F488001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1005 | 514 | 964 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_221_c1|nmdc:mga0k408_221_c1_16814_17779 |
| Length | 321 |
| Sequence | VSKTIKVALAGAGAFGIKHLDAMRNIDGVEVVSLVSRELDKTREVAAKYGIAHCSTDLADSLALPEVDAVILCTPTQMHAAQAQACLRAGKHVQVEIPLADSLADAEAVVALQKEMWKTRGLVAMCGHTRRFNPSHQWVRRRIMAGEFNILQMDVQTYFFRRTNMNALGQPRSWTDHLLWHHAAHTVDLFAYQTRSPIVQANAIQGPISPTLGIAMDMSIQLKAANGAICTLSLSFNNEGPLGTFFRYIGDSGTYIARYDDLINGKEEKIDVSGVDVSMNGIELQDREFFAAIREGREPNASVAQVLPCYEVLQKLEQQLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 7 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 8 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 12 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 13 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 14 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 15 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 16 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 17 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 18 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 21 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 22 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 23 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 24 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 25 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 26 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 27 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 28 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 29 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 30 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 31 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 32 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 33 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 34 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 35 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 36 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 37 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 38 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 39 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 40 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 41 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 44 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 45 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 56 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 59 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 65 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 111 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 112 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 123 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 124 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 125 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 126 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 140 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 143 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 144 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 145 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 146 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 167 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 174 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 175 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 177 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 259 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 260 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 261 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 263 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 264 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 270 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 274 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 275 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 283 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 284 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 285 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 286 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 287 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 288 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 289 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 290 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 291 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 292 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 293 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 294 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 295 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 296 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 297 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 298 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 299 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 300 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 301 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 302 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 303 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 305 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 306 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 307 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 308 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 309 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 310 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 313 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 314 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 315 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 316 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 320 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 321 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 322 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 323 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 325 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 326 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 327 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 328 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 329 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 330 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 331 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 333 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 334 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 335 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 336 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 337 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 338 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 339 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 340 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 341 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 342 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 343 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 344 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 345 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 346 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 347 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 348 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 349 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 350 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 351 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 352 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 353 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 354 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 355 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 356 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 357 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 358 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 359 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 360 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 361 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 362 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 363 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 364 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 365 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 366 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 367 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 368 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 369 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 370 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 434 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 435 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 436 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 437 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 438 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 441 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 442 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 443 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 444 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 445 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 446 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 449 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 450 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 451 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 470 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 471 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 472 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 473 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 474 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 476 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 477 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 481 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 482 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 483 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 484 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 485 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 486 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 500 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 503 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 504 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 505 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 506 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 509 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 511 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 512 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 514 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.32 |
| Metatranscriptomes | 0.6 |
| Isolates | 4.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.85 |
| Nodule | 0.7 |
| Rhizoplane | 2.39 |
| Rhizosphere | 76.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1627834 | 2162886006 | Bacteria | 1412 |
| 2 | JGI24739J22299_10003739 | 3300001989 | Bacteria | 5809 |
| 3 | JGI25406J46586_10051383 | 3300003203 | Bacteria | 1379 |
| 4 | JGI25165J46597_1001146 | 3300003214 | Bacteria | 16553 |
| 5 | rootL2_10143951 | 3300003322 | Bacteria | 3982 |
| 6 | rootL2_10253676 | 3300003322 | Bacteria | 2050 |
| 7 | Ga0055533_1000064 | 3300003756 | Bacteria | 169672 |
| 8 | Ga0055532_1000013 | 3300003758 | Bacteria | 380677 |
| 9 | Ga0055527_1000010 | 3300003760 | Bacteria | 380677 |
| 10 | Ga0055535_1000010 | 3300003761 | Bacteria | 380677 |
| 11 | Ga0055542_1000016 | 3300003762 | Bacteria | 380677 |
| 12 | Ga0055529_1000012 | 3300003763 | Bacteria | 380677 |
| 13 | Ga0055529_1001271 | 3300003763 | Bacteria | 9037 |
| 14 | Ga0055524_1000117 | 3300003775 | Bacteria | 93643 |
| 15 | Ga0055524_1029023 | 3300003775 | Bacteria | 1644 |
| 16 | Ga0055540_1001334 | 3300003792 | Bacteria | 14864 |
| 17 | Ga0055531_10001335 | 3300003794 | Bacteria | 18427 |
| 18 | Ga0055531_10001376 | 3300003794 | Bacteria | 18057 |
| 19 | Ga0055531_10008251 | 3300003794 | Bacteria | 5538 |
| 20 | Ga0055543_1004964 | 3300004625 | Bacteria | 3489 |
| 21 | Ga0065165_1000323 | 3300005262 | Bacteria | 78079 |
| 22 | Ga0065165_1000864 | 3300005262 | Bacteria | 39604 |
| 23 | Ga0065714_10100934 | 3300005288 | Bacteria | 1654 |
| 24 | Ga0065704_10147643 | 3300005289 | Bacteria | 1457 |
| 25 | Ga0065712_10132380 | 3300005290 | Bacteria | 1534 |
| 26 | Ga0065715_10092009 | 3300005293 | Bacteria | 5395 |
| 27 | Ga0065715_10130447 | 3300005293 | Bacteria | 2022 |
| 28 | Ga0065715_10142885 | 3300005293 | Bacteria | 1828 |
| 29 | Ga0065707_10175098 | 3300005295 | Bacteria | 1456 |
| 30 | Ga0070676_10061960 | 3300005328 | Bacteria | 2224 |
| 31 | Ga0070676_10082141 | 3300005328 | Bacteria | 1957 |
| 32 | Ga0070670_100000863 | 3300005331 | Bacteria | 23798 |
| 33 | Ga0070670_100187346 | 3300005331 | Bacteria | 1797 |
| 34 | Ga0070677_10113734 | 3300005333 | Bacteria | 1212 |
| 35 | Ga0068869_100017832 | 3300005334 | Bacteria | 4822 |
| 36 | Ga0070680_100131673 | 3300005336 | Bacteria | 2093 |
| 37 | Ga0070682_100001299 | 3300005337 | Bacteria | 14147 |
| 38 | Ga0068868_100086716 | 3300005338 | Bacteria | 2517 |
| 39 | Ga0068868_100090463 | 3300005338 | Bacteria | 2465 |
| 40 | Ga0070660_100010451 | 3300005339 | Bacteria | 6560 |
| 41 | Ga0070689_100310839 | 3300005340 | Bacteria | 1314 |
| 42 | Ga0070691_10092199 | 3300005341 | Bacteria | 1495 |
| 43 | Ga0070687_100023538 | 3300005343 | Bacteria | 2928 |
| 44 | Ga0070661_100058507 | 3300005344 | Bacteria | 2825 |
| 45 | Ga0070661_100237738 | 3300005344 | Bacteria | 1402 |
| 46 | Ga0070668_100001288 | 3300005347 | Bacteria | 17940 |
| 47 | Ga0070668_100033275 | 3300005347 | Bacteria | 3924 |
| 48 | Ga0070668_100238741 | 3300005347 | Bacteria | 1505 |
| 49 | Ga0070669_100003725 | 3300005353 | Bacteria | 11006 |
| 50 | Ga0070669_100025855 | 3300005353 | Bacteria | 4220 |
| 51 | Ga0070669_100115925 | 3300005353 | Bacteria | 2038 |
| 52 | Ga0070675_100000605 | 3300005354 | Bacteria | 24695 |
| 53 | Ga0070675_100001805 | 3300005354 | Bacteria | 15819 |
| 54 | Ga0070675_100025023 | 3300005354 | Bacteria | 4785 |
| 55 | Ga0070671_100023448 | 3300005355 | Bacteria | 5050 |
| 56 | Ga0070674_100010407 | 3300005356 | Bacteria | 5624 |
| 57 | Ga0070674_100021184 | 3300005356 | Bacteria | 4168 |
| 58 | Ga0070673_100012312 | 3300005364 | Bacteria | 5871 |
| 59 | Ga0070673_100032621 | 3300005364 | Bacteria | 3925 |
| 60 | Ga0070673_100114527 | 3300005364 | Bacteria | 2241 |
| 61 | Ga0070673_100238138 | 3300005364 | Bacteria | 1581 |
| 62 | Ga0070688_100052265 | 3300005365 | Bacteria | 2552 |
| 63 | Ga0070659_100524304 | 3300005366 | Bacteria | 1012 |
| 64 | Ga0070667_100279130 | 3300005367 | Bacteria | 1500 |
| 65 | Ga0070709_10000424 | 3300005434 | Bacteria | 25604 |
| 66 | Ga0070714_100005361 | 3300005435 | Bacteria | 9785 |
| 67 | Ga0070714_100559068 | 3300005435 | Bacteria | 1096 |
| 68 | Ga0070713_100000019 | 3300005436 | Bacteria | 110100 |
| 69 | Ga0070713_100031317 | 3300005436 | Bacteria | 4236 |
| 70 | Ga0070713_100162474 | 3300005436 | Bacteria | 1994 |
| 71 | Ga0070710_10021505 | 3300005437 | Bacteria | 3363 |
| 72 | Ga0070710_10044662 | 3300005437 | Bacteria | 2459 |
| 73 | Ga0070711_100010642 | 3300005439 | Bacteria | 5700 |
| 74 | Ga0070711_100075095 | 3300005439 | Bacteria | 2392 |
| 75 | Ga0070711_100176400 | 3300005439 | Bacteria | 1633 |
| 76 | Ga0070708_100144370 | 3300005445 | Bacteria | 2209 |
| 77 | Ga0070663_100043069 | 3300005455 | Bacteria | 3175 |
| 78 | Ga0070663_100145261 | 3300005455 | Bacteria | 1814 |
| 79 | Ga0070678_100195244 | 3300005456 | Bacteria | 1667 |
| 80 | Ga0070662_100009085 | 3300005457 | Bacteria | 6487 |
| 81 | Ga0070662_100032685 | 3300005457 | Bacteria | 3657 |
| 82 | Ga0070662_100046971 | 3300005457 | Bacteria | 3104 |
| 83 | Ga0070681_10148615 | 3300005458 | Bacteria | 2271 |
| 84 | Ga0068867_100001878 | 3300005459 | Bacteria | 14605 |
| 85 | Ga0068867_100007933 | 3300005459 | Bacteria | 7499 |
| 86 | Ga0068867_100011208 | 3300005459 | Bacteria | 6324 |
| 87 | Ga0070685_10011760 | 3300005466 | Bacteria | 4588 |
| 88 | Ga0070685_10020748 | 3300005466 | Bacteria | 3560 |
| 89 | Ga0070685_10165248 | 3300005466 | Bacteria | 1414 |
| 90 | Ga0070706_100017917 | 3300005467 | Bacteria | 6533 |
| 91 | Ga0070706_100322896 | 3300005467 | Bacteria | 1439 |
| 92 | Ga0070707_100093503 | 3300005468 | Bacteria | 2911 |
| 93 | Ga0070698_100003926 | 3300005471 | Bacteria | 16349 |
| 94 | Ga0070698_100024152 | 3300005471 | Bacteria | 6343 |
| 95 | Ga0070699_100015206 | 3300005518 | Bacteria | 6612 |
| 96 | Ga0070699_100064156 | 3300005518 | Bacteria | 3186 |
| 97 | Ga0070679_100010795 | 3300005530 | Bacteria | 8673 |
| 98 | Ga0070684_100004488 | 3300005535 | Bacteria | 10624 |
| 99 | Ga0070697_100062075 | 3300005536 | Bacteria | 3049 |
| 100 | Ga0070697_100333651 | 3300005536 | Bacteria | 1307 |
| 101 | Ga0070672_100003662 | 3300005543 | Bacteria | 9983 |
| 102 | Ga0070672_100034503 | 3300005543 | Bacteria | 3839 |
| 103 | Ga0070672_100037307 | 3300005543 | Bacteria | 3707 |
| 104 | Ga0070672_100040583 | 3300005543 | Bacteria | 3572 |
| 105 | Ga0070696_100093657 | 3300005546 | Bacteria | 2143 |
| 106 | Ga0070665_100038890 | 3300005548 | Bacteria | 4783 |
| 107 | Ga0070665_100162688 | 3300005548 | Bacteria | 2234 |
| 108 | Ga0070704_100054933 | 3300005549 | Bacteria | 2821 |
| 109 | Ga0068855_100067050 | 3300005563 | Bacteria | 4183 |
| 110 | Ga0068855_100121444 | 3300005563 | Bacteria | 2990 |
| 111 | Ga0068855_100210698 | 3300005563 | Bacteria | 2184 |
| 112 | Ga0070664_100119385 | 3300005564 | Bacteria | 2307 |
| 113 | Ga0068857_100171775 | 3300005577 | Bacteria | 1970 |
| 114 | Ga0068857_100290543 | 3300005577 | Bacteria | 1505 |
| 115 | Ga0068856_100025977 | 3300005614 | Bacteria | 5711 |
| 116 | Ga0068856_100035912 | 3300005614 | Bacteria | 4859 |
| 117 | Ga0068856_100062674 | 3300005614 | Bacteria | 3673 |
| 118 | Ga0068856_100311090 | 3300005614 | Bacteria | 1593 |
| 119 | Ga0070702_100058676 | 3300005615 | Bacteria | 2231 |
| 120 | Ga0068852_100007943 | 3300005616 | Bacteria | 7776 |
| 121 | Ga0068852_100128342 | 3300005616 | Bacteria | 2332 |
| 122 | Ga0068859_100005230 | 3300005617 | Bacteria | 13184 |
| 123 | Ga0068859_100216229 | 3300005617 | Bacteria | 2004 |
| 124 | Ga0068864_100011966 | 3300005618 | Bacteria | 7163 |
| 125 | Ga0068864_100095161 | 3300005618 | Bacteria | 2634 |
| 126 | Ga0068861_100001297 | 3300005719 | Bacteria | 15630 |
| 127 | Ga0068870_10016152 | 3300005840 | Bacteria | 3561 |
| 128 | Ga0068863_100004078 | 3300005841 | Bacteria | 14429 |
| 129 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 130 | Ga0068862_100000710 | 3300005844 | Bacteria | 33992 |
| 131 | Ga0068862_100000773 | 3300005844 | Bacteria | 31853 |
| 132 | Ga0068862_100013059 | 3300005844 | Bacteria | 6871 |
| 133 | Ga0081455_10006640 | 3300005937 | Bacteria | 12369 |
| 134 | Ga0081455_10012116 | 3300005937 | Bacteria | 8619 |
| 135 | Ga0081455_10014422 | 3300005937 | Bacteria | 7749 |
| 136 | Ga0081540_1000120 | 3300005983 | Bacteria | 83032 |
| 137 | Ga0081540_1024303 | 3300005983 | Bacteria | 3519 |
| 138 | Ga0081540_1028089 | 3300005983 | Bacteria | 3169 |
| 139 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 140 | Ga0081539_10031999 | 3300005985 | Bacteria | 3229 |
| 141 | Ga0081539_10053536 | 3300005985 | Bacteria | 2259 |
| 142 | Ga0070717_10023098 | 3300006028 | Bacteria | 4923 |
| 143 | Ga0070717_10157585 | 3300006028 | Bacteria | 1968 |
| 144 | Ga0070717_10248702 | 3300006028 | Bacteria | 1570 |
| 145 | Ga0075365_10002903 | 3300006038 | Bacteria | 8643 |
| 146 | Ga0075365_10011690 | 3300006038 | Bacteria | 5174 |
| 147 | Ga0075365_10056486 | 3300006038 | Bacteria | 2609 |
| 148 | Ga0075368_10001375 | 3300006042 | Bacteria | 7751 |
| 149 | Ga0075363_100032392 | 3300006048 | Bacteria | 2714 |
| 150 | Ga0075363_100055898 | 3300006048 | Bacteria | 2115 |
| 151 | Ga0075363_100080769 | 3300006048 | Bacteria | 1778 |
| 152 | Ga0075364_10001926 | 3300006051 | Bacteria | 11551 |
| 153 | Ga0075364_10046560 | 3300006051 | Bacteria | 2824 |
| 154 | Ga0075364_10220909 | 3300006051 | Bacteria | 1286 |
| 155 | Ga0070716_100013555 | 3300006173 | Bacteria | 4157 |
| 156 | Ga0070716_100109504 | 3300006173 | Bacteria | 1709 |
| 157 | Ga0070712_100162399 | 3300006175 | Bacteria | 1726 |
| 158 | Ga0075362_10017271 | 3300006177 | Bacteria | 2970 |
| 159 | Ga0075362_10066530 | 3300006177 | Bacteria | 1638 |
| 160 | Ga0075367_10006610 | 3300006178 | Bacteria | 5875 |
| 161 | Ga0075367_10046202 | 3300006178 | Bacteria | 2558 |
| 162 | Ga0075366_10006834 | 3300006195 | Bacteria | 6275 |
| 163 | Ga0075366_10008288 | 3300006195 | Bacteria | 5774 |
| 164 | Ga0075366_10048036 | 3300006195 | Bacteria | 2530 |
| 165 | Ga0075366_10151950 | 3300006195 | Bacteria | 1402 |
| 166 | Ga0075366_10185661 | 3300006195 | Bacteria | 1263 |
| 167 | Ga0097621_100016909 | 3300006237 | Bacteria | 5529 |
| 168 | Ga0097621_100104236 | 3300006237 | Bacteria | 2390 |
| 169 | Ga0075370_10040788 | 3300006353 | Bacteria | 2619 |
| 170 | Ga0075370_10044816 | 3300006353 | Bacteria | 2501 |
| 171 | Ga0068871_100025108 | 3300006358 | Bacteria | 4632 |
| 172 | Ga0075428_100005334 | 3300006844 | Bacteria | 14293 |
| 173 | Ga0075428_100007195 | 3300006844 | Bacteria | 12324 |
| 174 | Ga0075428_100008323 | 3300006844 | Bacteria | 11495 |
| 175 | Ga0075430_100057367 | 3300006846 | Bacteria | 3276 |
| 176 | Ga0075430_100134843 | 3300006846 | Bacteria | 2057 |
| 177 | Ga0075430_100175926 | 3300006846 | Bacteria | 1780 |
| 178 | Ga0075430_100320366 | 3300006846 | Bacteria | 1281 |
| 179 | Ga0075431_100009471 | 3300006847 | Bacteria | 9778 |
| 180 | Ga0075431_100024976 | 3300006847 | Bacteria | 6125 |
| 181 | Ga0075431_100148829 | 3300006847 | Bacteria | 2411 |
| 182 | Ga0075431_100154509 | 3300006847 | Bacteria | 2361 |
| 183 | Ga0075431_100379179 | 3300006847 | Bacteria | 1418 |
| 184 | Ga0075433_10032292 | 3300006852 | Bacteria | 4484 |
| 185 | Ga0075433_10061285 | 3300006852 | Bacteria | 3295 |
| 186 | Ga0075434_100039179 | 3300006871 | Bacteria | 4696 |
| 187 | Ga0075434_100050704 | 3300006871 | Bacteria | 4123 |
| 188 | Ga0075429_100002086 | 3300006880 | Bacteria | 16679 |
| 189 | Ga0075429_100029740 | 3300006880 | Bacteria | 4746 |
| 190 | Ga0075429_100044872 | 3300006880 | Bacteria | 3845 |
| 191 | Ga0075436_100131287 | 3300006914 | Bacteria | 1757 |
| 192 | Ga0097620_100005230 | 3300006931 | Bacteria | 13184 |
| 193 | Ga0097620_100216229 | 3300006931 | Bacteria | 2004 |
| 194 | Ga0099824_1039673 | 3300006942 | Bacteria | 1192 |
| 195 | Ga0099823_1000138 | 3300006944 | Bacteria | 37983 |
| 196 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 197 | Ga0075435_100018531 | 3300007076 | Bacteria | 5298 |
| 198 | Ga0075435_100054421 | 3300007076 | Bacteria | 3229 |
| 199 | Ga0105250_10000186 | 3300009092 | Bacteria | 53643 |
| 200 | Ga0105240_10073489 | 3300009093 | Bacteria | 4222 |
| 201 | Ga0105240_10106099 | 3300009093 | Bacteria | 3409 |
| 202 | Ga0105240_10125926 | 3300009093 | Bacteria | 3078 |
| 203 | Ga0111539_10042128 | 3300009094 | Bacteria | 5486 |
| 204 | Ga0111539_10046075 | 3300009094 | Bacteria | 5218 |
| 205 | Ga0111539_10183792 | 3300009094 | Bacteria | 2442 |
| 206 | Ga0111539_10373123 | 3300009094 | Bacteria | 1661 |
| 207 | Ga0105247_10184776 | 3300009101 | Bacteria | 1393 |
| 208 | Ga0114129_10008622 | 3300009147 | Bacteria | 14537 |
| 209 | Ga0114129_10009237 | 3300009147 | Bacteria | 14064 |
| 210 | Ga0114129_10122874 | 3300009147 | Bacteria | 3572 |
| 211 | Ga0114129_10144548 | 3300009147 | Bacteria | 3259 |
| 212 | Ga0114129_10171988 | 3300009147 | Bacteria | 2953 |
| 213 | Ga0105243_10173305 | 3300009148 | Bacteria | 1870 |
| 214 | Ga0105241_10030921 | 3300009174 | Bacteria | 4005 |
| 215 | Ga0105241_10056190 | 3300009174 | Bacteria | 3018 |
| 216 | Ga0105242_10006667 | 3300009176 | Bacteria | 8907 |
| 217 | Ga0105248_10003190 | 3300009177 | Bacteria | 18173 |
| 218 | Ga0105248_10022581 | 3300009177 | Bacteria | 6982 |
| 219 | Ga0105237_10015974 | 3300009545 | Bacteria | 7806 |
| 220 | Ga0105237_10430063 | 3300009545 | Bacteria | 1326 |
| 221 | Ga0105249_10015849 | 3300009553 | Bacteria | 6678 |
| 222 | Ga0105249_10021555 | 3300009553 | Bacteria | 5769 |
| 223 | Ga0105249_10038996 | 3300009553 | Bacteria | 4312 |
| 224 | Ga0105239_10025714 | 3300010375 | Bacteria | 6483 |
| 225 | Ga0105239_10461852 | 3300010375 | Bacteria | 1441 |
| 226 | Ga0157319_1000240 | 3300012497 | Bacteria | 2698 |
| 227 | Ga0157369_10296307 | 3300013105 | Bacteria | 1683 |
| 228 | Ga0157378_10098716 | 3300013297 | Bacteria | 2663 |
| 229 | Ga0163162_10024014 | 3300013306 | Bacteria | 6017 |
| 230 | Ga0163162_10170219 | 3300013306 | Bacteria | 2303 |
| 231 | Ga0157375_10000261 | 3300013308 | Bacteria | 47898 |
| 232 | Ga0157375_10042879 | 3300013308 | Bacteria | 4383 |
| 233 | Ga0157375_10140086 | 3300013308 | Bacteria | 2545 |
| 234 | Ga0157375_10320181 | 3300013308 | Bacteria | 1715 |
| 235 | Ga0157375_10654592 | 3300013308 | Bacteria | 1207 |
| 236 | Ga0163163_10000639 | 3300014325 | Bacteria | 30088 |
| 237 | Ga0157380_10160015 | 3300014326 | Bacteria | 1956 |
| 238 | Ga0157379_10000207 | 3300014968 | Bacteria | 45489 |
| 239 | Ga0157379_10075337 | 3300014968 | Bacteria | 3021 |
| 240 | Ga0183361_10005 | 3300016635 | Bacteria | 413599 |
| 241 | Ga0206351_10639124 | 3300020077 | Bacteria | 1335 |
| 242 | Ga0206350_10380697 | 3300020080 | Bacteria | 3517 |
| 243 | Ga0206354_11423707 | 3300020081 | Bacteria | 1333 |
| 244 | Ga0213872_10000134 | 3300021361 | Bacteria | 67449 |
| 245 | Ga0213872_10034574 | 3300021361 | Bacteria | 2313 |
| 246 | Ga0213874_10019036 | 3300021377 | Bacteria | 1864 |
| 247 | Ga0213876_10045174 | 3300021384 | Bacteria | 2330 |
| 248 | Ga0213876_10072141 | 3300021384 | Bacteria | 1823 |
| 249 | Ga0213875_10118570 | 3300021388 | Bacteria | 1237 |
| 250 | Ga0213871_10006411 | 3300021441 | Bacteria | 2486 |
| 251 | Ga0224712_10024103 | 3300022467 | Bacteria | 2121 |
| 252 | Ga0224572_1000229 | 3300024225 | Bacteria | 5557 |
| 253 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 254 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 255 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 256 | Ga0209563_100729 | 3300025230 | Bacteria | 10153 |
| 257 | Ga0207427_100230 | 3300025231 | Bacteria | 47028 |
| 258 | Ga0209258_100042 | 3300025242 | Bacteria | 380729 |
| 259 | Ga0209677_100280 | 3300025253 | Bacteria | 34034 |
| 260 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 261 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 262 | Ga0209233_1002614 | 3300025261 | Bacteria | 6539 |
| 263 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 264 | Ga0209455_1000337 | 3300025272 | Bacteria | 44758 |
| 265 | Ga0209455_1001166 | 3300025272 | Bacteria | 12650 |
| 266 | Ga0209455_1006539 | 3300025272 | Bacteria | 3423 |
| 267 | Ga0209673_1019006 | 3300025273 | Bacteria | 2480 |
| 268 | Ga0209673_1021109 | 3300025273 | Bacteria | 2287 |
| 269 | Ga0209130_1010519 | 3300025284 | Bacteria | 2542 |
| 270 | Ga0209564_1000097 | 3300025295 | Bacteria | 231436 |
| 271 | Ga0209050_1005408 | 3300025298 | Bacteria | 8053 |
| 272 | Ga0209256_1000075 | 3300025299 | Bacteria | 236149 |
| 273 | Ga0209256_1000840 | 3300025299 | Bacteria | 38531 |
| 274 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 275 | Ga0209051_1004454 | 3300025303 | Bacteria | 8621 |
| 276 | Ga0209257_1000101 | 3300025304 | Bacteria | 251553 |
| 277 | Ga0209257_1000244 | 3300025304 | Bacteria | 126098 |
| 278 | Ga0209257_1004031 | 3300025304 | Bacteria | 11813 |
| 279 | Ga0207697_10012568 | 3300025315 | Bacteria | 3547 |
| 280 | Ga0207696_1000072 | 3300025711 | Bacteria | 224214 |
| 281 | Ga0207682_10001822 | 3300025893 | Bacteria | 9720 |
| 282 | Ga0207682_10044025 | 3300025893 | Bacteria | 1829 |
| 283 | Ga0207692_10000738 | 3300025898 | Bacteria | 11534 |
| 284 | Ga0207692_10022718 | 3300025898 | Bacteria | 2890 |
| 285 | Ga0207692_10032685 | 3300025898 | Bacteria | 2502 |
| 286 | Ga0207688_10100146 | 3300025901 | Bacteria | 1672 |
| 287 | Ga0207680_10095411 | 3300025903 | Bacteria | 1901 |
| 288 | Ga0207699_10000465 | 3300025906 | Bacteria | 20602 |
| 289 | Ga0207645_10013208 | 3300025907 | Bacteria | 5572 |
| 290 | Ga0207705_10251711 | 3300025909 | Bacteria | 1347 |
| 291 | Ga0207684_10060092 | 3300025910 | Bacteria | 3228 |
| 292 | Ga0207707_10052812 | 3300025912 | Bacteria | 3537 |
| 293 | Ga0207695_10078715 | 3300025913 | Bacteria | 3344 |
| 294 | Ga0207671_10080063 | 3300025914 | Bacteria | 2448 |
| 295 | Ga0207693_10003980 | 3300025915 | Bacteria | 12554 |
| 296 | Ga0207663_10020666 | 3300025916 | Bacteria | 3732 |
| 297 | Ga0207663_10072159 | 3300025916 | Bacteria | 2230 |
| 298 | Ga0207663_10277948 | 3300025916 | Bacteria | 1243 |
| 299 | Ga0207660_10261282 | 3300025917 | Bacteria | 1369 |
| 300 | Ga0207662_10024547 | 3300025918 | Bacteria | 3468 |
| 301 | Ga0207652_10039498 | 3300025921 | Bacteria | 4005 |
| 302 | Ga0207652_10044388 | 3300025921 | Bacteria | 3787 |
| 303 | Ga0207646_10036712 | 3300025922 | Bacteria | 4422 |
| 304 | Ga0207646_10120025 | 3300025922 | Bacteria | 2362 |
| 305 | Ga0207646_10191660 | 3300025922 | Bacteria | 1846 |
| 306 | Ga0207681_10003681 | 3300025923 | Bacteria | 9530 |
| 307 | Ga0207681_10023667 | 3300025923 | Bacteria | 3932 |
| 308 | Ga0207694_10057390 | 3300025924 | Bacteria | 3027 |
| 309 | Ga0207694_10341034 | 3300025924 | Bacteria | 1239 |
| 310 | Ga0207650_10000326 | 3300025925 | Bacteria | 46321 |
| 311 | Ga0207659_10000299 | 3300025926 | Bacteria | 29997 |
| 312 | Ga0207659_10003803 | 3300025926 | Bacteria | 9104 |
| 313 | Ga0207687_10241108 | 3300025927 | Bacteria | 1433 |
| 314 | Ga0207687_10334515 | 3300025927 | Bacteria | 1229 |
| 315 | Ga0207700_10000035 | 3300025928 | Bacteria | 119648 |
| 316 | Ga0207700_10004029 | 3300025928 | Bacteria | 8601 |
| 317 | Ga0207700_10177250 | 3300025928 | Bacteria | 1782 |
| 318 | Ga0207664_10004452 | 3300025929 | Bacteria | 9489 |
| 319 | Ga0207664_10010239 | 3300025929 | Bacteria | 6622 |
| 320 | Ga0207664_10024659 | 3300025929 | Bacteria | 4521 |
| 321 | Ga0207644_10001354 | 3300025931 | Bacteria | 15752 |
| 322 | Ga0207706_10000606 | 3300025933 | Bacteria | 38141 |
| 323 | Ga0207706_10004288 | 3300025933 | Bacteria | 13404 |
| 324 | Ga0207706_10047194 | 3300025933 | Bacteria | 3811 |
| 325 | Ga0207706_10156774 | 3300025933 | Bacteria | 2002 |
| 326 | Ga0207686_10004843 | 3300025934 | Bacteria | 7234 |
| 327 | Ga0207686_10305411 | 3300025934 | Bacteria | 1183 |
| 328 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 329 | Ga0207709_10115703 | 3300025935 | Bacteria | 1802 |
| 330 | Ga0207669_10084624 | 3300025937 | Bacteria | 2044 |
| 331 | Ga0207669_10358360 | 3300025937 | Bacteria | 1129 |
| 332 | Ga0207704_10111667 | 3300025938 | Bacteria | 1849 |
| 333 | Ga0207704_10346326 | 3300025938 | Bacteria | 1155 |
| 334 | Ga0207665_10016681 | 3300025939 | Bacteria | 4824 |
| 335 | Ga0207665_10035614 | 3300025939 | Bacteria | 3305 |
| 336 | Ga0207691_10000049 | 3300025940 | Bacteria | 94813 |
| 337 | Ga0207691_10002506 | 3300025940 | Bacteria | 17971 |
| 338 | Ga0207691_10006862 | 3300025940 | Bacteria | 10987 |
| 339 | Ga0207691_10050698 | 3300025940 | Bacteria | 3798 |
| 340 | Ga0207691_10133760 | 3300025940 | Bacteria | 2189 |
| 341 | Ga0207711_10038852 | 3300025941 | Bacteria | 4047 |
| 342 | Ga0207689_10007180 | 3300025942 | Bacteria | 9786 |
| 343 | Ga0207689_10015453 | 3300025942 | Bacteria | 6463 |
| 344 | Ga0207661_10000444 | 3300025944 | Bacteria | 26690 |
| 345 | Ga0207679_10002985 | 3300025945 | Bacteria | 10490 |
| 346 | Ga0207679_10427917 | 3300025945 | Bacteria | 1170 |
| 347 | Ga0207667_10123088 | 3300025949 | Bacteria | 2672 |
| 348 | Ga0207667_10239885 | 3300025949 | Bacteria | 1855 |
| 349 | Ga0207651_10000834 | 3300025960 | Bacteria | 13379 |
| 350 | Ga0207651_10311190 | 3300025960 | Bacteria | 1313 |
| 351 | Ga0207651_10338064 | 3300025960 | Bacteria | 1264 |
| 352 | Ga0207712_10021719 | 3300025961 | Bacteria | 4217 |
| 353 | Ga0207712_10021950 | 3300025961 | Bacteria | 4197 |
| 354 | Ga0207712_10032944 | 3300025961 | Bacteria | 3500 |
| 355 | Ga0207668_10054702 | 3300025972 | Bacteria | 2771 |
| 356 | Ga0207668_10224891 | 3300025972 | Bacteria | 1509 |
| 357 | Ga0207658_10025492 | 3300025986 | Bacteria | 4141 |
| 358 | Ga0207677_10254566 | 3300026023 | Bacteria | 1428 |
| 359 | Ga0207703_10052950 | 3300026035 | Bacteria | 3298 |
| 360 | Ga0207703_10250156 | 3300026035 | Bacteria | 1597 |
| 361 | Ga0207678_10062549 | 3300026067 | Bacteria | 3199 |
| 362 | Ga0207708_10123386 | 3300026075 | Bacteria | 2020 |
| 363 | Ga0207702_10112622 | 3300026078 | Bacteria | 2422 |
| 364 | Ga0207702_10249627 | 3300026078 | Bacteria | 1666 |
| 365 | Ga0207641_10013507 | 3300026088 | Bacteria | 6698 |
| 366 | Ga0207648_10000984 | 3300026089 | Bacteria | 32138 |
| 367 | Ga0207648_10002321 | 3300026089 | Bacteria | 20531 |
| 368 | Ga0207648_10002748 | 3300026089 | Bacteria | 18702 |
| 369 | Ga0207648_10085045 | 3300026089 | Bacteria | 2759 |
| 370 | Ga0207648_10124336 | 3300026089 | Bacteria | 2269 |
| 371 | Ga0207676_10002345 | 3300026095 | Bacteria | 13538 |
| 372 | Ga0207676_10059072 | 3300026095 | Bacteria | 3027 |
| 373 | Ga0207674_10014643 | 3300026116 | Bacteria | 8650 |
| 374 | Ga0207674_10017659 | 3300026116 | Bacteria | 7778 |
| 375 | Ga0207674_10026083 | 3300026116 | Bacteria | 6217 |
| 376 | Ga0207675_100015598 | 3300026118 | Bacteria | 7087 |
| 377 | Ga0207675_100021807 | 3300026118 | Bacteria | 5963 |
| 378 | Ga0207675_100514665 | 3300026118 | Bacteria | 1192 |
| 379 | Ga0207683_10028651 | 3300026121 | Bacteria | 4817 |
| 380 | Ga0207683_10279075 | 3300026121 | Bacteria | 1527 |
| 381 | Ga0207683_10320388 | 3300026121 | Bacteria | 1420 |
| 382 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 383 | Ga0209389_1023254 | 3300027296 | Bacteria | 5470 |
| 384 | Ga0209982_1000525 | 3300027552 | Bacteria | 4772 |
| 385 | Ga0210002_1000631 | 3300027617 | Bacteria | 4778 |
| 386 | Ga0209971_1003298 | 3300027682 | Bacteria | 3838 |
| 387 | Ga0209974_10005216 | 3300027876 | Bacteria | 4585 |
| 388 | Ga0207428_10019081 | 3300027907 | Bacteria | 5848 |
| 389 | Ga0207428_10035182 | 3300027907 | Bacteria | 4096 |
| 390 | Ga0268266_10012901 | 3300028379 | Bacteria | 7211 |
| 391 | Ga0268266_10136602 | 3300028379 | Bacteria | 2197 |
| 392 | Ga0268265_10001103 | 3300028380 | Bacteria | 23957 |
| 393 | Ga0268265_10005116 | 3300028380 | Bacteria | 8979 |
| 394 | Ga0268265_10008379 | 3300028380 | Bacteria | 6980 |
| 395 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 396 | Ga0265337_1000042 | 3300028556 | Bacteria | 56158 |
| 397 | Ga0265337_1001439 | 3300028556 | Bacteria | 11715 |
| 398 | Ga0265326_10021531 | 3300028558 | Bacteria | 1846 |
| 399 | Ga0265319_1002798 | 3300028563 | Bacteria | 9365 |
| 400 | Ga0265319_1002822 | 3300028563 | Bacteria | 9278 |
| 401 | Ga0265334_10005637 | 3300028573 | Bacteria | 5466 |
| 402 | Ga0265334_10058479 | 3300028573 | Bacteria | 1458 |
| 403 | Ga0265318_10000962 | 3300028577 | Bacteria | 18486 |
| 404 | Ga0265318_10028484 | 3300028577 | Bacteria | 2184 |
| 405 | Ga0265323_10000992 | 3300028653 | Bacteria | 14760 |
| 406 | Ga0265322_10005607 | 3300028654 | Bacteria | 3711 |
| 407 | Ga0265336_10000003 | 3300028666 | Bacteria | 423158 |
| 408 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 409 | Ga0265336_10008217 | 3300028666 | Bacteria | 3672 |
| 410 | Ga0307515_10000494 | 3300028794 | Bacteria | 94354 |
| 411 | Ga0307515_10000658 | 3300028794 | Bacteria | 79766 |
| 412 | Ga0307515_10000737 | 3300028794 | Bacteria | 75687 |
| 413 | Ga0307515_10006133 | 3300028794 | Bacteria | 24177 |
| 414 | Ga0307515_10039959 | 3300028794 | Bacteria | 7435 |
| 415 | Ga0307515_10041913 | 3300028794 | Bacteria | 7181 |
| 416 | Ga0307515_10066530 | 3300028794 | Bacteria | 4991 |
| 417 | Ga0307515_10087967 | 3300028794 | Bacteria | 3934 |
| 418 | Ga0307515_10132053 | 3300028794 | Bacteria | 2742 |
| 419 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 420 | Ga0265338_10004381 | 3300028800 | Bacteria | 19092 |
| 421 | Ga0265338_10007488 | 3300028800 | Bacteria | 13527 |
| 422 | Ga0265338_10010111 | 3300028800 | Bacteria | 11142 |
| 423 | Ga0265324_10001160 | 3300029957 | Bacteria | 15689 |
| 424 | Ga0265324_10001590 | 3300029957 | Bacteria | 12642 |
| 425 | Ga0265324_10003293 | 3300029957 | Bacteria | 7760 |
| 426 | Ga0265324_10040385 | 3300029957 | Bacteria | 1616 |
| 427 | Ga0307511_10048394 | 3300030521 | Bacteria | 3459 |
| 428 | Ga0265770_1004563 | 3300030878 | Bacteria | 1893 |
| 429 | Ga0265332_10000083 | 3300031238 | Bacteria | 83040 |
| 430 | Ga0265332_10000626 | 3300031238 | Bacteria | 23073 |
| 431 | Ga0265332_10018655 | 3300031238 | Bacteria | 3061 |
| 432 | Ga0265332_10042179 | 3300031238 | Bacteria | 1973 |
| 433 | Ga0265332_10057278 | 3300031238 | Bacteria | 1669 |
| 434 | Ga0265320_10017209 | 3300031240 | Bacteria | 4022 |
| 435 | Ga0265320_10042687 | 3300031240 | Bacteria | 2248 |
| 436 | Ga0265325_10000929 | 3300031241 | Bacteria | 21157 |
| 437 | Ga0265325_10002402 | 3300031241 | Bacteria | 12664 |
| 438 | Ga0265325_10103867 | 3300031241 | Bacteria | 1388 |
| 439 | Ga0265340_10005079 | 3300031247 | Bacteria | 7317 |
| 440 | Ga0265340_10005895 | 3300031247 | Bacteria | 6775 |
| 441 | Ga0265340_10040161 | 3300031247 | Bacteria | 2306 |
| 442 | Ga0265340_10050275 | 3300031247 | Bacteria | 2022 |
| 443 | Ga0265339_10001335 | 3300031249 | Bacteria | 18436 |
| 444 | Ga0265339_10017132 | 3300031249 | Bacteria | 4297 |
| 445 | Ga0265339_10031160 | 3300031249 | Bacteria | 3015 |
| 446 | Ga0265331_10134556 | 3300031250 | Bacteria | 1126 |
| 447 | Ga0265327_10001037 | 3300031251 | Bacteria | 39182 |
| 448 | Ga0265327_10001335 | 3300031251 | Bacteria | 31984 |
| 449 | Ga0265316_10021381 | 3300031344 | Bacteria | 5480 |
| 450 | Ga0265316_10032233 | 3300031344 | Bacteria | 4277 |
| 451 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 452 | Ga0307513_10010205 | 3300031456 | Bacteria | 11805 |
| 453 | Ga0307513_10010252 | 3300031456 | Bacteria | 11765 |
| 454 | Ga0307513_10032606 | 3300031456 | Bacteria | 5871 |
| 455 | Ga0307513_10070175 | 3300031456 | Bacteria | 3663 |
| 456 | Ga0307509_10207183 | 3300031507 | Bacteria | 1790 |
| 457 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 458 | Ga0307408_100007410 | 3300031548 | Bacteria | 7256 |
| 459 | Ga0307408_100498244 | 3300031548 | Bacteria | 1066 |
| 460 | Ga0265313_10000779 | 3300031595 | Bacteria | 32214 |
| 461 | Ga0265313_10001164 | 3300031595 | Bacteria | 25145 |
| 462 | Ga0265313_10024584 | 3300031595 | Bacteria | 3214 |
| 463 | Ga0265313_10067376 | 3300031595 | Bacteria | 1656 |
| 464 | Ga0307508_10000282 | 3300031616 | Bacteria | 62510 |
| 465 | Ga0307508_10189174 | 3300031616 | Bacteria | 1660 |
| 466 | Ga0307514_10000408 | 3300031649 | Bacteria | 95961 |
| 467 | Ga0307514_10001033 | 3300031649 | Bacteria | 40119 |
| 468 | Ga0316579_10004261 | 3300031691 | Bacteria | 5666 |
| 469 | Ga0265314_10002116 | 3300031711 | Bacteria | 20849 |
| 470 | Ga0265314_10008410 | 3300031711 | Bacteria | 8846 |
| 471 | Ga0265314_10015177 | 3300031711 | Bacteria | 6122 |
| 472 | Ga0265314_10096259 | 3300031711 | Bacteria | 1915 |
| 473 | Ga0265342_10005960 | 3300031712 | Bacteria | 9171 |
| 474 | Ga0265342_10040268 | 3300031712 | Bacteria | 2835 |
| 475 | Ga0316576_10004360 | 3300031727 | Bacteria | 8474 |
| 476 | Ga0316576_10093532 | 3300031727 | Bacteria | 2241 |
| 477 | Ga0316576_10142533 | 3300031727 | Bacteria | 1804 |
| 478 | Ga0316576_10146759 | 3300031727 | Bacteria | 1777 |
| 479 | Ga0316576_10147348 | 3300031727 | Bacteria | 1773 |
| 480 | Ga0316578_10011530 | 3300031728 | Bacteria | 4630 |
| 481 | Ga0316578_10089391 | 3300031728 | Bacteria | 1838 |
| 482 | Ga0316578_10106884 | 3300031728 | Bacteria | 1680 |
| 483 | Ga0307516_10008117 | 3300031730 | Bacteria | 11929 |
| 484 | Ga0307516_10190035 | 3300031730 | Bacteria | 1780 |
| 485 | Ga0307405_10001234 | 3300031731 | Bacteria | 10638 |
| 486 | Ga0307405_10020308 | 3300031731 | Bacteria | 3709 |
| 487 | Ga0316577_10100242 | 3300031733 | Bacteria | 1623 |
| 488 | Ga0307413_10119822 | 3300031824 | Bacteria | 1780 |
| 489 | Ga0307410_10045742 | 3300031852 | Bacteria | 2916 |
| 490 | Ga0307410_10137867 | 3300031852 | Bacteria | 1801 |
| 491 | Ga0307410_10172071 | 3300031852 | Bacteria | 1633 |
| 492 | Ga0307406_10181751 | 3300031901 | Bacteria | 1532 |
| 493 | Ga0307406_10192770 | 3300031901 | Bacteria | 1493 |
| 494 | Ga0307406_10256893 | 3300031901 | Bacteria | 1319 |
| 495 | Ga0307407_10017891 | 3300031903 | Bacteria | 3570 |
| 496 | Ga0307407_10090797 | 3300031903 | Bacteria | 1872 |
| 497 | Ga0307412_10000857 | 3300031911 | Bacteria | 17500 |
| 498 | Ga0307412_10004520 | 3300031911 | Bacteria | 7750 |
| 499 | Ga0307412_10036277 | 3300031911 | Bacteria | 3157 |
| 500 | Ga0307409_100005343 | 3300031995 | Bacteria | 7374 |
| 501 | Ga0307416_100005644 | 3300032002 | Bacteria | 7724 |
| 502 | Ga0307416_100067494 | 3300032002 | Bacteria | 2950 |
| 503 | Ga0307414_10028494 | 3300032004 | Bacteria | 3624 |
| 504 | Ga0307414_10071457 | 3300032004 | Bacteria | 2503 |
| 505 | Ga0307411_10000218 | 3300032005 | Bacteria | 18566 |
| 506 | Ga0307411_10003401 | 3300032005 | Bacteria | 7374 |
| 507 | Ga0307411_10230273 | 3300032005 | Bacteria | 1444 |
| 508 | Ga0316580_10008604 | 3300032139 | Bacteria | 3060 |
| 509 | Ga0316593_10003817 | 3300032168 | Bacteria | 3789 |
| 510 | Ga0307507_10052214 | 3300033179 | Bacteria | 3922 |
| 511 | Ga0373948_0000494 | 3300034817 | Bacteria | 4917 |
| 512 | Ga0373948_0007373 | 3300034817 | Bacteria | 1848 |
| 513 | Ga0373950_0003278 | 3300034818 | Bacteria | 2301 |
| 514 | Ga0373958_0017674 | 3300034819 | Bacteria | 1285 |
| 515 | Ga0373959_0002211 | 3300034820 | Bacteria | 3101 |
| 516 | Ga0373928_0008496 | 3300035084 | Bacteria | 1994 |
| 517 | Ga0373934_0001020 | 3300035086 | Bacteria | 10119 |
| 518 | Ga0373934_0003290 | 3300035086 | Bacteria | 5912 |
| 519 | Ga0373934_0011045 | 3300035086 | Bacteria | 3397 |
| 520 | Ga0373934_0078727 | 3300035086 | Bacteria | 1323 |
| 521 | Ga0373940_0010606 | 3300035088 | Bacteria | 2171 |
| 522 | Ga0373951_0015605 | 3300035091 | Bacteria | 1712 |
| 523 | Ga0373923_0002059 | 3300035111 | Bacteria | 6070 |
| 524 | Ga0373923_0007720 | 3300035111 | Bacteria | 3799 |
| 525 | Ga0373936_0022611 | 3300035113 | Bacteria | 2448 |
| 526 | Ga0373939_0000469 | 3300035114 | Bacteria | 10203 |
| 527 | Ga0373953_0000026 | 3300035117 | Bacteria | 40030 |
| 528 | Ga0373953_0000542 | 3300035117 | Bacteria | 10471 |
| 529 | Ga0373953_0008838 | 3300035117 | Bacteria | 3437 |
| 530 | Ga0373954_0000323 | 3300035118 | Bacteria | 17518 |
| 531 | Ga0373954_0000865 | 3300035118 | Bacteria | 11751 |
| 532 | Ga0373954_0026368 | 3300035118 | Bacteria | 2664 |
| 533 | Ga0373956_0000442 | 3300035119 | Bacteria | 16877 |
| 534 | Ga0373956_0081153 | 3300035119 | Bacteria | 1488 |
| 535 | Ga0373957_0000038 | 3300035120 | Bacteria | 34200 |
| 536 | Ga0373960_0002150 | 3300035121 | Bacteria | 4439 |
| 537 | Ga0373943_0146870 | 3300035170 | Bacteria | 1275 |
| 538 | Ga0373955_0000231 | 3300035172 | Bacteria | 23261 |
| 539 | Ga0373955_0006619 | 3300035172 | Bacteria | 5286 |
| 540 | Ga0373955_0104747 | 3300035172 | Bacteria | 1628 |
| 541 | Ga0373961_0004472 | 3300035241 | Bacteria | 3379 |
| 542 | Ga0373962_0001611 | 3300035242 | Bacteria | 5354 |
| 543 | Ga0373962_0006157 | 3300035242 | Bacteria | 2900 |
| 544 | Ga0316574_0019069 | 3300035398 | Bacteria | 4043 |
| 545 | Ga0316574_0028981 | 3300035398 | Bacteria | 3342 |
| 546 | Ga0316574_0069336 | 3300035398 | Bacteria | 2225 |
| 547 | Ga0316574_0128007 | 3300035398 | Bacteria | 1633 |
| 548 | Ga0373924_0003392 | 3300035410 | Bacteria | 5475 |
| 549 | Ga0373924_0037134 | 3300035410 | Bacteria | 1982 |
| 550 | Ga0373931_0000097 | 3300035691 | Bacteria | 40104 |
| 551 | Ga0373931_0018319 | 3300035691 | Bacteria | 3481 |
| 552 | Ga0373927_0010672 | 3300035695 | Bacteria | 6119 |
| 553 | Ga0373927_0026821 | 3300035695 | Bacteria | 3764 |
| 554 | Ga0373927_0060355 | 3300035695 | Bacteria | 2453 |
| 555 | Ga0373933_0000604 | 3300035724 | Bacteria | 22424 |
| 556 | Ga0373933_0000839 | 3300035724 | Bacteria | 18804 |
| 557 | Ga0373933_0001324 | 3300035724 | Bacteria | 14581 |
| 558 | Ga0373947_0024761 | 3300035725 | Bacteria | 3500 |
| 559 | Ga0373947_0033853 | 3300035725 | Bacteria | 3019 |
| 560 | Ga0373937_0000138 | 3300036401 | Bacteria | 70068 |
| 561 | Ga0373937_0007329 | 3300036401 | Bacteria | 9549 |
| 562 | Ga0373937_0014264 | 3300036401 | Bacteria | 7013 |
| 563 | Ga0373937_0031919 | 3300036401 | Bacteria | 4774 |
| 564 | Ga0373937_0088464 | 3300036401 | Bacteria | 2867 |
| 565 | Ga0373937_0117828 | 3300036401 | Bacteria | 2473 |
| 566 | Ga0373937_0154145 | 3300036401 | Bacteria | 2153 |
| 567 | Ga0373937_0185616 | 3300036401 | Bacteria | 1953 |
| 568 | Ga0316582_0000235 | 3300036647 | Bacteria | 18349 |
| 569 | Ga0316584_0120326 | 3300036712 | Bacteria | 1962 |
| 570 | Ga0373925_0026089 | 3300037068 | Bacteria | 4273 |
| 571 | Ga0373925_0056446 | 3300037068 | Bacteria | 2941 |
| 572 | Ga0373925_0077084 | 3300037068 | Bacteria | 2529 |
| 573 | Ga0395899_0001283 | 3300037312 | Bacteria | 21775 |
| 574 | Ga0395899_0011366 | 3300037312 | Bacteria | 6820 |
| 575 | Ga0395900_0026724 | 3300037418 | Bacteria | 5909 |
| 576 | Ga0395900_0032994 | 3300037418 | Bacteria | 5328 |
| 577 | Ga0395900_0036907 | 3300037418 | Bacteria | 5037 |
| 578 | Ga0395900_0045778 | 3300037418 | Bacteria | 4506 |
| 579 | Ga0395898_0037745 | 3300037466 | Bacteria | 4790 |
| 580 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 581 | Ga0395905_0000138 | 3300037471 | Bacteria | 120373 |
| 582 | Ga0395905_0006240 | 3300037471 | Bacteria | 12037 |
| 583 | Ga0395905_0010810 | 3300037471 | Bacteria | 8844 |
| 584 | Ga0395905_0026512 | 3300037471 | Bacteria | 5463 |
| 585 | Ga0395905_0031618 | 3300037471 | Bacteria | 4982 |
| 586 | Ga0395905_0038385 | 3300037471 | Bacteria | 4494 |
| 587 | Ga0395905_0078767 | 3300037471 | Bacteria | 3088 |
| 588 | Ga0395905_0095477 | 3300037471 | Bacteria | 2790 |
| 589 | Ga0395905_0113073 | 3300037471 | Bacteria | 2550 |
| 590 | Ga0436364_0992730 | 3300037853 | Bacteria | 2498 |
| 591 | Ga0395901_0030455 | 3300038443 | Bacteria | 5558 |
| 592 | Ga0395901_0071636 | 3300038443 | Bacteria | 3612 |
| 593 | Ga0395901_0075467 | 3300038443 | Bacteria | 3516 |
| 594 | Ga0395901_0124818 | 3300038443 | Bacteria | 2705 |
| 595 | Ga0400490_31337 | 3300038726 | Bacteria | 30266 |
| 596 | Ga0400490_35285 | 3300038726 | Bacteria | 7917 |
| 597 | Ga0400490_43931 | 3300038726 | Bacteria | 87826 |
| 598 | Ga0400491_04736 | 3300038727 | Bacteria | 1583 |
| 599 | Ga0400491_06486 | 3300038727 | Bacteria | 8429 |
| 600 | Ga0400485_10823 | 3300038735 | Bacteria | 11344 |
| 601 | Ga0400488_05117 | 3300038741 | Bacteria | 3021 |
| 602 | Ga0400488_14976 | 3300038741 | Bacteria | 5186 |
| 603 | Ga0400488_34208 | 3300038741 | Bacteria | 12154 |
| 604 | Ga0400488_40259 | 3300038741 | Bacteria | 2428 |
| 605 | Ga0400486_17406 | 3300038742 | Bacteria | 1113 |
| 606 | Ga0400483_018531 | 3300039062 | Bacteria | 58611 |
| 607 | Ga0400483_035654 | 3300039062 | Bacteria | 2437 |
| 608 | Ga0400483_046831 | 3300039062 | Bacteria | 362835 |
| 609 | Ga0400483_115198 | 3300039062 | Bacteria | 2538 |
| 610 | Ga0400483_215880 | 3300039062 | Bacteria | 4205 |
| 611 | Ga0400483_219255 | 3300039062 | Bacteria | 53229 |
| 612 | Ga0400483_237740 | 3300039062 | Bacteria | 3849 |
| 613 | Ga0400483_269750 | 3300039062 | Bacteria | 5135 |
| 614 | Ga0400483_278860 | 3300039062 | Bacteria | 3563 |
| 615 | Ga0400483_280629 | 3300039062 | Bacteria | 8137 |
| 616 | Ga0400489_33603 | 3300039093 | Bacteria | 1835 |
| 617 | Ga0400487_27682 | 3300039110 | Bacteria | 2713 |
| 618 | Ga0400487_34028 | 3300039110 | Bacteria | 26819 |
| 619 | Ga0400487_41767 | 3300039110 | Bacteria | 1384 |
| 620 | Ga0400487_42799 | 3300039110 | Bacteria | 62577 |
| 621 | Ga0436365_0523972 | 3300039437 | Bacteria | 7205 |
| 622 | Ga0436365_0817445 | 3300039437 | Bacteria | 1232 |
| 623 | Ga0436365_0921695 | 3300039437 | Bacteria | 3085 |
| 624 | Ga0436365_1486157 | 3300039437 | Bacteria | 6072 |
| 625 | Ga0436361_0178809 | 3300039447 | Bacteria | 8427 |
| 626 | Ga0436361_0193139 | 3300039447 | Bacteria | 16854 |
| 627 | Ga0436361_0455065 | 3300039447 | Bacteria | 73475 |
| 628 | Ga0436363_0030776 | 3300039450 | Bacteria | 2581 |
| 629 | Ga0436363_1481785 | 3300039450 | Bacteria | 1154 |
| 630 | Ga0436362_0198186 | 3300039453 | Bacteria | 3385 |
| 631 | Ga0439465_0095430 | 3300041413 | Bacteria | 1022 |
| 632 | Ga0451843_1214629 | 3300041509 | Bacteria | 1044 |
| 633 | Ga0439431_0004185 | 3300041997 | Bacteria | 3164 |
| 634 | Ga0439433_0026479 | 3300041999 | Bacteria | 1312 |
| 635 | Ga0439449_0060268 | 3300042007 | Bacteria | 1400 |
| 636 | Ga0450891_001745 | 3300042129 | Bacteria | 2235 |
| 637 | Ga0450892_001022 | 3300042130 | Bacteria | 2960 |
| 638 | Ga0439459_0001486 | 3300042438 | Bacteria | 3464 |
| 639 | Ga0451577_0000235 | 3300042876 | Bacteria | 109693 |
| 640 | Ga0451577_0015823 | 3300042876 | Bacteria | 6999 |
| 641 | Ga0451577_0302917 | 3300042876 | Bacteria | 1448 |
| 642 | Ga0451577_0333803 | 3300042876 | Bacteria | 1375 |
| 643 | Ga0466969_0011838 | 3300044656 | Bacteria | 4613 |
| 644 | Ga0453683_0011905 | 3300044673 | Bacteria | 5719 |
| 645 | Ga0466966_0035156 | 3300044684 | Bacteria | 3239 |
| 646 | Ga0466961_0012926 | 3300044693 | Bacteria | 5339 |
| 647 | Ga0453684_0000583 | 3300044712 | Bacteria | 135940 |
| 648 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 649 | Ga0453684_0140562 | 3300044712 | Bacteria | 2883 |
| 650 | Ga0453684_0591900 | 3300044712 | Bacteria | 1217 |
| 651 | Ga0466957_0160086 | 3300044842 | Bacteria | 1462 |
| 652 | Ga0466959_0175644 | 3300045049 | Bacteria | 1501 |
| 653 | Ga0451576_0000137 | 3300045051 | Bacteria | 185212 |
| 654 | Ga0451576_0015435 | 3300045051 | Bacteria | 8461 |
| 655 | Ga0451576_0039548 | 3300045051 | Bacteria | 4992 |
| 656 | Ga0451576_0050999 | 3300045051 | Bacteria | 4339 |
| 657 | Ga0495592_0000041 | 3300046454 | Bacteria | 123431 |
| 658 | Ga0495592_0002287 | 3300046454 | Bacteria | 13506 |
| 659 | Ga0495603_0027174 | 3300046455 | Bacteria | 3454 |
| 660 | Ga0495590_0093275 | 3300046457 | Unclassified | 1066 |
| 661 | Ga0495629_0013834 | 3300046459 | Bacteria | 5822 |
| 662 | Ga0495629_0014811 | 3300046459 | Bacteria | 5608 |
| 663 | Ga0495629_0067077 | 3300046459 | Bacteria | 2504 |
| 664 | Ga0495638_0000710 | 3300046460 | Bacteria | 35874 |
| 665 | Ga0495641_0022013 | 3300046461 | Bacteria | 3197 |
| 666 | Ga0495651_0000018 | 3300046462 | Bacteria | 123195 |
| 667 | Ga0495651_0003600 | 3300046462 | Bacteria | 11877 |
| 668 | Ga0495651_0021971 | 3300046462 | Bacteria | 4962 |
| 669 | Ga0495651_0085282 | 3300046462 | Bacteria | 2378 |
| 670 | Ga0495653_0014349 | 3300046463 | Bacteria | 6463 |
| 671 | Ga0495653_0019823 | 3300046463 | Bacteria | 5452 |
| 672 | Ga0495653_0037741 | 3300046463 | Bacteria | 3793 |
| 673 | Ga0495653_0068638 | 3300046463 | Bacteria | 2658 |
| 674 | Ga0495650_0001834 | 3300046471 | Bacteria | 19019 |
| 675 | Ga0495650_0013002 | 3300046471 | Bacteria | 4438 |
| 676 | Ga0495650_0047442 | 3300046471 | Bacteria | 1796 |
| 677 | Ga0495580_0012366 | 3300046472 | Bacteria | 6548 |
| 678 | Ga0495580_0112906 | 3300046472 | Bacteria | 1887 |
| 679 | Ga0495582_0003548 | 3300046473 | Bacteria | 8792 |
| 680 | Ga0495605_0006813 | 3300046474 | Bacteria | 6527 |
| 681 | Ga0495639_0009195 | 3300046475 | Bacteria | 4234 |
| 682 | Ga0495639_0100548 | 3300046475 | Bacteria | 1365 |
| 683 | Ga0495662_0042130 | 3300046476 | Bacteria | 2203 |
| 684 | Ga0495664_0052111 | 3300046477 | Bacteria | 2430 |
| 685 | Ga0495664_0064262 | 3300046477 | Bacteria | 2187 |
| 686 | Ga0495596_0119890 | 3300046500 | Bacteria | 1021 |
| 687 | Ga0495583_0003737 | 3300046506 | Bacteria | 11319 |
| 688 | Ga0495606_0008456 | 3300046507 | Bacteria | 8935 |
| 689 | Ga0495606_0127099 | 3300046507 | Unclassified | 1519 |
| 690 | Ga0495608_0000039 | 3300046511 | Bacteria | 123195 |
| 691 | Ga0495608_0012184 | 3300046511 | Bacteria | 5975 |
| 692 | Ga0495608_0018525 | 3300046511 | Bacteria | 4800 |
| 693 | Ga0495608_0034635 | 3300046511 | Bacteria | 3408 |
| 694 | Ga0495618_0014687 | 3300046514 | Bacteria | 4775 |
| 695 | Ga0495618_0049428 | 3300046514 | Bacteria | 2655 |
| 696 | Ga0495628_0000219 | 3300046516 | Bacteria | 50121 |
| 697 | Ga0495628_0004882 | 3300046516 | Bacteria | 11805 |
| 698 | Ga0495630_0011003 | 3300046517 | Bacteria | 6541 |
| 699 | Ga0495630_0011057 | 3300046517 | Bacteria | 6529 |
| 700 | Ga0495630_0171798 | 3300046517 | Bacteria | 1651 |
| 701 | Ga0495648_0001735 | 3300046524 | Bacteria | 21077 |
| 702 | Ga0495648_0009710 | 3300046524 | Bacteria | 7413 |
| 703 | Ga0495666_0038237 | 3300046526 | Bacteria | 2334 |
| 704 | Ga0495642_0005224 | 3300046528 | Bacteria | 4994 |
| 705 | Ga0495652_0000092 | 3300046529 | Bacteria | 96258 |
| 706 | Ga0495652_0013473 | 3300046529 | Bacteria | 7360 |
| 707 | Ga0495652_0039030 | 3300046529 | Bacteria | 4107 |
| 708 | Ga0495654_0012961 | 3300046530 | Bacteria | 4469 |
| 709 | Ga0495665_0013248 | 3300046531 | Bacteria | 4459 |
| 710 | Ga0495587_0000034 | 3300046536 | Bacteria | 123432 |
| 711 | Ga0495587_0021836 | 3300046536 | Bacteria | 3948 |
| 712 | Ga0495587_0070409 | 3300046536 | Bacteria | 2035 |
| 713 | Ga0495587_0118048 | 3300046536 | Bacteria | 1520 |
| 714 | Ga0495597_0001231 | 3300046542 | Bacteria | 19066 |
| 715 | Ga0495597_0003270 | 3300046542 | Bacteria | 9606 |
| 716 | Ga0495645_0015569 | 3300046543 | Bacteria | 5410 |
| 717 | Ga0495645_0024809 | 3300046543 | Bacteria | 4349 |
| 718 | Ga0495645_0034491 | 3300046543 | Bacteria | 3691 |
| 719 | Ga0495667_0002416 | 3300046559 | Bacteria | 12473 |
| 720 | Ga0495667_0002599 | 3300046559 | Bacteria | 12052 |
| 721 | Ga0495667_0036966 | 3300046559 | Bacteria | 3256 |
| 722 | Ga0495667_0107748 | 3300046559 | Bacteria | 1800 |
| 723 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 724 | Ga0495668_0057580 | 3300046616 | Bacteria | 2144 |
| 725 | Ga0495634_0008151 | 3300046642 | Bacteria | 7806 |
| 726 | Ga0495634_0020326 | 3300046642 | Bacteria | 4710 |
| 727 | Ga0495634_0030347 | 3300046642 | Bacteria | 3734 |
| 728 | Ga0495634_0034901 | 3300046642 | Bacteria | 3448 |
| 729 | Ga0495625_0002034 | 3300046660 | Bacteria | 22774 |
| 730 | Ga0495635_0006348 | 3300046663 | Bacteria | 8242 |
| 731 | Ga0495635_0008259 | 3300046663 | Bacteria | 7267 |
| 732 | Ga0495635_0171464 | 3300046663 | Bacteria | 1475 |
| 733 | Ga0495661_0058809 | 3300046665 | Bacteria | 2290 |
| 734 | Ga0495657_0013370 | 3300046675 | Bacteria | 6060 |
| 735 | Ga0495657_0033050 | 3300046675 | Bacteria | 3605 |
| 736 | Ga0495657_0075109 | 3300046675 | Bacteria | 2197 |
| 737 | Ga0495599_0000108 | 3300046678 | Bacteria | 56078 |
| 738 | Ga0495599_0004863 | 3300046678 | Bacteria | 7993 |
| 739 | Ga0495599_0008955 | 3300046678 | Bacteria | 6096 |
| 740 | Ga0495599_0013304 | 3300046678 | Bacteria | 5086 |
| 741 | Ga0495599_0023534 | 3300046678 | Bacteria | 3851 |
| 742 | Ga0495623_0000287 | 3300046679 | Bacteria | 32946 |
| 743 | Ga0495623_0002882 | 3300046679 | Bacteria | 11335 |
| 744 | Ga0495623_0014003 | 3300046679 | Bacteria | 5197 |
| 745 | Ga0495623_0015327 | 3300046679 | Bacteria | 4954 |
| 746 | Ga0495646_0015716 | 3300046680 | Bacteria | 4804 |
| 747 | Ga0495646_0016018 | 3300046680 | Bacteria | 4757 |
| 748 | Ga0495646_0040810 | 3300046680 | Bacteria | 2855 |
| 749 | Ga0495647_0014431 | 3300046681 | Bacteria | 2752 |
| 750 | Ga0495658_0009052 | 3300046683 | Bacteria | 4950 |
| 751 | Ga0495613_0000380 | 3300046689 | Bacteria | 38251 |
| 752 | Ga0495613_0015491 | 3300046689 | Bacteria | 5669 |
| 753 | Ga0495613_0276241 | 3300046689 | Bacteria | 1167 |
| 754 | Ga0495624_0014434 | 3300046690 | Bacteria | 5359 |
| 755 | Ga0495624_0105690 | 3300046690 | Bacteria | 1732 |
| 756 | Ga0495670_0000076 | 3300046691 | Bacteria | 43635 |
| 757 | Ga0495649_0010900 | 3300046694 | Bacteria | 5354 |
| 758 | Ga0495600_0018788 | 3300046809 | Bacteria | 4409 |
| 759 | Ga0495600_0096933 | 3300046809 | Bacteria | 1922 |
| 760 | Ga0495600_0100038 | 3300046809 | Bacteria | 1890 |
| 761 | Ga0495600_0123427 | 3300046809 | Bacteria | 1684 |
| 762 | Ga0495581_0007236 | 3300047315 | Bacteria | 6420 |
| 763 | Ga0495581_0032115 | 3300047315 | Bacteria | 3040 |
| 764 | Ga0495604_0000039 | 3300047317 | Bacteria | 123431 |
| 765 | Ga0495604_0000893 | 3300047317 | Bacteria | 24849 |
| 766 | Ga0495604_0007655 | 3300047317 | Bacteria | 8553 |
| 767 | Ga0495604_0024846 | 3300047317 | Bacteria | 4778 |
| 768 | Ga0495604_0055840 | 3300047317 | Bacteria | 3042 |
| 769 | Ga0495604_0063469 | 3300047317 | Bacteria | 2817 |
| 770 | Ga0495604_0136822 | 3300047317 | Bacteria | 1754 |
| 771 | Ga0495674_0042962 | 3300047319 | Bacteria | 4027 |
| 772 | Ga0495674_0065760 | 3300047319 | Bacteria | 3148 |
| 773 | Ga0495674_0092293 | 3300047319 | Bacteria | 2585 |
| 774 | Ga0495674_0162704 | 3300047319 | Bacteria | 1866 |
| 775 | Ga0495674_0176440 | 3300047319 | Bacteria | 1780 |
| 776 | Ga0495672_0053599 | 3300047320 | Bacteria | 2362 |
| 777 | Ga0495672_0068131 | 3300047320 | Bacteria | 2024 |
| 778 | Ga0495676_0064879 | 3300047321 | Bacteria | 2837 |
| 779 | Ga0495676_0067632 | 3300047321 | Bacteria | 2763 |
| 780 | Ga0495680_0000028 | 3300047322 | Bacteria | 112865 |
| 781 | Ga0495680_0006442 | 3300047322 | Bacteria | 10909 |
| 782 | Ga0495680_0008757 | 3300047322 | Bacteria | 9166 |
| 783 | Ga0495680_0018186 | 3300047322 | Bacteria | 5976 |
| 784 | Ga0495680_0019445 | 3300047322 | Bacteria | 5732 |
| 785 | Ga0495680_0029149 | 3300047322 | Bacteria | 4522 |
| 786 | Ga0495680_0096509 | 3300047322 | Bacteria | 2207 |
| 787 | Ga0495680_0160993 | 3300047322 | Unclassified | 1630 |
| 788 | Ga0495683_0003543 | 3300047323 | Bacteria | 9076 |
| 789 | Ga0495683_0004867 | 3300047323 | Bacteria | 7521 |
| 790 | Ga0495675_0000355 | 3300047444 | Bacteria | 32066 |
| 791 | Ga0495675_0003845 | 3300047444 | Bacteria | 9091 |
| 792 | Ga0495675_0013496 | 3300047444 | Bacteria | 5158 |
| 793 | Ga0495675_0041332 | 3300047444 | Plasmid | 2939 |
| 794 | Ga0495675_0102863 | 3300047444 | Bacteria | 1786 |
| 795 | Ga0495675_0138468 | 3300047444 | Bacteria | 1510 |
| 796 | Ga0495673_0013392 | 3300047469 | Plasmid | 4310 |
| 797 | Ga0495684_0039388 | 3300047471 | Bacteria | 3622 |
| 798 | Ga0495684_0069496 | 3300047471 | Bacteria | 2678 |
| 799 | Ga0495686_0003011 | 3300047472 | Bacteria | 14965 |
| 800 | Ga0495686_0065500 | 3300047472 | Bacteria | 2246 |
| 801 | Ga0495686_0192075 | 3300047472 | Unclassified | 1176 |
| 802 | Ga0495593_0007376 | 3300047673 | Bacteria | 6441 |
| 803 | Ga0495593_0010087 | 3300047673 | Bacteria | 5467 |
| 804 | Ga0495593_0010226 | 3300047673 | Bacteria | 5426 |
| 805 | Ga0495602_0000043 | 3300048088 | Bacteria | 123431 |
| 806 | Ga0495602_0001190 | 3300048088 | Bacteria | 25555 |
| 807 | Ga0495602_0014212 | 3300048088 | Bacteria | 8090 |
| 808 | Ga0495602_0047037 | 3300048088 | Bacteria | 3891 |
| 809 | Ga0495602_0065072 | 3300048088 | Bacteria | 3148 |
| 810 | Ga0495602_0077837 | 3300048088 | Bacteria | 2803 |
| 811 | Ga0495602_0084968 | 3300048088 | Bacteria | 2646 |
| 812 | Ga0496100_0063051 | 3300048903 | Bacteria | 2448 |
| 813 | Ga0496101_0012928 | 3300048904 | Bacteria | 5583 |
| 814 | Ga0496101_0048231 | 3300048904 | Bacteria | 3060 |
| 815 | Ga0496102_0002985 | 3300048905 | Bacteria | 14321 |
| 816 | Ga0496102_0125396 | 3300048905 | Bacteria | 2400 |
| 817 | Ga0496103_0002185 | 3300048906 | Bacteria | 12428 |
| 818 | Ga0496104_0079087 | 3300048907 | Bacteria | 3134 |
| 819 | Ga0496104_0087093 | 3300048907 | Bacteria | 2982 |
| 820 | Ga0496104_0197721 | 3300048907 | Bacteria | 1922 |
| 821 | Ga0496104_0454717 | 3300048907 | Bacteria | 1192 |
| 822 | Ga0496105_0000572 | 3300048908 | Bacteria | 24357 |
| 823 | Ga0496105_0085406 | 3300048908 | Bacteria | 2607 |
| 824 | Ga0496105_0112640 | 3300048908 | Bacteria | 2245 |
| 825 | Ga0496105_0194455 | 3300048908 | Bacteria | 1657 |
| 826 | Ga0496107_0307824 | 3300048910 | Bacteria | 1179 |
| 827 | Ga0496108_0038970 | 3300048911 | Bacteria | 3961 |
| 828 | Ga0496109_0020379 | 3300048912 | Bacteria | 5857 |
| 829 | Ga0496109_0061236 | 3300048912 | Bacteria | 3440 |
| 830 | Ga0496110_0007760 | 3300048913 | Bacteria | 8593 |
| 831 | Ga0496110_0038516 | 3300048913 | Bacteria | 4161 |
| 832 | Ga0496111_0000082 | 3300048914 | Bacteria | 39683 |
| 833 | Ga0496114_0020996 | 3300048917 | Bacteria | 5305 |
| 834 | Ga0496114_0141306 | 3300048917 | Bacteria | 2085 |
| 835 | Ga0496115_0060886 | 3300048918 | Bacteria | 3042 |
| 836 | Ga0496116_0039687 | 3300048919 | Bacteria | 3251 |
| 837 | Ga0496118_0014666 | 3300048921 | Bacteria | 7324 |
| 838 | Ga0496119_0000213 | 3300048922 | Bacteria | 82822 |
| 839 | Ga0496119_0138711 | 3300048922 | Bacteria | 1316 |
| 840 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 841 | Ga0496121_0001529 | 3300048924 | Bacteria | 38730 |
| 842 | Ga0496121_0010277 | 3300048924 | Bacteria | 10589 |
| 843 | Ga0496121_0030039 | 3300048924 | Bacteria | 5002 |
| 844 | Ga0496121_0127710 | 3300048924 | Bacteria | 1909 |
| 845 | Ga0496124_0000919 | 3300048927 | Bacteria | 47561 |
| 846 | Ga0496124_0003747 | 3300048927 | Bacteria | 18315 |
| 847 | Ga0496125_0027360 | 3300048928 | Bacteria | 5171 |
| 848 | Ga0496125_0030798 | 3300048928 | Bacteria | 4792 |
| 849 | Ga0496125_0030887 | 3300048928 | Bacteria | 4784 |
| 850 | Ga0496126_0001434 | 3300048929 | Bacteria | 37437 |
| 851 | Ga0496126_0062889 | 3300048929 | Bacteria | 3328 |
| 852 | Ga0496126_0080106 | 3300048929 | Bacteria | 2890 |
| 853 | Ga0496126_0158743 | 3300048929 | Bacteria | 1933 |
| 854 | Ga0496126_0464343 | 3300048929 | Bacteria | 1017 |
| 855 | Ga0495678_018911 | 3300049459 | Bacteria | 3086 |
| 856 | Ga0501031_0001824 | 3300049568 | Bacteria | 13399 |
| 857 | Ga0501031_0002425 | 3300049568 | Bacteria | 11861 |
| 858 | Ga0501031_0017107 | 3300049568 | Bacteria | 4710 |
| 859 | Ga0501033_0008619 | 3300049570 | Bacteria | 7892 |
| 860 | Ga0501034_0020044 | 3300049571 | Bacteria | 6830 |
| 861 | Ga0501034_0030987 | 3300049571 | Bacteria | 5435 |
| 862 | Ga0501034_0046424 | 3300049571 | Bacteria | 4389 |
| 863 | Ga0501034_0111063 | 3300049571 | Bacteria | 2732 |
| 864 | Ga0501034_0164347 | 3300049571 | Bacteria | 2189 |
| 865 | Ga0501036_0005963 | 3300049572 | Bacteria | 9878 |
| 866 | Ga0501036_0055476 | 3300049572 | Bacteria | 3357 |
| 867 | Ga0501037_0013273 | 3300049573 | Bacteria | 6070 |
| 868 | Ga0501037_0017406 | 3300049573 | Bacteria | 5292 |
| 869 | Ga0501038_0065221 | 3300049574 | Bacteria | 3103 |
| 870 | Ga0501039_0072770 | 3300049575 | Bacteria | 2671 |
| 871 | Ga0501040_0031012 | 3300049576 | Bacteria | 3613 |
| 872 | Ga0501041_0032257 | 3300049577 | Bacteria | 3166 |
| 873 | Ga0501043_0011565 | 3300049579 | Bacteria | 6905 |
| 874 | Ga0501043_0099256 | 3300049579 | Bacteria | 2289 |
| 875 | Ga0501046_0048422 | 3300049580 | Bacteria | 3365 |
| 876 | Ga0501046_0116743 | 3300049580 | Bacteria | 2034 |
| 877 | Ga0501047_0005052 | 3300049581 | Bacteria | 12383 |
| 878 | Ga0501047_0139777 | 3300049581 | Bacteria | 2301 |
| 879 | Ga0501067_0022409 | 3300049583 | Bacteria | 3496 |
| 880 | Ga0501069_0086023 | 3300049585 | Bacteria | 1775 |
| 881 | Ga0501071_0092472 | 3300049587 | Bacteria | 2223 |
| 882 | Ga0501072_0047097 | 3300049588 | Bacteria | 3395 |
| 883 | Ga0501076_0325269 | 3300049592 | Bacteria | 1261 |
| 884 | Ga0501198_000037 | 3300049649 | Bacteria | 52054 |
| 885 | Ga0501222_000032 | 3300049662 | Bacteria | 55723 |
| 886 | Ga0501223_023254 | 3300049663 | Bacteria | 1209 |
| 887 | Ga0501224_000329 | 3300049664 | Bacteria | 5555 |
| 888 | Ga0501229_005806 | 3300049706 | Bacteria | 1520 |
| 889 | Ga0501079_0142818 | 3300049741 | Bacteria | 1865 |
| 890 | Ga0501267_002028 | 3300049764 | Bacteria | 1788 |
| 891 | Ga0501282_000048 | 3300049778 | Bacteria | 15453 |
| 892 | Ga0501035_0002048 | 3300049822 | Bacteria | 20096 |
| 893 | Ga0501035_0038030 | 3300049822 | Bacteria | 4357 |
| 894 | Ga0501044_0000515 | 3300049823 | Bacteria | 47051 |
| 895 | Ga0501044_0007899 | 3300049823 | Bacteria | 11699 |
| 896 | Ga0501044_0202965 | 3300049823 | Bacteria | 1940 |
| 897 | Ga0501045_0014064 | 3300049824 | Bacteria | 5665 |
| 898 | nmdc:mga03683_64086_c1 | 3300050489 | Bacteria | 1559 |
| 899 | nmdc:mga03n38_23268_c1 | 3300050490 | Bacteria | 2518 |
| 900 | nmdc:mga00v17_19064_c1 | 3300050491 | Bacteria | 3910 |
| 901 | nmdc:mga00v17_5502_c1 | 3300050491 | Bacteria | 6672 |
| 902 | nmdc:mga0yw44_169796_c1 | 3300050492 | Bacteria | 1432 |
| 903 | nmdc:mga0k408_104155_c1 | 3300050493 | Bacteria | 1674 |
| 904 | nmdc:mga0k408_221_c1 | 3300050493 | Bacteria | 30239 |
| 905 | nmdc:mga0k408_44082_c1 | 3300050493 | Bacteria | 2572 |
| 906 | nmdc:mga0k408_56008_c1 | 3300050493 | Bacteria | 2287 |
| 907 | nmdc:mga0k408_84793_c1 | 3300050493 | Bacteria | 1859 |
| 908 | nmdc:mga07m45_37757_c1 | 3300050496 | Bacteria | 2694 |
| 909 | nmdc:mga07m45_53549_c1 | 3300050496 | Bacteria | 2280 |
| 910 | nmdc:mga05p37_172666_c1 | 3300050507 | Bacteria | 2636 |
| 911 | nmdc:mga05p37_176319_c1 | 3300050507 | Bacteria | 2604 |
| 912 | nmdc:mga05p37_195_c1 | 3300050507 | Bacteria | 60494 |
| 913 | nmdc:mga05p37_319547_c1 | 3300050507 | Bacteria | 1838 |
| 914 | nmdc:mga09592_15523_c1 | 3300050508 | Bacteria | 6226 |
| 915 | nmdc:mga09592_31262_c1 | 3300050508 | Bacteria | 4435 |
| 916 | nmdc:mga09592_31543_c1 | 3300050508 | Bacteria | 4416 |
| 917 | nmdc:mga09592_75950_c1 | 3300050508 | Bacteria | 2857 |
| 918 | nmdc:mga0qj67_145461_c1 | 3300050509 | Bacteria | 1922 |
| 919 | nmdc:mga0qj67_18502_c1 | 3300050509 | Bacteria | 5310 |
| 920 | nmdc:mga0qj67_6146_c1 | 3300050509 | Bacteria | 8805 |
| 921 | nmdc:mga0qj67_748_c1 | 3300050509 | Bacteria | 22059 |
| 922 | nmdc:mga06r32_149437_c1 | 3300050510 | Bacteria | 2314 |
| 923 | nmdc:mga06r32_157235_c1 | 3300050510 | Bacteria | 2255 |
| 924 | nmdc:mga06r32_16238_c1 | 3300050510 | Bacteria | 6781 |
| 925 | nmdc:mga06r32_290840_c1 | 3300050510 | Bacteria | 1621 |
| 926 | nmdc:mga06r32_50376_c1 | 3300050510 | Bacteria | 3984 |
| 927 | nmdc:mga06r32_679_c1 | 3300050510 | Bacteria | 29614 |
| 928 | nmdc:mga08y16_143407_c1 | 3300050511 | Bacteria | 2483 |
| 929 | nmdc:mga08y16_146914_c1 | 3300050511 | Bacteria | 2451 |
| 930 | nmdc:mga08y16_153193_c1 | 3300050511 | Bacteria | 2396 |
| 931 | nmdc:mga08y16_192423_c1 | 3300050511 | Bacteria | 2115 |
| 932 | nmdc:mga0n895_103219_c1 | 3300050512 | Bacteria | 2863 |
| 933 | nmdc:mga0rr50_62340_c1 | 3300050513 | Bacteria | 2813 |
| 934 | nmdc:mga08x19_165786_c1 | 3300050514 | Bacteria | 1502 |
| 935 | nmdc:mga08x19_23217_c1 | 3300050514 | Bacteria | 3847 |
| 936 | nmdc:mga0a205_12356_c1 | 3300050515 | Bacteria | 7898 |
| 937 | nmdc:mga0sz30_11794_c1 | 3300050516 | Bacteria | 3385 |
| 938 | Ga0495601_0126239 | 3300053077 | Bacteria | 1664 |
| 939 | Ga0495601_0142219 | 3300053077 | Bacteria | 1565 |
| 940 | Ga0495619_0010048 | 3300053085 | Bacteria | 5957 |
| 941 | Ga0495619_0275864 | 3300053085 | Bacteria | 1165 |
| 942 | Ga0500643_000295 | 3300053087 | Bacteria | 42617 |
| 943 | Ga0500647_0007202 | 3300053091 | Bacteria | 4758 |
| 944 | Ga0500566_0138516 | 3300053094 | Bacteria | 1294 |
| 945 | Ga0500641_0005553 | 3300053096 | Bacteria | 4467 |
| 946 | Ga0500593_000250 | 3300053117 | Bacteria | 22072 |
| 947 | Ga0500607_000006 | 3300053121 | Bacteria | 136863 |
| 948 | Ga0500559_0000698 | 3300053136 | Bacteria | 22073 |
| 949 | Ga0500559_0004182 | 3300053136 | Bacteria | 6923 |
| 950 | Ga0500568_0011569 | 3300053139 | Bacteria | 4085 |
| 951 | Ga0500616_0035401 | 3300053153 | Bacteria | 2715 |
| 952 | Ga0500619_000038 | 3300053154 | Bacteria | 40615 |
| 953 | Ga0500622_0000970 | 3300053156 | Bacteria | 24316 |
| 954 | Ga0500622_0001376 | 3300053156 | Bacteria | 19604 |
| 955 | Ga0500622_0002997 | 3300053156 | Bacteria | 11697 |
| 956 | Ga0500622_0003799 | 3300053156 | Bacteria | 9831 |
| 957 | Ga0500622_0006287 | 3300053156 | Bacteria | 6936 |
| 958 | Ga0500636_0088542 | 3300053177 | Bacteria | 1775 |
| 959 | Ga0500636_0099119 | 3300053177 | Bacteria | 1659 |
| 960 | Ga0500637_0002011 | 3300053178 | Bacteria | 8870 |
| 961 | Ga0500645_000215 | 3300053730 | Bacteria | 43997 |
| 962 | Ga0500645_006747 | 3300053730 | Bacteria | 4067 |
| 963 | Ga0500645_018935 | 3300053730 | Bacteria | 2145 |
| 964 | Ga0501082_0076865 | 3300060353 | Bacteria | 2878 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031712 | Ga0265342_10040268 | Ga0265342_100402683 | 295 |
| 2 | 3300045051 | Ga0451576_0039548 | Ga0451576_0039548_2769_3722 | 295 |
| 3 | 3300005366 | Ga0070659_100524304 | Ga0070659_1005243041 | 296 |
| 4 | 3300006048 | Ga0075363_100032392 | Ga0075363_1000323922 | 297 |
| 5 | 3300006844 | Ga0075428_100007195 | Ga0075428_10000719512 | 297 |
| 6 | 3300006846 | Ga0075430_100057367 | Ga0075430_1000573672 | 297 |
| 7 | 3300006847 | Ga0075431_100148829 | Ga0075431_1001488293 | 297 |
| 8 | 3300009147 | Ga0114129_10122874 | Ga0114129_101228743 | 297 |
| 9 | 3300050507 | nmdc:mga05p37_319547_c1 | nmdc:mga05p37_319547_c1_320_1258 | 297 |
| 10 | 3300050508 | nmdc:mga09592_31543_c1 | nmdc:mga09592_31543_c1_1222_2160 | 297 |
| 11 | 3300038741 | Ga0400488_40259 | Ga0400488_40259_759_1691 | 299 |
| 12 | 3300046457 | Ga0495590_0093275 | Ga0495590_0093275_137_1042 | 301 |
| 13 | 3300049664 | Ga0501224_000329 | Ga0501224_000329_3421_4380 | 301 |
| 14 | 3300049778 | Ga0501282_000048 | Ga0501282_000048_13325_14284 | 301 |
| 15 | 3300006038 | Ga0075365_10002903 | Ga0075365_100029038 | 302 |
| 16 | 3300035111 | Ga0373923_0007720 | Ga0373923_0007720_458_1399 | 302 |
| 17 | 3300035724 | Ga0373933_0001324 | Ga0373933_0001324_7414_8355 | 302 |
| 18 | 3300036401 | Ga0373937_0007329 | Ga0373937_0007329_1034_1975 | 302 |
| 19 | 3300046454 | Ga0495592_0002287 | Ga0495592_0002287_4654_5595 | 302 |
| 20 | 3300046463 | Ga0495653_0014349 | Ga0495653_0014349_4489_5430 | 302 |
| 21 | 3300046511 | Ga0495608_0018525 | Ga0495608_0018525_2804_3745 | 302 |
| 22 | 3300046536 | Ga0495587_0070409 | Ga0495587_0070409_509_1450 | 302 |
| 23 | 3300046642 | Ga0495634_0008151 | Ga0495634_0008151_5387_6328 | 302 |
| 24 | 3300046663 | Ga0495635_0006348 | Ga0495635_0006348_683_1624 | 302 |
| 25 | 3300046809 | Ga0495600_0018788 | Ga0495600_0018788_665_1606 | 302 |
| 26 | 3300047317 | Ga0495604_0024846 | Ga0495604_0024846_2804_3745 | 302 |
| 27 | 3300047322 | Ga0495680_0019445 | Ga0495680_0019445_2116_3057 | 302 |
| 28 | 3300047444 | Ga0495675_0003845 | Ga0495675_0003845_1631_2572 | 302 |
| 29 | 3300053085 | Ga0495619_0010048 | Ga0495619_0010048_823_1764 | 302 |
| 30 | 3300005339 | Ga0070660_100010451 | Ga0070660_1000104517 | 303 |
| 31 | 3300005563 | Ga0068855_100067050 | Ga0068855_1000670504 | 303 |
| 32 | 3300006051 | Ga0075364_10220909 | Ga0075364_102209092 | 303 |
| 33 | 3300009093 | Ga0105240_10125926 | Ga0105240_101259262 | 303 |
| 34 | 3300025909 | Ga0207705_10251711 | Ga0207705_102517112 | 303 |
| 35 | 3300025924 | Ga0207694_10341034 | Ga0207694_103410342 | 303 |
| 36 | 3300025273 | Ga0209673_1021109 | Ga0209673_10211093 | 304 |
| 37 | 3300025298 | Ga0209050_1005408 | Ga0209050_10054085 | 304 |
| 38 | 3300025303 | Ga0209051_1004454 | Ga0209051_10044544 | 304 |
| 39 | 3300025304 | Ga0209257_1004031 | Ga0209257_100403111 | 304 |
| 40 | 3300005289 | Ga0065704_10147643 | Ga0065704_101476431 | 305 |
| 41 | 3300005937 | Ga0081455_10014422 | Ga0081455_100144229 | 305 |
| 42 | 3300009176 | Ga0105242_10006667 | Ga0105242_100066675 | 305 |
| 43 | 3300025934 | Ga0207686_10004843 | Ga0207686_100048436 | 305 |
| 44 | 3300025934 | Ga0207686_10305411 | Ga0207686_103054111 | 305 |
| 45 | 3300031238 | Ga0265332_10000083 | Ga0265332_100000839 | 305 |
| 46 | 3300048924 | Ga0496121_0030039 | Ga0496121_0030039_2530_3480 | 305 |
| 47 | 3300005338 | Ga0068868_100090463 | Ga0068868_1000904634 | 306 |
| 48 | 3300005436 | Ga0070713_100000019 | Ga0070713_10000001925 | 306 |
| 49 | 3300005614 | Ga0068856_100035912 | Ga0068856_1000359122 | 306 |
| 50 | 3300005983 | Ga0081540_1024303 | Ga0081540_10243034 | 306 |
| 51 | 3300006175 | Ga0070712_100162399 | Ga0070712_1001623992 | 306 |
| 52 | 3300006195 | Ga0075366_10151950 | Ga0075366_101519501 | 306 |
| 53 | 3300025917 | Ga0207660_10261282 | Ga0207660_102612822 | 306 |
| 54 | 3300025928 | Ga0207700_10000035 | Ga0207700_1000003554 | 306 |
| 55 | 3300026023 | Ga0207677_10254566 | Ga0207677_102545662 | 306 |
| 56 | 3300026078 | Ga0207702_10112622 | Ga0207702_101126222 | 306 |
| 57 | 3300028666 | Ga0265336_10000003 | Ga0265336_1000000341 | 306 |
| 58 | 3300029957 | Ga0265324_10003293 | Ga0265324_100032934 | 306 |
| 59 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006232 | 306 |
| 60 | 3300038443 | Ga0395901_0124818 | Ga0395901_0124818_198_1154 | 306 |
| 61 | 3300038742 | Ga0400486_17406 | Ga0400486_17406_85_1041 | 306 |
| 62 | 3300039447 | Ga0436361_0193139 | Ga0436361_0193139_603_1556 | 306 |
| 63 | 3300045051 | Ga0451576_0050999 | Ga0451576_0050999_776_1723 | 306 |
| 64 | 3300046542 | Ga0495597_0001231 | Ga0495597_0001231_1611_2570 | 306 |
| 65 | 3300048907 | Ga0496104_0087093 | Ga0496104_0087093_671_1624 | 306 |
| 66 | 3300048907 | Ga0496104_0197721 | Ga0496104_0197721_198_1151 | 306 |
| 67 | 3300048908 | Ga0496105_0000572 | Ga0496105_0000572_10316_11269 | 306 |
| 68 | 3300048908 | Ga0496105_0112640 | Ga0496105_0112640_605_1558 | 306 |
| 69 | 3300048918 | Ga0496115_0060886 | Ga0496115_0060886_603_1556 | 306 |
| 70 | 3300048922 | Ga0496119_0000213 | Ga0496119_0000213_61571_62524 | 306 |
| 71 | 3300003775 | Ga0055524_1029023 | Ga0055524_10290232 | 307 |
| 72 | 3300003794 | Ga0055531_10008251 | Ga0055531_100082514 | 307 |
| 73 | 3300005338 | Ga0068868_100086716 | Ga0068868_1000867162 | 307 |
| 74 | 3300005364 | Ga0070673_100032621 | Ga0070673_1000326213 | 307 |
| 75 | 3300005459 | Ga0068867_100001878 | Ga0068867_1000018784 | 307 |
| 76 | 3300005543 | Ga0070672_100040583 | Ga0070672_1000405834 | 307 |
| 77 | 3300005564 | Ga0070664_100119385 | Ga0070664_1001193853 | 307 |
| 78 | 3300005577 | Ga0068857_100171775 | Ga0068857_1001717752 | 307 |
| 79 | 3300005937 | Ga0081455_10006640 | Ga0081455_100066402 | 307 |
| 80 | 3300006942 | Ga0099824_1039673 | Ga0099824_10396731 | 307 |
| 81 | 3300006944 | Ga0099823_1000138 | Ga0099823_100013829 | 307 |
| 82 | 3300006946 | Ga0079104_1000007 | Ga0079104_10000072 | 307 |
| 83 | 3300021377 | Ga0213874_10019036 | Ga0213874_100190362 | 307 |
| 84 | 3300021384 | Ga0213876_10045174 | Ga0213876_100451742 | 307 |
| 85 | 3300025299 | Ga0209256_1000840 | Ga0209256_100084029 | 307 |
| 86 | 3300025893 | Ga0207682_10044025 | Ga0207682_100440251 | 307 |
| 87 | 3300025927 | Ga0207687_10241108 | Ga0207687_102411082 | 307 |
| 88 | 3300025927 | Ga0207687_10334515 | Ga0207687_103345151 | 307 |
| 89 | 3300025933 | Ga0207706_10156774 | Ga0207706_101567742 | 307 |
| 90 | 3300025935 | Ga0207709_10000172 | Ga0207709_1000017213 | 307 |
| 91 | 3300025940 | Ga0207691_10006862 | Ga0207691_100068624 | 307 |
| 92 | 3300025942 | Ga0207689_10007180 | Ga0207689_100071804 | 307 |
| 93 | 3300025945 | Ga0207679_10427917 | Ga0207679_104279171 | 307 |
| 94 | 3300026089 | Ga0207648_10000984 | Ga0207648_1000098422 | 307 |
| 95 | 3300026116 | Ga0207674_10017659 | Ga0207674_100176599 | 307 |
| 96 | 3300026121 | Ga0207683_10028651 | Ga0207683_100286514 | 307 |
| 97 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020495 | 307 |
| 98 | 3300027296 | Ga0209389_1023254 | Ga0209389_10232544 | 307 |
| 99 | 3300028794 | Ga0307515_10000737 | Ga0307515_1000073744 | 307 |
| 100 | 3300031251 | Ga0265327_10001335 | Ga0265327_1000133528 | 307 |
| 101 | 3300031456 | Ga0307513_10010252 | Ga0307513_100102524 | 307 |
| 102 | 3300031548 | Ga0307408_100000029 | Ga0307408_10000002981 | 307 |
| 103 | 3300031548 | Ga0307408_100498244 | Ga0307408_1004982441 | 307 |
| 104 | 3300031649 | Ga0307514_10000408 | Ga0307514_1000040825 | 307 |
| 105 | 3300038726 | Ga0400490_31337 | Ga0400490_31337_10250_11206 | 307 |
| 106 | 3300038726 | Ga0400490_35285 | Ga0400490_35285_6478_7434 | 307 |
| 107 | 3300038727 | Ga0400491_06486 | Ga0400491_06486_538_1494 | 307 |
| 108 | 3300038741 | Ga0400488_05117 | Ga0400488_05117_324_1280 | 307 |
| 109 | 3300039110 | Ga0400487_41767 | Ga0400487_41767_88_1044 | 307 |
| 110 | 3300039437 | Ga0436365_0921695 | Ga0436365_0921695_2057_3028 | 307 |
| 111 | 3300039450 | Ga0436363_0030776 | Ga0436363_0030776_716_1687 | 307 |
| 112 | 3300046475 | Ga0495639_0100548 | Ga0495639_0100548_47_997 | 307 |
| 113 | 3300046530 | Ga0495654_0012961 | Ga0495654_0012961_2022_2978 | 307 |
| 114 | 3300005434 | Ga0070709_10000424 | Ga0070709_1000042421 | 308 |
| 115 | 3300005437 | Ga0070710_10021505 | Ga0070710_100215053 | 308 |
| 116 | 3300005439 | Ga0070711_100010642 | Ga0070711_1000106422 | 308 |
| 117 | 3300005843 | Ga0068860_100000101 | Ga0068860_10000010163 | 308 |
| 118 | 3300006028 | Ga0070717_10248702 | Ga0070717_102487022 | 308 |
| 119 | 3300006173 | Ga0070716_100109504 | Ga0070716_1001095042 | 308 |
| 120 | 3300006195 | Ga0075366_10006834 | Ga0075366_100068344 | 308 |
| 121 | 3300006852 | Ga0075433_10032292 | Ga0075433_100322925 | 308 |
| 122 | 3300007076 | Ga0075435_100018531 | Ga0075435_1000185313 | 308 |
| 123 | 3300009101 | Ga0105247_10184776 | Ga0105247_101847762 | 308 |
| 124 | 3300009147 | Ga0114129_10008622 | Ga0114129_1000862214 | 308 |
| 125 | 3300009545 | Ga0105237_10015974 | Ga0105237_100159745 | 308 |
| 126 | 3300009545 | Ga0105237_10430063 | Ga0105237_104300632 | 308 |
| 127 | 3300010375 | Ga0105239_10025714 | Ga0105239_100257145 | 308 |
| 128 | 3300025898 | Ga0207692_10000738 | Ga0207692_1000073812 | 308 |
| 129 | 3300025906 | Ga0207699_10000465 | Ga0207699_100004651 | 308 |
| 130 | 3300025914 | Ga0207671_10080063 | Ga0207671_100800632 | 308 |
| 131 | 3300025915 | Ga0207693_10003980 | Ga0207693_100039808 | 308 |
| 132 | 3300025929 | Ga0207664_10010239 | Ga0207664_100102394 | 308 |
| 133 | 3300025939 | Ga0207665_10035614 | Ga0207665_100356142 | 308 |
| 134 | 3300026035 | Ga0207703_10250156 | Ga0207703_102501562 | 308 |
| 135 | 3300026121 | Ga0207683_10279075 | Ga0207683_102790751 | 308 |
| 136 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030167 | 308 |
| 137 | 3300028556 | Ga0265337_1001439 | Ga0265337_100143910 | 308 |
| 138 | 3300028563 | Ga0265319_1002798 | Ga0265319_10027983 | 308 |
| 139 | 3300028573 | Ga0265334_10005637 | Ga0265334_100056375 | 308 |
| 140 | 3300028653 | Ga0265323_10000992 | Ga0265323_100009929 | 308 |
| 141 | 3300028654 | Ga0265322_10005607 | Ga0265322_100056072 | 308 |
| 142 | 3300028666 | Ga0265336_10000063 | Ga0265336_1000006383 | 308 |
| 143 | 3300028800 | Ga0265338_10000154 | Ga0265338_1000015411 | 308 |
| 144 | 3300029957 | Ga0265324_10001590 | Ga0265324_100015905 | 308 |
| 145 | 3300031238 | Ga0265332_10057278 | Ga0265332_100572782 | 308 |
| 146 | 3300031241 | Ga0265325_10002402 | Ga0265325_100024022 | 308 |
| 147 | 3300031249 | Ga0265339_10017132 | Ga0265339_100171324 | 308 |
| 148 | 3300031595 | Ga0265313_10067376 | Ga0265313_100673761 | 308 |
| 149 | 3300031730 | Ga0307516_10008117 | Ga0307516_1000811711 | 308 |
| 150 | 3300031731 | Ga0307405_10001234 | Ga0307405_1000123411 | 308 |
| 151 | 3300031903 | Ga0307407_10017891 | Ga0307407_100178912 | 308 |
| 152 | 3300031911 | Ga0307412_10004520 | Ga0307412_100045203 | 308 |
| 153 | 3300031995 | Ga0307409_100005343 | Ga0307409_1000053435 | 308 |
| 154 | 3300032002 | Ga0307416_100005644 | Ga0307416_1000056445 | 308 |
| 155 | 3300032005 | Ga0307411_10003401 | Ga0307411_100034018 | 308 |
| 156 | 3300035086 | Ga0373934_0078727 | Ga0373934_0078727_185_1144 | 308 |
| 157 | 3300035117 | Ga0373953_0000542 | Ga0373953_0000542_2015_2974 | 308 |
| 158 | 3300035118 | Ga0373954_0000323 | Ga0373954_0000323_4228_5187 | 308 |
| 159 | 3300036401 | Ga0373937_0154145 | Ga0373937_0154145_379_1338 | 308 |
| 160 | 3300038741 | Ga0400488_14976 | Ga0400488_14976_1116_2078 | 308 |
| 161 | 3300039062 | Ga0400483_215880 | Ga0400483_215880_1000_1962 | 308 |
| 162 | 3300039110 | Ga0400487_34028 | Ga0400487_34028_17399_18358 | 308 |
| 163 | 3300039450 | Ga0436363_1481785 | Ga0436363_1481785_50_1009 | 308 |
| 164 | 3300044712 | Ga0453684_0140562 | Ga0453684_0140562_1707_2666 | 308 |
| 165 | 3300046459 | Ga0495629_0013834 | Ga0495629_0013834_627_1586 | 308 |
| 166 | 3300046678 | Ga0495599_0004863 | Ga0495599_0004863_6481_7440 | 308 |
| 167 | 3300048924 | Ga0496121_0000089 | Ga0496121_0000089_66841_67800 | 308 |
| 168 | 3300048927 | Ga0496124_0003747 | Ga0496124_0003747_442_1401 | 308 |
| 169 | 3300048928 | Ga0496125_0030798 | Ga0496125_0030798_1399_2370 | 308 |
| 170 | 3300053177 | Ga0500636_0088542 | Ga0500636_0088542_583_1542 | 308 |
| 171 | 3300021441 | Ga0213871_10006411 | Ga0213871_100064112 | 309 |
| 172 | 3300028794 | Ga0307515_10066530 | Ga0307515_100665303 | 309 |
| 173 | 3300031616 | Ga0307508_10000282 | Ga0307508_1000028235 | 309 |
| 174 | 3300032004 | Ga0307414_10028494 | Ga0307414_100284944 | 309 |
| 175 | 3300032005 | Ga0307411_10000218 | Ga0307411_100002189 | 309 |
| 176 | 3300037471 | Ga0395905_0010810 | Ga0395905_0010810_4273_5238 | 309 |
| 177 | 3300038741 | Ga0400488_34208 | Ga0400488_34208_3752_4708 | 309 |
| 178 | 3300049568 | Ga0501031_0001824 | Ga0501031_0001824_7576_8535 | 309 |
| 179 | 3300049663 | Ga0501223_023254 | Ga0501223_023254_213_1175 | 309 |
| 180 | 3300049706 | Ga0501229_005806 | Ga0501229_005806_273_1232 | 309 |
| 181 | 3300053096 | Ga0500641_0005553 | Ga0500641_0005553_1150_2079 | 309 |
| 182 | iso_pu_bacteria | 2643221598 | 2643999135 | 309 |
| 183 | 3300003203 | JGI25406J46586_10051383 | JGI25406J46586_100513831 | 310 |
| 184 | 3300005336 | Ga0070680_100131673 | Ga0070680_1001316731 | 310 |
| 185 | 3300005577 | Ga0068857_100290543 | Ga0068857_1002905432 | 310 |
| 186 | 3300005614 | Ga0068856_100062674 | Ga0068856_1000626742 | 310 |
| 187 | 3300005616 | Ga0068852_100007943 | Ga0068852_1000079439 | 310 |
| 188 | 3300005937 | Ga0081455_10012116 | Ga0081455_100121168 | 310 |
| 189 | 3300005983 | Ga0081540_1028089 | Ga0081540_10280892 | 310 |
| 190 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022014 | 310 |
| 191 | 3300005985 | Ga0081539_10031999 | Ga0081539_100319994 | 310 |
| 192 | 3300005985 | Ga0081539_10053536 | Ga0081539_100535363 | 310 |
| 193 | 3300013105 | Ga0157369_10296307 | Ga0157369_102963072 | 310 |
| 194 | 3300025949 | Ga0207667_10123088 | Ga0207667_101230882 | 310 |
| 195 | 3300028794 | Ga0307515_10039959 | Ga0307515_100399591 | 310 |
| 196 | 3300030521 | Ga0307511_10048394 | Ga0307511_100483943 | 310 |
| 197 | 3300031247 | Ga0265340_10050275 | Ga0265340_100502752 | 310 |
| 198 | 3300031616 | Ga0307508_10189174 | Ga0307508_101891742 | 310 |
| 199 | 3300031730 | Ga0307516_10190035 | Ga0307516_101900352 | 310 |
| 200 | 3300033179 | Ga0307507_10052214 | Ga0307507_100522144 | 310 |
| 201 | 3300035695 | Ga0373927_0010672 | Ga0373927_0010672_3483_4442 | 310 |
| 202 | 3300035695 | Ga0373927_0026821 | Ga0373927_0026821_2626_3585 | 310 |
| 203 | 3300035725 | Ga0373947_0024761 | Ga0373947_0024761_1667_2626 | 310 |
| 204 | 3300037068 | Ga0373925_0077084 | Ga0373925_0077084_1346_2305 | 310 |
| 205 | 3300042876 | Ga0451577_0000235 | Ga0451577_0000235_65326_66294 | 310 |
| 206 | 3300044712 | Ga0453684_0000906 | Ga0453684_0000906_54451_55419 | 310 |
| 207 | 3300049649 | Ga0501198_000037 | Ga0501198_000037_47747_48706 | 310 |
| 208 | 3300049662 | Ga0501222_000032 | Ga0501222_000032_10518_11477 | 310 |
| 209 | 3300053154 | Ga0500619_000038 | Ga0500619_000038_25541_26500 | 310 |
| 210 | iso_pu_bacteria | 2897803580 | 2897808573 | 310 |
| 211 | 3300005293 | Ga0065715_10130447 | Ga0065715_101304472 | 311 |
| 212 | 3300005331 | Ga0070670_100000863 | Ga0070670_10000086310 | 311 |
| 213 | 3300005340 | Ga0070689_100310839 | Ga0070689_1003108391 | 311 |
| 214 | 3300005353 | Ga0070669_100003725 | Ga0070669_1000037253 | 311 |
| 215 | 3300005354 | Ga0070675_100000605 | Ga0070675_10000060511 | 311 |
| 216 | 3300005355 | Ga0070671_100023448 | Ga0070671_1000234483 | 311 |
| 217 | 3300005364 | Ga0070673_100012312 | Ga0070673_1000123123 | 311 |
| 218 | 3300005367 | Ga0070667_100279130 | Ga0070667_1002791301 | 311 |
| 219 | 3300005459 | Ga0068867_100007933 | Ga0068867_1000079335 | 311 |
| 220 | 3300005466 | Ga0070685_10165248 | Ga0070685_101652482 | 311 |
| 221 | 3300005543 | Ga0070672_100003662 | Ga0070672_1000036627 | 311 |
| 222 | 3300005548 | Ga0070665_100162688 | Ga0070665_1001626882 | 311 |
| 223 | 3300005616 | Ga0068852_100128342 | Ga0068852_1001283422 | 311 |
| 224 | 3300005618 | Ga0068864_100095161 | Ga0068864_1000951612 | 311 |
| 225 | 3300006237 | Ga0097621_100016909 | Ga0097621_1000169093 | 311 |
| 226 | 3300006358 | Ga0068871_100025108 | Ga0068871_1000251082 | 311 |
| 227 | 3300009177 | Ga0105248_10022581 | Ga0105248_100225815 | 311 |
| 228 | 3300013306 | Ga0163162_10170219 | Ga0163162_101702192 | 311 |
| 229 | 3300013308 | Ga0157375_10042879 | Ga0157375_100428792 | 311 |
| 230 | 3300025315 | Ga0207697_10012568 | Ga0207697_100125683 | 311 |
| 231 | 3300025893 | Ga0207682_10001822 | Ga0207682_100018227 | 311 |
| 232 | 3300025901 | Ga0207688_10100146 | Ga0207688_101001462 | 311 |
| 233 | 3300025903 | Ga0207680_10095411 | Ga0207680_100954112 | 311 |
| 234 | 3300025923 | Ga0207681_10023667 | Ga0207681_100236673 | 311 |
| 235 | 3300025925 | Ga0207650_10000326 | Ga0207650_1000032610 | 311 |
| 236 | 3300025926 | Ga0207659_10000299 | Ga0207659_1000029924 | 311 |
| 237 | 3300025931 | Ga0207644_10001354 | Ga0207644_100013549 | 311 |
| 238 | 3300025940 | Ga0207691_10000049 | Ga0207691_1000004927 | 311 |
| 239 | 3300025940 | Ga0207691_10133760 | Ga0207691_101337601 | 311 |
| 240 | 3300025960 | Ga0207651_10000834 | Ga0207651_1000083411 | 311 |
| 241 | 3300025972 | Ga0207668_10224891 | Ga0207668_102248912 | 311 |
| 242 | 3300025986 | Ga0207658_10025492 | Ga0207658_100254925 | 311 |
| 243 | 3300026089 | Ga0207648_10002748 | Ga0207648_100027483 | 311 |
| 244 | 3300026095 | Ga0207676_10059072 | Ga0207676_100590724 | 311 |
| 245 | 3300028379 | Ga0268266_10136602 | Ga0268266_101366022 | 311 |
| 246 | 3300047472 | Ga0495686_0192075 | Ga0495686_0192075_51_986 | 311 |
| 247 | 3300048919 | Ga0496116_0039687 | Ga0496116_0039687_2042_2977 | 311 |
| 248 | 3300048924 | Ga0496121_0127710 | Ga0496121_0127710_757_1692 | 311 |
| 249 | 3300049580 | Ga0501046_0116743 | Ga0501046_0116743_877_1812 | 311 |
| 250 | iso_pu_bacteria | 642555112 | 642594997 | 311 |
| 251 | 3300005334 | Ga0068869_100017832 | Ga0068869_1000178326 | 312 |
| 252 | 3300006038 | Ga0075365_10011690 | Ga0075365_100116905 | 312 |
| 253 | 3300006042 | Ga0075368_10001375 | Ga0075368_100013758 | 312 |
| 254 | 3300006048 | Ga0075363_100080769 | Ga0075363_1000807692 | 312 |
| 255 | 3300006051 | Ga0075364_10001926 | Ga0075364_100019268 | 312 |
| 256 | 3300006178 | Ga0075367_10006610 | Ga0075367_100066104 | 312 |
| 257 | 3300021384 | Ga0213876_10072141 | Ga0213876_100721412 | 312 |
| 258 | 3300028794 | Ga0307515_10087967 | Ga0307515_100879674 | 312 |
| 259 | 3300031852 | Ga0307410_10137867 | Ga0307410_101378672 | 312 |
| 260 | 3300035398 | Ga0316574_0028981 | Ga0316574_0028981_974_1912 | 312 |
| 261 | 3300039437 | Ga0436365_0523972 | Ga0436365_0523972_5473_6432 | 312 |
| 262 | 3300039453 | Ga0436362_0198186 | Ga0436362_0198186_2055_3014 | 312 |
| 263 | 3300050489 | nmdc:mga03683_64086_c1 | nmdc:mga03683_64086_c1_609_1547 | 312 |
| 264 | 3300050490 | nmdc:mga03n38_23268_c1 | nmdc:mga03n38_23268_c1_325_1263 | 312 |
| 265 | 3300050491 | nmdc:mga00v17_5502_c1 | nmdc:mga00v17_5502_c1_2823_3761 | 312 |
| 266 | 3300050516 | nmdc:mga0sz30_11794_c1 | nmdc:mga0sz30_11794_c1_618_1556 | 312 |
| 267 | 3300053091 | Ga0500647_0007202 | Ga0500647_0007202_1687_2625 | 312 |
| 268 | 3300053153 | Ga0500616_0035401 | Ga0500616_0035401_1283_2221 | 312 |
| 269 | iso_pu_bacteria | 2896184354 | 2896186541 | 312 |
| 270 | iso_pu_bacteria | 2896253425 | 2896253888 | 312 |
| 271 | iso_pu_bacteria | 2919034639 | 2919037802 | 312 |
| 272 | iso_pu_bacteria | 3000865235 | 3000867503 | 312 |
| 273 | 3300005353 | Ga0070669_100115925 | Ga0070669_1001159251 | 313 |
| 274 | 3300006846 | Ga0075430_100320366 | Ga0075430_1003203661 | 313 |
| 275 | 3300006847 | Ga0075431_100154509 | Ga0075431_1001545093 | 313 |
| 276 | 3300006880 | Ga0075429_100044872 | Ga0075429_1000448722 | 313 |
| 277 | 3300028800 | Ga0265338_10010111 | Ga0265338_100101116 | 313 |
| 278 | 3300029957 | Ga0265324_10040385 | Ga0265324_100403852 | 313 |
| 279 | 3300031251 | Ga0265327_10001037 | Ga0265327_1000103717 | 313 |
| 280 | 3300032168 | Ga0316593_10003817 | Ga0316593_100038171 | 313 |
| 281 | 3300037418 | Ga0395900_0036907 | Ga0395900_0036907_2587_3528 | 313 |
| 282 | 3300039062 | Ga0400483_035654 | Ga0400483_035654_717_1658 | 313 |
| 283 | 3300039093 | Ga0400489_33603 | Ga0400489_33603_230_1174 | 313 |
| 284 | 3300046689 | Ga0495613_0000380 | Ga0495613_0000380_35210_36151 | 313 |
| 285 | 3300048924 | Ga0496121_0001529 | Ga0496121_0001529_10726_11667 | 313 |
| 286 | 3300049571 | Ga0501034_0164347 | Ga0501034_0164347_249_1193 | 313 |
| 287 | 3300050508 | nmdc:mga09592_75950_c1 | nmdc:mga09592_75950_c1_1335_2276 | 313 |
| 288 | 3300050509 | nmdc:mga0qj67_145461_c1 | nmdc:mga0qj67_145461_c1_340_1281 | 313 |
| 289 | 3300050510 | nmdc:mga06r32_290840_c1 | nmdc:mga06r32_290840_c1_651_1592 | 313 |
| 290 | 3300053156 | Ga0500622_0003799 | Ga0500622_0003799_5256_6197 | 313 |
| 291 | iso_pu_bacteria | 2547132374 | 2548500316 | 313 |
| 292 | iso_pu_bacteria | 2643221544 | 2643745043 | 313 |
| 293 | iso_pu_bacteria | 2643221570 | 2643864649 | 313 |
| 294 | iso_pu_bacteria | 2643221596 | 2643992736 | 313 |
| 295 | iso_pu_bacteria | 2643221646 | 2644258146 | 313 |
| 296 | iso_pu_bacteria | 2643221652 | 2644296445 | 313 |
| 297 | iso_pu_bacteria | 2643221717 | 2644647135 | 313 |
| 298 | iso_pu_bacteria | 2738541296 | 2738821393 | 313 |
| 299 | iso_pu_bacteria | 2738541298 | 2738833876 | 313 |
| 300 | iso_pu_bacteria | 2738541306 | 2738875079 | 313 |
| 301 | iso_pu_bacteria | 2738543002 | 2739187033 | 313 |
| 302 | iso_pu_bacteria | 2738543008 | 2739221677 | 313 |
| 303 | iso_pu_bacteria | 2744054900 | 2746091608 | 313 |
| 304 | iso_pu_bacteria | 2744054901 | 2746099237 | 313 |
| 305 | iso_pu_bacteria | 2881101125 | 2881105146 | 313 |
| 306 | iso_pu_bacteria | 2904483920 | 2904485821 | 313 |
| 307 | iso_pu_bacteria | 2919527303 | 2919533641 | 313 |
| 308 | iso_pu_bacteria | 2932422444 | 2932422644 | 313 |
| 309 | iso_pu_bacteria | 2939631187 | 2939632350 | 313 |
| 310 | iso_pu_bacteria | 2990710928 | 2990715231 | 313 |
| 311 | 3300003322 | rootL2_10253676 | rootL2_102536762 | 314 |
| 312 | 3300005548 | Ga0070665_100038890 | Ga0070665_1000388904 | 314 |
| 313 | 3300009093 | Ga0105240_10106099 | Ga0105240_101060992 | 314 |
| 314 | 3300009553 | Ga0105249_10021555 | Ga0105249_100215556 | 314 |
| 315 | 3300025913 | Ga0207695_10078715 | Ga0207695_100787154 | 314 |
| 316 | 3300025961 | Ga0207712_10021719 | Ga0207712_100217193 | 314 |
| 317 | 3300028379 | Ga0268266_10012901 | Ga0268266_100129016 | 314 |
| 318 | 3300030878 | Ga0265770_1004563 | Ga0265770_10045632 | 314 |
| 319 | 3300031727 | Ga0316576_10004360 | Ga0316576_100043604 | 314 |
| 320 | 3300031728 | Ga0316578_10089391 | Ga0316578_100893912 | 314 |
| 321 | 3300036712 | Ga0316584_0120326 | Ga0316584_0120326_308_1252 | 314 |
| 322 | 3300039062 | Ga0400483_237740 | Ga0400483_237740_1084_2031 | 314 |
| 323 | 3300039437 | Ga0436365_0817445 | Ga0436365_0817445_118_1062 | 314 |
| 324 | 3300048922 | Ga0496119_0138711 | Ga0496119_0138711_185_1129 | 314 |
| 325 | 3300048929 | Ga0496126_0464343 | Ga0496126_0464343_57_1001 | 314 |
| 326 | 3300049571 | Ga0501034_0030987 | Ga0501034_0030987_3580_4524 | 314 |
| 327 | 3300049572 | Ga0501036_0055476 | Ga0501036_0055476_886_1830 | 314 |
| 328 | 3300049581 | Ga0501047_0139777 | Ga0501047_0139777_1213_2157 | 314 |
| 329 | 3300049823 | Ga0501044_0202965 | Ga0501044_0202965_673_1617 | 314 |
| 330 | 3300050492 | nmdc:mga0yw44_169796_c1 | nmdc:mga0yw44_169796_c1_66_1010 | 314 |
| 331 | 3300053087 | Ga0500643_000295 | Ga0500643_000295_31107_32051 | 314 |
| 332 | 3300053156 | Ga0500622_0001376 | Ga0500622_0001376_1305_2249 | 314 |
| 333 | 3300053730 | Ga0500645_000215 | Ga0500645_000215_31107_32051 | 314 |
| 334 | iso_pu_bacteria | 2585428062 | 2587756660 | 314 |
| 335 | iso_pu_bacteria | 2738541337 | 2739053723 | 314 |
| 336 | iso_pu_bacteria | 2831864461 | 2831867257 | 314 |
| 337 | 3300003322 | rootL2_10143951 | rootL2_101439512 | 315 |
| 338 | 3300005295 | Ga0065707_10175098 | Ga0065707_101750982 | 315 |
| 339 | 3300005337 | Ga0070682_100001299 | Ga0070682_1000012991 | 315 |
| 340 | 3300005445 | Ga0070708_100144370 | Ga0070708_1001443702 | 315 |
| 341 | 3300005518 | Ga0070699_100064156 | Ga0070699_1000641562 | 315 |
| 342 | 3300005536 | Ga0070697_100062075 | Ga0070697_1000620752 | 315 |
| 343 | 3300005563 | Ga0068855_100210698 | Ga0068855_1002106984 | 315 |
| 344 | 3300006195 | Ga0075366_10048036 | Ga0075366_100480362 | 315 |
| 345 | 3300006880 | Ga0075429_100002086 | Ga0075429_1000020863 | 315 |
| 346 | 3300009094 | Ga0111539_10183792 | Ga0111539_101837923 | 315 |
| 347 | 3300016635 | Ga0183361_10005 | Ga0183361_10005213 | 315 |
| 348 | 3300021361 | Ga0213872_10034574 | Ga0213872_100345742 | 315 |
| 349 | 3300025941 | Ga0207711_10038852 | Ga0207711_100388525 | 315 |
| 350 | 3300025960 | Ga0207651_10311190 | Ga0207651_103111902 | 315 |
| 351 | 3300028794 | Ga0307515_10000658 | Ga0307515_1000065852 | 315 |
| 352 | 3300028794 | Ga0307515_10041913 | Ga0307515_100419132 | 315 |
| 353 | 3300039062 | Ga0400483_046831 | Ga0400483_046831_325363_326313 | 315 |
| 354 | 3300039062 | Ga0400483_115198 | Ga0400483_115198_343_1290 | 315 |
| 355 | 3300039062 | Ga0400483_269750 | Ga0400483_269750_3788_4735 | 315 |
| 356 | 3300039062 | Ga0400483_278860 | Ga0400483_278860_1535_2482 | 315 |
| 357 | 3300039062 | Ga0400483_280629 | Ga0400483_280629_1405_2352 | 315 |
| 358 | 3300039447 | Ga0436361_0178809 | Ga0436361_0178809_7107_8054 | 315 |
| 359 | 3300044712 | Ga0453684_0591900 | Ga0453684_0591900_180_1127 | 315 |
| 360 | 3300050508 | nmdc:mga09592_15523_c1 | nmdc:mga09592_15523_c1_4439_5386 | 315 |
| 361 | 3300050509 | nmdc:mga0qj67_748_c1 | nmdc:mga0qj67_748_c1_18891_19838 | 315 |
| 362 | 3300050510 | nmdc:mga06r32_679_c1 | nmdc:mga06r32_679_c1_2208_3155 | 315 |
| 363 | 3300050511 | nmdc:mga08y16_153193_c1 | nmdc:mga08y16_153193_c1_444_1391 | 315 |
| 364 | 3300053156 | Ga0500622_0002997 | Ga0500622_0002997_10156_11103 | 315 |
| 365 | 3300053730 | Ga0500645_018935 | Ga0500645_018935_209_1156 | 315 |
| 366 | iso_pu_bacteria | 2574179768 | 2574433015 | 315 |
| 367 | iso_pu_bacteria | 2643221609 | 2644058349 | 315 |
| 368 | iso_pu_bacteria | 2643221611 | 2644073401 | 315 |
| 369 | iso_pu_bacteria | 2643221639 | 2644222261 | 315 |
| 370 | iso_pu_bacteria | 2721755523 | 2722883085 | 315 |
| 371 | iso_pu_bacteria | 2738543012 | 2739244309 | 315 |
| 372 | iso_pu_bacteria | 2816332133 | 2816469740 | 315 |
| 373 | iso_pu_bacteria | 2839138175 | 2839141436 | 315 |
| 374 | iso_pu_bacteria | 2886848708 | 2886853711 | 315 |
| 375 | iso_pu_bacteria | 639633007 | 639787691 | 315 |
| 376 | 3300005288 | Ga0065714_10100934 | Ga0065714_101009342 | 316 |
| 377 | 3300005290 | Ga0065712_10132380 | Ga0065712_101323802 | 316 |
| 378 | 3300005293 | Ga0065715_10092009 | Ga0065715_100920095 | 316 |
| 379 | 3300005328 | Ga0070676_10061960 | Ga0070676_100619602 | 316 |
| 380 | 3300005328 | Ga0070676_10082141 | Ga0070676_100821412 | 316 |
| 381 | 3300005333 | Ga0070677_10113734 | Ga0070677_101137341 | 316 |
| 382 | 3300005341 | Ga0070691_10092199 | Ga0070691_100921992 | 316 |
| 383 | 3300005343 | Ga0070687_100023538 | Ga0070687_1000235382 | 316 |
| 384 | 3300005344 | Ga0070661_100058507 | Ga0070661_1000585074 | 316 |
| 385 | 3300005347 | Ga0070668_100001288 | Ga0070668_10000128814 | 316 |
| 386 | 3300005347 | Ga0070668_100033275 | Ga0070668_1000332753 | 316 |
| 387 | 3300005353 | Ga0070669_100025855 | Ga0070669_1000258555 | 316 |
| 388 | 3300005354 | Ga0070675_100001805 | Ga0070675_1000018055 | 316 |
| 389 | 3300005356 | Ga0070674_100021184 | Ga0070674_1000211843 | 316 |
| 390 | 3300005364 | Ga0070673_100114527 | Ga0070673_1001145272 | 316 |
| 391 | 3300005365 | Ga0070688_100052265 | Ga0070688_1000522653 | 316 |
| 392 | 3300005435 | Ga0070714_100005361 | Ga0070714_1000053617 | 316 |
| 393 | 3300005435 | Ga0070714_100559068 | Ga0070714_1005590681 | 316 |
| 394 | 3300005436 | Ga0070713_100031317 | Ga0070713_1000313173 | 316 |
| 395 | 3300005436 | Ga0070713_100162474 | Ga0070713_1001624742 | 316 |
| 396 | 3300005437 | Ga0070710_10044662 | Ga0070710_100446621 | 316 |
| 397 | 3300005439 | Ga0070711_100075095 | Ga0070711_1000750952 | 316 |
| 398 | 3300005439 | Ga0070711_100176400 | Ga0070711_1001764002 | 316 |
| 399 | 3300005455 | Ga0070663_100145261 | Ga0070663_1001452612 | 316 |
| 400 | 3300005457 | Ga0070662_100009085 | Ga0070662_1000090854 | 316 |
| 401 | 3300005457 | Ga0070662_100032685 | Ga0070662_1000326853 | 316 |
| 402 | 3300005457 | Ga0070662_100046971 | Ga0070662_1000469714 | 316 |
| 403 | 3300005458 | Ga0070681_10148615 | Ga0070681_101486152 | 316 |
| 404 | 3300005459 | Ga0068867_100011208 | Ga0068867_1000112082 | 316 |
| 405 | 3300005466 | Ga0070685_10011760 | Ga0070685_100117602 | 316 |
| 406 | 3300005466 | Ga0070685_10020748 | Ga0070685_100207484 | 316 |
| 407 | 3300005467 | Ga0070706_100017917 | Ga0070706_1000179176 | 316 |
| 408 | 3300005467 | Ga0070706_100322896 | Ga0070706_1003228962 | 316 |
| 409 | 3300005468 | Ga0070707_100093503 | Ga0070707_1000935033 | 316 |
| 410 | 3300005471 | Ga0070698_100003926 | Ga0070698_1000039266 | 316 |
| 411 | 3300005471 | Ga0070698_100024152 | Ga0070698_1000241526 | 316 |
| 412 | 3300005518 | Ga0070699_100015206 | Ga0070699_1000152066 | 316 |
| 413 | 3300005535 | Ga0070684_100004488 | Ga0070684_1000044882 | 316 |
| 414 | 3300005536 | Ga0070697_100333651 | Ga0070697_1003336512 | 316 |
| 415 | 3300005543 | Ga0070672_100034503 | Ga0070672_1000345032 | 316 |
| 416 | 3300005543 | Ga0070672_100037307 | Ga0070672_1000373073 | 316 |
| 417 | 3300005546 | Ga0070696_100093657 | Ga0070696_1000936572 | 316 |
| 418 | 3300005549 | Ga0070704_100054933 | Ga0070704_1000549332 | 316 |
| 419 | 3300005563 | Ga0068855_100121444 | Ga0068855_1001214442 | 316 |
| 420 | 3300005614 | Ga0068856_100025977 | Ga0068856_1000259773 | 316 |
| 421 | 3300005614 | Ga0068856_100311090 | Ga0068856_1003110902 | 316 |
| 422 | 3300005615 | Ga0070702_100058676 | Ga0070702_1000586762 | 316 |
| 423 | 3300005617 | Ga0068859_100005230 | Ga0068859_1000052304 | 316 |
| 424 | 3300005618 | Ga0068864_100011966 | Ga0068864_1000119665 | 316 |
| 425 | 3300005719 | Ga0068861_100001297 | Ga0068861_1000012977 | 316 |
| 426 | 3300005840 | Ga0068870_10016152 | Ga0068870_100161523 | 316 |
| 427 | 3300005841 | Ga0068863_100004078 | Ga0068863_10000407813 | 316 |
| 428 | 3300005844 | Ga0068862_100000710 | Ga0068862_10000071017 | 316 |
| 429 | 3300005844 | Ga0068862_100000773 | Ga0068862_10000077318 | 316 |
| 430 | 3300005844 | Ga0068862_100013059 | Ga0068862_1000130596 | 316 |
| 431 | 3300005983 | Ga0081540_1000120 | Ga0081540_100012026 | 316 |
| 432 | 3300006028 | Ga0070717_10023098 | Ga0070717_100230985 | 316 |
| 433 | 3300006028 | Ga0070717_10157585 | Ga0070717_101575852 | 316 |
| 434 | 3300006038 | Ga0075365_10056486 | Ga0075365_100564862 | 316 |
| 435 | 3300006048 | Ga0075363_100055898 | Ga0075363_1000558982 | 316 |
| 436 | 3300006051 | Ga0075364_10046560 | Ga0075364_100465603 | 316 |
| 437 | 3300006173 | Ga0070716_100013555 | Ga0070716_1000135554 | 316 |
| 438 | 3300006177 | Ga0075362_10017271 | Ga0075362_100172712 | 316 |
| 439 | 3300006178 | Ga0075367_10046202 | Ga0075367_100462023 | 316 |
| 440 | 3300006195 | Ga0075366_10185661 | Ga0075366_101856612 | 316 |
| 441 | 3300006237 | Ga0097621_100104236 | Ga0097621_1001042362 | 316 |
| 442 | 3300006844 | Ga0075428_100008323 | Ga0075428_1000083239 | 316 |
| 443 | 3300006846 | Ga0075430_100134843 | Ga0075430_1001348432 | 316 |
| 444 | 3300006847 | Ga0075431_100024976 | Ga0075431_1000249765 | 316 |
| 445 | 3300006847 | Ga0075431_100379179 | Ga0075431_1003791792 | 316 |
| 446 | 3300006852 | Ga0075433_10061285 | Ga0075433_100612853 | 316 |
| 447 | 3300006871 | Ga0075434_100039179 | Ga0075434_1000391792 | 316 |
| 448 | 3300006871 | Ga0075434_100050704 | Ga0075434_1000507043 | 316 |
| 449 | 3300006914 | Ga0075436_100131287 | Ga0075436_1001312872 | 316 |
| 450 | 3300006931 | Ga0097620_100005230 | Ga0097620_1000052304 | 316 |
| 451 | 3300007076 | Ga0075435_100054421 | Ga0075435_1000544212 | 316 |
| 452 | 3300009094 | Ga0111539_10042128 | Ga0111539_100421286 | 316 |
| 453 | 3300009147 | Ga0114129_10009237 | Ga0114129_100092374 | 316 |
| 454 | 3300009147 | Ga0114129_10144548 | Ga0114129_101445482 | 316 |
| 455 | 3300009148 | Ga0105243_10173305 | Ga0105243_101733052 | 316 |
| 456 | 3300009174 | Ga0105241_10056190 | Ga0105241_100561904 | 316 |
| 457 | 3300009177 | Ga0105248_10003190 | Ga0105248_1000319013 | 316 |
| 458 | 3300009553 | Ga0105249_10015849 | Ga0105249_100158497 | 316 |
| 459 | 3300009553 | Ga0105249_10038996 | Ga0105249_100389963 | 316 |
| 460 | 3300013297 | Ga0157378_10098716 | Ga0157378_100987162 | 316 |
| 461 | 3300013306 | Ga0163162_10024014 | Ga0163162_100240145 | 316 |
| 462 | 3300013308 | Ga0157375_10000261 | Ga0157375_1000026126 | 316 |
| 463 | 3300013308 | Ga0157375_10320181 | Ga0157375_103201812 | 316 |
| 464 | 3300013308 | Ga0157375_10654592 | Ga0157375_106545921 | 316 |
| 465 | 3300014325 | Ga0163163_10000639 | Ga0163163_1000063921 | 316 |
| 466 | 3300014326 | Ga0157380_10160015 | Ga0157380_101600151 | 316 |
| 467 | 3300014968 | Ga0157379_10075337 | Ga0157379_100753374 | 316 |
| 468 | 3300020077 | Ga0206351_10639124 | Ga0206351_106391242 | 316 |
| 469 | 3300020080 | Ga0206350_10380697 | Ga0206350_103806974 | 316 |
| 470 | 3300020081 | Ga0206354_11423707 | Ga0206354_114237072 | 316 |
| 471 | 3300021388 | Ga0213875_10118570 | Ga0213875_101185702 | 316 |
| 472 | 3300022467 | Ga0224712_10024103 | Ga0224712_100241032 | 316 |
| 473 | 3300024225 | Ga0224572_1000229 | Ga0224572_10002292 | 316 |
| 474 | 3300025898 | Ga0207692_10022718 | Ga0207692_100227183 | 316 |
| 475 | 3300025898 | Ga0207692_10032685 | Ga0207692_100326853 | 316 |
| 476 | 3300025907 | Ga0207645_10013208 | Ga0207645_100132084 | 316 |
| 477 | 3300025910 | Ga0207684_10060092 | Ga0207684_100600923 | 316 |
| 478 | 3300025912 | Ga0207707_10052812 | Ga0207707_100528124 | 316 |
| 479 | 3300025916 | Ga0207663_10020666 | Ga0207663_100206664 | 316 |
| 480 | 3300025916 | Ga0207663_10072159 | Ga0207663_100721592 | 316 |
| 481 | 3300025916 | Ga0207663_10277948 | Ga0207663_102779482 | 316 |
| 482 | 3300025918 | Ga0207662_10024547 | Ga0207662_100245472 | 316 |
| 483 | 3300025921 | Ga0207652_10039498 | Ga0207652_100394983 | 316 |
| 484 | 3300025922 | Ga0207646_10036712 | Ga0207646_100367124 | 316 |
| 485 | 3300025922 | Ga0207646_10120025 | Ga0207646_101200252 | 316 |
| 486 | 3300025922 | Ga0207646_10191660 | Ga0207646_101916602 | 316 |
| 487 | 3300025923 | Ga0207681_10003681 | Ga0207681_100036815 | 316 |
| 488 | 3300025926 | Ga0207659_10003803 | Ga0207659_100038037 | 316 |
| 489 | 3300025928 | Ga0207700_10004029 | Ga0207700_100040292 | 316 |
| 490 | 3300025928 | Ga0207700_10177250 | Ga0207700_101772502 | 316 |
| 491 | 3300025929 | Ga0207664_10004452 | Ga0207664_100044526 | 316 |
| 492 | 3300025929 | Ga0207664_10024659 | Ga0207664_100246595 | 316 |
| 493 | 3300025933 | Ga0207706_10000606 | Ga0207706_1000060618 | 316 |
| 494 | 3300025933 | Ga0207706_10004288 | Ga0207706_1000428812 | 316 |
| 495 | 3300025933 | Ga0207706_10047194 | Ga0207706_100471944 | 316 |
| 496 | 3300025935 | Ga0207709_10115703 | Ga0207709_101157032 | 316 |
| 497 | 3300025937 | Ga0207669_10084624 | Ga0207669_100846242 | 316 |
| 498 | 3300025937 | Ga0207669_10358360 | Ga0207669_103583602 | 316 |
| 499 | 3300025938 | Ga0207704_10111667 | Ga0207704_101116671 | 316 |
| 500 | 3300025938 | Ga0207704_10346326 | Ga0207704_103463261 | 316 |
| 501 | 3300025939 | Ga0207665_10016681 | Ga0207665_100166813 | 316 |
| 502 | 3300025940 | Ga0207691_10002506 | Ga0207691_1000250616 | 316 |
| 503 | 3300025940 | Ga0207691_10050698 | Ga0207691_100506984 | 316 |
| 504 | 3300025942 | Ga0207689_10015453 | Ga0207689_100154537 | 316 |
| 505 | 3300025944 | Ga0207661_10000444 | Ga0207661_1000044423 | 316 |
| 506 | 3300025945 | Ga0207679_10002985 | Ga0207679_1000298510 | 316 |
| 507 | 3300025949 | Ga0207667_10239885 | Ga0207667_102398852 | 316 |
| 508 | 3300025961 | Ga0207712_10021950 | Ga0207712_100219505 | 316 |
| 509 | 3300025961 | Ga0207712_10032944 | Ga0207712_100329443 | 316 |
| 510 | 3300025972 | Ga0207668_10054702 | Ga0207668_100547024 | 316 |
| 511 | 3300026035 | Ga0207703_10052950 | Ga0207703_100529502 | 316 |
| 512 | 3300026067 | Ga0207678_10062549 | Ga0207678_100625492 | 316 |
| 513 | 3300026075 | Ga0207708_10123386 | Ga0207708_101233862 | 316 |
| 514 | 3300026078 | Ga0207702_10249627 | Ga0207702_102496272 | 316 |
| 515 | 3300026088 | Ga0207641_10013507 | Ga0207641_100135074 | 316 |
| 516 | 3300026089 | Ga0207648_10002321 | Ga0207648_100023213 | 316 |
| 517 | 3300026089 | Ga0207648_10085045 | Ga0207648_100850452 | 316 |
| 518 | 3300026095 | Ga0207676_10002345 | Ga0207676_100023458 | 316 |
| 519 | 3300026116 | Ga0207674_10014643 | Ga0207674_100146439 | 316 |
| 520 | 3300026116 | Ga0207674_10026083 | Ga0207674_100260832 | 316 |
| 521 | 3300026118 | Ga0207675_100015598 | Ga0207675_1000155987 | 316 |
| 522 | 3300026118 | Ga0207675_100021807 | Ga0207675_1000218077 | 316 |
| 523 | 3300027552 | Ga0209982_1000525 | Ga0209982_10005252 | 316 |
| 524 | 3300027617 | Ga0210002_1000631 | Ga0210002_10006314 | 316 |
| 525 | 3300027682 | Ga0209971_1003298 | Ga0209971_10032984 | 316 |
| 526 | 3300027876 | Ga0209974_10005216 | Ga0209974_100052164 | 316 |
| 527 | 3300027907 | Ga0207428_10019081 | Ga0207428_100190814 | 316 |
| 528 | 3300027907 | Ga0207428_10035182 | Ga0207428_100351822 | 316 |
| 529 | 3300028380 | Ga0268265_10001103 | Ga0268265_100011035 | 316 |
| 530 | 3300028380 | Ga0268265_10005116 | Ga0268265_100051164 | 316 |
| 531 | 3300028380 | Ga0268265_10008379 | Ga0268265_100083796 | 316 |
| 532 | 3300028556 | Ga0265337_1000042 | Ga0265337_100004248 | 316 |
| 533 | 3300028558 | Ga0265326_10021531 | Ga0265326_100215311 | 316 |
| 534 | 3300028563 | Ga0265319_1002822 | Ga0265319_10028225 | 316 |
| 535 | 3300028577 | Ga0265318_10000962 | Ga0265318_100009625 | 316 |
| 536 | 3300028577 | Ga0265318_10028484 | Ga0265318_100284842 | 316 |
| 537 | 3300028666 | Ga0265336_10008217 | Ga0265336_100082172 | 316 |
| 538 | 3300028794 | Ga0307515_10000494 | Ga0307515_1000049438 | 316 |
| 539 | 3300028794 | Ga0307515_10132053 | Ga0307515_101320534 | 316 |
| 540 | 3300028800 | Ga0265338_10004381 | Ga0265338_100043812 | 316 |
| 541 | 3300028800 | Ga0265338_10007488 | Ga0265338_100074882 | 316 |
| 542 | 3300029957 | Ga0265324_10001160 | Ga0265324_1000116016 | 316 |
| 543 | 3300031238 | Ga0265332_10000626 | Ga0265332_100006262 | 316 |
| 544 | 3300031238 | Ga0265332_10018655 | Ga0265332_100186554 | 316 |
| 545 | 3300031238 | Ga0265332_10042179 | Ga0265332_100421792 | 316 |
| 546 | 3300031240 | Ga0265320_10017209 | Ga0265320_100172095 | 316 |
| 547 | 3300031240 | Ga0265320_10042687 | Ga0265320_100426873 | 316 |
| 548 | 3300031241 | Ga0265325_10000929 | Ga0265325_1000092911 | 316 |
| 549 | 3300031241 | Ga0265325_10103867 | Ga0265325_101038672 | 316 |
| 550 | 3300031247 | Ga0265340_10005079 | Ga0265340_100050792 | 316 |
| 551 | 3300031249 | Ga0265339_10031160 | Ga0265339_100311604 | 316 |
| 552 | 3300031250 | Ga0265331_10134556 | Ga0265331_101345561 | 316 |
| 553 | 3300031344 | Ga0265316_10021381 | Ga0265316_100213816 | 316 |
| 554 | 3300031456 | Ga0307513_10032606 | Ga0307513_100326064 | 316 |
| 555 | 3300031507 | Ga0307509_10207183 | Ga0307509_102071832 | 316 |
| 556 | 3300031548 | Ga0307408_100007410 | Ga0307408_1000074105 | 316 |
| 557 | 3300031595 | Ga0265313_10000779 | Ga0265313_1000077925 | 316 |
| 558 | 3300031595 | Ga0265313_10001164 | Ga0265313_1000116411 | 316 |
| 559 | 3300031595 | Ga0265313_10024584 | Ga0265313_100245842 | 316 |
| 560 | 3300031711 | Ga0265314_10002116 | Ga0265314_1000211611 | 316 |
| 561 | 3300031711 | Ga0265314_10008410 | Ga0265314_100084102 | 316 |
| 562 | 3300031711 | Ga0265314_10015177 | Ga0265314_100151775 | 316 |
| 563 | 3300031711 | Ga0265314_10096259 | Ga0265314_100962593 | 316 |
| 564 | 3300031712 | Ga0265342_10005960 | Ga0265342_100059602 | 316 |
| 565 | 3300031727 | Ga0316576_10093532 | Ga0316576_100935322 | 316 |
| 566 | 3300031731 | Ga0307405_10020308 | Ga0307405_100203083 | 316 |
| 567 | 3300031824 | Ga0307413_10119822 | Ga0307413_101198222 | 316 |
| 568 | 3300031852 | Ga0307410_10045742 | Ga0307410_100457422 | 316 |
| 569 | 3300031901 | Ga0307406_10181751 | Ga0307406_101817512 | 316 |
| 570 | 3300031901 | Ga0307406_10192770 | Ga0307406_101927702 | 316 |
| 571 | 3300031901 | Ga0307406_10256893 | Ga0307406_102568932 | 316 |
| 572 | 3300031911 | Ga0307412_10036277 | Ga0307412_100362772 | 316 |
| 573 | 3300032002 | Ga0307416_100067494 | Ga0307416_1000674944 | 316 |
| 574 | 3300032004 | Ga0307414_10071457 | Ga0307414_100714573 | 316 |
| 575 | 3300032005 | Ga0307411_10230273 | Ga0307411_102302732 | 316 |
| 576 | 3300034817 | Ga0373948_0007373 | Ga0373948_0007373_574_1524 | 316 |
| 577 | 3300034819 | Ga0373958_0017674 | Ga0373958_0017674_184_1134 | 316 |
| 578 | 3300035084 | Ga0373928_0008496 | Ga0373928_0008496_241_1191 | 316 |
| 579 | 3300035086 | Ga0373934_0001020 | Ga0373934_0001020_5248_6207 | 316 |
| 580 | 3300035086 | Ga0373934_0003290 | Ga0373934_0003290_3652_4602 | 316 |
| 581 | 3300035086 | Ga0373934_0011045 | Ga0373934_0011045_2285_3235 | 316 |
| 582 | 3300035088 | Ga0373940_0010606 | Ga0373940_0010606_995_1945 | 316 |
| 583 | 3300035091 | Ga0373951_0015605 | Ga0373951_0015605_606_1556 | 316 |
| 584 | 3300035111 | Ga0373923_0002059 | Ga0373923_0002059_136_1086 | 316 |
| 585 | 3300035113 | Ga0373936_0022611 | Ga0373936_0022611_143_1093 | 316 |
| 586 | 3300035117 | Ga0373953_0000026 | Ga0373953_0000026_30061_31020 | 316 |
| 587 | 3300035117 | Ga0373953_0008838 | Ga0373953_0008838_1161_2111 | 316 |
| 588 | 3300035118 | Ga0373954_0000865 | Ga0373954_0000865_786_1745 | 316 |
| 589 | 3300035118 | Ga0373954_0026368 | Ga0373954_0026368_1693_2643 | 316 |
| 590 | 3300035119 | Ga0373956_0000442 | Ga0373956_0000442_5877_6836 | 316 |
| 591 | 3300035119 | Ga0373956_0081153 | Ga0373956_0081153_117_1067 | 316 |
| 592 | 3300035120 | Ga0373957_0000038 | Ga0373957_0000038_31197_32156 | 316 |
| 593 | 3300035172 | Ga0373955_0000231 | Ga0373955_0000231_8616_9575 | 316 |
| 594 | 3300035172 | Ga0373955_0006619 | Ga0373955_0006619_652_1602 | 316 |
| 595 | 3300035172 | Ga0373955_0104747 | Ga0373955_0104747_550_1500 | 316 |
| 596 | 3300035242 | Ga0373962_0006157 | Ga0373962_0006157_600_1550 | 316 |
| 597 | 3300035398 | Ga0316574_0069336 | Ga0316574_0069336_100_1050 | 316 |
| 598 | 3300035410 | Ga0373924_0003392 | Ga0373924_0003392_3711_4661 | 316 |
| 599 | 3300035410 | Ga0373924_0037134 | Ga0373924_0037134_61_1011 | 316 |
| 600 | 3300035691 | Ga0373931_0018319 | Ga0373931_0018319_1788_2738 | 316 |
| 601 | 3300035695 | Ga0373927_0060355 | Ga0373927_0060355_484_1446 | 316 |
| 602 | 3300035724 | Ga0373933_0000604 | Ga0373933_0000604_18120_19070 | 316 |
| 603 | 3300035724 | Ga0373933_0000839 | Ga0373933_0000839_7807_8766 | 316 |
| 604 | 3300035725 | Ga0373947_0033853 | Ga0373947_0033853_1663_2613 | 316 |
| 605 | 3300036401 | Ga0373937_0000138 | Ga0373937_0000138_20596_21555 | 316 |
| 606 | 3300036401 | Ga0373937_0014264 | Ga0373937_0014264_4942_5904 | 316 |
| 607 | 3300036401 | Ga0373937_0031919 | Ga0373937_0031919_328_1278 | 316 |
| 608 | 3300036401 | Ga0373937_0088464 | Ga0373937_0088464_491_1441 | 316 |
| 609 | 3300036401 | Ga0373937_0117828 | Ga0373937_0117828_522_1472 | 316 |
| 610 | 3300036401 | Ga0373937_0185616 | Ga0373937_0185616_133_1083 | 316 |
| 611 | 3300037068 | Ga0373925_0026089 | Ga0373925_0026089_3174_4124 | 316 |
| 612 | 3300037068 | Ga0373925_0056446 | Ga0373925_0056446_982_1932 | 316 |
| 613 | 3300037853 | Ga0436364_0992730 | Ga0436364_0992730_1504_2454 | 316 |
| 614 | 3300038726 | Ga0400490_43931 | Ga0400490_43931_28344_29294 | 316 |
| 615 | 3300038727 | Ga0400491_04736 | Ga0400491_04736_599_1549 | 316 |
| 616 | 3300039110 | Ga0400487_42799 | Ga0400487_42799_17036_17986 | 316 |
| 617 | 3300041413 | Ga0439465_0095430 | Ga0439465_0095430_47_1006 | 316 |
| 618 | 3300042876 | Ga0451577_0015823 | Ga0451577_0015823_5377_6327 | 316 |
| 619 | 3300044656 | Ga0466969_0011838 | Ga0466969_0011838_174_1124 | 316 |
| 620 | 3300044684 | Ga0466966_0035156 | Ga0466966_0035156_2188_3138 | 316 |
| 621 | 3300044693 | Ga0466961_0012926 | Ga0466961_0012926_736_1686 | 316 |
| 622 | 3300046454 | Ga0495592_0000041 | Ga0495592_0000041_73959_74918 | 316 |
| 623 | 3300046455 | Ga0495603_0027174 | Ga0495603_0027174_547_1497 | 316 |
| 624 | 3300046459 | Ga0495629_0014811 | Ga0495629_0014811_2875_3825 | 316 |
| 625 | 3300046459 | Ga0495629_0067077 | Ga0495629_0067077_1542_2492 | 316 |
| 626 | 3300046461 | Ga0495641_0022013 | Ga0495641_0022013_2143_3093 | 316 |
| 627 | 3300046462 | Ga0495651_0000018 | Ga0495651_0000018_48514_49473 | 316 |
| 628 | 3300046462 | Ga0495651_0003600 | Ga0495651_0003600_3588_4538 | 316 |
| 629 | 3300046462 | Ga0495651_0021971 | Ga0495651_0021971_2528_3478 | 316 |
| 630 | 3300046462 | Ga0495651_0085282 | Ga0495651_0085282_868_1818 | 316 |
| 631 | 3300046463 | Ga0495653_0019823 | Ga0495653_0019823_3207_4157 | 316 |
| 632 | 3300046463 | Ga0495653_0037741 | Ga0495653_0037741_1667_2617 | 316 |
| 633 | 3300046463 | Ga0495653_0068638 | Ga0495653_0068638_1667_2617 | 316 |
| 634 | 3300046472 | Ga0495580_0012366 | Ga0495580_0012366_3708_4658 | 316 |
| 635 | 3300046472 | Ga0495580_0112906 | Ga0495580_0112906_242_1204 | 316 |
| 636 | 3300046473 | Ga0495582_0003548 | Ga0495582_0003548_679_1629 | 316 |
| 637 | 3300046475 | Ga0495639_0009195 | Ga0495639_0009195_80_1030 | 316 |
| 638 | 3300046476 | Ga0495662_0042130 | Ga0495662_0042130_1029_1979 | 316 |
| 639 | 3300046477 | Ga0495664_0052111 | Ga0495664_0052111_42_992 | 316 |
| 640 | 3300046477 | Ga0495664_0064262 | Ga0495664_0064262_566_1516 | 316 |
| 641 | 3300046511 | Ga0495608_0000039 | Ga0495608_0000039_48514_49473 | 316 |
| 642 | 3300046511 | Ga0495608_0012184 | Ga0495608_0012184_215_1165 | 316 |
| 643 | 3300046511 | Ga0495608_0034635 | Ga0495608_0034635_1105_2055 | 316 |
| 644 | 3300046514 | Ga0495618_0014687 | Ga0495618_0014687_2451_3401 | 316 |
| 645 | 3300046514 | Ga0495618_0049428 | Ga0495618_0049428_789_1739 | 316 |
| 646 | 3300046516 | Ga0495628_0000219 | Ga0495628_0000219_30085_31044 | 316 |
| 647 | 3300046517 | Ga0495630_0011003 | Ga0495630_0011003_2016_2978 | 316 |
| 648 | 3300046517 | Ga0495630_0011057 | Ga0495630_0011057_2938_3888 | 316 |
| 649 | 3300046517 | Ga0495630_0171798 | Ga0495630_0171798_41_991 | 316 |
| 650 | 3300046526 | Ga0495666_0038237 | Ga0495666_0038237_235_1185 | 316 |
| 651 | 3300046529 | Ga0495652_0000092 | Ga0495652_0000092_73723_74682 | 316 |
| 652 | 3300046529 | Ga0495652_0013473 | Ga0495652_0013473_1274_2224 | 316 |
| 653 | 3300046529 | Ga0495652_0039030 | Ga0495652_0039030_2548_3498 | 316 |
| 654 | 3300046531 | Ga0495665_0013248 | Ga0495665_0013248_859_1809 | 316 |
| 655 | 3300046536 | Ga0495587_0000034 | Ga0495587_0000034_73960_74919 | 316 |
| 656 | 3300046536 | Ga0495587_0021836 | Ga0495587_0021836_2731_3681 | 316 |
| 657 | 3300046536 | Ga0495587_0118048 | Ga0495587_0118048_98_1060 | 316 |
| 658 | 3300046543 | Ga0495645_0015569 | Ga0495645_0015569_1956_2906 | 316 |
| 659 | 3300046543 | Ga0495645_0024809 | Ga0495645_0024809_194_1144 | 316 |
| 660 | 3300046543 | Ga0495645_0034491 | Ga0495645_0034491_1612_2562 | 316 |
| 661 | 3300046559 | Ga0495667_0002416 | Ga0495667_0002416_8087_9037 | 316 |
| 662 | 3300046559 | Ga0495667_0002599 | Ga0495667_0002599_1030_1989 | 316 |
| 663 | 3300046559 | Ga0495667_0036966 | Ga0495667_0036966_1116_2066 | 316 |
| 664 | 3300046559 | Ga0495667_0107748 | Ga0495667_0107748_111_1061 | 316 |
| 665 | 3300046642 | Ga0495634_0020326 | Ga0495634_0020326_2320_3270 | 316 |
| 666 | 3300046642 | Ga0495634_0034901 | Ga0495634_0034901_1214_2164 | 316 |
| 667 | 3300046663 | Ga0495635_0008259 | Ga0495635_0008259_2320_3270 | 316 |
| 668 | 3300046663 | Ga0495635_0171464 | Ga0495635_0171464_102_1064 | 316 |
| 669 | 3300046675 | Ga0495657_0013370 | Ga0495657_0013370_4623_5573 | 316 |
| 670 | 3300046675 | Ga0495657_0033050 | Ga0495657_0033050_2285_3247 | 316 |
| 671 | 3300046675 | Ga0495657_0075109 | Ga0495657_0075109_635_1585 | 316 |
| 672 | 3300046678 | Ga0495599_0000108 | Ga0495599_0000108_6677_7636 | 316 |
| 673 | 3300046678 | Ga0495599_0008955 | Ga0495599_0008955_3751_4701 | 316 |
| 674 | 3300046678 | Ga0495599_0013304 | Ga0495599_0013304_2733_3683 | 316 |
| 675 | 3300046679 | Ga0495623_0000287 | Ga0495623_0000287_15682_16641 | 316 |
| 676 | 3300046679 | Ga0495623_0014003 | Ga0495623_0014003_2229_3179 | 316 |
| 677 | 3300046679 | Ga0495623_0015327 | Ga0495623_0015327_780_1730 | 316 |
| 678 | 3300046680 | Ga0495646_0015716 | Ga0495646_0015716_383_1345 | 316 |
| 679 | 3300046680 | Ga0495646_0016018 | Ga0495646_0016018_1321_2280 | 316 |
| 680 | 3300046680 | Ga0495646_0040810 | Ga0495646_0040810_163_1113 | 316 |
| 681 | 3300046681 | Ga0495647_0014431 | Ga0495647_0014431_1571_2521 | 316 |
| 682 | 3300046683 | Ga0495658_0009052 | Ga0495658_0009052_1431_2381 | 316 |
| 683 | 3300046689 | Ga0495613_0015491 | Ga0495613_0015491_842_1792 | 316 |
| 684 | 3300046689 | Ga0495613_0276241 | Ga0495613_0276241_42_992 | 316 |
| 685 | 3300046690 | Ga0495624_0105690 | Ga0495624_0105690_41_991 | 316 |
| 686 | 3300046809 | Ga0495600_0096933 | Ga0495600_0096933_237_1187 | 316 |
| 687 | 3300046809 | Ga0495600_0100038 | Ga0495600_0100038_261_1211 | 316 |
| 688 | 3300046809 | Ga0495600_0123427 | Ga0495600_0123427_297_1247 | 316 |
| 689 | 3300047315 | Ga0495581_0007236 | Ga0495581_0007236_2929_3879 | 316 |
| 690 | 3300047315 | Ga0495581_0032115 | Ga0495581_0032115_688_1638 | 316 |
| 691 | 3300047317 | Ga0495604_0000039 | Ga0495604_0000039_73959_74918 | 316 |
| 692 | 3300047317 | Ga0495604_0007655 | Ga0495604_0007655_4620_5570 | 316 |
| 693 | 3300047317 | Ga0495604_0055840 | Ga0495604_0055840_2015_2977 | 316 |
| 694 | 3300047317 | Ga0495604_0063469 | Ga0495604_0063469_1620_2570 | 316 |
| 695 | 3300047317 | Ga0495604_0136822 | Ga0495604_0136822_41_991 | 316 |
| 696 | 3300047319 | Ga0495674_0042962 | Ga0495674_0042962_2667_3617 | 316 |
| 697 | 3300047319 | Ga0495674_0065760 | Ga0495674_0065760_520_1482 | 316 |
| 698 | 3300047319 | Ga0495674_0162704 | Ga0495674_0162704_228_1178 | 316 |
| 699 | 3300047319 | Ga0495674_0176440 | Ga0495674_0176440_661_1611 | 316 |
| 700 | 3300047320 | Ga0495672_0068131 | Ga0495672_0068131_627_1577 | 316 |
| 701 | 3300047321 | Ga0495676_0064879 | Ga0495676_0064879_1828_2778 | 316 |
| 702 | 3300047321 | Ga0495676_0067632 | Ga0495676_0067632_1614_2564 | 316 |
| 703 | 3300047322 | Ga0495680_0000028 | Ga0495680_0000028_37948_38907 | 316 |
| 704 | 3300047322 | Ga0495680_0006442 | Ga0495680_0006442_2768_3718 | 316 |
| 705 | 3300047322 | Ga0495680_0008757 | Ga0495680_0008757_6301_7251 | 316 |
| 706 | 3300047322 | Ga0495680_0018186 | Ga0495680_0018186_3362_4312 | 316 |
| 707 | 3300047322 | Ga0495680_0096509 | Ga0495680_0096509_597_1547 | 316 |
| 708 | 3300047444 | Ga0495675_0000355 | Ga0495675_0000355_16006_16965 | 316 |
| 709 | 3300047444 | Ga0495675_0013496 | Ga0495675_0013496_1241_2191 | 316 |
| 710 | 3300047444 | Ga0495675_0102863 | Ga0495675_0102863_598_1548 | 316 |
| 711 | 3300047444 | Ga0495675_0138468 | Ga0495675_0138468_172_1122 | 316 |
| 712 | 3300047471 | Ga0495684_0039388 | Ga0495684_0039388_661_1611 | 316 |
| 713 | 3300047471 | Ga0495684_0069496 | Ga0495684_0069496_204_1154 | 316 |
| 714 | 3300047673 | Ga0495593_0007376 | Ga0495593_0007376_796_1758 | 316 |
| 715 | 3300047673 | Ga0495593_0010087 | Ga0495593_0010087_853_1803 | 316 |
| 716 | 3300047673 | Ga0495593_0010226 | Ga0495593_0010226_2982_3932 | 316 |
| 717 | 3300048088 | Ga0495602_0000043 | Ga0495602_0000043_73959_74918 | 316 |
| 718 | 3300048088 | Ga0495602_0014212 | Ga0495602_0014212_3496_4446 | 316 |
| 719 | 3300048088 | Ga0495602_0047037 | Ga0495602_0047037_414_1364 | 316 |
| 720 | 3300048088 | Ga0495602_0077837 | Ga0495602_0077837_239_1189 | 316 |
| 721 | 3300048088 | Ga0495602_0084968 | Ga0495602_0084968_284_1234 | 316 |
| 722 | 3300048903 | Ga0496100_0063051 | Ga0496100_0063051_1165_2115 | 316 |
| 723 | 3300048904 | Ga0496101_0012928 | Ga0496101_0012928_1242_2192 | 316 |
| 724 | 3300048904 | Ga0496101_0048231 | Ga0496101_0048231_946_1896 | 316 |
| 725 | 3300048905 | Ga0496102_0002985 | Ga0496102_0002985_3264_4214 | 316 |
| 726 | 3300048905 | Ga0496102_0125396 | Ga0496102_0125396_980_1930 | 316 |
| 727 | 3300048906 | Ga0496103_0002185 | Ga0496103_0002185_2268_3218 | 316 |
| 728 | 3300048907 | Ga0496104_0454717 | Ga0496104_0454717_178_1128 | 316 |
| 729 | 3300048908 | Ga0496105_0085406 | Ga0496105_0085406_1090_2040 | 316 |
| 730 | 3300048910 | Ga0496107_0307824 | Ga0496107_0307824_34_984 | 316 |
| 731 | 3300048911 | Ga0496108_0038970 | Ga0496108_0038970_1757_2707 | 316 |
| 732 | 3300048912 | Ga0496109_0020379 | Ga0496109_0020379_1825_2775 | 316 |
| 733 | 3300048912 | Ga0496109_0061236 | Ga0496109_0061236_310_1260 | 316 |
| 734 | 3300048913 | Ga0496110_0007760 | Ga0496110_0007760_2668_3618 | 316 |
| 735 | 3300048913 | Ga0496110_0038516 | Ga0496110_0038516_3145_4095 | 316 |
| 736 | 3300048914 | Ga0496111_0000082 | Ga0496111_0000082_24646_25596 | 316 |
| 737 | 3300048917 | Ga0496114_0020996 | Ga0496114_0020996_3443_4393 | 316 |
| 738 | 3300048927 | Ga0496124_0000919 | Ga0496124_0000919_44702_45652 | 316 |
| 739 | 3300048928 | Ga0496125_0027360 | Ga0496125_0027360_2419_3369 | 316 |
| 740 | 3300048929 | Ga0496126_0062889 | Ga0496126_0062889_2218_3168 | 316 |
| 741 | 3300048929 | Ga0496126_0080106 | Ga0496126_0080106_405_1355 | 316 |
| 742 | 3300049583 | Ga0501067_0022409 | Ga0501067_0022409_2391_3341 | 316 |
| 743 | 3300049741 | Ga0501079_0142818 | Ga0501079_0142818_187_1137 | 316 |
| 744 | 3300050491 | nmdc:mga00v17_19064_c1 | nmdc:mga00v17_19064_c1_469_1422 | 316 |
| 745 | 3300050493 | nmdc:mga0k408_56008_c1 | nmdc:mga0k408_56008_c1_903_1862 | 316 |
| 746 | 3300050496 | nmdc:mga07m45_37757_c1 | nmdc:mga07m45_37757_c1_462_1421 | 316 |
| 747 | 3300050496 | nmdc:mga07m45_53549_c1 | nmdc:mga07m45_53549_c1_1102_2052 | 316 |
| 748 | 3300050507 | nmdc:mga05p37_172666_c1 | nmdc:mga05p37_172666_c1_1672_2622 | 316 |
| 749 | 3300050507 | nmdc:mga05p37_195_c1 | nmdc:mga05p37_195_c1_59425_60375 | 316 |
| 750 | 3300050509 | nmdc:mga0qj67_6146_c1 | nmdc:mga0qj67_6146_c1_804_1754 | 316 |
| 751 | 3300050510 | nmdc:mga06r32_149437_c1 | nmdc:mga06r32_149437_c1_1169_2119 | 316 |
| 752 | 3300050510 | nmdc:mga06r32_157235_c1 | nmdc:mga06r32_157235_c1_1096_2046 | 316 |
| 753 | 3300050510 | nmdc:mga06r32_50376_c1 | nmdc:mga06r32_50376_c1_1500_2450 | 316 |
| 754 | 3300050511 | nmdc:mga08y16_146914_c1 | nmdc:mga08y16_146914_c1_1258_2208 | 316 |
| 755 | 3300050512 | nmdc:mga0n895_103219_c1 | nmdc:mga0n895_103219_c1_1494_2444 | 316 |
| 756 | 3300050513 | nmdc:mga0rr50_62340_c1 | nmdc:mga0rr50_62340_c1_408_1358 | 316 |
| 757 | 3300050514 | nmdc:mga08x19_165786_c1 | nmdc:mga08x19_165786_c1_411_1361 | 316 |
| 758 | 3300050514 | nmdc:mga08x19_23217_c1 | nmdc:mga08x19_23217_c1_2864_3814 | 316 |
| 759 | 3300050515 | nmdc:mga0a205_12356_c1 | nmdc:mga0a205_12356_c1_4788_5738 | 316 |
| 760 | 3300053077 | Ga0495601_0126239 | Ga0495601_0126239_676_1626 | 316 |
| 761 | 3300053077 | Ga0495601_0142219 | Ga0495601_0142219_323_1273 | 316 |
| 762 | 3300053085 | Ga0495619_0275864 | Ga0495619_0275864_101_1051 | 316 |
| 763 | 3300053094 | Ga0500566_0138516 | Ga0500566_0138516_236_1195 | 316 |
| 764 | 3300053121 | Ga0500607_000006 | Ga0500607_000006_118781_119740 | 316 |
| 765 | 3300053136 | Ga0500559_0000698 | Ga0500559_0000698_3276_4235 | 316 |
| 766 | 3300053136 | Ga0500559_0004182 | Ga0500559_0004182_2352_3311 | 316 |
| 767 | 3300053178 | Ga0500637_0002011 | Ga0500637_0002011_5570_6529 | 316 |
| 768 | 3300053730 | Ga0500645_006747 | Ga0500645_006747_1881_2840 | 316 |
| 769 | iso_pu_bacteria | 2902682994 | 2902689585 | 316 |
| 770 | 3300001989 | JGI24739J22299_10003739 | JGI24739J22299_100037393 | 317 |
| 771 | 3300003214 | JGI25165J46597_1001146 | JGI25165J46597_100114616 | 317 |
| 772 | 3300003756 | Ga0055533_1000064 | Ga0055533_100006473 | 317 |
| 773 | 3300003758 | Ga0055532_1000013 | Ga0055532_1000013296 | 317 |
| 774 | 3300003760 | Ga0055527_1000010 | Ga0055527_100001074 | 317 |
| 775 | 3300003761 | Ga0055535_1000010 | Ga0055535_1000010296 | 317 |
| 776 | 3300003762 | Ga0055542_1000016 | Ga0055542_1000016296 | 317 |
| 777 | 3300003763 | Ga0055529_1000012 | Ga0055529_1000012296 | 317 |
| 778 | 3300005530 | Ga0070679_100010795 | Ga0070679_1000107953 | 317 |
| 779 | 3300025226 | Ga0209674_100011 | Ga0209674_10001172 | 317 |
| 780 | 3300025228 | Ga0209672_100002 | Ga0209672_10000272 | 317 |
| 781 | 3300025229 | Ga0209147_100003 | Ga0209147_10000372 | 317 |
| 782 | 3300025230 | Ga0209563_100729 | Ga0209563_1007295 | 317 |
| 783 | 3300025231 | Ga0207427_100230 | Ga0207427_10023031 | 317 |
| 784 | 3300025242 | Ga0209258_100042 | Ga0209258_100042288 | 317 |
| 785 | 3300025254 | Ga0209148_1000006 | Ga0209148_100000672 | 317 |
| 786 | 3300025261 | Ga0209233_1000033 | Ga0209233_1000033477 | 317 |
| 787 | 3300025272 | Ga0209455_1000003 | Ga0209455_100000372 | 317 |
| 788 | 3300025921 | Ga0207652_10044388 | Ga0207652_100443883 | 317 |
| 789 | 3300028794 | Ga0307515_10006133 | Ga0307515_100061335 | 317 |
| 790 | 3300031247 | Ga0265340_10040161 | Ga0265340_100401613 | 317 |
| 791 | 3300031911 | Ga0307412_10000857 | Ga0307412_1000085710 | 317 |
| 792 | 3300037312 | Ga0395899_0001283 | Ga0395899_0001283_7880_8833 | 317 |
| 793 | 3300037418 | Ga0395900_0032994 | Ga0395900_0032994_1404_2357 | 317 |
| 794 | 3300037418 | Ga0395900_0045778 | Ga0395900_0045778_1428_2381 | 317 |
| 795 | 3300037471 | Ga0395905_0000138 | Ga0395905_0000138_118950_119903 | 317 |
| 796 | 3300037471 | Ga0395905_0006240 | Ga0395905_0006240_4945_5901 | 317 |
| 797 | 3300037471 | Ga0395905_0026512 | Ga0395905_0026512_3943_4896 | 317 |
| 798 | 3300037471 | Ga0395905_0095477 | Ga0395905_0095477_1785_2738 | 317 |
| 799 | 3300037471 | Ga0395905_0113073 | Ga0395905_0113073_51_1004 | 317 |
| 800 | 3300038443 | Ga0395901_0030455 | Ga0395901_0030455_1539_2492 | 317 |
| 801 | 3300038443 | Ga0395901_0071636 | Ga0395901_0071636_804_1757 | 317 |
| 802 | 3300038735 | Ga0400485_10823 | Ga0400485_10823_2528_3487 | 317 |
| 803 | 3300045051 | Ga0451576_0015435 | Ga0451576_0015435_4141_5094 | 317 |
| 804 | 3300046471 | Ga0495650_0001834 | Ga0495650_0001834_8564_9517 | 317 |
| 805 | 3300046471 | Ga0495650_0047442 | Ga0495650_0047442_555_1508 | 317 |
| 806 | 3300046500 | Ga0495596_0119890 | Ga0495596_0119890_15_968 | 317 |
| 807 | 3300046507 | Ga0495606_0008456 | Ga0495606_0008456_4889_5842 | 317 |
| 808 | 3300046507 | Ga0495606_0127099 | Ga0495606_0127099_294_1247 | 317 |
| 809 | 3300046516 | Ga0495628_0004882 | Ga0495628_0004882_9800_10753 | 317 |
| 810 | 3300046524 | Ga0495648_0001735 | Ga0495648_0001735_13771_14724 | 317 |
| 811 | 3300046524 | Ga0495648_0009710 | Ga0495648_0009710_5425_6378 | 317 |
| 812 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_175499_176452 | 317 |
| 813 | 3300046642 | Ga0495634_0030347 | Ga0495634_0030347_2692_3645 | 317 |
| 814 | 3300046660 | Ga0495625_0002034 | Ga0495625_0002034_6231_7184 | 317 |
| 815 | 3300046665 | Ga0495661_0058809 | Ga0495661_0058809_130_1083 | 317 |
| 816 | 3300046678 | Ga0495599_0023534 | Ga0495599_0023534_2337_3290 | 317 |
| 817 | 3300046679 | Ga0495623_0002882 | Ga0495623_0002882_7592_8545 | 317 |
| 818 | 3300046690 | Ga0495624_0014434 | Ga0495624_0014434_4090_5043 | 317 |
| 819 | 3300046694 | Ga0495649_0010900 | Ga0495649_0010900_4075_5028 | 317 |
| 820 | 3300047317 | Ga0495604_0000893 | Ga0495604_0000893_10981_11934 | 317 |
| 821 | 3300047319 | Ga0495674_0092293 | Ga0495674_0092293_1488_2441 | 317 |
| 822 | 3300047320 | Ga0495672_0053599 | Ga0495672_0053599_524_1477 | 317 |
| 823 | 3300047322 | Ga0495680_0029149 | Ga0495680_0029149_936_1889 | 317 |
| 824 | 3300047322 | Ga0495680_0160993 | Ga0495680_0160993_371_1324 | 317 |
| 825 | 3300047323 | Ga0495683_0003543 | Ga0495683_0003543_2373_3326 | 317 |
| 826 | 3300047323 | Ga0495683_0004867 | Ga0495683_0004867_2272_3225 | 317 |
| 827 | 3300047444 | Ga0495675_0041332 | Ga0495675_0041332_381_1334 | 317 |
| 828 | 3300047469 | Ga0495673_0013392 | Ga0495673_0013392_2570_3523 | 317 |
| 829 | 3300047472 | Ga0495686_0003011 | Ga0495686_0003011_3826_4779 | 317 |
| 830 | 3300048088 | Ga0495602_0001190 | Ga0495602_0001190_15191_16144 | 317 |
| 831 | 3300048088 | Ga0495602_0065072 | Ga0495602_0065072_658_1611 | 317 |
| 832 | 3300048924 | Ga0496121_0010277 | Ga0496121_0010277_9613_10566 | 317 |
| 833 | 3300048928 | Ga0496125_0030887 | Ga0496125_0030887_886_1842 | 317 |
| 834 | 3300048929 | Ga0496126_0001434 | Ga0496126_0001434_8554_9507 | 317 |
| 835 | 3300049459 | Ga0495678_018911 | Ga0495678_018911_650_1603 | 317 |
| 836 | 3300050493 | nmdc:mga0k408_221_c1 | nmdc:mga0k408_221_c1_16814_17779 | 317 |
| 837 | 3300050493 | nmdc:mga0k408_84793_c1 | nmdc:mga0k408_84793_c1_394_1347 | 317 |
| 838 | 3300003763 | Ga0055529_1001271 | Ga0055529_10012715 | 318 |
| 839 | 3300003792 | Ga0055540_1001334 | Ga0055540_10013346 | 318 |
| 840 | 3300003794 | Ga0055531_10001335 | Ga0055531_100013353 | 318 |
| 841 | 3300005293 | Ga0065715_10142885 | Ga0065715_101428852 | 318 |
| 842 | 3300005344 | Ga0070661_100237738 | Ga0070661_1002377381 | 318 |
| 843 | 3300005347 | Ga0070668_100238741 | Ga0070668_1002387412 | 318 |
| 844 | 3300005354 | Ga0070675_100025023 | Ga0070675_1000250236 | 318 |
| 845 | 3300005364 | Ga0070673_100238138 | Ga0070673_1002381382 | 318 |
| 846 | 3300005455 | Ga0070663_100043069 | Ga0070663_1000430693 | 318 |
| 847 | 3300005617 | Ga0068859_100216229 | Ga0068859_1002162292 | 318 |
| 848 | 3300006353 | Ga0075370_10040788 | Ga0075370_100407882 | 318 |
| 849 | 3300006846 | Ga0075430_100175926 | Ga0075430_1001759262 | 318 |
| 850 | 3300006931 | Ga0097620_100216229 | Ga0097620_1002162292 | 318 |
| 851 | 3300009093 | Ga0105240_10073489 | Ga0105240_100734894 | 318 |
| 852 | 3300009094 | Ga0111539_10373123 | Ga0111539_103731232 | 318 |
| 853 | 3300009174 | Ga0105241_10030921 | Ga0105241_100309214 | 318 |
| 854 | 3300010375 | Ga0105239_10461852 | Ga0105239_104618522 | 318 |
| 855 | 3300025272 | Ga0209455_1000337 | Ga0209455_100033712 | 318 |
| 856 | 3300025284 | Ga0209130_1010519 | Ga0209130_10105192 | 318 |
| 857 | 3300025303 | Ga0209051_1000055 | Ga0209051_1000055243 | 318 |
| 858 | 3300025304 | Ga0209257_1000101 | Ga0209257_1000101217 | 318 |
| 859 | 3300025924 | Ga0207694_10057390 | Ga0207694_100573903 | 318 |
| 860 | 3300025960 | Ga0207651_10338064 | Ga0207651_103380642 | 318 |
| 861 | 3300026118 | Ga0207675_100514665 | Ga0207675_1005146652 | 318 |
| 862 | 3300028573 | Ga0265334_10058479 | Ga0265334_100584792 | 318 |
| 863 | 3300031344 | Ga0265316_10032233 | Ga0265316_100322336 | 318 |
| 864 | 3300031456 | Ga0307513_10010205 | Ga0307513_100102058 | 318 |
| 865 | 3300031456 | Ga0307513_10070175 | Ga0307513_100701752 | 318 |
| 866 | 3300031649 | Ga0307514_10001033 | Ga0307514_1000103335 | 318 |
| 867 | 3300031727 | Ga0316576_10142533 | Ga0316576_101425332 | 318 |
| 868 | 3300031727 | Ga0316576_10146759 | Ga0316576_101467593 | 318 |
| 869 | 3300031728 | Ga0316578_10106884 | Ga0316578_101068842 | 318 |
| 870 | 3300031903 | Ga0307407_10090797 | Ga0307407_100907971 | 318 |
| 871 | 3300035170 | Ga0373943_0146870 | Ga0373943_0146870_43_999 | 318 |
| 872 | 3300035398 | Ga0316574_0128007 | Ga0316574_0128007_506_1480 | 318 |
| 873 | 3300037312 | Ga0395899_0011366 | Ga0395899_0011366_1487_2443 | 318 |
| 874 | 3300037418 | Ga0395900_0026724 | Ga0395900_0026724_953_1915 | 318 |
| 875 | 3300037466 | Ga0395898_0037745 | Ga0395898_0037745_455_1411 | 318 |
| 876 | 3300037471 | Ga0395905_0000043 | Ga0395905_0000043_5639_6595 | 318 |
| 877 | 3300037471 | Ga0395905_0031618 | Ga0395905_0031618_1627_2583 | 318 |
| 878 | 3300037471 | Ga0395905_0038385 | Ga0395905_0038385_1898_2854 | 318 |
| 879 | 3300038443 | Ga0395901_0075467 | Ga0395901_0075467_982_1938 | 318 |
| 880 | 3300039062 | Ga0400483_018531 | Ga0400483_018531_44467_45423 | 318 |
| 881 | 3300039062 | Ga0400483_219255 | Ga0400483_219255_7856_8812 | 318 |
| 882 | 3300039110 | Ga0400487_27682 | Ga0400487_27682_550_1506 | 318 |
| 883 | 3300041999 | Ga0439433_0026479 | Ga0439433_0026479_287_1243 | 318 |
| 884 | 3300042007 | Ga0439449_0060268 | Ga0439449_0060268_126_1082 | 318 |
| 885 | 3300042876 | Ga0451577_0333803 | Ga0451577_0333803_170_1129 | 318 |
| 886 | 3300044673 | Ga0453683_0011905 | Ga0453683_0011905_241_1197 | 318 |
| 887 | 3300044712 | Ga0453684_0000583 | Ga0453684_0000583_125715_126674 | 318 |
| 888 | 3300045049 | Ga0466959_0175644 | Ga0466959_0175644_57_1013 | 318 |
| 889 | 3300045051 | Ga0451576_0000137 | Ga0451576_0000137_9267_10226 | 318 |
| 890 | 3300046460 | Ga0495638_0000710 | Ga0495638_0000710_3629_4585 | 318 |
| 891 | 3300046474 | Ga0495605_0006813 | Ga0495605_0006813_614_1570 | 318 |
| 892 | 3300046506 | Ga0495583_0003737 | Ga0495583_0003737_9713_10669 | 318 |
| 893 | 3300046528 | Ga0495642_0005224 | Ga0495642_0005224_3554_4510 | 318 |
| 894 | 3300046542 | Ga0495597_0003270 | Ga0495597_0003270_2706_3662 | 318 |
| 895 | 3300046616 | Ga0495668_0057580 | Ga0495668_0057580_806_1762 | 318 |
| 896 | 3300046691 | Ga0495670_0000076 | Ga0495670_0000076_42197_43153 | 318 |
| 897 | 3300049574 | Ga0501038_0065221 | Ga0501038_0065221_2037_2999 | 318 |
| 898 | 3300049575 | Ga0501039_0072770 | Ga0501039_0072770_1614_2576 | 318 |
| 899 | 3300049576 | Ga0501040_0031012 | Ga0501040_0031012_144_1106 | 318 |
| 900 | 3300049577 | Ga0501041_0032257 | Ga0501041_0032257_1149_2111 | 318 |
| 901 | 3300049585 | Ga0501069_0086023 | Ga0501069_0086023_448_1410 | 318 |
| 902 | 3300049587 | Ga0501071_0092472 | Ga0501071_0092472_78_1040 | 318 |
| 903 | 3300049588 | Ga0501072_0047097 | Ga0501072_0047097_862_1824 | 318 |
| 904 | 3300049592 | Ga0501076_0325269 | Ga0501076_0325269_56_1018 | 318 |
| 905 | 3300049822 | Ga0501035_0038030 | Ga0501035_0038030_1243_2202 | 318 |
| 906 | 3300049823 | Ga0501044_0000515 | Ga0501044_0000515_39203_40162 | 318 |
| 907 | 3300049824 | Ga0501045_0014064 | Ga0501045_0014064_1798_2760 | 318 |
| 908 | 3300050493 | nmdc:mga0k408_104155_c1 | nmdc:mga0k408_104155_c1_249_1205 | 318 |
| 909 | 3300050509 | nmdc:mga0qj67_18502_c1 | nmdc:mga0qj67_18502_c1_3873_4829 | 318 |
| 910 | 3300050511 | nmdc:mga08y16_192423_c1 | nmdc:mga08y16_192423_c1_661_1620 | 318 |
| 911 | 3300060353 | Ga0501082_0076865 | Ga0501082_0076865_1866_2834 | 318 |
| 912 | 3300003775 | Ga0055524_1000117 | Ga0055524_100011748 | 319 |
| 913 | 3300003794 | Ga0055531_10001376 | Ga0055531_1000137616 | 319 |
| 914 | 3300005262 | Ga0065165_1000323 | Ga0065165_100032357 | 319 |
| 915 | 3300005356 | Ga0070674_100010407 | Ga0070674_1000104074 | 319 |
| 916 | 3300005456 | Ga0070678_100195244 | Ga0070678_1001952442 | 319 |
| 917 | 3300006353 | Ga0075370_10044816 | Ga0075370_100448163 | 319 |
| 918 | 3300006844 | Ga0075428_100005334 | Ga0075428_1000053349 | 319 |
| 919 | 3300006847 | Ga0075431_100009471 | Ga0075431_1000094718 | 319 |
| 920 | 3300006880 | Ga0075429_100029740 | Ga0075429_1000297402 | 319 |
| 921 | 3300009094 | Ga0111539_10046075 | Ga0111539_100460752 | 319 |
| 922 | 3300009147 | Ga0114129_10171988 | Ga0114129_101719883 | 319 |
| 923 | 3300012497 | Ga0157319_1000240 | Ga0157319_10002402 | 319 |
| 924 | 3300013308 | Ga0157375_10140086 | Ga0157375_101400862 | 319 |
| 925 | 3300021361 | Ga0213872_10000134 | Ga0213872_1000013412 | 319 |
| 926 | 3300025253 | Ga0209677_100280 | Ga0209677_1002806 | 319 |
| 927 | 3300025261 | Ga0209233_1002614 | Ga0209233_10026144 | 319 |
| 928 | 3300025272 | Ga0209455_1001166 | Ga0209455_10011665 | 319 |
| 929 | 3300025272 | Ga0209455_1006539 | Ga0209455_10065392 | 319 |
| 930 | 3300025273 | Ga0209673_1019006 | Ga0209673_10190063 | 319 |
| 931 | 3300025295 | Ga0209564_1000097 | Ga0209564_1000097104 | 319 |
| 932 | 3300025299 | Ga0209256_1000075 | Ga0209256_100007584 | 319 |
| 933 | 3300025304 | Ga0209257_1000244 | Ga0209257_100024475 | 319 |
| 934 | 3300026089 | Ga0207648_10124336 | Ga0207648_101243362 | 319 |
| 935 | 3300026121 | Ga0207683_10320388 | Ga0207683_103203881 | 319 |
| 936 | 3300031247 | Ga0265340_10005895 | Ga0265340_100058952 | 319 |
| 937 | 3300031249 | Ga0265339_10001335 | Ga0265339_100013352 | 319 |
| 938 | 3300031852 | Ga0307410_10172071 | Ga0307410_101720712 | 319 |
| 939 | 3300034817 | Ga0373948_0000494 | Ga0373948_0000494_1828_2787 | 319 |
| 940 | 3300034820 | Ga0373959_0002211 | Ga0373959_0002211_448_1407 | 319 |
| 941 | 3300035114 | Ga0373939_0000469 | Ga0373939_0000469_6300_7259 | 319 |
| 942 | 3300035241 | Ga0373961_0004472 | Ga0373961_0004472_2018_2977 | 319 |
| 943 | 3300035242 | Ga0373962_0001611 | Ga0373962_0001611_2342_3301 | 319 |
| 944 | 3300035691 | Ga0373931_0000097 | Ga0373931_0000097_19759_20718 | 319 |
| 945 | 3300037471 | Ga0395905_0078767 | Ga0395905_0078767_1776_2741 | 319 |
| 946 | 3300039437 | Ga0436365_1486157 | Ga0436365_1486157_5030_5995 | 319 |
| 947 | 3300039447 | Ga0436361_0455065 | Ga0436361_0455065_15688_16647 | 319 |
| 948 | 3300041509 | Ga0451843_1214629 | Ga0451843_1214629_57_1016 | 319 |
| 949 | 3300041997 | Ga0439431_0004185 | Ga0439431_0004185_252_1214 | 319 |
| 950 | 3300042129 | Ga0450891_001745 | Ga0450891_001745_1114_2073 | 319 |
| 951 | 3300042130 | Ga0450892_001022 | Ga0450892_001022_501_1460 | 319 |
| 952 | 3300042438 | Ga0439459_0001486 | Ga0439459_0001486_837_1796 | 319 |
| 953 | 3300042876 | Ga0451577_0302917 | Ga0451577_0302917_327_1286 | 319 |
| 954 | 3300044842 | Ga0466957_0160086 | Ga0466957_0160086_187_1146 | 319 |
| 955 | 3300048917 | Ga0496114_0141306 | Ga0496114_0141306_694_1656 | 319 |
| 956 | 3300048921 | Ga0496118_0014666 | Ga0496118_0014666_4897_5856 | 319 |
| 957 | 3300048929 | Ga0496126_0158743 | Ga0496126_0158743_651_1625 | 319 |
| 958 | 3300049571 | Ga0501034_0111063 | Ga0501034_0111063_503_1465 | 319 |
| 959 | 3300049764 | Ga0501267_002028 | Ga0501267_002028_540_1499 | 319 |
| 960 | 3300050507 | nmdc:mga05p37_176319_c1 | nmdc:mga05p37_176319_c1_1613_2587 | 319 |
| 961 | 3300050508 | nmdc:mga09592_31262_c1 | nmdc:mga09592_31262_c1_651_1625 | 319 |
| 962 | 3300050510 | nmdc:mga06r32_16238_c1 | nmdc:mga06r32_16238_c1_1177_2151 | 319 |
| 963 | 3300050511 | nmdc:mga08y16_143407_c1 | nmdc:mga08y16_143407_c1_288_1262 | 319 |
| 964 | 3300053117 | Ga0500593_000250 | Ga0500593_000250_10120_11079 | 319 |
| 965 | 3300053139 | Ga0500568_0011569 | Ga0500568_0011569_1203_2162 | 319 |
| 966 | 3300053156 | Ga0500622_0000970 | Ga0500622_0000970_23298_24257 | 319 |
| 967 | 3300053156 | Ga0500622_0006287 | Ga0500622_0006287_5842_6801 | 319 |
| 968 | 3300053177 | Ga0500636_0099119 | Ga0500636_0099119_632_1603 | 319 |
| 969 | 2162886006 | SwRhRL3b_contig_1627834 | SwRhRL3b_0101.00001050 | 320 |
| 970 | 3300004625 | Ga0055543_1004964 | Ga0055543_10049642 | 320 |
| 971 | 3300005262 | Ga0065165_1000864 | Ga0065165_100086414 | 320 |
| 972 | 3300005331 | Ga0070670_100187346 | Ga0070670_1001873462 | 320 |
| 973 | 3300006177 | Ga0075362_10066530 | Ga0075362_100665302 | 320 |
| 974 | 3300006195 | Ga0075366_10008288 | Ga0075366_100082885 | 320 |
| 975 | 3300009092 | Ga0105250_10000186 | Ga0105250_100001864 | 320 |
| 976 | 3300014968 | Ga0157379_10000207 | Ga0157379_1000020742 | 320 |
| 977 | 3300025711 | Ga0207696_1000072 | Ga0207696_1000072196 | 320 |
| 978 | 3300031691 | Ga0316579_10004261 | Ga0316579_100042613 | 320 |
| 979 | 3300031727 | Ga0316576_10147348 | Ga0316576_101473482 | 320 |
| 980 | 3300031728 | Ga0316578_10011530 | Ga0316578_100115302 | 320 |
| 981 | 3300031733 | Ga0316577_10100242 | Ga0316577_101002422 | 320 |
| 982 | 3300032139 | Ga0316580_10008604 | Ga0316580_100086042 | 320 |
| 983 | 3300034818 | Ga0373950_0003278 | Ga0373950_0003278_420_1382 | 320 |
| 984 | 3300035121 | Ga0373960_0002150 | Ga0373960_0002150_339_1301 | 320 |
| 985 | 3300035398 | Ga0316574_0019069 | Ga0316574_0019069_1977_2963 | 320 |
| 986 | 3300036647 | Ga0316582_0000235 | Ga0316582_0000235_1084_2070 | 320 |
| 987 | 3300046471 | Ga0495650_0013002 | Ga0495650_0013002_3090_4052 | 320 |
| 988 | 3300047472 | Ga0495686_0065500 | Ga0495686_0065500_1134_2099 | 320 |
| 989 | 3300048907 | Ga0496104_0079087 | Ga0496104_0079087_1895_2863 | 320 |
| 990 | 3300048908 | Ga0496105_0194455 | Ga0496105_0194455_29_997 | 320 |
| 991 | 3300049568 | Ga0501031_0002425 | Ga0501031_0002425_982_1956 | 320 |
| 992 | 3300049568 | Ga0501031_0017107 | Ga0501031_0017107_277_1251 | 320 |
| 993 | 3300049570 | Ga0501033_0008619 | Ga0501033_0008619_3676_4650 | 320 |
| 994 | 3300049571 | Ga0501034_0020044 | Ga0501034_0020044_1160_2134 | 320 |
| 995 | 3300049571 | Ga0501034_0046424 | Ga0501034_0046424_1075_2049 | 320 |
| 996 | 3300049572 | Ga0501036_0005963 | Ga0501036_0005963_4825_5799 | 320 |
| 997 | 3300049573 | Ga0501037_0013273 | Ga0501037_0013273_3158_4132 | 320 |
| 998 | 3300049573 | Ga0501037_0017406 | Ga0501037_0017406_1979_2953 | 320 |
| 999 | 3300049579 | Ga0501043_0011565 | Ga0501043_0011565_4360_5334 | 320 |
| 1000 | 3300049579 | Ga0501043_0099256 | Ga0501043_0099256_565_1539 | 320 |
| 1001 | 3300049580 | Ga0501046_0048422 | Ga0501046_0048422_2038_3012 | 320 |
| 1002 | 3300049581 | Ga0501047_0005052 | Ga0501047_0005052_9107_10081 | 320 |
| 1003 | 3300049822 | Ga0501035_0002048 | Ga0501035_0002048_1921_2895 | 320 |
| 1004 | 3300049823 | Ga0501044_0007899 | Ga0501044_0007899_7630_8604 | 320 |
| 1005 | 3300050493 | nmdc:mga0k408_44082_c1 | nmdc:mga0k408_44082_c1_447_1409 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a3g-assembly1.cif.gz_B | levoglucosan dehydrogenase, complex with nadh | 0.8724 | 5 | 318 |
| 7bvj-assembly4.cif.gz_D | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.8718 | 1 | 318 |
| 7bvk-assembly2.cif.gz_B | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) | 0.8715 | 5 | 318 |
| 5ya8-assembly1.cif.gz_D | crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol | 0.8701 | 5 | 320 |
| 6a3f-assembly1.cif.gz_B-2 | levoglucosan dehydrogenase, apo form | 0.8681 | 3 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ezyC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9667 | 5 | 122 | 3.40.50.720 |
| af_Q9VJH7_91_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9542 | 5 | 121 | 3.40.50.720 |
| af_P42599_1_134_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9513 | 5 | 122 | 3.40.50.720 |
| 3ezyC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9507 | 5 | 122 | 3.40.50.720 |
| af_Q2G1E6_2_122_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9491 | 5 | 120 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8QQM0-F1-model_v4 | Oxidoreductase | 0.9782 | 120 | 316 |
|
| AF-A0A6N8URL0-F1-model_v4 | deleted | 0.9725 | 1 | 95 |
|
| AF-A0A3B8QQM0-F1-model_v4 | Oxidoreductase | 0.9638 | 120 | 316 |
|
| AF-A0A3D0M678-F1-model_v4 | Dehydrogenase | 0.9593 | 3 | 143 |
GO:0000166
|
| AF-A0A7W0GP34-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9553 | 2 | 142 |
GO:0000166
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar