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
132 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
133 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
134 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
135 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
136 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
137 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
138 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
139 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
140 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
141 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
142 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
143 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
144 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
145 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
165 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
252 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
267 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
268 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
288 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
291 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
292 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
293 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
294 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
295 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
296 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
297 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
298 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
299 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
300 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
301 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
302 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
303 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
304 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
305 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
306 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
307 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
308 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
309 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
310 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
311 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
312 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
313 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
314 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
315 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
316 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
319 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
354 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
373 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
374 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
375 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
376 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
377 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
406 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
407 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
408 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
409 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
410 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
411 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
412 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
413 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
414 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
415 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
416 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
417 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
418 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
419 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
420 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
421 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
422 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
423 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
424 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
425 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
426 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
427 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
428 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
429 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
430 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
431 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
432 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
433 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
434 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
435 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
436 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
437 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
438 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
439 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
445 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
446 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
447 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
448 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
449 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
450 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
451 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
456 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
459 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
460 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
461 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
462 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
466 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
472 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
473 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
474 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
475 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
476 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
477 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
478 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
479 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
482 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
483 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
484 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
489 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.56
Metatranscriptomes 3.35
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0.1
Rhizoplane 2.2
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100062404 3300006847 Archaea 3845
2 MBSR1b_contig_3938206 2162886012 Archaea 1639
3 2214683817 2209111006 Unclassified 4626
4 ARSoilYngRDRAFT_c00027 3300000042 Archaea 22319
5 ARcpr5yngRDRAFT_c000028 3300000043 Archaea 23901
6 ARSoilOldRDRAFT_c000043 3300000044 Archaea 27479
7 ARCol0oldRDRAFT_c00010 3300000045 Archaea 15395
8 ARCol0yngRDRAFT_1000291 3300000652 Archaea 7775
9 JGI24746J21847_1000879 3300001977 Unclassified 4679
10 JGI24740J21852_10030744 3300001979 Bacteria 1742
11 JGI24739J22299_10000660 3300001989 Archaea 12406
12 JGI24739J22299_10085727 3300001989 Bacteria 963
13 JGI24737J22298_10035484 3300001990 Archaea 1543
14 JGI24033J26618_1002893 3300002155 Archaea 1784
15 JGI24033J26618_1007951 3300002155 Archaea 1214
16 JGI24742J22300_10006365 3300002244 Archaea 1951
17 JGI26129J50193_1000020 3300003349 Archaea 9467
18 JGI26145J50221_1000007 3300003371 Archaea 18227
19 JGI26144J50225_100026 3300003380 Archaea 7179
20 JGI26139J50223_100001 3300003382 Archaea 22196
21 JGI26140J50224_100003 3300003383 Archaea 21201
22 JGI26134J50242_100053 3300003392 Archaea 6325
23 JGI26137J50245_100201 3300003396 Archaea 2639
24 JGI26130J50248_100164 3300003398 Archaea 3323
25 JGI26136J50244_100009 3300003399 Archaea 6998
26 JGI26141J51220_1000079 3300003503 Archaea 4394
27 JGI26138J51218_100001 3300003504 Archaea 15563
28 Ga0007417J51691_1047715 3300003544 Bacteria 934
29 Ga0007410J51695_1034200 3300003574 Bacteria 1000
30 Ga0007429J51699_1088431 3300003579 Bacteria 930
31 Ga0032354_1010548 3300003693 Bacteria 1040
32 JGI25405J52794_10000256 3300003911 Archaea 7097
33 Ga0058861_10064932 3300004800 Unclassified 2205
34 Ga0058862_10131613 3300004803 Archaea 4502
35 Ga0058862_12692810 3300004803 Unclassified 1292
36 Ga0065717_1000042 3300005276 Archaea 12392
37 Ga0065716_1000050 3300005277 Archaea 8427
38 Ga0065704_10002382 3300005289 Archaea 18401
39 Ga0065704_10008712 3300005289 Archaea 2218
40 Ga0065704_10010785 3300005289 Archaea 2504
41 Ga0065704_10090895 3300005289 Archaea 2757
42 Ga0065712_10000465 3300005290 Archaea 17919
43 Ga0065715_10000262 3300005293 Archaea 57184
44 Ga0065715_10000267 3300005293 Archaea 23865
45 Ga0065715_10002844 3300005293 Archaea 8310
46 Ga0065707_10000622 3300005295 Archaea 24535
47 Ga0070658_10015386 3300005327 Bacteria 6123
48 Ga0070658_10416576 3300005327 Bacteria 1155
49 Ga0070676_10002475 3300005328 Archaea 9465
50 Ga0070676_10006070 3300005328 Archaea 6449
51 Ga0070676_10105476 3300005328 Archaea 1747
52 Ga0070683_100036978 3300005329 Archaea 4467
53 Ga0070683_100164046 3300005329 Unclassified 2108
54 Ga0070683_100429583 3300005329 Bacteria 1260
55 Ga0070670_100007910 3300005331 Archaea 9047
56 Ga0070670_100010069 3300005331 Archaea 8067
57 Ga0070670_100308264 3300005331 Bacteria 1385
58 Ga0068869_100000470 3300005334 Archaea 22288
59 Ga0068869_100013500 3300005334 Archaea 5435
60 Ga0068869_100027468 3300005334 Archaea 3968
61 Ga0070680_100002022 3300005336 Archaea 14962
62 Ga0070680_100060861 3300005336 Archaea 3090
63 Ga0070680_100071782 3300005336 Bacteria 2845
64 Ga0070682_100003748 3300005337 Unclassified 8451
65 Ga0070682_100043310 3300005337 Bacteria 2783
66 Ga0070682_100603339 3300005337 Bacteria 867
67 Ga0068868_100009247 3300005338 Archaea 7083
68 Ga0068868_100009403 3300005338 Archaea 7030
69 Ga0068868_100010690 3300005338 Unclassified 6652
70 Ga0068868_100289348 3300005338 Unclassified 1389
71 Ga0070660_100038011 3300005339 Bacteria 3652
72 Ga0070660_100323698 3300005339 Bacteria 1267
73 Ga0070660_100410706 3300005339 Bacteria 1120
74 Ga0070689_100351182 3300005340 Bacteria 1237
75 Ga0070687_100048107 3300005343 Unclassified 2191
76 Ga0070661_100008612 3300005344 Archaea 7056
77 Ga0070692_10044759 3300005345 Bacteria 2281
78 Ga0070692_10212621 3300005345 Unclassified 1139
79 Ga0070668_100003204 3300005347 Archaea 12055
80 Ga0070668_100051744 3300005347 Archaea 3166
81 Ga0070669_100267988 3300005353 Unclassified 1365
82 Ga0070675_100005051 3300005354 Archaea 10074
83 Ga0070675_100174538 3300005354 Archaea 1855
84 Ga0070674_100032296 3300005356 Archaea 3476
85 Ga0070674_100102281 3300005356 Archaea 2089
86 Ga0070673_100001003 3300005364 Archaea 16012
87 Ga0070673_100107554 3300005364 Unclassified 2307
88 Ga0070673_100151382 3300005364 Archaea 1965
89 Ga0070659_100128135 3300005366 Archaea 2060
90 Ga0070659_100145859 3300005366 Bacteria 1928
91 Ga0070659_100352959 3300005366 Bacteria 1234
92 Ga0070659_100375535 3300005366 Bacteria 1197
93 Ga0070659_100390310 3300005366 Archaea 1174
94 Ga0070709_10006735 3300005434 Archaea 6271
95 Ga0070714_100025498 3300005435 Archaea 4879
96 Ga0070714_100082970 3300005435 Archaea 2793
97 Ga0070710_10024672 3300005437 Archaea 3175
98 Ga0070710_10034001 3300005437 Archaea 2771
99 Ga0070701_10011812 3300005438 Archaea 3921
100 Ga0070701_10024247 3300005438 Archaea 2933
101 Ga0070711_100001153 3300005439 Archaea 14205
102 Ga0070711_100043440 3300005439 Archaea 3044
103 Ga0070711_100068021 3300005439 Unclassified 2501
104 Ga0070705_100002666 3300005440 Archaea 8930
105 Ga0070705_100008454 3300005440 Archaea 5101
106 Ga0070705_100231096 3300005440 Archaea 1287
107 Ga0070700_100027059 3300005441 Archaea 3396
108 Ga0070700_100027408 3300005441 Archaea 3377
109 Ga0070700_100036934 3300005441 Archaea 2967
110 Ga0070700_100300371 3300005441 Archaea 1172
111 Ga0070694_100000011 3300005444 Archaea 89485
112 Ga0070694_100000014 3300005444 Bacteria 84368
113 Ga0070708_100004719 3300005445 Archaea 10738
114 Ga0070708_100038812 3300005445 Bacteria 4163
115 Ga0070708_100299649 3300005445 Archaea 1514
116 Ga0070708_100402327 3300005445 Unclassified 1291
117 Ga0070708_100631731 3300005445 Archaea 1009
118 Ga0070678_100131508 3300005456 Archaea 1989
119 Ga0070678_100463518 3300005456 Bacteria 1112
120 Ga0070662_100002213 3300005457 Archaea 11938
121 Ga0070681_10011002 3300005458 Bacteria 8943
122 Ga0070681_10032868 3300005458 Archaea 5207
123 Ga0070681_10330582 3300005458 Archaea 1434
124 Ga0070681_10405206 3300005458 Unclassified 1275
125 Ga0068867_100002683 3300005459 Archaea 12547
126 Ga0068867_100002794 3300005459 Archaea 12275
127 Ga0070706_100003766 3300005467 Bacteria 14800
128 Ga0070706_100224685 3300005467 Archaea 1753
129 Ga0070707_100010733 3300005468 Bacteria 8532
130 Ga0070707_100012976 3300005468 Archaea 7784
131 Ga0070707_100017794 3300005468 Bacteria 6681
132 Ga0070698_100002987 3300005471 Archaea 18621
133 Ga0070698_100088751 3300005471 Archaea 3076
134 Ga0070698_100297796 3300005471 Archaea 1544
135 Ga0070699_100037988 3300005518 Archaea 4169
136 Ga0070699_100048991 3300005518 Unclassified 3657
137 Ga0070699_100104182 3300005518 Archaea 2488
138 Ga0070679_100000115 3300005530 Bacteria 63346
139 Ga0070679_100051369 3300005530 Bacteria 4106
140 Ga0070684_100030616 3300005535 Archaea 4573
141 Ga0070684_100544383 3300005535 Bacteria 1077
142 Ga0070697_100009494 3300005536 Archaea 7604
143 Ga0070697_100045002 3300005536 Archaea 3576
144 Ga0070697_100301333 3300005536 Unclassified 1378
145 Ga0070672_100001378 3300005543 Archaea 14998
146 Ga0070672_100020700 3300005543 Archaea 4801
147 Ga0070672_100050605 3300005543 Archaea 3237
148 Ga0070686_100005335 3300005544 Archaea 7110
149 Ga0070695_100009282 3300005545 Archaea 5847
150 Ga0070695_100032062 3300005545 Archaea 3283
151 Ga0070695_100065883 3300005545 Archaea 2360
152 Ga0070695_100136523 3300005545 Archaea 1696
153 Ga0070695_100487251 3300005545 Bacteria 951
154 Ga0070696_100000853 3300005546 Archaea 19687
155 Ga0070696_100008890 3300005546 Archaea 6721
156 Ga0070696_100127775 3300005546 Unclassified 1846
157 Ga0070693_100001334 3300005547 Archaea 11098
158 Ga0070693_100011960 3300005547 Unclassified 4381
159 Ga0070693_100127240 3300005547 Bacteria 1588
160 Ga0070693_100148270 3300005547 Bacteria 1483
161 Ga0070704_100012508 3300005549 Archaea 5241
162 Ga0070704_100017373 3300005549 Archaea 4574
163 Ga0070704_100338482 3300005549 Bacteria 1266
164 Ga0068855_100040492 3300005563 Bacteria 5530
165 Ga0070664_100003163 3300005564 Archaea 13302
166 Ga0070664_100249365 3300005564 Archaea 1596
167 Ga0070664_100520167 3300005564 Archaea 1098
168 Ga0068854_100012005 3300005578 Archaea 5661
169 Ga0068854_100081758 3300005578 Archaea 2387
170 Ga0068856_100003600 3300005614 Unclassified 15592
171 Ga0068856_100088375 3300005614 Archaea 3081
172 Ga0070702_100011237 3300005615 Archaea 4447
173 Ga0070702_100016396 3300005615 Archaea 3800
174 Ga0070702_100021476 3300005615 Unclassified 3397
175 Ga0070702_100050224 3300005615 Archaea 2381
176 Ga0070702_100076445 3300005615 Archaea 1993
177 Ga0068852_100022997 3300005616 Bacteria 5009
178 Ga0068852_100274994 3300005616 Bacteria 1622
179 Ga0068859_100050668 3300005617 Archaea 4171
180 Ga0068864_100004153 3300005618 Archaea 11887
181 Ga0068864_100004669 3300005618 Archaea 11239
182 Ga0068864_100038148 3300005618 Archaea 4101
183 Ga0068864_100418281 3300005618 Bacteria 1277
184 Ga0068866_10011043 3300005718 Archaea 3893
185 Ga0068870_10010441 3300005840 Archaea 4269
186 Ga0068870_10040564 3300005840 Unclassified 2414
187 Ga0068870_10256893 3300005840 Bacteria 1085
188 Ga0068860_100008980 3300005843 Archaea 9957
189 Ga0068860_100014847 3300005843 Archaea 7616
190 Ga0068860_100408152 3300005843 Unclassified 1345
191 Ga0068862_100025409 3300005844 Archaea 4972
192 Ga0068862_100061912 3300005844 Archaea 3217
193 Ga0068862_100469196 3300005844 Unclassified 1189
194 Ga0081455_10007199 3300005937 Archaea 11758
195 Ga0081455_10010035 3300005937 Archaea 9672
196 Ga0081538_10000314 3300005981 Archaea 55280
197 Ga0081538_10003117 3300005981 Archaea 15772
198 Ga0081538_10016951 3300005981 Archaea 5557
199 Ga0081538_10076806 3300005981 Bacteria 1802
200 Ga0070717_10242912 3300006028 Archaea 1588
201 Ga0075365_10016836 3300006038 Bacteria 4459
202 Ga0075365_10071206 3300006038 Bacteria 2340
203 Ga0075432_10003737 3300006058 Archaea 5184
204 Ga0075432_10007661 3300006058 Archaea 3683
205 Ga0075432_10040718 3300006058 Unclassified 1622
206 Ga0070715_10002118 3300006163 Archaea 5999
207 Ga0070716_100000060 3300006173 Archaea 42993
208 Ga0070716_100026372 3300006173 Archaea 3111
209 Ga0070712_100025948 3300006175 Archaea 3899
210 Ga0070712_100079924 3300006175 Archaea 2365
211 Ga0070712_100357863 3300006175 Bacteria 1196
212 Ga0097621_100009133 3300006237 Archaea 7184
213 Ga0097621_100254868 3300006237 Archaea 1538
214 Ga0068871_100053767 3300006358 Archaea 3265
215 Ga0068871_100065952 3300006358 Archaea 2967
216 Ga0068871_100093872 3300006358 Bacteria 2504
217 Ga0075428_100001101 3300006844 Archaea 28779
218 Ga0075428_100005532 3300006844 Archaea 14053
219 Ga0075428_100016775 3300006844 Archaea 8087
220 Ga0075428_100063807 3300006844 Archaea 4033
221 Ga0075428_100147155 3300006844 Archaea 2560
222 Ga0075428_100235106 3300006844 Archaea 1977
223 Ga0075428_100240454 3300006844 Archaea 1953
224 Ga0075428_100269567 3300006844 Bacteria 1832
225 Ga0075430_100004105 3300006846 Archaea 12283
226 Ga0075430_100032036 3300006846 Archaea 4462
227 Ga0075430_100080655 3300006846 Archaea 2726
228 Ga0075430_100085811 3300006846 Archaea 2636
229 Ga0075430_100129111 3300006846 Archaea 2107
230 Ga0075430_100315379 3300006846 Bacteria 1293
231 Ga0075431_100000716 3300006847 Archaea 28568
232 Ga0075431_100120724 3300006847 Archaea 2704
233 Ga0075431_100352930 3300006847 Archaea 1478
234 Ga0075431_100477632 3300006847 Bacteria 1239
235 Ga0075431_100577754 3300006847 Archaea 1109
236 Ga0075431_100722302 3300006847 Archaea 973
237 Ga0075433_10006758 3300006852 Archaea 9089
238 Ga0075433_10009753 3300006852 Archaea 7692
239 Ga0075433_10014579 3300006852 Archaea 6426
240 Ga0075433_10032504 3300006852 Archaea 4469
241 Ga0075434_100001997 3300006871 Archaea 17706
242 Ga0075434_100043651 3300006871 Archaea 4446
243 Ga0075434_100048742 3300006871 Archaea 4203
244 Ga0075434_100052079 3300006871 Archaea 4067
245 Ga0075434_100083916 3300006871 Archaea 3184
246 Ga0075429_100000182 3300006880 Archaea 41058
247 Ga0075429_100011916 3300006880 Archaea 7539
248 Ga0075429_100022952 3300006880 Archaea 5409
249 Ga0075429_100041343 3300006880 Archaea 4015
250 Ga0075429_100164766 3300006880 Archaea 1942
251 Ga0068865_100048813 3300006881 Archaea 2914
252 Ga0075436_100000163 3300006914 Archaea 41596
253 Ga0075436_100017606 3300006914 Archaea 4891
254 Ga0075436_100070974 3300006914 Archaea 2408
255 Ga0097620_100050669 3300006931 Archaea 4171
256 Ga0075435_100014858 3300007076 Archaea 5838
257 Ga0075435_100018049 3300007076 Archaea 5353
258 Ga0075435_100034510 3300007076 Archaea 4009
259 Ga0075435_100037856 3300007076 Archaea 3844
260 Ga0075435_100157794 3300007076 Unclassified 1910
261 Ga0075435_100277138 3300007076 Unclassified 1431
262 Ga0105240_10009429 3300009093 Bacteria 13817
263 Ga0111539_10000714 3300009094 Archaea 43161
264 Ga0111539_10011624 3300009094 Archaea 11045
265 Ga0111539_10055682 3300009094 Archaea 4702
266 Ga0111539_10063762 3300009094 Archaea 4360
267 Ga0111539_10070485 3300009094 Archaea 4127
268 Ga0111539_10658878 3300009094 Unclassified 1219
269 Ga0111539_11157833 3300009094 Bacteria 899
270 Ga0111539_11192868 3300009094 Bacteria 884
271 Ga0105245_10039085 3300009098 Archaea 4223
272 Ga0105245_10607414 3300009098 Bacteria 1121
273 Ga0114129_10000060 3300009147 Archaea 97673
274 Ga0114129_10000984 3300009147 Archaea 37233
275 Ga0114129_10001050 3300009147 Archaea 36211
276 Ga0114129_10002941 3300009147 Archaea 23839
277 Ga0114129_10005212 3300009147 Archaea 18319
278 Ga0114129_10040269 3300009147 Archaea 6587
279 Ga0114129_10098990 3300009147 Archaea 4036
280 Ga0114129_10260048 3300009147 Bacteria 2327
281 Ga0114129_10453909 3300009147 Archaea 1681
282 Ga0114129_10459471 3300009147 Archaea 1669
283 Ga0114129_10459818 3300009147 Archaea 1668
284 Ga0114129_10860551 3300009147 Archaea 1152
285 Ga0105241_10573887 3300009174 Bacteria 1016
286 Ga0105242_10135528 3300009176 Archaea 2130
287 Ga0105242_10579627 3300009176 Archaea 1080
288 Ga0105237_10017109 3300009545 Archaea 7522
289 Ga0105237_10048905 3300009545 Archaea 4251
290 Ga0105249_10000864 3300009553 Archaea 26984
291 Ga0105249_10138977 3300009553 Archaea 2327
292 Ga0105249_10213146 3300009553 Archaea 1896
293 Ga0105239_10026316 3300010375 Archaea 6402
294 Ga0105239_10030132 3300010375 Archaea 5965
295 Ga0105239_10083755 3300010375 Unclassified 3512
296 Ga0105246_10000379 3300011119 Archaea 23735
297 Ga0105246_10015805 3300011119 Archaea 4771
298 Ga0105246_10167542 3300011119 Archaea 1679
299 Ga0105246_10260225 3300011119 Archaea 1382
300 Ga0157317_1000035 3300012475 Archaea 3171
301 Ga0157336_1000002 3300012477 Archaea 10820
302 Ga0157346_1000002 3300012480 Archaea 12954
303 Ga0157320_1000001 3300012481 Archaea 6204
304 Ga0157318_1001096 3300012482 Archaea 1312
305 Ga0157325_1000004 3300012485 Archaea 10374
306 Ga0157329_1000034 3300012491 Archaea 2872
307 Ga0157335_1000009 3300012492 Archaea 7906
308 Ga0157341_1000025 3300012494 Archaea 6093
309 Ga0157323_1000018 3300012495 Archaea 7382
310 Ga0157319_1000054 3300012497 Archaea 10935
311 Ga0157345_1000221 3300012498 Archaea 8496
312 Ga0157314_1002659 3300012500 Archaea 1240
313 Ga0157313_1000001 3300012503 Archaea 12581
314 Ga0157339_1000004 3300012505 Archaea 12327
315 Ga0157324_1000120 3300012506 Archaea 3507
316 Ga0157342_1000004 3300012507 Archaea 12473
317 Ga0157315_1000002 3300012508 Archaea 9958
318 Ga0157316_1000279 3300012510 Archaea 2560
319 Ga0157327_1000001 3300012512 Archaea 18224
320 Ga0157338_1000003 3300012515 Archaea 12978
321 Ga0157373_10138708 3300013100 Archaea 1710
322 Ga0157371_10003989 3300013102 Archaea 13080
323 Ga0157371_10132591 3300013102 Bacteria 1773
324 Ga0157370_10031680 3300013104 Bacteria 5171
325 Ga0157369_10016227 3300013105 Bacteria 8381
326 Ga0157369_10511785 3300013105 Bacteria 1242
327 Ga0157374_10009577 3300013296 Archaea 8320
328 Ga0157374_10314738 3300013296 Unclassified 1550
329 Ga0157378_10000658 3300013297 Archaea 32539
330 Ga0157378_10001020 3300013297 Archaea 25571
331 Ga0157378_10007779 3300013297 Archaea 9357
332 Ga0157378_10537581 3300013297 Unclassified 1172
333 Ga0163162_10007817 3300013306 Archaea 10424
334 Ga0163162_10031699 3300013306 Archaea 5244
335 Ga0157372_10005598 3300013307 Archaea 13355
336 Ga0157372_10088125 3300013307 Archaea 3523
337 Ga0157375_10007347 3300013308 Archaea 9645
338 Ga0157375_10126597 3300013308 Archaea 2670
339 Ga0163163_10304298 3300014325 Archaea 1647
340 Ga0157380_10404863 3300014326 Bacteria 1296
341 Ga0157380_10796883 3300014326 Bacteria 961
342 Ga0182008_10001029 3300014497 Archaea 19387
343 Ga0182008_10002897 3300014497 Archaea 10619
344 Ga0182008_10007192 3300014497 Archaea 6160
345 Ga0182008_10065926 3300014497 Archaea 1781
346 Ga0157377_10023285 3300014745 Archaea 3281
347 Ga0157377_10208252 3300014745 Bacteria 1245
348 Ga0157376_10589905 3300014969 Bacteria 1105
349 Ga0182006_1024761 3300015261 Archaea 2472
350 Ga0182007_10002823 3300015262 Archaea 8458
351 Ga0206356_10252989 3300020070 Archaea 3128
352 Ga0206349_1231071 3300020075 Unclassified 2364
353 Ga0206349_1329635 3300020075 Bacteria 2905
354 Ga0206355_1101130 3300020076 Bacteria 1535
355 Ga0206355_1360124 3300020076 Bacteria 933
356 Ga0206351_10572467 3300020077 Bacteria 3278
357 Ga0206351_10770016 3300020077 Unclassified 2149
358 Ga0206352_10309879 3300020078 Archaea 1981
359 Ga0206352_10894037 3300020078 Unclassified 2470
360 Ga0206350_11442193 3300020080 Archaea 3719
361 Ga0206350_11608681 3300020080 Bacteria 2526
362 Ga0206354_11108938 3300020081 Unclassified 1408
363 Ga0206354_11257073 3300020081 Bacteria 3316
364 Ga0206353_10924154 3300020082 Unclassified 1946
365 Ga0206353_11663780 3300020082 Unclassified 1807
366 Ga0213876_10197185 3300021384 Bacteria 1070
367 Ga0224712_10016965 3300022467 Bacteria 2404
368 Ga0224712_10021568 3300022467 Archaea 2207
369 Ga0224712_10101020 3300022467 Unclassified 1223
370 Ga0207697_10000311 3300025315 Archaea 27196
371 Ga0207692_10110784 3300025898 Archaea 1522
372 Ga0207692_10181615 3300025898 Unclassified 1226
373 Ga0207642_10009374 3300025899 Archaea 3402
374 Ga0207688_10000285 3300025901 Archaea 23049
375 Ga0207688_10057053 3300025901 Archaea 2195
376 Ga0207647_10000254 3300025904 Archaea 43745
377 Ga0207647_10010744 3300025904 Archaea 6448
378 Ga0207647_10013305 3300025904 Archaea 5710
379 Ga0207685_10004616 3300025905 Unclassified 3531
380 Ga0207645_10000453 3300025907 Archaea 34079
381 Ga0207645_10001395 3300025907 Archaea 19805
382 Ga0207645_10003378 3300025907 Archaea 12134
383 Ga0207645_10027474 3300025907 Archaea 3674
384 Ga0207643_10000060 3300025908 Archaea 73359
385 Ga0207643_10000151 3300025908 Archaea 47592
386 Ga0207643_10002512 3300025908 Archaea 9916
387 Ga0207705_10142286 3300025909 Bacteria 1792
388 Ga0207684_10225183 3300025910 Archaea 1618
389 Ga0207654_10170627 3300025911 Unclassified 1412
390 Ga0207707_10008421 3300025912 Bacteria 8943
391 Ga0207707_10066079 3300025912 Unclassified 3149
392 Ga0207707_10405908 3300025912 Bacteria 1169
393 Ga0207695_10056272 3300025913 Bacteria 4094
394 Ga0207671_10028051 3300025914 Archaea 4207
395 Ga0207671_10316117 3300025914 Bacteria 1235
396 Ga0207693_10000933 3300025915 Archaea 26274
397 Ga0207693_10130498 3300025915 Archaea 1976
398 Ga0207693_10322166 3300025915 Bacteria 1210
399 Ga0207663_10007639 3300025916 Archaea 5620
400 Ga0207663_10036568 3300025916 Archaea 2955
401 Ga0207663_10041825 3300025916 Archaea 2795
402 Ga0207660_10014729 3300025917 Archaea 5152
403 Ga0207660_10030416 3300025917 Archaea 3711
404 Ga0207660_10048635 3300025917 Bacteria 3002
405 Ga0207662_10000395 3300025918 Archaea 19433
406 Ga0207662_10163836 3300025918 Archaea 1422
407 Ga0207657_10151099 3300025919 Bacteria 1892
408 Ga0207657_10174390 3300025919 Archaea 1741
409 Ga0207657_10299874 3300025919 Archaea 1273
410 Ga0207649_10196737 3300025920 Archaea 1421
411 Ga0207652_10048500 3300025921 Bacteria 3631
412 Ga0207652_10073851 3300025921 Archaea 2968
413 Ga0207646_10010814 3300025922 Bacteria 8869
414 Ga0207646_10039394 3300025922 Bacteria 4254
415 Ga0207646_10080632 3300025922 Unclassified 2910
416 Ga0207681_10000226 3300025923 Archaea 44465
417 Ga0207650_10002804 3300025925 Archaea 12028
418 Ga0207650_10010770 3300025925 Archaea 6277
419 Ga0207650_10063392 3300025925 Archaea 2763
420 Ga0207650_10310286 3300025925 Archaea 1290
421 Ga0207659_10005569 3300025926 Archaea 7645
422 Ga0207659_10156110 3300025926 Archaea 1787
423 Ga0207700_10131473 3300025928 Archaea 2044
424 Ga0207664_10036125 3300025929 Archaea 3817
425 Ga0207664_10091021 3300025929 Archaea 2501
426 Ga0207690_10322609 3300025932 Bacteria 1214
427 Ga0207690_10428374 3300025932 Archaea 1060
428 Ga0207706_10003483 3300025933 Archaea 15020
429 Ga0207706_10053573 3300025933 Archaea 3561
430 Ga0207686_10021272 3300025934 Archaea 3720
431 Ga0207669_10059192 3300025937 Archaea 2342
432 Ga0207704_10204338 3300025938 Bacteria 1448
433 Ga0207665_10000484 3300025939 Archaea 26941
434 Ga0207665_10004562 3300025939 Archaea 9190
435 Ga0207665_10053942 3300025939 Archaea 2710
436 Ga0207665_10091194 3300025939 Archaea 2113
437 Ga0207691_10000831 3300025940 Archaea 30843
438 Ga0207691_10001470 3300025940 Archaea 23499
439 Ga0207689_10000099 3300025942 Archaea 69619
440 Ga0207689_10000924 3300025942 Archaea 28206
441 Ga0207689_10030663 3300025942 Unclassified 4481
442 Ga0207661_10175753 3300025944 Unclassified 1867
443 Ga0207661_10226267 3300025944 Bacteria 1655
444 Ga0207661_10386906 3300025944 Bacteria 1267
445 Ga0207679_10176324 3300025945 Archaea 1765
446 Ga0207667_10119084 3300025949 Bacteria 2721
447 Ga0207651_10059869 3300025960 Unclassified 2640
448 Ga0207651_10190138 3300025960 Archaea 1637
449 Ga0207712_10022945 3300025961 Archaea 4115
450 Ga0207712_10050754 3300025961 Archaea 2898
451 Ga0207712_10243424 3300025961 Archaea 1450
452 Ga0207668_10083887 3300025972 Archaea 2320
453 Ga0207668_10290266 3300025972 Bacteria 1345
454 Ga0207640_10123789 3300025981 Bacteria 1858
455 Ga0207640_10157803 3300025981 Archaea 1675
456 Ga0207677_10030192 3300026023 Archaea 3456
457 Ga0207677_10053781 3300026023 Archaea 2743
458 Ga0207677_10165652 3300026023 Unclassified 1722
459 Ga0207677_10271265 3300026023 Bacteria 1388
460 Ga0207677_10464635 3300026023 Archaea 1087
461 Ga0207703_10012376 3300026035 Bacteria 6649
462 Ga0207639_10086625 3300026041 Archaea 2494
463 Ga0207678_10070203 3300026067 Archaea 3003
464 Ga0207678_10076963 3300026067 Archaea 2857
465 Ga0207708_10000211 3300026075 Archaea 46235
466 Ga0207708_10004526 3300026075 Archaea 10228
467 Ga0207708_10035024 3300026075 Archaea 3820
468 Ga0207702_10032169 3300026078 Archaea 4377
469 Ga0207648_10001089 3300026089 Archaea 30442
470 Ga0207648_10009197 3300026089 Archaea 9490
471 Ga0207648_10053957 3300026089 Archaea 3512
472 Ga0207676_10006725 3300026095 Archaea 8137
473 Ga0207676_10198813 3300026095 Archaea 1769
474 Ga0207674_10003384 3300026116 Archaea 19569
475 Ga0207683_10012211 3300026121 Archaea 7332
476 Ga0207683_10319757 3300026121 Bacteria 1421
477 Ga0207698_10055078 3300026142 Bacteria 3062
478 Ga0207698_10249665 3300026142 Bacteria 1623
479 Ga0209969_1000388 3300027360 Archaea 5866
480 Ga0209967_1000443 3300027364 Archaea 5420
481 Ga0209967_1000592 3300027364 Unclassified 4719
482 Ga0209981_1000005 3300027378 Archaea 22900
483 Ga0209996_1000197 3300027395 Archaea 7754
484 Ga0209984_1000037 3300027424 Archaea 13673
485 Ga0209984_1001042 3300027424 Archaea 2955
486 Ga0210000_1001171 3300027462 Archaea 3679
487 Ga0209995_1000528 3300027471 Archaea 5793
488 Ga0209968_1001146 3300027526 Archaea 4039
489 Ga0209999_1002617 3300027543 Archaea 3187
490 Ga0209982_1000804 3300027552 Archaea 4075
491 Ga0209982_1001651 3300027552 Unclassified 3065
492 Ga0209970_1001561 3300027614 Archaea 3994
493 Ga0209970_1012441 3300027614 Unclassified 1406
494 Ga0210002_1000911 3300027617 Archaea 4075
495 Ga0210002_1003717 3300027617 Archaea 2259
496 Ga0209983_1003333 3300027665 Archaea 3439
497 Ga0209971_1002058 3300027682 Archaea 4895
498 Ga0209966_1000233 3300027695 Archaea 21010
499 Ga0209998_10000526 3300027717 Archaea 10383
500 Ga0209998_10001715 3300027717 Archaea 5228
501 Ga0209974_10000209 3300027876 Archaea 18944
502 Ga0209974_10008784 3300027876 Archaea 3443
503 Ga0207428_10000170 3300027907 Archaea 90470
504 Ga0207428_10000230 3300027907 Archaea 77168
505 Ga0207428_10000434 3300027907 Archaea 51396
506 Ga0207428_10000478 3300027907 Archaea 48328
507 Ga0207428_10030272 3300027907 Archaea 4477
508 Ga0268265_10009870 3300028380 Archaea 6448
509 Ga0268264_10010217 3300028381 Archaea 7767
510 Ga0268264_10036432 3300028381 Archaea 4053
511 Ga0307515_10051621 3300028794 Bacteria 6124
512 Ga0307513_10020653 3300031456 Bacteria 7803
513 Ga0307509_10000035 3300031507 Bacteria 192339
514 Ga0307408_100264296 3300031548 Unclassified 1426
515 Ga0307408_100317712 3300031548 Bacteria 1311
516 Ga0265313_10025066 3300031595 Bacteria 3171
517 Ga0265342_10063742 3300031712 Bacteria 2165
518 Ga0316576_10002213 3300031727 Bacteria 10981
519 Ga0316578_10088484 3300031728 Bacteria 1848
520 Ga0316578_10091204 3300031728 Bacteria 1820
521 Ga0307516_10037063 3300031730 Bacteria 4876
522 Ga0307405_10003058 3300031731 Archaea 7580
523 Ga0316577_10002196 3300031733 Bacteria 9583
524 Ga0316577_10031802 3300031733 Bacteria 2948
525 Ga0316577_10150552 3300031733 Bacteria 1311
526 Ga0307413_10018924 3300031824 Archaea 3625
527 Ga0307410_10000350 3300031852 Archaea 17878
528 Ga0307410_10208265 3300031852 Archaea 1497
529 Ga0307406_10008698 3300031901 Archaea 5674
530 Ga0307407_10000866 3300031903 Archaea 10156
531 Ga0307412_10008929 3300031911 Archaea 5740
532 Ga0307412_10223901 3300031911 Bacteria 1444
533 Ga0307409_100005524 3300031995 Archaea 7295
534 Ga0307409_100018366 3300031995 Bacteria 4699
535 Ga0307409_100270764 3300031995 Bacteria 1564
536 Ga0307416_100000573 3300032002 Archaea 18855
537 Ga0307416_100014241 3300032002 Bacteria 5440
538 Ga0307416_100045892 3300032002 Archaea 3444
539 Ga0307416_100121561 3300032002 Archaea 2328
540 Ga0307414_10005689 3300032004 Archaea 6881
541 Ga0307411_10075622 3300032005 Archaea 2299
542 Ga0307415_100006283 3300032126 Bacteria 6386
543 Ga0307415_100120122 3300032126 Archaea 1968
544 Ga0307415_100131263 3300032126 Archaea 1897
545 Ga0307415_100415446 3300032126 Archaea 1153
546 Ga0373948_0004062 3300034817 Archaea 2291
547 Ga0373940_0004054 3300035088 Bacteria 3063
548 Ga0373939_0001601 3300035114 Bacteria 5463
549 Ga0373939_0002258 3300035114 Archaea 4562
550 Ga0373953_0000078 3300035117 Archaea 23388
551 Ga0373954_0000473 3300035118 Bacteria 15089
552 Ga0373956_0004393 3300035119 Archaea 5646
553 Ga0373960_0002560 3300035121 Archaea 4103
554 Ga0373955_0000142 3300035172 Bacteria 28326
555 Ga0373961_0003063 3300035241 Archaea 4205
556 Ga0373961_0021242 3300035241 Archaea 1724
557 Ga0373962_0000694 3300035242 Archaea 7605
558 Ga0316574_0025988 3300035398 Bacteria 3519
559 Ga0373924_0003877 3300035410 Archaea 5183
560 Ga0373931_0011111 3300035691 Archaea 4342
561 Ga0373935_0239816 3300035692 Archaea 1265
562 Ga0373933_0000008 3300035724 Archaea 112991
563 Ga0373947_0029346 3300035725 Archaea 3227
564 Ga0373947_0160344 3300035725 Archaea 1454
565 Ga0373937_0000366 3300036401 Archaea 42036
566 Ga0316584_0010391 3300036712 Bacteria 6503
567 Ga0316584_0082879 3300036712 Bacteria 2402
568 Ga0316584_0304767 3300036712 Unclassified 1153
569 Ga0373925_0115416 3300037068 Archaea 2079
570 Ga0373925_0118249 3300037068 Unclassified 2055
571 Ga0395898_0108900 3300037466 Bacteria 2656
572 Ga0395905_0041319 3300037471 Bacteria 4327
573 Ga0242419_000090 3300038698 Archaea 4294
574 Ga0242419_000592 3300038698 Unclassified 2005
575 Ga0242420_000010 3300038996 Archaea 27345
576 Ga0242420_014030 3300038996 Archaea 1370
577 Ga0436365_0144313 3300039437 Bacteria 1546
578 Ga0436365_1203833 3300039437 Bacteria 1060
579 Ga0439439_0001669 3300041406 Archaea 4500
580 Ga0439439_0025164 3300041406 Archaea 1497
581 Ga0439453_0001453 3300041408 Unclassified 3047
582 Ga0439453_0004005 3300041408 Archaea 2163
583 Ga0439461_0005067 3300041410 Archaea 2230
584 Ga0451839_0106539 3300041496 Bacteria 1116
585 Ga0439437_000034 3300042000 Archaea 9694
586 Ga0439441_000011 3300042001 Archaea 17843
587 Ga0439443_000163 3300042003 Unclassified 4746
588 Ga0439448_0061773 3300042005 Archaea 1239
589 Ga0439448_0070235 3300042005 Archaea 1166
590 Ga0439432_026994 3300042006 Archaea 1878
591 Ga0439451_000486 3300042009 Archaea 7678
592 Ga0439452_010733 3300042010 Unclassified 2652
593 Ga0439454_000015 3300042011 Archaea 12810
594 Ga0439455_0001879 3300042012 Archaea 3672
595 Ga0439456_000998 3300042013 Archaea 5622
596 Ga0439462_0013237 3300042015 Archaea 2114
597 Ga0450888_002660 3300042126 Archaea 1773
598 Ga0450906_008535 3300042145 Archaea 1978
599 Ga0450910_010005 3300042147 Unclassified 1347
600 Ga0439458_0005537 3300042157 Archaea 2839
601 Ga0450908_018800 3300042184 Bacteria 1219
602 Ga0439434_0002145 3300042435 Archaea 5716
603 Ga0439435_0000032 3300042436 Archaea 15134
604 Ga0439444_0000005 3300042437 Archaea 17173
605 Ga0439459_0011300 3300042438 Archaea 1572
606 Ga0439464_0000149 3300042439 Archaea 11392
607 Ga0439460_0000288 3300042461 Archaea 10546
608 Ga0450893_0001103 3300042532 Archaea 4065
609 Ga0450893_0005166 3300042532 Unclassified 2088
610 Ga0451577_0032342 3300042876 Archaea 4714
611 Ga0439440_0000359 3300042993 Archaea 7538
612 Ga0439440_0005126 3300042993 Unclassified 2589
613 Ga0453683_0055401 3300044673 Bacteria 2482
614 Ga0453684_0048600 3300044712 Archaea 5605
615 Ga0451576_0014887 3300045051 Archaea 8642
616 Ga0466967_0023655 3300045976 Bacteria 5039
617 Ga0466967_0587733 3300045976 Archaea 1098
618 Ga0495592_0023477 3300046454 Archaea 4691
619 Ga0495592_0047399 3300046454 Bacteria 3200
620 Ga0495651_0000732 3300046462 Archaea 25355
621 Ga0495651_0022789 3300046462 Bacteria 4868
622 Ga0495653_0000687 3300046463 Bacteria 25844
623 Ga0495580_0044948 3300046472 Bacteria 3139
624 Ga0495662_0000203 3300046476 Bacteria 24566
625 Ga0495584_0060375 3300046491 Archaea 1906
626 Ga0495585_0036932 3300046492 Archaea 2753
627 Ga0495608_0000506 3300046511 Bacteria 26795
628 Ga0495608_0097902 3300046511 Archaea 1893
629 Ga0495628_0008786 3300046516 Bacteria 8644
630 Ga0495628_0025364 3300046516 Archaea 4843
631 Ga0495630_0143048 3300046517 Bacteria 1818
632 Ga0495666_0014797 3300046526 Bacteria 3882
633 Ga0495652_0002041 3300046529 Archaea 21418
634 Ga0495652_0129618 3300046529 Bacteria 1998
635 Ga0495665_0001512 3300046531 Bacteria 12429
636 Ga0495640_0065390 3300046533 Bacteria 2455
637 Ga0495587_0003246 3300046536 Archaea 10866
638 Ga0495587_0028602 3300046536 Bacteria 3388
639 Ga0495587_0266653 3300046536 Bacteria 961
640 Ga0495645_0018255 3300046543 Bacteria 5036
641 Ga0495645_0044836 3300046543 Archaea 3225
642 Ga0495667_0002226 3300046559 Archaea 12977
643 Ga0495667_0018712 3300046559 Bacteria 4676
644 Ga0495656_0070721 3300046615 Archaea 1549
645 Ga0495634_0023433 3300046642 Bacteria 4339
646 Ga0495611_0054823 3300046648 Archaea 1803
647 Ga0495635_0023984 3300046663 Bacteria 4252
648 Ga0495657_0071787 3300046675 Bacteria 2259
649 Ga0495599_0010628 3300046678 Archaea 5633
650 Ga0495599_0010849 3300046678 Bacteria 5583
651 Ga0495623_0008181 3300046679 Archaea 6801
652 Ga0495623_0031866 3300046679 Bacteria 3388
653 Ga0495646_0021711 3300046680 Archaea 4055
654 Ga0495646_0022594 3300046680 Bacteria 3966
655 Ga0495613_0072208 3300046689 Bacteria 2515
656 Ga0495624_0294043 3300046690 Archaea 980
657 Ga0495670_0223110 3300046691 Archaea 1001
658 Ga0495600_0022553 3300046809 Bacteria 4043
659 Ga0495604_0000409 3300047317 Bacteria 38733
660 Ga0495604_0036509 3300047317 Archaea 3874
661 Ga0495636_0040412 3300047318 Archaea 1934
662 Ga0495674_0019998 3300047319 Bacteria 6205
663 Ga0495674_0393698 3300047319 Archaea 1119
664 Ga0495675_0005264 3300047444 Archaea 7878
665 Ga0495675_0011732 3300047444 Bacteria 5504
666 Ga0495684_0005230 3300047471 Bacteria 10110
667 Ga0495593_0032649 3300047673 Bacteria 2836
668 Ga0495602_0000563 3300048088 Archaea 34594
669 Ga0496100_0009999 3300048903 Archaea 5356
670 Ga0496100_0041870 3300048903 Archaea 2922
671 Ga0496101_0019009 3300048904 Archaea 4681
672 Ga0496101_0192351 3300048904 Archaea 1575
673 Ga0496102_0026567 3300048905 Bacteria 5166
674 Ga0496103_0163795 3300048906 Bacteria 1427
675 Ga0496103_0176400 3300048906 Unclassified 1373
676 Ga0496104_0029650 3300048907 Archaea 5076
677 Ga0496104_0577828 3300048907 Bacteria 1034
678 Ga0496106_0004562 3300048909 Archaea 10267
679 Ga0496106_0009260 3300048909 Archaea 7277
680 Ga0496106_0015600 3300048909 Archaea 5619
681 Ga0496106_0018842 3300048909 Archaea 5113
682 Ga0496106_0038357 3300048909 Archaea 3585
683 Ga0496107_0004214 3300048910 Archaea 9717
684 Ga0496107_0035492 3300048910 Archaea 3574
685 Ga0496107_0052976 3300048910 Archaea 2927
686 Ga0496110_0343541 3300048913 Unclassified 1359
687 Ga0496110_0441296 3300048913 Bacteria 1186
688 Ga0496112_0000371 3300048915 Archaea 29354
689 Ga0496112_0147514 3300048915 Unclassified 2320
690 Ga0496113_0213069 3300048916 Unclassified 1538
691 Ga0496114_0547200 3300048917 Bacteria 1023
692 Ga0501306_000201 3300049127 Archaea 4036
693 Ga0501309_000625 3300049129 Archaea 3001
694 Ga0501290_008124 3300049513 Archaea 1324
695 Ga0501292_001749 3300049515 Archaea 2705
696 Ga0501295_002610 3300049518 Archaea 2087
697 Ga0501299_003004 3300049522 Archaea 2398
698 Ga0501300_014513 3300049523 Archaea 1149
699 Ga0501311_000596 3300049527 Archaea 2637
700 Ga0501320_000173 3300049536 Archaea 3193
701 Ga0501321_002443 3300049537 Archaea 1614
702 Ga0501324_002469 3300049540 Archaea 1340
703 Ga0501325_007182 3300049541 Bacteria 936
704 Ga0501031_0000732 3300049568 Archaea 19678
705 Ga0501031_0024202 3300049568 Bacteria 3959
706 Ga0501031_0043459 3300049568 Archaea 2932
707 Ga0501031_0062207 3300049568 Archaea 2432
708 Ga0501031_0157135 3300049568 Archaea 1486
709 Ga0501032_0003729 3300049569 Archaea 11556
710 Ga0501032_0021894 3300049569 Archaea 4439
711 Ga0501032_0065449 3300049569 Archaea 2431
712 Ga0501033_0029014 3300049570 Archaea 4157
713 Ga0501033_0045599 3300049570 Archaea 3262
714 Ga0501033_0045632 3300049570 Archaea 3261
715 Ga0501033_0089419 3300049570 Bacteria 2253
716 Ga0501034_0015017 3300049571 Archaea 7965
717 Ga0501034_0618592 3300049571 Archaea 987
718 Ga0501036_0001615 3300049572 Archaea 17441
719 Ga0501036_0009162 3300049572 Archaea 8139
720 Ga0501036_0010176 3300049572 Archaea 7750
721 Ga0501036_0019748 3300049572 Archaea 5658
722 Ga0501036_0050808 3300049572 Archaea 3511
723 Ga0501036_0074106 3300049572 Archaea 2878
724 Ga0501036_0135611 3300049572 Bacteria 2078
725 Ga0501036_0228254 3300049572 Bacteria 1563
726 Ga0501037_0009373 3300049573 Archaea 7185
727 Ga0501037_0010653 3300049573 Archaea 6759
728 Ga0501037_0015420 3300049573 Archaea 5622
729 Ga0501037_0033967 3300049573 Archaea 3766
730 Ga0501037_0118577 3300049573 Archaea 1904
731 Ga0501037_0132436 3300049573 Archaea 1787
732 Ga0501037_0224652 3300049573 Archaea 1320
733 Ga0501038_0002516 3300049574 Archaea 17076
734 Ga0501038_0012125 3300049574 Archaea 7872
735 Ga0501038_0029378 3300049574 Archaea 4872
736 Ga0501038_0031684 3300049574 Archaea 4670
737 Ga0501038_0092243 3300049574 Archaea 2536
738 Ga0501038_0111050 3300049574 Archaea 2271
739 Ga0501039_0002987 3300049575 Archaea 12651
740 Ga0501039_0003982 3300049575 Archaea 11105
741 Ga0501039_0005528 3300049575 Archaea 9564
742 Ga0501039_0006334 3300049575 Archaea 8987
743 Ga0501039_0008366 3300049575 Archaea 7883
744 Ga0501039_0021198 3300049575 Archaea 4985
745 Ga0501039_0052885 3300049575 Archaea 3142
746 Ga0501039_0063454 3300049575 Archaea 2863
747 Ga0501039_0079726 3300049575 Archaea 2547
748 Ga0501039_0193511 3300049575 Bacteria 1599
749 Ga0501039_0210451 3300049575 Unclassified 1529
750 Ga0501040_0000522 3300049576 Archaea 23072
751 Ga0501040_0001037 3300049576 Archaea 17578
752 Ga0501040_0003666 3300049576 Archaea 9948
753 Ga0501040_0009081 3300049576 Archaea 6468
754 Ga0501040_0011874 3300049576 Archaea 5697
755 Ga0501040_0015676 3300049576 Archaea 5009
756 Ga0501040_0061110 3300049576 Archaea 2590
757 Ga0501040_0095891 3300049576 Archaea 2065
758 Ga0501040_0173509 3300049576 Bacteria 1527
759 Ga0501040_0213895 3300049576 Unclassified 1371
760 Ga0501041_0000049 3300049577 Archaea 42251
761 Ga0501041_0001792 3300049577 Archaea 12035
762 Ga0501041_0002791 3300049577 Archaea 9972
763 Ga0501041_0003070 3300049577 Archaea 9588
764 Ga0501041_0009137 3300049577 Archaea 5834
765 Ga0501041_0036823 3300049577 Archaea 2963
766 Ga0501041_0073596 3300049577 Archaea 2099
767 Ga0501041_0136815 3300049577 Unclassified 1527
768 Ga0501041_0200215 3300049577 Archaea 1252
769 Ga0501042_0001062 3300049578 Archaea 15714
770 Ga0501042_0002359 3300049578 Archaea 11577
771 Ga0501042_0003918 3300049578 Archaea 9418
772 Ga0501042_0005794 3300049578 Archaea 7976
773 Ga0501042_0008563 3300049578 Archaea 6764
774 Ga0501042_0009756 3300049578 Archaea 6414
775 Ga0501042_0019473 3300049578 Archaea 4713
776 Ga0501042_0019719 3300049578 Archaea 4687
777 Ga0501042_0029430 3300049578 Archaea 3873
778 Ga0501042_0029894 3300049578 Unclassified 3844
779 Ga0501042_0041952 3300049578 Unclassified 3255
780 Ga0501042_0177337 3300049578 Archaea 1537
781 Ga0501042_0180492 3300049578 Bacteria 1523
782 Ga0501042_0507024 3300049578 Archaea 876
783 Ga0501043_0002242 3300049579 Archaea 16462
784 Ga0501043_0003729 3300049579 Archaea 12522
785 Ga0501043_0080464 3300049579 Bacteria 2560
786 Ga0501043_0087547 3300049579 Archaea 2448
787 Ga0501043_0103405 3300049579 Archaea 2238
788 Ga0501046_0004008 3300049580 Archaea 13450
789 Ga0501046_0004335 3300049580 Archaea 12917
790 Ga0501046_0004407 3300049580 Archaea 12782
791 Ga0501046_0005600 3300049580 Archaea 11210
792 Ga0501046_0022591 3300049580 Archaea 5181
793 Ga0501046_0027570 3300049580 Archaea 4633
794 Ga0501046_0087217 3300049580 Archaea 2405
795 Ga0501046_0108804 3300049580 Archaea 2119
796 Ga0501046_0111895 3300049580 Archaea 2085
797 Ga0501046_0261697 3300049580 Unclassified 1271
798 Ga0501046_0336547 3300049580 Bacteria 1097
799 Ga0501047_0064186 3300049581 Archaea 3542
800 Ga0501048_0000173 3300049582 Archaea 40516
801 Ga0501048_0003527 3300049582 Archaea 11893
802 Ga0501048_0005202 3300049582 Archaea 9912
803 Ga0501048_0005390 3300049582 Archaea 9728
804 Ga0501048_0008790 3300049582 Archaea 7612
805 Ga0501048_0014446 3300049582 Archaea 5846
806 Ga0501048_0045878 3300049582 Archaea 3120
807 Ga0501048_0064855 3300049582 Archaea 2583
808 Ga0501048_0088759 3300049582 Unclassified 2181
809 Ga0501048_0092684 3300049582 Archaea 2130
810 Ga0501067_0208779 3300049583 Archaea 1088
811 Ga0501068_0033518 3300049584 Archaea 3059
812 Ga0501068_0147754 3300049584 Unclassified 1476
813 Ga0501069_0102064 3300049585 Archaea 1629
814 Ga0501069_0158681 3300049585 Bacteria 1302
815 Ga0501070_0316031 3300049586 Archaea 1271
816 Ga0501071_0000039 3300049587 Archaea 44026
817 Ga0501071_0000076 3300049587 Archaea 35094
818 Ga0501071_0005819 3300049587 Archaea 7967
819 Ga0501071_0013544 3300049587 Archaea 5560
820 Ga0501071_0022839 3300049587 Archaea 4363
821 Ga0501071_0065743 3300049587 Archaea 2634
822 Ga0501071_0149584 3300049587 Archaea 1741
823 Ga0501071_0304310 3300049587 Archaea 1209
824 Ga0501071_0344651 3300049587 Unclassified 1133
825 Ga0501072_0000103 3300049588 Archaea 62498
826 Ga0501072_0000154 3300049588 Archaea 51002
827 Ga0501072_0000305 3300049588 Archaea 34854
828 Ga0501072_0005539 3300049588 Archaea 9601
829 Ga0501072_0017257 3300049588 Archaea 5548
830 Ga0501072_0027018 3300049588 Bacteria 4478
831 Ga0501072_0129607 3300049588 Unclassified 2010
832 Ga0501073_0030935 3300049589 Archaea 3821
833 Ga0501074_0003257 3300049590 Archaea 11471
834 Ga0501074_0011358 3300049590 Archaea 6472
835 Ga0501074_0049431 3300049590 Archaea 3036
836 Ga0501074_0075603 3300049590 Archaea 2418
837 Ga0501074_0080193 3300049590 Archaea 2342
838 Ga0501074_0138068 3300049590 Archaea 1744
839 Ga0501075_0001024 3300049591 Archaea 17911
840 Ga0501075_0001887 3300049591 Archaea 13825
841 Ga0501075_0002197 3300049591 Archaea 12910
842 Ga0501075_0009145 3300049591 Archaea 6924
843 Ga0501075_0009237 3300049591 Archaea 6894
844 Ga0501075_0010848 3300049591 Archaea 6424
845 Ga0501075_0015069 3300049591 Archaea 5546
846 Ga0501075_0041492 3300049591 Unclassified 3448
847 Ga0501075_0058485 3300049591 Archaea 2903
848 Ga0501076_0000112 3300049592 Archaea 44772
849 Ga0501076_0001114 3300049592 Archaea 17716
850 Ga0501076_0001381 3300049592 Archaea 16252
851 Ga0501076_0004638 3300049592 Archaea 9792
852 Ga0501076_0057891 3300049592 Bacteria 3079
853 Ga0501076_0074478 3300049592 Bacteria 2720
854 Ga0501076_0091190 3300049592 Archaea 2451
855 Ga0501076_0095319 3300049592 Bacteria 2397
856 Ga0501076_0127986 3300049592 Archaea 2059
857 Ga0501076_0494824 3300049592 Bacteria 1008
858 Ga0501077_0003175 3300049593 Archaea 9894
859 Ga0501077_0003341 3300049593 Archaea 9643
860 Ga0501077_0005272 3300049593 Archaea 7853
861 Ga0501077_0007543 3300049593 Archaea 6711
862 Ga0501198_000263 3300049649 Archaea 6637
863 Ga0501199_000697 3300049650 Archaea 2970
864 Ga0501199_002490 3300049650 Archaea 1723
865 Ga0501208_000104 3300049655 Archaea 5168
866 Ga0501209_001078 3300049656 Archaea 3676
867 Ga0501211_002614 3300049658 Archaea 1896
868 Ga0501214_000140 3300049659 Archaea 4168
869 Ga0501216_000905 3300049660 Archaea 3766
870 Ga0501217_000155 3300049661 Archaea 9596
871 Ga0501217_000793 3300049661 Archaea 5504
872 Ga0501222_013902 3300049662 Archaea 1060
873 Ga0501223_016812 3300049663 Archaea 1445
874 Ga0501224_001811 3300049664 Archaea 2878
875 Ga0501227_001241 3300049665 Archaea 5707
876 Ga0501230_003282 3300049667 Archaea 2138
877 Ga0501233_000095 3300049668 Archaea 11800
878 Ga0501235_002705 3300049669 Archaea 3811
879 Ga0501235_007946 3300049669 Archaea 2310
880 Ga0501238_003812 3300049671 Archaea 1864
881 Ga0501242_005589 3300049674 Archaea 1419
882 Ga0501243_000728 3300049675 Archaea 4556
883 Ga0501248_000361 3300049678 Archaea 2401
884 Ga0501249_003466 3300049679 Archaea 3167
885 Ga0501251_001520 3300049681 Archaea 2172
886 Ga0501253_000066 3300049683 Archaea 7251
887 Ga0501253_036119 3300049683 Unclassified 971
888 Ga0501255_011379 3300049684 Archaea 1024
889 Ga0501256_001408 3300049685 Archaea 1772
890 Ga0501257_001247 3300049686 Archaea 5220
891 Ga0501259_001302 3300049688 Archaea 4175
892 Ga0501259_032521 3300049688 Archaea 992
893 Ga0501261_000215 3300049690 Archaea 7963
894 Ga0501219_002606 3300049703 Archaea 1367
895 Ga0501221_000092 3300049704 Archaea 10631
896 Ga0501221_003532 3300049704 Archaea 2575
897 Ga0501225_0002619 3300049705 Archaea 5530
898 Ga0501225_0014777 3300049705 Archaea 2177
899 Ga0501234_001112 3300049707 Archaea 4246
900 Ga0501245_000733 3300049708 Archaea 4069
901 Ga0501079_0001993 3300049741 Archaea 14629
902 Ga0501079_0006902 3300049741 Archaea 8557
903 Ga0501079_0020550 3300049741 Archaea 5048
904 Ga0501079_0047480 3300049741 Bacteria 3312
905 Ga0501079_0057067 3300049741 Bacteria 3013
906 Ga0501079_0125263 3300049741 Archaea 1999
907 Ga0501079_0187134 3300049741 Archaea 1616
908 Ga0501080_0001244 3300049742 Archaea 21217
909 Ga0501080_0023384 3300049742 Archaea 5729
910 Ga0501080_0026284 3300049742 Archaea 5409
911 Ga0501080_0030093 3300049742 Archaea 5057
912 Ga0501080_0176169 3300049742 Bacteria 1970
913 Ga0501080_0306761 3300049742 Bacteria 1439
914 Ga0501080_0318252 3300049742 Archaea 1409
915 Ga0501081_0001183 3300049743 Archaea 15789
916 Ga0501081_0003108 3300049743 Archaea 10544
917 Ga0501081_0003709 3300049743 Archaea 9784
918 Ga0501081_0007550 3300049743 Archaea 7050
919 Ga0501081_0023561 3300049743 Archaea 4127
920 Ga0501081_0026950 3300049743 Archaea 3877
921 Ga0501081_0035200 3300049743 Bacteria 3408
922 Ga0501081_0046882 3300049743 Bacteria 2972
923 Ga0501081_0052314 3300049743 Unclassified 2818
924 Ga0501083_0065165 3300049744 Archaea 2427
925 Ga0501241_016410 3300049758 Archaea 1350
926 Ga0501266_000220 3300049763 Archaea 7436
927 Ga0501269_001972 3300049766 Archaea 2591
928 Ga0501270_002884 3300049767 Archaea 1804
929 Ga0501271_000127 3300049768 Archaea 6165
930 Ga0501280_003241 3300049776 Archaea 2534
931 Ga0501281_01729 3300049777 Archaea 1673
932 Ga0501283_020443 3300049779 Archaea 1056
933 Ga0501035_0012685 3300049822 Archaea 7787
934 Ga0501035_0020888 3300049822 Archaea 6017
935 Ga0501035_0025287 3300049822 Unclassified 5443
936 Ga0501035_0172492 3300049822 Bacteria 1868
937 Ga0501044_0002572 3300049823 Archaea 20665
938 Ga0501044_0069460 3300049823 Archaea 3586
939 Ga0501044_0162250 3300049823 Archaea 2211
940 Ga0501044_0218506 3300049823 Archaea 1857
941 Ga0501045_0000285 3300049824 Archaea 29667
942 Ga0501045_0000794 3300049824 Archaea 20334
943 Ga0501045_0001311 3300049824 Archaea 16520
944 Ga0501045_0002609 3300049824 Archaea 12285
945 Ga0501045_0006818 3300049824 Archaea 7912
946 Ga0501045_0044597 3300049824 Archaea 3230
947 Ga0501045_0049329 3300049824 Bacteria 3069
948 Ga0501045_0074077 3300049824 Archaea 2507
949 Ga0501204_000029 3300049850 Archaea 11359
950 Ga0501212_000656 3300049851 Archaea 3496
951 Ga0501212_002705 3300049851 Archaea 2163
952 nmdc:mga0yw44_33768_c1 3300050492 Bacteria 2992
953 nmdc:mga05p37_110477_c1 3300050507 Archaea 3382
954 nmdc:mga05p37_11214_c1 3300050507 Archaea 10655
955 nmdc:mga05p37_1209_c1 3300050507 Archaea 29905
956 nmdc:mga05p37_23771_c1 3300050507 Archaea 7442
957 nmdc:mga05p37_24652_c1 3300050507 Archaea 7312
958 nmdc:mga05p37_28043_c1 3300050507 Archaea 6862
959 nmdc:mga05p37_3051_c1 3300050507 Archaea 19452
960 nmdc:mga05p37_372009_c1 3300050507 Bacteria 1677
961 nmdc:mga09592_10046_c1 3300050508 Archaea 7696
962 nmdc:mga09592_24515_c1 3300050508 Archaea 4990
963 nmdc:mga09592_27189_c1 3300050508 Archaea 4747
964 nmdc:mga09592_42699_c1 3300050508 Archaea 3814
965 nmdc:mga09592_95_c2 3300050508 Archaea 46011
966 nmdc:mga0qj67_11154_c1 3300050509 Archaea 6729
967 nmdc:mga0qj67_24319_c1 3300050509 Archaea 4669
968 nmdc:mga0qj67_307704_c1 3300050509 Archaea 1284
969 nmdc:mga0qj67_311156_c1 3300050509 Archaea 1275
970 nmdc:mga0qj67_394_c1 3300050509 Archaea 30177
971 nmdc:mga0qj67_431_c1 3300050509 Archaea 28675
972 nmdc:mga0qj67_442946_c1 3300050509 Archaea 1047
973 nmdc:mga06r32_1600_c2 3300050510 Archaea 3434
974 nmdc:mga06r32_28389_c1 3300050510 Archaea 5235
975 nmdc:mga06r32_3454_c1 3300050510 Archaea 14113
976 nmdc:mga08y16_247_c1 3300050511 Archaea 48634
977 nmdc:mga08y16_24948_c1 3300050511 Archaea 6307
978 nmdc:mga08y16_4120_c1 3300050511 Archaea 15171
979 nmdc:mga08y16_4323_c1 3300050511 Archaea 14844
980 nmdc:mga08y16_511512_c1 3300050511 Bacteria 1219
981 nmdc:mga08y16_589213_c1 3300050511 Archaea 1122
982 nmdc:mga08y16_630876_c1 3300050511 Archaea 1078
983 nmdc:mga08y16_760_c1 3300050511 Archaea 30701
984 nmdc:mga08y16_81557_c1 3300050511 Archaea 3372
985 nmdc:mga0n895_209909_c1 3300050512 Unclassified 1978
986 nmdc:mga0n895_40936_c1 3300050512 Archaea 4503
987 nmdc:mga0n895_44839_c1 3300050512 Archaea 4313
988 nmdc:mga0n895_486816_c1 3300050512 Bacteria 1244
989 nmdc:mga0n895_74479_c1 3300050512 Archaea 3373
990 nmdc:mga0n895_85_c1 3300050512 Archaea 54204
991 nmdc:mga0n895_9905_c1 3300050512 Archaea 8381
992 nmdc:mga0rr50_111299_c1 3300050513 Unclassified 2167
993 nmdc:mga0rr50_1350_c1 3300050513 Archaea 13403
994 nmdc:mga0rr50_40548_c1 3300050513 Archaea 3386
995 nmdc:mga0rr50_44742_c1 3300050513 Archaea 3249
996 nmdc:mga0rr50_50238_c1 3300050513 Archaea 3090
997 nmdc:mga08x19_161311_c1 3300050514 Unclassified 1523
998 nmdc:mga08x19_3912_c1 3300050514 Archaea 8862
999 nmdc:mga0a205_111660_c1 3300050515 Unclassified 2633
1000 nmdc:mga0a205_13918_c1 3300050515 Archaea 7502
1001 nmdc:mga0a205_16095_c1 3300050515 Archaea 7002
1002 nmdc:mga0a205_3700_c1 3300050515 Archaea 13681
1003 nmdc:mga0a205_429976_c1 3300050515 Bacteria 1182
1004 Ga0495601_0019182 3300053077 Bacteria 4169
1005 Ga0495612_0044914 3300053078 Archaea 1808
1006 Ga0500635_0003410 3300053080 Bacteria 3997
1007 Ga0495619_0000244 3300053085 Archaea 39596
1008 Ga0500647_0154457 3300053091 Bacteria 1069
1009 Ga0500566_0010812 3300053094 Bacteria 5378
1010 Ga0500640_024786 3300053095 Bacteria 2607
1011 Ga0500554_000069 3300053102 Bacteria 18724
1012 Ga0500572_001885 3300053111 Bacteria 5286
1013 Ga0500595_000335 3300053119 Bacteria 30890
1014 Ga0500614_000221 3300053123 Bacteria 14976
1015 Ga0500585_033147 3300053144 Bacteria 1790
1016 Ga0500603_017212 3300053150 Bacteria 1724
1017 Ga0501084_0000255 3300054114 Archaea 40285
1018 Ga0501084_0004182 3300054114 Archaea 11772
1019 Ga0501084_0010674 3300054114 Archaea 7603
1020 Ga0501084_0079858 3300054114 Archaea 2742
1021 Ga0501084_0718464 3300054114 Unclassified 842
1022 Ga0590071_001011 3300059421 Archaea 7666
1023 Ga0590071_032337 3300059421 Unclassified 1249
1024 Ga0590074_000962 3300059423 Archaea 4518
1025 Ga0590075_003379 3300059424 Archaea 3801
1026 Ga0590075_006181 3300059424 Bacteria 2838
1027 Ga0587073_0038596 3300059492 Bacteria 1029
1028 Ga0587092_016341 3300059512 Archaea 1097
1029 Ga0587067_010665 3300059640 Bacteria 1398
1030 Ga0501082_0000911 3300060353 Archaea 26045
1031 Ga0501082_0002467 3300060353 Archaea 16236
1032 Ga0501082_0002512 3300060353 Archaea 16052
1033 Ga0501082_0005051 3300060353 Archaea 11505
1034 Ga0501082_0006803 3300060353 Archaea 9881
1035 Ga0501082_0052616 3300060353 Bacteria 3510
1036 Ga0501082_0084966 3300060353 Archaea 2729
1037 Ga0501082_0104310 3300060353 Archaea 2452
1038 Ga0501082_0162221 3300060353 Archaea 1943
1039 Ga0501082_0495905 3300060353 Bacteria 1067
1040 Ga0530510_0001088 3300061734 Archaea 18014
1041 Ga0530510_0002940 3300061734 Archaea 11685
1042 Ga0530510_0009999 3300061734 Archaea 6654
1043 Ga0530510_0024427 3300061734 Archaea 4311
1044 Ga0530510_0124132 3300061734 Unclassified 1897
1045 Ga0530510_0271154 3300061734 Archaea 1266
1046 2937894813 2937891427 Bacteria 6357007
1047 Ga0075431_100062404
1048 MBSR1b_contig_3938206
1049 2214683817
1050 ARSoilYngRDRAFT_c00027
1051 ARcpr5yngRDRAFT_c000028
1052 ARSoilOldRDRAFT_c000043
1053 ARCol0oldRDRAFT_c00010
1054 ARCol0yngRDRAFT_1000291
1055 JGI24746J21847_1000879
1056 JGI24740J21852_10030744
1057 JGI24739J22299_10000660
1058 JGI24739J22299_10085727
1059 JGI24737J22298_10035484
1060 JGI24033J26618_1002893
1061 JGI24033J26618_1007951
1062 JGI24742J22300_10006365
1063 JGI26129J50193_1000020
1064 JGI26145J50221_1000007
1065 JGI26144J50225_100026
1066 JGI26139J50223_100001
1067 JGI26140J50224_100003
1068 JGI26134J50242_100053
1069 JGI26137J50245_100201
1070 JGI26130J50248_100164
1071 JGI26136J50244_100009
1072 JGI26141J51220_1000079
1073 JGI26138J51218_100001
1074 Ga0007417J51691_1047715
1075 Ga0007410J51695_1034200
1076 Ga0007429J51699_1088431
1077 Ga0032354_1010548
1078 JGI25405J52794_10000256
1079 Ga0058861_10064932
1080 Ga0058862_10131613
1081 Ga0058862_12692810
1082 Ga0065717_1000042
1083 Ga0065716_1000050
1084 Ga0065704_10002382
1085 Ga0065704_10008712
1086 Ga0065704_10010785
1087 Ga0065704_10090895
1088 Ga0065712_10000465
1089 Ga0065715_10000262
1090 Ga0065715_10000267
1091 Ga0065715_10002844
1092 Ga0065707_10000622
1093 Ga0070658_10015386
1094 Ga0070658_10416576
1095 Ga0070676_10002475
1096 Ga0070676_10006070
1097 Ga0070676_10105476
1098 Ga0070683_100036978
1099 Ga0070683_100164046
1100 Ga0070683_100429583
1101 Ga0070670_100007910
1102 Ga0070670_100010069
1103 Ga0070670_100308264
1104 Ga0068869_100000470
1105 Ga0068869_100013500
1106 Ga0068869_100027468
1107 Ga0070680_100002022
1108 Ga0070680_100060861
1109 Ga0070680_100071782
1110 Ga0070682_100003748
1111 Ga0070682_100043310
1112 Ga0070682_100603339
1113 Ga0068868_100009247
1114 Ga0068868_100009403
1115 Ga0068868_100010690
1116 Ga0068868_100289348
1117 Ga0070660_100038011
1118 Ga0070660_100323698
1119 Ga0070660_100410706
1120 Ga0070689_100351182
1121 Ga0070687_100048107
1122 Ga0070661_100008612
1123 Ga0070692_10044759
1124 Ga0070692_10212621
1125 Ga0070668_100003204
1126 Ga0070668_100051744
1127 Ga0070669_100267988
1128 Ga0070675_100005051
1129 Ga0070675_100174538
1130 Ga0070674_100032296
1131 Ga0070674_100102281
1132 Ga0070673_100001003
1133 Ga0070673_100107554
1134 Ga0070673_100151382
1135 Ga0070659_100128135
1136 Ga0070659_100145859
1137 Ga0070659_100352959
1138 Ga0070659_100375535
1139 Ga0070659_100390310
1140 Ga0070709_10006735
1141 Ga0070714_100025498
1142 Ga0070714_100082970
1143 Ga0070710_10024672
1144 Ga0070710_10034001
1145 Ga0070701_10011812
1146 Ga0070701_10024247
1147 Ga0070711_100001153
1148 Ga0070711_100043440
1149 Ga0070711_100068021
1150 Ga0070705_100002666
1151 Ga0070705_100008454
1152 Ga0070705_100231096
1153 Ga0070700_100027059
1154 Ga0070700_100027408
1155 Ga0070700_100036934
1156 Ga0070700_100300371
1157 Ga0070694_100000011
1158 Ga0070694_100000014
1159 Ga0070708_100004719
1160 Ga0070708_100038812
1161 Ga0070708_100299649
1162 Ga0070708_100402327
1163 Ga0070708_100631731
1164 Ga0070678_100131508
1165 Ga0070678_100463518
1166 Ga0070662_100002213
1167 Ga0070681_10011002
1168 Ga0070681_10032868
1169 Ga0070681_10330582
1170 Ga0070681_10405206
1171 Ga0068867_100002683
1172 Ga0068867_100002794
1173 Ga0070706_100003766
1174 Ga0070706_100224685
1175 Ga0070707_100010733
1176 Ga0070707_100012976
1177 Ga0070707_100017794
1178 Ga0070698_100002987
1179 Ga0070698_100088751
1180 Ga0070698_100297796
1181 Ga0070699_100037988
1182 Ga0070699_100048991
1183 Ga0070699_100104182
1184 Ga0070679_100000115
1185 Ga0070679_100051369
1186 Ga0070684_100030616
1187 Ga0070684_100544383
1188 Ga0070697_100009494
1189 Ga0070697_100045002
1190 Ga0070697_100301333
1191 Ga0070672_100001378
1192 Ga0070672_100020700
1193 Ga0070672_100050605
1194 Ga0070686_100005335
1195 Ga0070695_100009282
1196 Ga0070695_100032062
1197 Ga0070695_100065883
1198 Ga0070695_100136523
1199 Ga0070695_100487251
1200 Ga0070696_100000853
1201 Ga0070696_100008890
1202 Ga0070696_100127775
1203 Ga0070693_100001334
1204 Ga0070693_100011960
1205 Ga0070693_100127240
1206 Ga0070693_100148270
1207 Ga0070704_100012508
1208 Ga0070704_100017373
1209 Ga0070704_100338482
1210 Ga0068855_100040492
1211 Ga0070664_100003163
1212 Ga0070664_100249365
1213 Ga0070664_100520167
1214 Ga0068854_100012005
1215 Ga0068854_100081758
1216 Ga0068856_100003600
1217 Ga0068856_100088375
1218 Ga0070702_100011237
1219 Ga0070702_100016396
1220 Ga0070702_100021476
1221 Ga0070702_100050224
1222 Ga0070702_100076445
1223 Ga0068852_100022997
1224 Ga0068852_100274994
1225 Ga0068859_100050668
1226 Ga0068864_100004153
1227 Ga0068864_100004669
1228 Ga0068864_100038148
1229 Ga0068864_100418281
1230 Ga0068866_10011043
1231 Ga0068870_10010441
1232 Ga0068870_10040564
1233 Ga0068870_10256893
1234 Ga0068860_100008980
1235 Ga0068860_100014847
1236 Ga0068860_100408152
1237 Ga0068862_100025409
1238 Ga0068862_100061912
1239 Ga0068862_100469196
1240 Ga0081455_10007199
1241 Ga0081455_10010035
1242 Ga0081538_10000314
1243 Ga0081538_10003117
1244 Ga0081538_10016951
1245 Ga0081538_10076806
1246 Ga0070717_10242912
1247 Ga0075365_10016836
1248 Ga0075365_10071206
1249 Ga0075432_10003737
1250 Ga0075432_10007661
1251 Ga0075432_10040718
1252 Ga0070715_10002118
1253 Ga0070716_100000060
1254 Ga0070716_100026372
1255 Ga0070712_100025948
1256 Ga0070712_100079924
1257 Ga0070712_100357863
1258 Ga0097621_100009133
1259 Ga0097621_100254868
1260 Ga0068871_100053767
1261 Ga0068871_100065952
1262 Ga0068871_100093872
1263 Ga0075428_100001101
1264 Ga0075428_100005532
1265 Ga0075428_100016775
1266 Ga0075428_100063807
1267 Ga0075428_100147155
1268 Ga0075428_100235106
1269 Ga0075428_100240454
1270 Ga0075428_100269567
1271 Ga0075430_100004105
1272 Ga0075430_100032036
1273 Ga0075430_100080655
1274 Ga0075430_100085811
1275 Ga0075430_100129111
1276 Ga0075430_100315379
1277 Ga0075431_100000716
1278 Ga0075431_100120724
1279 Ga0075431_100352930
1280 Ga0075431_100477632
1281 Ga0075431_100577754
1282 Ga0075431_100722302
1283 Ga0075433_10006758
1284 Ga0075433_10009753
1285 Ga0075433_10014579
1286 Ga0075433_10032504
1287 Ga0075434_100001997
1288 Ga0075434_100043651
1289 Ga0075434_100048742
1290 Ga0075434_100052079
1291 Ga0075434_100083916
1292 Ga0075429_100000182
1293 Ga0075429_100011916
1294 Ga0075429_100022952
1295 Ga0075429_100041343
1296 Ga0075429_100164766
1297 Ga0068865_100048813
1298 Ga0075436_100000163
1299 Ga0075436_100017606
1300 Ga0075436_100070974
1301 Ga0097620_100050669
1302 Ga0075435_100014858
1303 Ga0075435_100018049
1304 Ga0075435_100034510
1305 Ga0075435_100037856
1306 Ga0075435_100157794
1307 Ga0075435_100277138
1308 Ga0105240_10009429
1309 Ga0111539_10000714
1310 Ga0111539_10011624
1311 Ga0111539_10055682
1312 Ga0111539_10063762
1313 Ga0111539_10070485
1314 Ga0111539_10658878
1315 Ga0111539_11157833
1316 Ga0111539_11192868
1317 Ga0105245_10039085
1318 Ga0105245_10607414
1319 Ga0114129_10000060
1320 Ga0114129_10000984
1321 Ga0114129_10001050
1322 Ga0114129_10002941
1323 Ga0114129_10005212
1324 Ga0114129_10040269
1325 Ga0114129_10098990
1326 Ga0114129_10260048
1327 Ga0114129_10453909
1328 Ga0114129_10459471
1329 Ga0114129_10459818
1330 Ga0114129_10860551
1331 Ga0105241_10573887
1332 Ga0105242_10135528
1333 Ga0105242_10579627
1334 Ga0105237_10017109
1335 Ga0105237_10048905
1336 Ga0105249_10000864
1337 Ga0105249_10138977
1338 Ga0105249_10213146
1339 Ga0105239_10026316
1340 Ga0105239_10030132
1341 Ga0105239_10083755
1342 Ga0105246_10000379
1343 Ga0105246_10015805
1344 Ga0105246_10167542
1345 Ga0105246_10260225
1346 Ga0157317_1000035
1347 Ga0157336_1000002
1348 Ga0157346_1000002
1349 Ga0157320_1000001
1350 Ga0157318_1001096
1351 Ga0157325_1000004
1352 Ga0157329_1000034
1353 Ga0157335_1000009
1354 Ga0157341_1000025
1355 Ga0157323_1000018
1356 Ga0157319_1000054
1357 Ga0157345_1000221
1358 Ga0157314_1002659
1359 Ga0157313_1000001
1360 Ga0157339_1000004
1361 Ga0157324_1000120
1362 Ga0157342_1000004
1363 Ga0157315_1000002
1364 Ga0157316_1000279
1365 Ga0157327_1000001
1366 Ga0157338_1000003
1367 Ga0157373_10138708
1368 Ga0157371_10003989
1369 Ga0157371_10132591
1370 Ga0157370_10031680
1371 Ga0157369_10016227
1372 Ga0157369_10511785
1373 Ga0157374_10009577
1374 Ga0157374_10314738
1375 Ga0157378_10000658
1376 Ga0157378_10001020
1377 Ga0157378_10007779
1378 Ga0157378_10537581
1379 Ga0163162_10007817
1380 Ga0163162_10031699
1381 Ga0157372_10005598
1382 Ga0157372_10088125
1383 Ga0157375_10007347
1384 Ga0157375_10126597
1385 Ga0163163_10304298
1386 Ga0157380_10404863
1387 Ga0157380_10796883
1388 Ga0182008_10001029
1389 Ga0182008_10002897
1390 Ga0182008_10007192
1391 Ga0182008_10065926
1392 Ga0157377_10023285
1393 Ga0157377_10208252
1394 Ga0157376_10589905
1395 Ga0182006_1024761
1396 Ga0182007_10002823
1397 Ga0206356_10252989
1398 Ga0206349_1231071
1399 Ga0206349_1329635
1400 Ga0206355_1101130
1401 Ga0206355_1360124
1402 Ga0206351_10572467
1403 Ga0206351_10770016
1404 Ga0206352_10309879
1405 Ga0206352_10894037
1406 Ga0206350_11442193
1407 Ga0206350_11608681
1408 Ga0206354_11108938
1409 Ga0206354_11257073
1410 Ga0206353_10924154
1411 Ga0206353_11663780
1412 Ga0213876_10197185
1413 Ga0224712_10016965
1414 Ga0224712_10021568
1415 Ga0224712_10101020
1416 Ga0207697_10000311
1417 Ga0207692_10110784
1418 Ga0207692_10181615
1419 Ga0207642_10009374
1420 Ga0207688_10000285
1421 Ga0207688_10057053
1422 Ga0207647_10000254
1423 Ga0207647_10010744
1424 Ga0207647_10013305
1425 Ga0207685_10004616
1426 Ga0207645_10000453
1427 Ga0207645_10001395
1428 Ga0207645_10003378
1429 Ga0207645_10027474
1430 Ga0207643_10000060
1431 Ga0207643_10000151
1432 Ga0207643_10002512
1433 Ga0207705_10142286
1434 Ga0207684_10225183
1435 Ga0207654_10170627
1436 Ga0207707_10008421
1437 Ga0207707_10066079
1438 Ga0207707_10405908
1439 Ga0207695_10056272
1440 Ga0207671_10028051
1441 Ga0207671_10316117
1442 Ga0207693_10000933
1443 Ga0207693_10130498
1444 Ga0207693_10322166
1445 Ga0207663_10007639
1446 Ga0207663_10036568
1447 Ga0207663_10041825
1448 Ga0207660_10014729
1449 Ga0207660_10030416
1450 Ga0207660_10048635
1451 Ga0207662_10000395
1452 Ga0207662_10163836
1453 Ga0207657_10151099
1454 Ga0207657_10174390
1455 Ga0207657_10299874
1456 Ga0207649_10196737
1457 Ga0207652_10048500
1458 Ga0207652_10073851
1459 Ga0207646_10010814
1460 Ga0207646_10039394
1461 Ga0207646_10080632
1462 Ga0207681_10000226
1463 Ga0207650_10002804
1464 Ga0207650_10010770
1465 Ga0207650_10063392
1466 Ga0207650_10310286
1467 Ga0207659_10005569
1468 Ga0207659_10156110
1469 Ga0207700_10131473
1470 Ga0207664_10036125
1471 Ga0207664_10091021
1472 Ga0207690_10322609
1473 Ga0207690_10428374
1474 Ga0207706_10003483
1475 Ga0207706_10053573
1476 Ga0207686_10021272
1477 Ga0207669_10059192
1478 Ga0207704_10204338
1479 Ga0207665_10000484
1480 Ga0207665_10004562
1481 Ga0207665_10053942
1482 Ga0207665_10091194
1483 Ga0207691_10000831
1484 Ga0207691_10001470
1485 Ga0207689_10000099
1486 Ga0207689_10000924
1487 Ga0207689_10030663
1488 Ga0207661_10175753
1489 Ga0207661_10226267
1490 Ga0207661_10386906
1491 Ga0207679_10176324
1492 Ga0207667_10119084
1493 Ga0207651_10059869
1494 Ga0207651_10190138
1495 Ga0207712_10022945
1496 Ga0207712_10050754
1497 Ga0207712_10243424
1498 Ga0207668_10083887
1499 Ga0207668_10290266
1500 Ga0207640_10123789
1501 Ga0207640_10157803
1502 Ga0207677_10030192
1503 Ga0207677_10053781
1504 Ga0207677_10165652
1505 Ga0207677_10271265
1506 Ga0207677_10464635
1507 Ga0207703_10012376
1508 Ga0207639_10086625
1509 Ga0207678_10070203
1510 Ga0207678_10076963
1511 Ga0207708_10000211
1512 Ga0207708_10004526
1513 Ga0207708_10035024
1514 Ga0207702_10032169
1515 Ga0207648_10001089
1516 Ga0207648_10009197
1517 Ga0207648_10053957
1518 Ga0207676_10006725
1519 Ga0207676_10198813
1520 Ga0207674_10003384
1521 Ga0207683_10012211
1522 Ga0207683_10319757
1523 Ga0207698_10055078
1524 Ga0207698_10249665
1525 Ga0209969_1000388
1526 Ga0209967_1000443
1527 Ga0209967_1000592
1528 Ga0209981_1000005
1529 Ga0209996_1000197
1530 Ga0209984_1000037
1531 Ga0209984_1001042
1532 Ga0210000_1001171
1533 Ga0209995_1000528
1534 Ga0209968_1001146
1535 Ga0209999_1002617
1536 Ga0209982_1000804
1537 Ga0209982_1001651
1538 Ga0209970_1001561
1539 Ga0209970_1012441
1540 Ga0210002_1000911
1541 Ga0210002_1003717
1542 Ga0209983_1003333
1543 Ga0209971_1002058
1544 Ga0209966_1000233
1545 Ga0209998_10000526
1546 Ga0209998_10001715
1547 Ga0209974_10000209
1548 Ga0209974_10008784
1549 Ga0207428_10000170
1550 Ga0207428_10000230
1551 Ga0207428_10000434
1552 Ga0207428_10000478
1553 Ga0207428_10030272
1554 Ga0268265_10009870
1555 Ga0268264_10010217
1556 Ga0268264_10036432
1557 Ga0307515_10051621
1558 Ga0307513_10020653
1559 Ga0307509_10000035
1560 Ga0307408_100264296
1561 Ga0307408_100317712
1562 Ga0265313_10025066
1563 Ga0265342_10063742
1564 Ga0316576_10002213
1565 Ga0316578_10088484
1566 Ga0316578_10091204
1567 Ga0307516_10037063
1568 Ga0307405_10003058
1569 Ga0316577_10002196
1570 Ga0316577_10031802
1571 Ga0316577_10150552
1572 Ga0307413_10018924
1573 Ga0307410_10000350
1574 Ga0307410_10208265
1575 Ga0307406_10008698
1576 Ga0307407_10000866
1577 Ga0307412_10008929
1578 Ga0307412_10223901
1579 Ga0307409_100005524
1580 Ga0307409_100018366
1581 Ga0307409_100270764
1582 Ga0307416_100000573
1583 Ga0307416_100014241
1584 Ga0307416_100045892
1585 Ga0307416_100121561
1586 Ga0307414_10005689
1587 Ga0307411_10075622
1588 Ga0307415_100006283
1589 Ga0307415_100120122
1590 Ga0307415_100131263
1591 Ga0307415_100415446
1592 Ga0373948_0004062
1593 Ga0373940_0004054
1594 Ga0373939_0001601
1595 Ga0373939_0002258
1596 Ga0373953_0000078
1597 Ga0373954_0000473
1598 Ga0373956_0004393
1599 Ga0373960_0002560
1600 Ga0373955_0000142
1601 Ga0373961_0003063
1602 Ga0373961_0021242
1603 Ga0373962_0000694
1604 Ga0316574_0025988
1605 Ga0373924_0003877
1606 Ga0373931_0011111
1607 Ga0373935_0239816
1608 Ga0373933_0000008
1609 Ga0373947_0029346
1610 Ga0373947_0160344
1611 Ga0373937_0000366
1612 Ga0316584_0010391
1613 Ga0316584_0082879
1614 Ga0316584_0304767
1615 Ga0373925_0115416
1616 Ga0373925_0118249
1617 Ga0395898_0108900
1618 Ga0395905_0041319
1619 Ga0242419_000090
1620 Ga0242419_000592
1621 Ga0242420_000010
1622 Ga0242420_014030
1623 Ga0436365_0144313
1624 Ga0436365_1203833
1625 Ga0439439_0001669
1626 Ga0439439_0025164
1627 Ga0439453_0001453
1628 Ga0439453_0004005
1629 Ga0439461_0005067
1630 Ga0451839_0106539
1631 Ga0439437_000034
1632 Ga0439441_000011
1633 Ga0439443_000163
1634 Ga0439448_0061773
1635 Ga0439448_0070235
1636 Ga0439432_026994
1637 Ga0439451_000486
1638 Ga0439452_010733
1639 Ga0439454_000015
1640 Ga0439455_0001879
1641 Ga0439456_000998
1642 Ga0439462_0013237
1643 Ga0450888_002660
1644 Ga0450906_008535
1645 Ga0450910_010005
1646 Ga0439458_0005537
1647 Ga0450908_018800
1648 Ga0439434_0002145
1649 Ga0439435_0000032
1650 Ga0439444_0000005
1651 Ga0439459_0011300
1652 Ga0439464_0000149
1653 Ga0439460_0000288
1654 Ga0450893_0001103
1655 Ga0450893_0005166
1656 Ga0451577_0032342
1657 Ga0439440_0000359
1658 Ga0439440_0005126
1659 Ga0453683_0055401
1660 Ga0453684_0048600
1661 Ga0451576_0014887
1662 Ga0466967_0023655
1663 Ga0466967_0587733
1664 Ga0495592_0023477
1665 Ga0495592_0047399
1666 Ga0495651_0000732
1667 Ga0495651_0022789
1668 Ga0495653_0000687
1669 Ga0495580_0044948
1670 Ga0495662_0000203
1671 Ga0495584_0060375
1672 Ga0495585_0036932
1673 Ga0495608_0000506
1674 Ga0495608_0097902
1675 Ga0495628_0008786
1676 Ga0495628_0025364
1677 Ga0495630_0143048
1678 Ga0495666_0014797
1679 Ga0495652_0002041
1680 Ga0495652_0129618
1681 Ga0495665_0001512
1682 Ga0495640_0065390
1683 Ga0495587_0003246
1684 Ga0495587_0028602
1685 Ga0495587_0266653
1686 Ga0495645_0018255
1687 Ga0495645_0044836
1688 Ga0495667_0002226
1689 Ga0495667_0018712
1690 Ga0495656_0070721
1691 Ga0495634_0023433
1692 Ga0495611_0054823
1693 Ga0495635_0023984
1694 Ga0495657_0071787
1695 Ga0495599_0010628
1696 Ga0495599_0010849
1697 Ga0495623_0008181
1698 Ga0495623_0031866
1699 Ga0495646_0021711
1700 Ga0495646_0022594
1701 Ga0495613_0072208
1702 Ga0495624_0294043
1703 Ga0495670_0223110
1704 Ga0495600_0022553
1705 Ga0495604_0000409
1706 Ga0495604_0036509
1707 Ga0495636_0040412
1708 Ga0495674_0019998
1709 Ga0495674_0393698
1710 Ga0495675_0005264
1711 Ga0495675_0011732
1712 Ga0495684_0005230
1713 Ga0495593_0032649
1714 Ga0495602_0000563
1715 Ga0496100_0009999
1716 Ga0496100_0041870
1717 Ga0496101_0019009
1718 Ga0496101_0192351
1719 Ga0496102_0026567
1720 Ga0496103_0163795
1721 Ga0496103_0176400
1722 Ga0496104_0029650
1723 Ga0496104_0577828
1724 Ga0496106_0004562
1725 Ga0496106_0009260
1726 Ga0496106_0015600
1727 Ga0496106_0018842
1728 Ga0496106_0038357
1729 Ga0496107_0004214
1730 Ga0496107_0035492
1731 Ga0496107_0052976
1732 Ga0496110_0343541
1733 Ga0496110_0441296
1734 Ga0496112_0000371
1735 Ga0496112_0147514
1736 Ga0496113_0213069
1737 Ga0496114_0547200
1738 Ga0501306_000201
1739 Ga0501309_000625
1740 Ga0501290_008124
1741 Ga0501292_001749
1742 Ga0501295_002610
1743 Ga0501299_003004
1744 Ga0501300_014513
1745 Ga0501311_000596
1746 Ga0501320_000173
1747 Ga0501321_002443
1748 Ga0501324_002469
1749 Ga0501325_007182
1750 Ga0501031_0000732
1751 Ga0501031_0024202
1752 Ga0501031_0043459
1753 Ga0501031_0062207
1754 Ga0501031_0157135
1755 Ga0501032_0003729
1756 Ga0501032_0021894
1757 Ga0501032_0065449
1758 Ga0501033_0029014
1759 Ga0501033_0045599
1760 Ga0501033_0045632
1761 Ga0501033_0089419
1762 Ga0501034_0015017
1763 Ga0501034_0618592
1764 Ga0501036_0001615
1765 Ga0501036_0009162
1766 Ga0501036_0010176
1767 Ga0501036_0019748
1768 Ga0501036_0050808
1769 Ga0501036_0074106
1770 Ga0501036_0135611
1771 Ga0501036_0228254
1772 Ga0501037_0009373
1773 Ga0501037_0010653
1774 Ga0501037_0015420
1775 Ga0501037_0033967
1776 Ga0501037_0118577
1777 Ga0501037_0132436
1778 Ga0501037_0224652
1779 Ga0501038_0002516
1780 Ga0501038_0012125
1781 Ga0501038_0029378
1782 Ga0501038_0031684
1783 Ga0501038_0092243
1784 Ga0501038_0111050
1785 Ga0501039_0002987
1786 Ga0501039_0003982
1787 Ga0501039_0005528
1788 Ga0501039_0006334
1789 Ga0501039_0008366
1790 Ga0501039_0021198
1791 Ga0501039_0052885
1792 Ga0501039_0063454
1793 Ga0501039_0079726
1794 Ga0501039_0193511
1795 Ga0501039_0210451
1796 Ga0501040_0000522
1797 Ga0501040_0001037
1798 Ga0501040_0003666
1799 Ga0501040_0009081
1800 Ga0501040_0011874
1801 Ga0501040_0015676
1802 Ga0501040_0061110
1803 Ga0501040_0095891
1804 Ga0501040_0173509
1805 Ga0501040_0213895
1806 Ga0501041_0000049
1807 Ga0501041_0001792
1808 Ga0501041_0002791
1809 Ga0501041_0003070
1810 Ga0501041_0009137
1811 Ga0501041_0036823
1812 Ga0501041_0073596
1813 Ga0501041_0136815
1814 Ga0501041_0200215
1815 Ga0501042_0001062
1816 Ga0501042_0002359
1817 Ga0501042_0003918
1818 Ga0501042_0005794
1819 Ga0501042_0008563
1820 Ga0501042_0009756
1821 Ga0501042_0019473
1822 Ga0501042_0019719
1823 Ga0501042_0029430
1824 Ga0501042_0029894
1825 Ga0501042_0041952
1826 Ga0501042_0177337
1827 Ga0501042_0180492
1828 Ga0501042_0507024
1829 Ga0501043_0002242
1830 Ga0501043_0003729
1831 Ga0501043_0080464
1832 Ga0501043_0087547
1833 Ga0501043_0103405
1834 Ga0501046_0004008
1835 Ga0501046_0004335
1836 Ga0501046_0004407
1837 Ga0501046_0005600
1838 Ga0501046_0022591
1839 Ga0501046_0027570
1840 Ga0501046_0087217
1841 Ga0501046_0108804
1842 Ga0501046_0111895
1843 Ga0501046_0261697
1844 Ga0501046_0336547
1845 Ga0501047_0064186
1846 Ga0501048_0000173
1847 Ga0501048_0003527
1848 Ga0501048_0005202
1849 Ga0501048_0005390
1850 Ga0501048_0008790
1851 Ga0501048_0014446
1852 Ga0501048_0045878
1853 Ga0501048_0064855
1854 Ga0501048_0088759
1855 Ga0501048_0092684
1856 Ga0501067_0208779
1857 Ga0501068_0033518
1858 Ga0501068_0147754
1859 Ga0501069_0102064
1860 Ga0501069_0158681
1861 Ga0501070_0316031
1862 Ga0501071_0000039
1863 Ga0501071_0000076
1864 Ga0501071_0005819
1865 Ga0501071_0013544
1866 Ga0501071_0022839
1867 Ga0501071_0065743
1868 Ga0501071_0149584
1869 Ga0501071_0304310
1870 Ga0501071_0344651
1871 Ga0501072_0000103
1872 Ga0501072_0000154
1873 Ga0501072_0000305
1874 Ga0501072_0005539
1875 Ga0501072_0017257
1876 Ga0501072_0027018
1877 Ga0501072_0129607
1878 Ga0501073_0030935
1879 Ga0501074_0003257
1880 Ga0501074_0011358
1881 Ga0501074_0049431
1882 Ga0501074_0075603
1883 Ga0501074_0080193
1884 Ga0501074_0138068
1885 Ga0501075_0001024
1886 Ga0501075_0001887
1887 Ga0501075_0002197
1888 Ga0501075_0009145
1889 Ga0501075_0009237
1890 Ga0501075_0010848
1891 Ga0501075_0015069
1892 Ga0501075_0041492
1893 Ga0501075_0058485
1894 Ga0501076_0000112
1895 Ga0501076_0001114
1896 Ga0501076_0001381
1897 Ga0501076_0004638
1898 Ga0501076_0057891
1899 Ga0501076_0074478
1900 Ga0501076_0091190
1901 Ga0501076_0095319
1902 Ga0501076_0127986
1903 Ga0501076_0494824
1904 Ga0501077_0003175
1905 Ga0501077_0003341
1906 Ga0501077_0005272
1907 Ga0501077_0007543
1908 Ga0501198_000263
1909 Ga0501199_000697
1910 Ga0501199_002490
1911 Ga0501208_000104
1912 Ga0501209_001078
1913 Ga0501211_002614
1914 Ga0501214_000140
1915 Ga0501216_000905
1916 Ga0501217_000155
1917 Ga0501217_000793
1918 Ga0501222_013902
1919 Ga0501223_016812
1920 Ga0501224_001811
1921 Ga0501227_001241
1922 Ga0501230_003282
1923 Ga0501233_000095
1924 Ga0501235_002705
1925 Ga0501235_007946
1926 Ga0501238_003812
1927 Ga0501242_005589
1928 Ga0501243_000728
1929 Ga0501248_000361
1930 Ga0501249_003466
1931 Ga0501251_001520
1932 Ga0501253_000066
1933 Ga0501253_036119
1934 Ga0501255_011379
1935 Ga0501256_001408
1936 Ga0501257_001247
1937 Ga0501259_001302
1938 Ga0501259_032521
1939 Ga0501261_000215
1940 Ga0501219_002606
1941 Ga0501221_000092
1942 Ga0501221_003532
1943 Ga0501225_0002619
1944 Ga0501225_0014777
1945 Ga0501234_001112
1946 Ga0501245_000733
1947 Ga0501079_0001993
1948 Ga0501079_0006902
1949 Ga0501079_0020550
1950 Ga0501079_0047480
1951 Ga0501079_0057067
1952 Ga0501079_0125263
1953 Ga0501079_0187134
1954 Ga0501080_0001244
1955 Ga0501080_0023384
1956 Ga0501080_0026284
1957 Ga0501080_0030093
1958 Ga0501080_0176169
1959 Ga0501080_0306761
1960 Ga0501080_0318252
1961 Ga0501081_0001183
1962 Ga0501081_0003108
1963 Ga0501081_0003709
1964 Ga0501081_0007550
1965 Ga0501081_0023561
1966 Ga0501081_0026950
1967 Ga0501081_0035200
1968 Ga0501081_0046882
1969 Ga0501081_0052314
1970 Ga0501083_0065165
1971 Ga0501241_016410
1972 Ga0501266_000220
1973 Ga0501269_001972
1974 Ga0501270_002884
1975 Ga0501271_000127
1976 Ga0501280_003241
1977 Ga0501281_01729
1978 Ga0501283_020443
1979 Ga0501035_0012685
1980 Ga0501035_0020888
1981 Ga0501035_0025287
1982 Ga0501035_0172492
1983 Ga0501044_0002572
1984 Ga0501044_0069460
1985 Ga0501044_0162250
1986 Ga0501044_0218506
1987 Ga0501045_0000285
1988 Ga0501045_0000794
1989 Ga0501045_0001311
1990 Ga0501045_0002609
1991 Ga0501045_0006818
1992 Ga0501045_0044597
1993 Ga0501045_0049329
1994 Ga0501045_0074077
1995 Ga0501204_000029
1996 Ga0501212_000656
1997 Ga0501212_002705
1998 nmdc:mga0yw44_33768_c1
1999 nmdc:mga05p37_110477_c1
2000 nmdc:mga05p37_11214_c1
2001 nmdc:mga05p37_1209_c1
2002 nmdc:mga05p37_23771_c1
2003 nmdc:mga05p37_24652_c1
2004 nmdc:mga05p37_28043_c1
2005 nmdc:mga05p37_3051_c1
2006 nmdc:mga05p37_372009_c1
2007 nmdc:mga09592_10046_c1
2008 nmdc:mga09592_24515_c1
2009 nmdc:mga09592_27189_c1
2010 nmdc:mga09592_42699_c1
2011 nmdc:mga09592_95_c2
2012 nmdc:mga0qj67_11154_c1
2013 nmdc:mga0qj67_24319_c1
2014 nmdc:mga0qj67_307704_c1
2015 nmdc:mga0qj67_311156_c1
2016 nmdc:mga0qj67_394_c1
2017 nmdc:mga0qj67_431_c1
2018 nmdc:mga0qj67_442946_c1
2019 nmdc:mga06r32_1600_c2
2020 nmdc:mga06r32_28389_c1
2021 nmdc:mga06r32_3454_c1
2022 nmdc:mga08y16_247_c1
2023 nmdc:mga08y16_24948_c1
2024 nmdc:mga08y16_4120_c1
2025 nmdc:mga08y16_4323_c1
2026 nmdc:mga08y16_511512_c1
2027 nmdc:mga08y16_589213_c1
2028 nmdc:mga08y16_630876_c1
2029 nmdc:mga08y16_760_c1
2030 nmdc:mga08y16_81557_c1
2031 nmdc:mga0n895_209909_c1
2032 nmdc:mga0n895_40936_c1
2033 nmdc:mga0n895_44839_c1
2034 nmdc:mga0n895_486816_c1
2035 nmdc:mga0n895_74479_c1
2036 nmdc:mga0n895_85_c1
2037 nmdc:mga0n895_9905_c1
2038 nmdc:mga0rr50_111299_c1
2039 nmdc:mga0rr50_1350_c1
2040 nmdc:mga0rr50_40548_c1
2041 nmdc:mga0rr50_44742_c1
2042 nmdc:mga0rr50_50238_c1
2043 nmdc:mga08x19_161311_c1
2044 nmdc:mga08x19_3912_c1
2045 nmdc:mga0a205_111660_c1
2046 nmdc:mga0a205_13918_c1
2047 nmdc:mga0a205_16095_c1
2048 nmdc:mga0a205_3700_c1
2049 nmdc:mga0a205_429976_c1
2050 Ga0495601_0019182
2051 Ga0495612_0044914
2052 Ga0500635_0003410
2053 Ga0495619_0000244
2054 Ga0500647_0154457
2055 Ga0500566_0010812
2056 Ga0500640_024786
2057 Ga0500554_000069
2058 Ga0500572_001885
2059 Ga0500595_000335
2060 Ga0500614_000221
2061 Ga0500585_033147
2062 Ga0500603_017212
2063 Ga0501084_0000255
2064 Ga0501084_0004182
2065 Ga0501084_0010674
2066 Ga0501084_0079858
2067 Ga0501084_0718464
2068 Ga0590071_001011
2069 Ga0590071_032337
2070 Ga0590074_000962
2071 Ga0590075_003379
2072 Ga0590075_006181
2073 Ga0587073_0038596
2074 Ga0587092_016341
2075 Ga0587067_010665
2076 Ga0501082_0000911
2077 Ga0501082_0002467
2078 Ga0501082_0002512
2079 Ga0501082_0005051
2080 Ga0501082_0006803
2081 Ga0501082_0052616
2082 Ga0501082_0084966
2083 Ga0501082_0104310
2084 Ga0501082_0162221
2085 Ga0501082_0495905
2086 Ga0530510_0001088
2087 Ga0530510_0002940
2088 Ga0530510_0009999
2089 Ga0530510_0024427
2090 Ga0530510_0124132
2091 Ga0530510_0271154
2092 2937894813

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

41

224

0.98

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

46

249

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.9828 1 271
7eum-assembly1.cif.gz_C crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9826 4 264
7eum-assembly1.cif.gz_D crystal structure of apo nmar_1308 protein at cryogenic temperature 0.973 4 261
7eum-assembly1.cif.gz_F crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9724 4 261
7eum-assembly1.cif.gz_C crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9703 4 264
ID Description Score Start End Superfamily
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9783 1 220 3.90.226.10
4fzwB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9767 221 270 1.10.12.10
4fzwA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9758 221 270 1.10.12.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9746 4 220 3.90.226.10
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9716 223 270 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A3M1MTY6-F1-model_v4 Crotonase 0.9923 3 131 GO:0003824
GO:0006635
AF-A0A6N8ZKG2-F1-model_v4 deleted 0.9907 3 270
AF-A0A4V6F2K9-F1-model_v4 deleted 0.9893 1 252
AF-A0A534Q6J1-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9886 1 270 GO:0006635
GO:0016829
GO:0016853
AF-A0A832FA10-F1-model_v4 deleted 0.9869 3 152

Map