F488001

General Info

Members Datasets Scaffolds Average Seq Length
1005 514 964 315

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_221_c1|nmdc:mga0k408_221_c1_16814_17779
Length 321
Sequence VSKTIKVALAGAGAFGIKHLDAMRNIDGVEVVSLVSRELDKTREVAAKYGIAHCSTDLADSLALPEVDAVILCTPTQMHAAQAQACLRAGKHVQVEIPLADSLADAEAVVALQKEMWKTRGLVAMCGHTRRFNPSHQWVRRRIMAGEFNILQMDVQTYFFRRTNMNALGQPRSWTDHLLWHHAAHTVDLFAYQTRSPIVQANAIQGPISPTLGIAMDMSIQLKAANGAICTLSLSFNNEGPLGTFFRYIGDSGTYIARYDDLINGKEEKIDVSGVDVSMNGIELQDREFFAAIREGREPNASVAQVLPCYEVLQKLEQQLT

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221570 Acidovorax sp. Root568 Isolate Unclassified
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221717 Acidovorax sp. Root267 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
17 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
18 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
21 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
24 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2831864461 Roseateles noduli HZ7 Isolate Nodule
27 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
28 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
29 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
30 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
31 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
32 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
33 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
34 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
35 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
36 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
37 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
38 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
39 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
40 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
71 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
72 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
127 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
128 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
136 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
137 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
143 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
144 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
145 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
167 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
174 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
175 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
177 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
249 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
250 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
259 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
260 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
261 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
262 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
263 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
264 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
265 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
269 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
270 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
272 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
273 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
274 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
275 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
276 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
277 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
283 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
284 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
285 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
286 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
287 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
288 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
289 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
290 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
291 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
292 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
293 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
294 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
295 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
296 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
297 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
298 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
299 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
300 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
301 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
302 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
303 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
305 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
306 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
307 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
308 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
309 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
310 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
311 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
312 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
313 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
314 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
315 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
316 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
317 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
318 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
319 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
320 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
321 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
322 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
323 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
324 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
325 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
326 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
327 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
328 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
329 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
330 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
331 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
332 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
333 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
334 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
335 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
336 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
337 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
338 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
339 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
340 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
341 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
342 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
343 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
344 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
345 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
346 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
347 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
348 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
349 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
350 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
351 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
352 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
353 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
354 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
355 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
356 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
357 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
358 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
359 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
360 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
361 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
362 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
363 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
364 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
365 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
366 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
367 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
368 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
369 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
370 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
371 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
372 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
373 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
376 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
377 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
378 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
379 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
380 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
381 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
382 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
383 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
384 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
385 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
386 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
387 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
388 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
389 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
390 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
391 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
392 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
397 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
400 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
407 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
408 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
409 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
410 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
411 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
412 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
417 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
418 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
419 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
420 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
423 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
424 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
425 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
426 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
427 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
428 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
429 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
430 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
431 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
432 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
433 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
434 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
435 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
436 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
465 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
466 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
467 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
468 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
469 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
470 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
471 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
472 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
473 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
476 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
480 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
481 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
482 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
483 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
486 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
487 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
488 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
489 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
490 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
491 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
494 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
495 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
496 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
499 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
500 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
501 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
502 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
503 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
504 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
505 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
506 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
507 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
508 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
511 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
512 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
513 639633007 Azoarcus olearius BH72 Isolate Unclassified
514 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0.6
Isolates 4.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 0.7
Rhizoplane 2.39
Rhizosphere 76.12
Stem 0
Stem Tuber 0
Unclassified 10.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1627834 2162886006 Bacteria 1412
2 JGI24739J22299_10003739 3300001989 Bacteria 5809
3 JGI25406J46586_10051383 3300003203 Bacteria 1379
4 JGI25165J46597_1001146 3300003214 Bacteria 16553
5 rootL2_10143951 3300003322 Bacteria 3982
6 rootL2_10253676 3300003322 Bacteria 2050
7 Ga0055533_1000064 3300003756 Bacteria 169672
8 Ga0055532_1000013 3300003758 Bacteria 380677
9 Ga0055527_1000010 3300003760 Bacteria 380677
10 Ga0055535_1000010 3300003761 Bacteria 380677
11 Ga0055542_1000016 3300003762 Bacteria 380677
12 Ga0055529_1000012 3300003763 Bacteria 380677
13 Ga0055529_1001271 3300003763 Bacteria 9037
14 Ga0055524_1000117 3300003775 Bacteria 93643
15 Ga0055524_1029023 3300003775 Bacteria 1644
16 Ga0055540_1001334 3300003792 Bacteria 14864
17 Ga0055531_10001335 3300003794 Bacteria 18427
18 Ga0055531_10001376 3300003794 Bacteria 18057
19 Ga0055531_10008251 3300003794 Bacteria 5538
20 Ga0055543_1004964 3300004625 Bacteria 3489
21 Ga0065165_1000323 3300005262 Bacteria 78079
22 Ga0065165_1000864 3300005262 Bacteria 39604
23 Ga0065714_10100934 3300005288 Bacteria 1654
24 Ga0065704_10147643 3300005289 Bacteria 1457
25 Ga0065712_10132380 3300005290 Bacteria 1534
26 Ga0065715_10092009 3300005293 Bacteria 5395
27 Ga0065715_10130447 3300005293 Bacteria 2022
28 Ga0065715_10142885 3300005293 Bacteria 1828
29 Ga0065707_10175098 3300005295 Bacteria 1456
30 Ga0070676_10061960 3300005328 Bacteria 2224
31 Ga0070676_10082141 3300005328 Bacteria 1957
32 Ga0070670_100000863 3300005331 Bacteria 23798
33 Ga0070670_100187346 3300005331 Bacteria 1797
34 Ga0070677_10113734 3300005333 Bacteria 1212
35 Ga0068869_100017832 3300005334 Bacteria 4822
36 Ga0070680_100131673 3300005336 Bacteria 2093
37 Ga0070682_100001299 3300005337 Bacteria 14147
38 Ga0068868_100086716 3300005338 Bacteria 2517
39 Ga0068868_100090463 3300005338 Bacteria 2465
40 Ga0070660_100010451 3300005339 Bacteria 6560
41 Ga0070689_100310839 3300005340 Bacteria 1314
42 Ga0070691_10092199 3300005341 Bacteria 1495
43 Ga0070687_100023538 3300005343 Bacteria 2928
44 Ga0070661_100058507 3300005344 Bacteria 2825
45 Ga0070661_100237738 3300005344 Bacteria 1402
46 Ga0070668_100001288 3300005347 Bacteria 17940
47 Ga0070668_100033275 3300005347 Bacteria 3924
48 Ga0070668_100238741 3300005347 Bacteria 1505
49 Ga0070669_100003725 3300005353 Bacteria 11006
50 Ga0070669_100025855 3300005353 Bacteria 4220
51 Ga0070669_100115925 3300005353 Bacteria 2038
52 Ga0070675_100000605 3300005354 Bacteria 24695
53 Ga0070675_100001805 3300005354 Bacteria 15819
54 Ga0070675_100025023 3300005354 Bacteria 4785
55 Ga0070671_100023448 3300005355 Bacteria 5050
56 Ga0070674_100010407 3300005356 Bacteria 5624
57 Ga0070674_100021184 3300005356 Bacteria 4168
58 Ga0070673_100012312 3300005364 Bacteria 5871
59 Ga0070673_100032621 3300005364 Bacteria 3925
60 Ga0070673_100114527 3300005364 Bacteria 2241
61 Ga0070673_100238138 3300005364 Bacteria 1581
62 Ga0070688_100052265 3300005365 Bacteria 2552
63 Ga0070659_100524304 3300005366 Bacteria 1012
64 Ga0070667_100279130 3300005367 Bacteria 1500
65 Ga0070709_10000424 3300005434 Bacteria 25604
66 Ga0070714_100005361 3300005435 Bacteria 9785
67 Ga0070714_100559068 3300005435 Bacteria 1096
68 Ga0070713_100000019 3300005436 Bacteria 110100
69 Ga0070713_100031317 3300005436 Bacteria 4236
70 Ga0070713_100162474 3300005436 Bacteria 1994
71 Ga0070710_10021505 3300005437 Bacteria 3363
72 Ga0070710_10044662 3300005437 Bacteria 2459
73 Ga0070711_100010642 3300005439 Bacteria 5700
74 Ga0070711_100075095 3300005439 Bacteria 2392
75 Ga0070711_100176400 3300005439 Bacteria 1633
76 Ga0070708_100144370 3300005445 Bacteria 2209
77 Ga0070663_100043069 3300005455 Bacteria 3175
78 Ga0070663_100145261 3300005455 Bacteria 1814
79 Ga0070678_100195244 3300005456 Bacteria 1667
80 Ga0070662_100009085 3300005457 Bacteria 6487
81 Ga0070662_100032685 3300005457 Bacteria 3657
82 Ga0070662_100046971 3300005457 Bacteria 3104
83 Ga0070681_10148615 3300005458 Bacteria 2271
84 Ga0068867_100001878 3300005459 Bacteria 14605
85 Ga0068867_100007933 3300005459 Bacteria 7499
86 Ga0068867_100011208 3300005459 Bacteria 6324
87 Ga0070685_10011760 3300005466 Bacteria 4588
88 Ga0070685_10020748 3300005466 Bacteria 3560
89 Ga0070685_10165248 3300005466 Bacteria 1414
90 Ga0070706_100017917 3300005467 Bacteria 6533
91 Ga0070706_100322896 3300005467 Bacteria 1439
92 Ga0070707_100093503 3300005468 Bacteria 2911
93 Ga0070698_100003926 3300005471 Bacteria 16349
94 Ga0070698_100024152 3300005471 Bacteria 6343
95 Ga0070699_100015206 3300005518 Bacteria 6612
96 Ga0070699_100064156 3300005518 Bacteria 3186
97 Ga0070679_100010795 3300005530 Bacteria 8673
98 Ga0070684_100004488 3300005535 Bacteria 10624
99 Ga0070697_100062075 3300005536 Bacteria 3049
100 Ga0070697_100333651 3300005536 Bacteria 1307
101 Ga0070672_100003662 3300005543 Bacteria 9983
102 Ga0070672_100034503 3300005543 Bacteria 3839
103 Ga0070672_100037307 3300005543 Bacteria 3707
104 Ga0070672_100040583 3300005543 Bacteria 3572
105 Ga0070696_100093657 3300005546 Bacteria 2143
106 Ga0070665_100038890 3300005548 Bacteria 4783
107 Ga0070665_100162688 3300005548 Bacteria 2234
108 Ga0070704_100054933 3300005549 Bacteria 2821
109 Ga0068855_100067050 3300005563 Bacteria 4183
110 Ga0068855_100121444 3300005563 Bacteria 2990
111 Ga0068855_100210698 3300005563 Bacteria 2184
112 Ga0070664_100119385 3300005564 Bacteria 2307
113 Ga0068857_100171775 3300005577 Bacteria 1970
114 Ga0068857_100290543 3300005577 Bacteria 1505
115 Ga0068856_100025977 3300005614 Bacteria 5711
116 Ga0068856_100035912 3300005614 Bacteria 4859
117 Ga0068856_100062674 3300005614 Bacteria 3673
118 Ga0068856_100311090 3300005614 Bacteria 1593
119 Ga0070702_100058676 3300005615 Bacteria 2231
120 Ga0068852_100007943 3300005616 Bacteria 7776
121 Ga0068852_100128342 3300005616 Bacteria 2332
122 Ga0068859_100005230 3300005617 Bacteria 13184
123 Ga0068859_100216229 3300005617 Bacteria 2004
124 Ga0068864_100011966 3300005618 Bacteria 7163
125 Ga0068864_100095161 3300005618 Bacteria 2634
126 Ga0068861_100001297 3300005719 Bacteria 15630
127 Ga0068870_10016152 3300005840 Bacteria 3561
128 Ga0068863_100004078 3300005841 Bacteria 14429
129 Ga0068860_100000101 3300005843 Bacteria 142856
130 Ga0068862_100000710 3300005844 Bacteria 33992
131 Ga0068862_100000773 3300005844 Bacteria 31853
132 Ga0068862_100013059 3300005844 Bacteria 6871
133 Ga0081455_10006640 3300005937 Bacteria 12369
134 Ga0081455_10012116 3300005937 Bacteria 8619
135 Ga0081455_10014422 3300005937 Bacteria 7749
136 Ga0081540_1000120 3300005983 Bacteria 83032
137 Ga0081540_1024303 3300005983 Bacteria 3519
138 Ga0081540_1028089 3300005983 Bacteria 3169
139 Ga0081539_10000220 3300005985 Bacteria 133834
140 Ga0081539_10031999 3300005985 Bacteria 3229
141 Ga0081539_10053536 3300005985 Bacteria 2259
142 Ga0070717_10023098 3300006028 Bacteria 4923
143 Ga0070717_10157585 3300006028 Bacteria 1968
144 Ga0070717_10248702 3300006028 Bacteria 1570
145 Ga0075365_10002903 3300006038 Bacteria 8643
146 Ga0075365_10011690 3300006038 Bacteria 5174
147 Ga0075365_10056486 3300006038 Bacteria 2609
148 Ga0075368_10001375 3300006042 Bacteria 7751
149 Ga0075363_100032392 3300006048 Bacteria 2714
150 Ga0075363_100055898 3300006048 Bacteria 2115
151 Ga0075363_100080769 3300006048 Bacteria 1778
152 Ga0075364_10001926 3300006051 Bacteria 11551
153 Ga0075364_10046560 3300006051 Bacteria 2824
154 Ga0075364_10220909 3300006051 Bacteria 1286
155 Ga0070716_100013555 3300006173 Bacteria 4157
156 Ga0070716_100109504 3300006173 Bacteria 1709
157 Ga0070712_100162399 3300006175 Bacteria 1726
158 Ga0075362_10017271 3300006177 Bacteria 2970
159 Ga0075362_10066530 3300006177 Bacteria 1638
160 Ga0075367_10006610 3300006178 Bacteria 5875
161 Ga0075367_10046202 3300006178 Bacteria 2558
162 Ga0075366_10006834 3300006195 Bacteria 6275
163 Ga0075366_10008288 3300006195 Bacteria 5774
164 Ga0075366_10048036 3300006195 Bacteria 2530
165 Ga0075366_10151950 3300006195 Bacteria 1402
166 Ga0075366_10185661 3300006195 Bacteria 1263
167 Ga0097621_100016909 3300006237 Bacteria 5529
168 Ga0097621_100104236 3300006237 Bacteria 2390
169 Ga0075370_10040788 3300006353 Bacteria 2619
170 Ga0075370_10044816 3300006353 Bacteria 2501
171 Ga0068871_100025108 3300006358 Bacteria 4632
172 Ga0075428_100005334 3300006844 Bacteria 14293
173 Ga0075428_100007195 3300006844 Bacteria 12324
174 Ga0075428_100008323 3300006844 Bacteria 11495
175 Ga0075430_100057367 3300006846 Bacteria 3276
176 Ga0075430_100134843 3300006846 Bacteria 2057
177 Ga0075430_100175926 3300006846 Bacteria 1780
178 Ga0075430_100320366 3300006846 Bacteria 1281
179 Ga0075431_100009471 3300006847 Bacteria 9778
180 Ga0075431_100024976 3300006847 Bacteria 6125
181 Ga0075431_100148829 3300006847 Bacteria 2411
182 Ga0075431_100154509 3300006847 Bacteria 2361
183 Ga0075431_100379179 3300006847 Bacteria 1418
184 Ga0075433_10032292 3300006852 Bacteria 4484
185 Ga0075433_10061285 3300006852 Bacteria 3295
186 Ga0075434_100039179 3300006871 Bacteria 4696
187 Ga0075434_100050704 3300006871 Bacteria 4123
188 Ga0075429_100002086 3300006880 Bacteria 16679
189 Ga0075429_100029740 3300006880 Bacteria 4746
190 Ga0075429_100044872 3300006880 Bacteria 3845
191 Ga0075436_100131287 3300006914 Bacteria 1757
192 Ga0097620_100005230 3300006931 Bacteria 13184
193 Ga0097620_100216229 3300006931 Bacteria 2004
194 Ga0099824_1039673 3300006942 Bacteria 1192
195 Ga0099823_1000138 3300006944 Bacteria 37983
196 Ga0079104_1000007 3300006946 Bacteria 390531
197 Ga0075435_100018531 3300007076 Bacteria 5298
198 Ga0075435_100054421 3300007076 Bacteria 3229
199 Ga0105250_10000186 3300009092 Bacteria 53643
200 Ga0105240_10073489 3300009093 Bacteria 4222
201 Ga0105240_10106099 3300009093 Bacteria 3409
202 Ga0105240_10125926 3300009093 Bacteria 3078
203 Ga0111539_10042128 3300009094 Bacteria 5486
204 Ga0111539_10046075 3300009094 Bacteria 5218
205 Ga0111539_10183792 3300009094 Bacteria 2442
206 Ga0111539_10373123 3300009094 Bacteria 1661
207 Ga0105247_10184776 3300009101 Bacteria 1393
208 Ga0114129_10008622 3300009147 Bacteria 14537
209 Ga0114129_10009237 3300009147 Bacteria 14064
210 Ga0114129_10122874 3300009147 Bacteria 3572
211 Ga0114129_10144548 3300009147 Bacteria 3259
212 Ga0114129_10171988 3300009147 Bacteria 2953
213 Ga0105243_10173305 3300009148 Bacteria 1870
214 Ga0105241_10030921 3300009174 Bacteria 4005
215 Ga0105241_10056190 3300009174 Bacteria 3018
216 Ga0105242_10006667 3300009176 Bacteria 8907
217 Ga0105248_10003190 3300009177 Bacteria 18173
218 Ga0105248_10022581 3300009177 Bacteria 6982
219 Ga0105237_10015974 3300009545 Bacteria 7806
220 Ga0105237_10430063 3300009545 Bacteria 1326
221 Ga0105249_10015849 3300009553 Bacteria 6678
222 Ga0105249_10021555 3300009553 Bacteria 5769
223 Ga0105249_10038996 3300009553 Bacteria 4312
224 Ga0105239_10025714 3300010375 Bacteria 6483
225 Ga0105239_10461852 3300010375 Bacteria 1441
226 Ga0157319_1000240 3300012497 Bacteria 2698
227 Ga0157369_10296307 3300013105 Bacteria 1683
228 Ga0157378_10098716 3300013297 Bacteria 2663
229 Ga0163162_10024014 3300013306 Bacteria 6017
230 Ga0163162_10170219 3300013306 Bacteria 2303
231 Ga0157375_10000261 3300013308 Bacteria 47898
232 Ga0157375_10042879 3300013308 Bacteria 4383
233 Ga0157375_10140086 3300013308 Bacteria 2545
234 Ga0157375_10320181 3300013308 Bacteria 1715
235 Ga0157375_10654592 3300013308 Bacteria 1207
236 Ga0163163_10000639 3300014325 Bacteria 30088
237 Ga0157380_10160015 3300014326 Bacteria 1956
238 Ga0157379_10000207 3300014968 Bacteria 45489
239 Ga0157379_10075337 3300014968 Bacteria 3021
240 Ga0183361_10005 3300016635 Bacteria 413599
241 Ga0206351_10639124 3300020077 Bacteria 1335
242 Ga0206350_10380697 3300020080 Bacteria 3517
243 Ga0206354_11423707 3300020081 Bacteria 1333
244 Ga0213872_10000134 3300021361 Bacteria 67449
245 Ga0213872_10034574 3300021361 Bacteria 2313
246 Ga0213874_10019036 3300021377 Bacteria 1864
247 Ga0213876_10045174 3300021384 Bacteria 2330
248 Ga0213876_10072141 3300021384 Bacteria 1823
249 Ga0213875_10118570 3300021388 Bacteria 1237
250 Ga0213871_10006411 3300021441 Bacteria 2486
251 Ga0224712_10024103 3300022467 Bacteria 2121
252 Ga0224572_1000229 3300024225 Bacteria 5557
253 Ga0209674_100011 3300025226 Bacteria 997175
254 Ga0209672_100002 3300025228 Bacteria 1733325
255 Ga0209147_100003 3300025229 Bacteria 1733325
256 Ga0209563_100729 3300025230 Bacteria 10153
257 Ga0207427_100230 3300025231 Bacteria 47028
258 Ga0209258_100042 3300025242 Bacteria 380729
259 Ga0209677_100280 3300025253 Bacteria 34034
260 Ga0209148_1000006 3300025254 Bacteria 1733325
261 Ga0209233_1000033 3300025261 Bacteria 596094
262 Ga0209233_1002614 3300025261 Bacteria 6539
263 Ga0209455_1000003 3300025272 Bacteria 1471893
264 Ga0209455_1000337 3300025272 Bacteria 44758
265 Ga0209455_1001166 3300025272 Bacteria 12650
266 Ga0209455_1006539 3300025272 Bacteria 3423
267 Ga0209673_1019006 3300025273 Bacteria 2480
268 Ga0209673_1021109 3300025273 Bacteria 2287
269 Ga0209130_1010519 3300025284 Bacteria 2542
270 Ga0209564_1000097 3300025295 Bacteria 231436
271 Ga0209050_1005408 3300025298 Bacteria 8053
272 Ga0209256_1000075 3300025299 Bacteria 236149
273 Ga0209256_1000840 3300025299 Bacteria 38531
274 Ga0209051_1000055 3300025303 Bacteria 277194
275 Ga0209051_1004454 3300025303 Bacteria 8621
276 Ga0209257_1000101 3300025304 Bacteria 251553
277 Ga0209257_1000244 3300025304 Bacteria 126098
278 Ga0209257_1004031 3300025304 Bacteria 11813
279 Ga0207697_10012568 3300025315 Bacteria 3547
280 Ga0207696_1000072 3300025711 Bacteria 224214
281 Ga0207682_10001822 3300025893 Bacteria 9720
282 Ga0207682_10044025 3300025893 Bacteria 1829
283 Ga0207692_10000738 3300025898 Bacteria 11534
284 Ga0207692_10022718 3300025898 Bacteria 2890
285 Ga0207692_10032685 3300025898 Bacteria 2502
286 Ga0207688_10100146 3300025901 Bacteria 1672
287 Ga0207680_10095411 3300025903 Bacteria 1901
288 Ga0207699_10000465 3300025906 Bacteria 20602
289 Ga0207645_10013208 3300025907 Bacteria 5572
290 Ga0207705_10251711 3300025909 Bacteria 1347
291 Ga0207684_10060092 3300025910 Bacteria 3228
292 Ga0207707_10052812 3300025912 Bacteria 3537
293 Ga0207695_10078715 3300025913 Bacteria 3344
294 Ga0207671_10080063 3300025914 Bacteria 2448
295 Ga0207693_10003980 3300025915 Bacteria 12554
296 Ga0207663_10020666 3300025916 Bacteria 3732
297 Ga0207663_10072159 3300025916 Bacteria 2230
298 Ga0207663_10277948 3300025916 Bacteria 1243
299 Ga0207660_10261282 3300025917 Bacteria 1369
300 Ga0207662_10024547 3300025918 Bacteria 3468
301 Ga0207652_10039498 3300025921 Bacteria 4005
302 Ga0207652_10044388 3300025921 Bacteria 3787
303 Ga0207646_10036712 3300025922 Bacteria 4422
304 Ga0207646_10120025 3300025922 Bacteria 2362
305 Ga0207646_10191660 3300025922 Bacteria 1846
306 Ga0207681_10003681 3300025923 Bacteria 9530
307 Ga0207681_10023667 3300025923 Bacteria 3932
308 Ga0207694_10057390 3300025924 Bacteria 3027
309 Ga0207694_10341034 3300025924 Bacteria 1239
310 Ga0207650_10000326 3300025925 Bacteria 46321
311 Ga0207659_10000299 3300025926 Bacteria 29997
312 Ga0207659_10003803 3300025926 Bacteria 9104
313 Ga0207687_10241108 3300025927 Bacteria 1433
314 Ga0207687_10334515 3300025927 Bacteria 1229
315 Ga0207700_10000035 3300025928 Bacteria 119648
316 Ga0207700_10004029 3300025928 Bacteria 8601
317 Ga0207700_10177250 3300025928 Bacteria 1782
318 Ga0207664_10004452 3300025929 Bacteria 9489
319 Ga0207664_10010239 3300025929 Bacteria 6622
320 Ga0207664_10024659 3300025929 Bacteria 4521
321 Ga0207644_10001354 3300025931 Bacteria 15752
322 Ga0207706_10000606 3300025933 Bacteria 38141
323 Ga0207706_10004288 3300025933 Bacteria 13404
324 Ga0207706_10047194 3300025933 Bacteria 3811
325 Ga0207706_10156774 3300025933 Bacteria 2002
326 Ga0207686_10004843 3300025934 Bacteria 7234
327 Ga0207686_10305411 3300025934 Bacteria 1183
328 Ga0207709_10000172 3300025935 Bacteria 86654
329 Ga0207709_10115703 3300025935 Bacteria 1802
330 Ga0207669_10084624 3300025937 Bacteria 2044
331 Ga0207669_10358360 3300025937 Bacteria 1129
332 Ga0207704_10111667 3300025938 Bacteria 1849
333 Ga0207704_10346326 3300025938 Bacteria 1155
334 Ga0207665_10016681 3300025939 Bacteria 4824
335 Ga0207665_10035614 3300025939 Bacteria 3305
336 Ga0207691_10000049 3300025940 Bacteria 94813
337 Ga0207691_10002506 3300025940 Bacteria 17971
338 Ga0207691_10006862 3300025940 Bacteria 10987
339 Ga0207691_10050698 3300025940 Bacteria 3798
340 Ga0207691_10133760 3300025940 Bacteria 2189
341 Ga0207711_10038852 3300025941 Bacteria 4047
342 Ga0207689_10007180 3300025942 Bacteria 9786
343 Ga0207689_10015453 3300025942 Bacteria 6463
344 Ga0207661_10000444 3300025944 Bacteria 26690
345 Ga0207679_10002985 3300025945 Bacteria 10490
346 Ga0207679_10427917 3300025945 Bacteria 1170
347 Ga0207667_10123088 3300025949 Bacteria 2672
348 Ga0207667_10239885 3300025949 Bacteria 1855
349 Ga0207651_10000834 3300025960 Bacteria 13379
350 Ga0207651_10311190 3300025960 Bacteria 1313
351 Ga0207651_10338064 3300025960 Bacteria 1264
352 Ga0207712_10021719 3300025961 Bacteria 4217
353 Ga0207712_10021950 3300025961 Bacteria 4197
354 Ga0207712_10032944 3300025961 Bacteria 3500
355 Ga0207668_10054702 3300025972 Bacteria 2771
356 Ga0207668_10224891 3300025972 Bacteria 1509
357 Ga0207658_10025492 3300025986 Bacteria 4141
358 Ga0207677_10254566 3300026023 Bacteria 1428
359 Ga0207703_10052950 3300026035 Bacteria 3298
360 Ga0207703_10250156 3300026035 Bacteria 1597
361 Ga0207678_10062549 3300026067 Bacteria 3199
362 Ga0207708_10123386 3300026075 Bacteria 2020
363 Ga0207702_10112622 3300026078 Bacteria 2422
364 Ga0207702_10249627 3300026078 Bacteria 1666
365 Ga0207641_10013507 3300026088 Bacteria 6698
366 Ga0207648_10000984 3300026089 Bacteria 32138
367 Ga0207648_10002321 3300026089 Bacteria 20531
368 Ga0207648_10002748 3300026089 Bacteria 18702
369 Ga0207648_10085045 3300026089 Bacteria 2759
370 Ga0207648_10124336 3300026089 Bacteria 2269
371 Ga0207676_10002345 3300026095 Bacteria 13538
372 Ga0207676_10059072 3300026095 Bacteria 3027
373 Ga0207674_10014643 3300026116 Bacteria 8650
374 Ga0207674_10017659 3300026116 Bacteria 7778
375 Ga0207674_10026083 3300026116 Bacteria 6217
376 Ga0207675_100015598 3300026118 Bacteria 7087
377 Ga0207675_100021807 3300026118 Bacteria 5963
378 Ga0207675_100514665 3300026118 Bacteria 1192
379 Ga0207683_10028651 3300026121 Bacteria 4817
380 Ga0207683_10279075 3300026121 Bacteria 1527
381 Ga0207683_10320388 3300026121 Bacteria 1420
382 Ga0209281_1000020 3300027111 Bacteria 575972
383 Ga0209389_1023254 3300027296 Bacteria 5470
384 Ga0209982_1000525 3300027552 Bacteria 4772
385 Ga0210002_1000631 3300027617 Bacteria 4778
386 Ga0209971_1003298 3300027682 Bacteria 3838
387 Ga0209974_10005216 3300027876 Bacteria 4585
388 Ga0207428_10019081 3300027907 Bacteria 5848
389 Ga0207428_10035182 3300027907 Bacteria 4096
390 Ga0268266_10012901 3300028379 Bacteria 7211
391 Ga0268266_10136602 3300028379 Bacteria 2197
392 Ga0268265_10001103 3300028380 Bacteria 23957
393 Ga0268265_10005116 3300028380 Bacteria 8979
394 Ga0268265_10008379 3300028380 Bacteria 6980
395 Ga0268264_10000030 3300028381 Bacteria 418542
396 Ga0265337_1000042 3300028556 Bacteria 56158
397 Ga0265337_1001439 3300028556 Bacteria 11715
398 Ga0265326_10021531 3300028558 Bacteria 1846
399 Ga0265319_1002798 3300028563 Bacteria 9365
400 Ga0265319_1002822 3300028563 Bacteria 9278
401 Ga0265334_10005637 3300028573 Bacteria 5466
402 Ga0265334_10058479 3300028573 Bacteria 1458
403 Ga0265318_10000962 3300028577 Bacteria 18486
404 Ga0265318_10028484 3300028577 Bacteria 2184
405 Ga0265323_10000992 3300028653 Bacteria 14760
406 Ga0265322_10005607 3300028654 Bacteria 3711
407 Ga0265336_10000003 3300028666 Bacteria 423158
408 Ga0265336_10000063 3300028666 Bacteria 98413
409 Ga0265336_10008217 3300028666 Bacteria 3672
410 Ga0307515_10000494 3300028794 Bacteria 94354
411 Ga0307515_10000658 3300028794 Bacteria 79766
412 Ga0307515_10000737 3300028794 Bacteria 75687
413 Ga0307515_10006133 3300028794 Bacteria 24177
414 Ga0307515_10039959 3300028794 Bacteria 7435
415 Ga0307515_10041913 3300028794 Bacteria 7181
416 Ga0307515_10066530 3300028794 Bacteria 4991
417 Ga0307515_10087967 3300028794 Bacteria 3934
418 Ga0307515_10132053 3300028794 Bacteria 2742
419 Ga0265338_10000154 3300028800 Bacteria 125708
420 Ga0265338_10004381 3300028800 Bacteria 19092
421 Ga0265338_10007488 3300028800 Bacteria 13527
422 Ga0265338_10010111 3300028800 Bacteria 11142
423 Ga0265324_10001160 3300029957 Bacteria 15689
424 Ga0265324_10001590 3300029957 Bacteria 12642
425 Ga0265324_10003293 3300029957 Bacteria 7760
426 Ga0265324_10040385 3300029957 Bacteria 1616
427 Ga0307511_10048394 3300030521 Bacteria 3459
428 Ga0265770_1004563 3300030878 Bacteria 1893
429 Ga0265332_10000083 3300031238 Bacteria 83040
430 Ga0265332_10000626 3300031238 Bacteria 23073
431 Ga0265332_10018655 3300031238 Bacteria 3061
432 Ga0265332_10042179 3300031238 Bacteria 1973
433 Ga0265332_10057278 3300031238 Bacteria 1669
434 Ga0265320_10017209 3300031240 Bacteria 4022
435 Ga0265320_10042687 3300031240 Bacteria 2248
436 Ga0265325_10000929 3300031241 Bacteria 21157
437 Ga0265325_10002402 3300031241 Bacteria 12664
438 Ga0265325_10103867 3300031241 Bacteria 1388
439 Ga0265340_10005079 3300031247 Bacteria 7317
440 Ga0265340_10005895 3300031247 Bacteria 6775
441 Ga0265340_10040161 3300031247 Bacteria 2306
442 Ga0265340_10050275 3300031247 Bacteria 2022
443 Ga0265339_10001335 3300031249 Bacteria 18436
444 Ga0265339_10017132 3300031249 Bacteria 4297
445 Ga0265339_10031160 3300031249 Bacteria 3015
446 Ga0265331_10134556 3300031250 Bacteria 1126
447 Ga0265327_10001037 3300031251 Bacteria 39182
448 Ga0265327_10001335 3300031251 Bacteria 31984
449 Ga0265316_10021381 3300031344 Bacteria 5480
450 Ga0265316_10032233 3300031344 Bacteria 4277
451 Ga0307513_10000006 3300031456 Bacteria 470848
452 Ga0307513_10010205 3300031456 Bacteria 11805
453 Ga0307513_10010252 3300031456 Bacteria 11765
454 Ga0307513_10032606 3300031456 Bacteria 5871
455 Ga0307513_10070175 3300031456 Bacteria 3663
456 Ga0307509_10207183 3300031507 Bacteria 1790
457 Ga0307408_100000029 3300031548 Bacteria 227806
458 Ga0307408_100007410 3300031548 Bacteria 7256
459 Ga0307408_100498244 3300031548 Bacteria 1066
460 Ga0265313_10000779 3300031595 Bacteria 32214
461 Ga0265313_10001164 3300031595 Bacteria 25145
462 Ga0265313_10024584 3300031595 Bacteria 3214
463 Ga0265313_10067376 3300031595 Bacteria 1656
464 Ga0307508_10000282 3300031616 Bacteria 62510
465 Ga0307508_10189174 3300031616 Bacteria 1660
466 Ga0307514_10000408 3300031649 Bacteria 95961
467 Ga0307514_10001033 3300031649 Bacteria 40119
468 Ga0316579_10004261 3300031691 Bacteria 5666
469 Ga0265314_10002116 3300031711 Bacteria 20849
470 Ga0265314_10008410 3300031711 Bacteria 8846
471 Ga0265314_10015177 3300031711 Bacteria 6122
472 Ga0265314_10096259 3300031711 Bacteria 1915
473 Ga0265342_10005960 3300031712 Bacteria 9171
474 Ga0265342_10040268 3300031712 Bacteria 2835
475 Ga0316576_10004360 3300031727 Bacteria 8474
476 Ga0316576_10093532 3300031727 Bacteria 2241
477 Ga0316576_10142533 3300031727 Bacteria 1804
478 Ga0316576_10146759 3300031727 Bacteria 1777
479 Ga0316576_10147348 3300031727 Bacteria 1773
480 Ga0316578_10011530 3300031728 Bacteria 4630
481 Ga0316578_10089391 3300031728 Bacteria 1838
482 Ga0316578_10106884 3300031728 Bacteria 1680
483 Ga0307516_10008117 3300031730 Bacteria 11929
484 Ga0307516_10190035 3300031730 Bacteria 1780
485 Ga0307405_10001234 3300031731 Bacteria 10638
486 Ga0307405_10020308 3300031731 Bacteria 3709
487 Ga0316577_10100242 3300031733 Bacteria 1623
488 Ga0307413_10119822 3300031824 Bacteria 1780
489 Ga0307410_10045742 3300031852 Bacteria 2916
490 Ga0307410_10137867 3300031852 Bacteria 1801
491 Ga0307410_10172071 3300031852 Bacteria 1633
492 Ga0307406_10181751 3300031901 Bacteria 1532
493 Ga0307406_10192770 3300031901 Bacteria 1493
494 Ga0307406_10256893 3300031901 Bacteria 1319
495 Ga0307407_10017891 3300031903 Bacteria 3570
496 Ga0307407_10090797 3300031903 Bacteria 1872
497 Ga0307412_10000857 3300031911 Bacteria 17500
498 Ga0307412_10004520 3300031911 Bacteria 7750
499 Ga0307412_10036277 3300031911 Bacteria 3157
500 Ga0307409_100005343 3300031995 Bacteria 7374
501 Ga0307416_100005644 3300032002 Bacteria 7724
502 Ga0307416_100067494 3300032002 Bacteria 2950
503 Ga0307414_10028494 3300032004 Bacteria 3624
504 Ga0307414_10071457 3300032004 Bacteria 2503
505 Ga0307411_10000218 3300032005 Bacteria 18566
506 Ga0307411_10003401 3300032005 Bacteria 7374
507 Ga0307411_10230273 3300032005 Bacteria 1444
508 Ga0316580_10008604 3300032139 Bacteria 3060
509 Ga0316593_10003817 3300032168 Bacteria 3789
510 Ga0307507_10052214 3300033179 Bacteria 3922
511 Ga0373948_0000494 3300034817 Bacteria 4917
512 Ga0373948_0007373 3300034817 Bacteria 1848
513 Ga0373950_0003278 3300034818 Bacteria 2301
514 Ga0373958_0017674 3300034819 Bacteria 1285
515 Ga0373959_0002211 3300034820 Bacteria 3101
516 Ga0373928_0008496 3300035084 Bacteria 1994
517 Ga0373934_0001020 3300035086 Bacteria 10119
518 Ga0373934_0003290 3300035086 Bacteria 5912
519 Ga0373934_0011045 3300035086 Bacteria 3397
520 Ga0373934_0078727 3300035086 Bacteria 1323
521 Ga0373940_0010606 3300035088 Bacteria 2171
522 Ga0373951_0015605 3300035091 Bacteria 1712
523 Ga0373923_0002059 3300035111 Bacteria 6070
524 Ga0373923_0007720 3300035111 Bacteria 3799
525 Ga0373936_0022611 3300035113 Bacteria 2448
526 Ga0373939_0000469 3300035114 Bacteria 10203
527 Ga0373953_0000026 3300035117 Bacteria 40030
528 Ga0373953_0000542 3300035117 Bacteria 10471
529 Ga0373953_0008838 3300035117 Bacteria 3437
530 Ga0373954_0000323 3300035118 Bacteria 17518
531 Ga0373954_0000865 3300035118 Bacteria 11751
532 Ga0373954_0026368 3300035118 Bacteria 2664
533 Ga0373956_0000442 3300035119 Bacteria 16877
534 Ga0373956_0081153 3300035119 Bacteria 1488
535 Ga0373957_0000038 3300035120 Bacteria 34200
536 Ga0373960_0002150 3300035121 Bacteria 4439
537 Ga0373943_0146870 3300035170 Bacteria 1275
538 Ga0373955_0000231 3300035172 Bacteria 23261
539 Ga0373955_0006619 3300035172 Bacteria 5286
540 Ga0373955_0104747 3300035172 Bacteria 1628
541 Ga0373961_0004472 3300035241 Bacteria 3379
542 Ga0373962_0001611 3300035242 Bacteria 5354
543 Ga0373962_0006157 3300035242 Bacteria 2900
544 Ga0316574_0019069 3300035398 Bacteria 4043
545 Ga0316574_0028981 3300035398 Bacteria 3342
546 Ga0316574_0069336 3300035398 Bacteria 2225
547 Ga0316574_0128007 3300035398 Bacteria 1633
548 Ga0373924_0003392 3300035410 Bacteria 5475
549 Ga0373924_0037134 3300035410 Bacteria 1982
550 Ga0373931_0000097 3300035691 Bacteria 40104
551 Ga0373931_0018319 3300035691 Bacteria 3481
552 Ga0373927_0010672 3300035695 Bacteria 6119
553 Ga0373927_0026821 3300035695 Bacteria 3764
554 Ga0373927_0060355 3300035695 Bacteria 2453
555 Ga0373933_0000604 3300035724 Bacteria 22424
556 Ga0373933_0000839 3300035724 Bacteria 18804
557 Ga0373933_0001324 3300035724 Bacteria 14581
558 Ga0373947_0024761 3300035725 Bacteria 3500
559 Ga0373947_0033853 3300035725 Bacteria 3019
560 Ga0373937_0000138 3300036401 Bacteria 70068
561 Ga0373937_0007329 3300036401 Bacteria 9549
562 Ga0373937_0014264 3300036401 Bacteria 7013
563 Ga0373937_0031919 3300036401 Bacteria 4774
564 Ga0373937_0088464 3300036401 Bacteria 2867
565 Ga0373937_0117828 3300036401 Bacteria 2473
566 Ga0373937_0154145 3300036401 Bacteria 2153
567 Ga0373937_0185616 3300036401 Bacteria 1953
568 Ga0316582_0000235 3300036647 Bacteria 18349
569 Ga0316584_0120326 3300036712 Bacteria 1962
570 Ga0373925_0026089 3300037068 Bacteria 4273
571 Ga0373925_0056446 3300037068 Bacteria 2941
572 Ga0373925_0077084 3300037068 Bacteria 2529
573 Ga0395899_0001283 3300037312 Bacteria 21775
574 Ga0395899_0011366 3300037312 Bacteria 6820
575 Ga0395900_0026724 3300037418 Bacteria 5909
576 Ga0395900_0032994 3300037418 Bacteria 5328
577 Ga0395900_0036907 3300037418 Bacteria 5037
578 Ga0395900_0045778 3300037418 Bacteria 4506
579 Ga0395898_0037745 3300037466 Bacteria 4790
580 Ga0395905_0000043 3300037471 Bacteria 247469
581 Ga0395905_0000138 3300037471 Bacteria 120373
582 Ga0395905_0006240 3300037471 Bacteria 12037
583 Ga0395905_0010810 3300037471 Bacteria 8844
584 Ga0395905_0026512 3300037471 Bacteria 5463
585 Ga0395905_0031618 3300037471 Bacteria 4982
586 Ga0395905_0038385 3300037471 Bacteria 4494
587 Ga0395905_0078767 3300037471 Bacteria 3088
588 Ga0395905_0095477 3300037471 Bacteria 2790
589 Ga0395905_0113073 3300037471 Bacteria 2550
590 Ga0436364_0992730 3300037853 Bacteria 2498
591 Ga0395901_0030455 3300038443 Bacteria 5558
592 Ga0395901_0071636 3300038443 Bacteria 3612
593 Ga0395901_0075467 3300038443 Bacteria 3516
594 Ga0395901_0124818 3300038443 Bacteria 2705
595 Ga0400490_31337 3300038726 Bacteria 30266
596 Ga0400490_35285 3300038726 Bacteria 7917
597 Ga0400490_43931 3300038726 Bacteria 87826
598 Ga0400491_04736 3300038727 Bacteria 1583
599 Ga0400491_06486 3300038727 Bacteria 8429
600 Ga0400485_10823 3300038735 Bacteria 11344
601 Ga0400488_05117 3300038741 Bacteria 3021
602 Ga0400488_14976 3300038741 Bacteria 5186
603 Ga0400488_34208 3300038741 Bacteria 12154
604 Ga0400488_40259 3300038741 Bacteria 2428
605 Ga0400486_17406 3300038742 Bacteria 1113
606 Ga0400483_018531 3300039062 Bacteria 58611
607 Ga0400483_035654 3300039062 Bacteria 2437
608 Ga0400483_046831 3300039062 Bacteria 362835
609 Ga0400483_115198 3300039062 Bacteria 2538
610 Ga0400483_215880 3300039062 Bacteria 4205
611 Ga0400483_219255 3300039062 Bacteria 53229
612 Ga0400483_237740 3300039062 Bacteria 3849
613 Ga0400483_269750 3300039062 Bacteria 5135
614 Ga0400483_278860 3300039062 Bacteria 3563
615 Ga0400483_280629 3300039062 Bacteria 8137
616 Ga0400489_33603 3300039093 Bacteria 1835
617 Ga0400487_27682 3300039110 Bacteria 2713
618 Ga0400487_34028 3300039110 Bacteria 26819
619 Ga0400487_41767 3300039110 Bacteria 1384
620 Ga0400487_42799 3300039110 Bacteria 62577
621 Ga0436365_0523972 3300039437 Bacteria 7205
622 Ga0436365_0817445 3300039437 Bacteria 1232
623 Ga0436365_0921695 3300039437 Bacteria 3085
624 Ga0436365_1486157 3300039437 Bacteria 6072
625 Ga0436361_0178809 3300039447 Bacteria 8427
626 Ga0436361_0193139 3300039447 Bacteria 16854
627 Ga0436361_0455065 3300039447 Bacteria 73475
628 Ga0436363_0030776 3300039450 Bacteria 2581
629 Ga0436363_1481785 3300039450 Bacteria 1154
630 Ga0436362_0198186 3300039453 Bacteria 3385
631 Ga0439465_0095430 3300041413 Bacteria 1022
632 Ga0451843_1214629 3300041509 Bacteria 1044
633 Ga0439431_0004185 3300041997 Bacteria 3164
634 Ga0439433_0026479 3300041999 Bacteria 1312
635 Ga0439449_0060268 3300042007 Bacteria 1400
636 Ga0450891_001745 3300042129 Bacteria 2235
637 Ga0450892_001022 3300042130 Bacteria 2960
638 Ga0439459_0001486 3300042438 Bacteria 3464
639 Ga0451577_0000235 3300042876 Bacteria 109693
640 Ga0451577_0015823 3300042876 Bacteria 6999
641 Ga0451577_0302917 3300042876 Bacteria 1448
642 Ga0451577_0333803 3300042876 Bacteria 1375
643 Ga0466969_0011838 3300044656 Bacteria 4613
644 Ga0453683_0011905 3300044673 Bacteria 5719
645 Ga0466966_0035156 3300044684 Bacteria 3239
646 Ga0466961_0012926 3300044693 Bacteria 5339
647 Ga0453684_0000583 3300044712 Bacteria 135940
648 Ga0453684_0000906 3300044712 Bacteria 98768
649 Ga0453684_0140562 3300044712 Bacteria 2883
650 Ga0453684_0591900 3300044712 Bacteria 1217
651 Ga0466957_0160086 3300044842 Bacteria 1462
652 Ga0466959_0175644 3300045049 Bacteria 1501
653 Ga0451576_0000137 3300045051 Bacteria 185212
654 Ga0451576_0015435 3300045051 Bacteria 8461
655 Ga0451576_0039548 3300045051 Bacteria 4992
656 Ga0451576_0050999 3300045051 Bacteria 4339
657 Ga0495592_0000041 3300046454 Bacteria 123431
658 Ga0495592_0002287 3300046454 Bacteria 13506
659 Ga0495603_0027174 3300046455 Bacteria 3454
660 Ga0495590_0093275 3300046457 Unclassified 1066
661 Ga0495629_0013834 3300046459 Bacteria 5822
662 Ga0495629_0014811 3300046459 Bacteria 5608
663 Ga0495629_0067077 3300046459 Bacteria 2504
664 Ga0495638_0000710 3300046460 Bacteria 35874
665 Ga0495641_0022013 3300046461 Bacteria 3197
666 Ga0495651_0000018 3300046462 Bacteria 123195
667 Ga0495651_0003600 3300046462 Bacteria 11877
668 Ga0495651_0021971 3300046462 Bacteria 4962
669 Ga0495651_0085282 3300046462 Bacteria 2378
670 Ga0495653_0014349 3300046463 Bacteria 6463
671 Ga0495653_0019823 3300046463 Bacteria 5452
672 Ga0495653_0037741 3300046463 Bacteria 3793
673 Ga0495653_0068638 3300046463 Bacteria 2658
674 Ga0495650_0001834 3300046471 Bacteria 19019
675 Ga0495650_0013002 3300046471 Bacteria 4438
676 Ga0495650_0047442 3300046471 Bacteria 1796
677 Ga0495580_0012366 3300046472 Bacteria 6548
678 Ga0495580_0112906 3300046472 Bacteria 1887
679 Ga0495582_0003548 3300046473 Bacteria 8792
680 Ga0495605_0006813 3300046474 Bacteria 6527
681 Ga0495639_0009195 3300046475 Bacteria 4234
682 Ga0495639_0100548 3300046475 Bacteria 1365
683 Ga0495662_0042130 3300046476 Bacteria 2203
684 Ga0495664_0052111 3300046477 Bacteria 2430
685 Ga0495664_0064262 3300046477 Bacteria 2187
686 Ga0495596_0119890 3300046500 Bacteria 1021
687 Ga0495583_0003737 3300046506 Bacteria 11319
688 Ga0495606_0008456 3300046507 Bacteria 8935
689 Ga0495606_0127099 3300046507 Unclassified 1519
690 Ga0495608_0000039 3300046511 Bacteria 123195
691 Ga0495608_0012184 3300046511 Bacteria 5975
692 Ga0495608_0018525 3300046511 Bacteria 4800
693 Ga0495608_0034635 3300046511 Bacteria 3408
694 Ga0495618_0014687 3300046514 Bacteria 4775
695 Ga0495618_0049428 3300046514 Bacteria 2655
696 Ga0495628_0000219 3300046516 Bacteria 50121
697 Ga0495628_0004882 3300046516 Bacteria 11805
698 Ga0495630_0011003 3300046517 Bacteria 6541
699 Ga0495630_0011057 3300046517 Bacteria 6529
700 Ga0495630_0171798 3300046517 Bacteria 1651
701 Ga0495648_0001735 3300046524 Bacteria 21077
702 Ga0495648_0009710 3300046524 Bacteria 7413
703 Ga0495666_0038237 3300046526 Bacteria 2334
704 Ga0495642_0005224 3300046528 Bacteria 4994
705 Ga0495652_0000092 3300046529 Bacteria 96258
706 Ga0495652_0013473 3300046529 Bacteria 7360
707 Ga0495652_0039030 3300046529 Bacteria 4107
708 Ga0495654_0012961 3300046530 Bacteria 4469
709 Ga0495665_0013248 3300046531 Bacteria 4459
710 Ga0495587_0000034 3300046536 Bacteria 123432
711 Ga0495587_0021836 3300046536 Bacteria 3948
712 Ga0495587_0070409 3300046536 Bacteria 2035
713 Ga0495587_0118048 3300046536 Bacteria 1520
714 Ga0495597_0001231 3300046542 Bacteria 19066
715 Ga0495597_0003270 3300046542 Bacteria 9606
716 Ga0495645_0015569 3300046543 Bacteria 5410
717 Ga0495645_0024809 3300046543 Bacteria 4349
718 Ga0495645_0034491 3300046543 Bacteria 3691
719 Ga0495667_0002416 3300046559 Bacteria 12473
720 Ga0495667_0002599 3300046559 Bacteria 12052
721 Ga0495667_0036966 3300046559 Bacteria 3256
722 Ga0495667_0107748 3300046559 Bacteria 1800
723 Ga0495668_0000018 3300046616 Bacteria 417480
724 Ga0495668_0057580 3300046616 Bacteria 2144
725 Ga0495634_0008151 3300046642 Bacteria 7806
726 Ga0495634_0020326 3300046642 Bacteria 4710
727 Ga0495634_0030347 3300046642 Bacteria 3734
728 Ga0495634_0034901 3300046642 Bacteria 3448
729 Ga0495625_0002034 3300046660 Bacteria 22774
730 Ga0495635_0006348 3300046663 Bacteria 8242
731 Ga0495635_0008259 3300046663 Bacteria 7267
732 Ga0495635_0171464 3300046663 Bacteria 1475
733 Ga0495661_0058809 3300046665 Bacteria 2290
734 Ga0495657_0013370 3300046675 Bacteria 6060
735 Ga0495657_0033050 3300046675 Bacteria 3605
736 Ga0495657_0075109 3300046675 Bacteria 2197
737 Ga0495599_0000108 3300046678 Bacteria 56078
738 Ga0495599_0004863 3300046678 Bacteria 7993
739 Ga0495599_0008955 3300046678 Bacteria 6096
740 Ga0495599_0013304 3300046678 Bacteria 5086
741 Ga0495599_0023534 3300046678 Bacteria 3851
742 Ga0495623_0000287 3300046679 Bacteria 32946
743 Ga0495623_0002882 3300046679 Bacteria 11335
744 Ga0495623_0014003 3300046679 Bacteria 5197
745 Ga0495623_0015327 3300046679 Bacteria 4954
746 Ga0495646_0015716 3300046680 Bacteria 4804
747 Ga0495646_0016018 3300046680 Bacteria 4757
748 Ga0495646_0040810 3300046680 Bacteria 2855
749 Ga0495647_0014431 3300046681 Bacteria 2752
750 Ga0495658_0009052 3300046683 Bacteria 4950
751 Ga0495613_0000380 3300046689 Bacteria 38251
752 Ga0495613_0015491 3300046689 Bacteria 5669
753 Ga0495613_0276241 3300046689 Bacteria 1167
754 Ga0495624_0014434 3300046690 Bacteria 5359
755 Ga0495624_0105690 3300046690 Bacteria 1732
756 Ga0495670_0000076 3300046691 Bacteria 43635
757 Ga0495649_0010900 3300046694 Bacteria 5354
758 Ga0495600_0018788 3300046809 Bacteria 4409
759 Ga0495600_0096933 3300046809 Bacteria 1922
760 Ga0495600_0100038 3300046809 Bacteria 1890
761 Ga0495600_0123427 3300046809 Bacteria 1684
762 Ga0495581_0007236 3300047315 Bacteria 6420
763 Ga0495581_0032115 3300047315 Bacteria 3040
764 Ga0495604_0000039 3300047317 Bacteria 123431
765 Ga0495604_0000893 3300047317 Bacteria 24849
766 Ga0495604_0007655 3300047317 Bacteria 8553
767 Ga0495604_0024846 3300047317 Bacteria 4778
768 Ga0495604_0055840 3300047317 Bacteria 3042
769 Ga0495604_0063469 3300047317 Bacteria 2817
770 Ga0495604_0136822 3300047317 Bacteria 1754
771 Ga0495674_0042962 3300047319 Bacteria 4027
772 Ga0495674_0065760 3300047319 Bacteria 3148
773 Ga0495674_0092293 3300047319 Bacteria 2585
774 Ga0495674_0162704 3300047319 Bacteria 1866
775 Ga0495674_0176440 3300047319 Bacteria 1780
776 Ga0495672_0053599 3300047320 Bacteria 2362
777 Ga0495672_0068131 3300047320 Bacteria 2024
778 Ga0495676_0064879 3300047321 Bacteria 2837
779 Ga0495676_0067632 3300047321 Bacteria 2763
780 Ga0495680_0000028 3300047322 Bacteria 112865
781 Ga0495680_0006442 3300047322 Bacteria 10909
782 Ga0495680_0008757 3300047322 Bacteria 9166
783 Ga0495680_0018186 3300047322 Bacteria 5976
784 Ga0495680_0019445 3300047322 Bacteria 5732
785 Ga0495680_0029149 3300047322 Bacteria 4522
786 Ga0495680_0096509 3300047322 Bacteria 2207
787 Ga0495680_0160993 3300047322 Unclassified 1630
788 Ga0495683_0003543 3300047323 Bacteria 9076
789 Ga0495683_0004867 3300047323 Bacteria 7521
790 Ga0495675_0000355 3300047444 Bacteria 32066
791 Ga0495675_0003845 3300047444 Bacteria 9091
792 Ga0495675_0013496 3300047444 Bacteria 5158
793 Ga0495675_0041332 3300047444 Plasmid 2939
794 Ga0495675_0102863 3300047444 Bacteria 1786
795 Ga0495675_0138468 3300047444 Bacteria 1510
796 Ga0495673_0013392 3300047469 Plasmid 4310
797 Ga0495684_0039388 3300047471 Bacteria 3622
798 Ga0495684_0069496 3300047471 Bacteria 2678
799 Ga0495686_0003011 3300047472 Bacteria 14965
800 Ga0495686_0065500 3300047472 Bacteria 2246
801 Ga0495686_0192075 3300047472 Unclassified 1176
802 Ga0495593_0007376 3300047673 Bacteria 6441
803 Ga0495593_0010087 3300047673 Bacteria 5467
804 Ga0495593_0010226 3300047673 Bacteria 5426
805 Ga0495602_0000043 3300048088 Bacteria 123431
806 Ga0495602_0001190 3300048088 Bacteria 25555
807 Ga0495602_0014212 3300048088 Bacteria 8090
808 Ga0495602_0047037 3300048088 Bacteria 3891
809 Ga0495602_0065072 3300048088 Bacteria 3148
810 Ga0495602_0077837 3300048088 Bacteria 2803
811 Ga0495602_0084968 3300048088 Bacteria 2646
812 Ga0496100_0063051 3300048903 Bacteria 2448
813 Ga0496101_0012928 3300048904 Bacteria 5583
814 Ga0496101_0048231 3300048904 Bacteria 3060
815 Ga0496102_0002985 3300048905 Bacteria 14321
816 Ga0496102_0125396 3300048905 Bacteria 2400
817 Ga0496103_0002185 3300048906 Bacteria 12428
818 Ga0496104_0079087 3300048907 Bacteria 3134
819 Ga0496104_0087093 3300048907 Bacteria 2982
820 Ga0496104_0197721 3300048907 Bacteria 1922
821 Ga0496104_0454717 3300048907 Bacteria 1192
822 Ga0496105_0000572 3300048908 Bacteria 24357
823 Ga0496105_0085406 3300048908 Bacteria 2607
824 Ga0496105_0112640 3300048908 Bacteria 2245
825 Ga0496105_0194455 3300048908 Bacteria 1657
826 Ga0496107_0307824 3300048910 Bacteria 1179
827 Ga0496108_0038970 3300048911 Bacteria 3961
828 Ga0496109_0020379 3300048912 Bacteria 5857
829 Ga0496109_0061236 3300048912 Bacteria 3440
830 Ga0496110_0007760 3300048913 Bacteria 8593
831 Ga0496110_0038516 3300048913 Bacteria 4161
832 Ga0496111_0000082 3300048914 Bacteria 39683
833 Ga0496114_0020996 3300048917 Bacteria 5305
834 Ga0496114_0141306 3300048917 Bacteria 2085
835 Ga0496115_0060886 3300048918 Bacteria 3042
836 Ga0496116_0039687 3300048919 Bacteria 3251
837 Ga0496118_0014666 3300048921 Bacteria 7324
838 Ga0496119_0000213 3300048922 Bacteria 82822
839 Ga0496119_0138711 3300048922 Bacteria 1316
840 Ga0496121_0000089 3300048924 Bacteria 219007
841 Ga0496121_0001529 3300048924 Bacteria 38730
842 Ga0496121_0010277 3300048924 Bacteria 10589
843 Ga0496121_0030039 3300048924 Bacteria 5002
844 Ga0496121_0127710 3300048924 Bacteria 1909
845 Ga0496124_0000919 3300048927 Bacteria 47561
846 Ga0496124_0003747 3300048927 Bacteria 18315
847 Ga0496125_0027360 3300048928 Bacteria 5171
848 Ga0496125_0030798 3300048928 Bacteria 4792
849 Ga0496125_0030887 3300048928 Bacteria 4784
850 Ga0496126_0001434 3300048929 Bacteria 37437
851 Ga0496126_0062889 3300048929 Bacteria 3328
852 Ga0496126_0080106 3300048929 Bacteria 2890
853 Ga0496126_0158743 3300048929 Bacteria 1933
854 Ga0496126_0464343 3300048929 Bacteria 1017
855 Ga0495678_018911 3300049459 Bacteria 3086
856 Ga0501031_0001824 3300049568 Bacteria 13399
857 Ga0501031_0002425 3300049568 Bacteria 11861
858 Ga0501031_0017107 3300049568 Bacteria 4710
859 Ga0501033_0008619 3300049570 Bacteria 7892
860 Ga0501034_0020044 3300049571 Bacteria 6830
861 Ga0501034_0030987 3300049571 Bacteria 5435
862 Ga0501034_0046424 3300049571 Bacteria 4389
863 Ga0501034_0111063 3300049571 Bacteria 2732
864 Ga0501034_0164347 3300049571 Bacteria 2189
865 Ga0501036_0005963 3300049572 Bacteria 9878
866 Ga0501036_0055476 3300049572 Bacteria 3357
867 Ga0501037_0013273 3300049573 Bacteria 6070
868 Ga0501037_0017406 3300049573 Bacteria 5292
869 Ga0501038_0065221 3300049574 Bacteria 3103
870 Ga0501039_0072770 3300049575 Bacteria 2671
871 Ga0501040_0031012 3300049576 Bacteria 3613
872 Ga0501041_0032257 3300049577 Bacteria 3166
873 Ga0501043_0011565 3300049579 Bacteria 6905
874 Ga0501043_0099256 3300049579 Bacteria 2289
875 Ga0501046_0048422 3300049580 Bacteria 3365
876 Ga0501046_0116743 3300049580 Bacteria 2034
877 Ga0501047_0005052 3300049581 Bacteria 12383
878 Ga0501047_0139777 3300049581 Bacteria 2301
879 Ga0501067_0022409 3300049583 Bacteria 3496
880 Ga0501069_0086023 3300049585 Bacteria 1775
881 Ga0501071_0092472 3300049587 Bacteria 2223
882 Ga0501072_0047097 3300049588 Bacteria 3395
883 Ga0501076_0325269 3300049592 Bacteria 1261
884 Ga0501198_000037 3300049649 Bacteria 52054
885 Ga0501222_000032 3300049662 Bacteria 55723
886 Ga0501223_023254 3300049663 Bacteria 1209
887 Ga0501224_000329 3300049664 Bacteria 5555
888 Ga0501229_005806 3300049706 Bacteria 1520
889 Ga0501079_0142818 3300049741 Bacteria 1865
890 Ga0501267_002028 3300049764 Bacteria 1788
891 Ga0501282_000048 3300049778 Bacteria 15453
892 Ga0501035_0002048 3300049822 Bacteria 20096
893 Ga0501035_0038030 3300049822 Bacteria 4357
894 Ga0501044_0000515 3300049823 Bacteria 47051
895 Ga0501044_0007899 3300049823 Bacteria 11699
896 Ga0501044_0202965 3300049823 Bacteria 1940
897 Ga0501045_0014064 3300049824 Bacteria 5665
898 nmdc:mga03683_64086_c1 3300050489 Bacteria 1559
899 nmdc:mga03n38_23268_c1 3300050490 Bacteria 2518
900 nmdc:mga00v17_19064_c1 3300050491 Bacteria 3910
901 nmdc:mga00v17_5502_c1 3300050491 Bacteria 6672
902 nmdc:mga0yw44_169796_c1 3300050492 Bacteria 1432
903 nmdc:mga0k408_104155_c1 3300050493 Bacteria 1674
904 nmdc:mga0k408_221_c1 3300050493 Bacteria 30239
905 nmdc:mga0k408_44082_c1 3300050493 Bacteria 2572
906 nmdc:mga0k408_56008_c1 3300050493 Bacteria 2287
907 nmdc:mga0k408_84793_c1 3300050493 Bacteria 1859
908 nmdc:mga07m45_37757_c1 3300050496 Bacteria 2694
909 nmdc:mga07m45_53549_c1 3300050496 Bacteria 2280
910 nmdc:mga05p37_172666_c1 3300050507 Bacteria 2636
911 nmdc:mga05p37_176319_c1 3300050507 Bacteria 2604
912 nmdc:mga05p37_195_c1 3300050507 Bacteria 60494
913 nmdc:mga05p37_319547_c1 3300050507 Bacteria 1838
914 nmdc:mga09592_15523_c1 3300050508 Bacteria 6226
915 nmdc:mga09592_31262_c1 3300050508 Bacteria 4435
916 nmdc:mga09592_31543_c1 3300050508 Bacteria 4416
917 nmdc:mga09592_75950_c1 3300050508 Bacteria 2857
918 nmdc:mga0qj67_145461_c1 3300050509 Bacteria 1922
919 nmdc:mga0qj67_18502_c1 3300050509 Bacteria 5310
920 nmdc:mga0qj67_6146_c1 3300050509 Bacteria 8805
921 nmdc:mga0qj67_748_c1 3300050509 Bacteria 22059
922 nmdc:mga06r32_149437_c1 3300050510 Bacteria 2314
923 nmdc:mga06r32_157235_c1 3300050510 Bacteria 2255
924 nmdc:mga06r32_16238_c1 3300050510 Bacteria 6781
925 nmdc:mga06r32_290840_c1 3300050510 Bacteria 1621
926 nmdc:mga06r32_50376_c1 3300050510 Bacteria 3984
927 nmdc:mga06r32_679_c1 3300050510 Bacteria 29614
928 nmdc:mga08y16_143407_c1 3300050511 Bacteria 2483
929 nmdc:mga08y16_146914_c1 3300050511 Bacteria 2451
930 nmdc:mga08y16_153193_c1 3300050511 Bacteria 2396
931 nmdc:mga08y16_192423_c1 3300050511 Bacteria 2115
932 nmdc:mga0n895_103219_c1 3300050512 Bacteria 2863
933 nmdc:mga0rr50_62340_c1 3300050513 Bacteria 2813
934 nmdc:mga08x19_165786_c1 3300050514 Bacteria 1502
935 nmdc:mga08x19_23217_c1 3300050514 Bacteria 3847
936 nmdc:mga0a205_12356_c1 3300050515 Bacteria 7898
937 nmdc:mga0sz30_11794_c1 3300050516 Bacteria 3385
938 Ga0495601_0126239 3300053077 Bacteria 1664
939 Ga0495601_0142219 3300053077 Bacteria 1565
940 Ga0495619_0010048 3300053085 Bacteria 5957
941 Ga0495619_0275864 3300053085 Bacteria 1165
942 Ga0500643_000295 3300053087 Bacteria 42617
943 Ga0500647_0007202 3300053091 Bacteria 4758
944 Ga0500566_0138516 3300053094 Bacteria 1294
945 Ga0500641_0005553 3300053096 Bacteria 4467
946 Ga0500593_000250 3300053117 Bacteria 22072
947 Ga0500607_000006 3300053121 Bacteria 136863
948 Ga0500559_0000698 3300053136 Bacteria 22073
949 Ga0500559_0004182 3300053136 Bacteria 6923
950 Ga0500568_0011569 3300053139 Bacteria 4085
951 Ga0500616_0035401 3300053153 Bacteria 2715
952 Ga0500619_000038 3300053154 Bacteria 40615
953 Ga0500622_0000970 3300053156 Bacteria 24316
954 Ga0500622_0001376 3300053156 Bacteria 19604
955 Ga0500622_0002997 3300053156 Bacteria 11697
956 Ga0500622_0003799 3300053156 Bacteria 9831
957 Ga0500622_0006287 3300053156 Bacteria 6936
958 Ga0500636_0088542 3300053177 Bacteria 1775
959 Ga0500636_0099119 3300053177 Bacteria 1659
960 Ga0500637_0002011 3300053178 Bacteria 8870
961 Ga0500645_000215 3300053730 Bacteria 43997
962 Ga0500645_006747 3300053730 Bacteria 4067
963 Ga0500645_018935 3300053730 Bacteria 2145
964 Ga0501082_0076865 3300060353 Bacteria 2878

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031712 Ga0265342_10040268 Ga0265342_100402683 295
2 3300045051 Ga0451576_0039548 Ga0451576_0039548_2769_3722 295
3 3300005366 Ga0070659_100524304 Ga0070659_1005243041 296
4 3300006048 Ga0075363_100032392 Ga0075363_1000323922 297
5 3300006844 Ga0075428_100007195 Ga0075428_10000719512 297
6 3300006846 Ga0075430_100057367 Ga0075430_1000573672 297
7 3300006847 Ga0075431_100148829 Ga0075431_1001488293 297
8 3300009147 Ga0114129_10122874 Ga0114129_101228743 297
9 3300050507 nmdc:mga05p37_319547_c1 nmdc:mga05p37_319547_c1_320_1258 297
10 3300050508 nmdc:mga09592_31543_c1 nmdc:mga09592_31543_c1_1222_2160 297
11 3300038741 Ga0400488_40259 Ga0400488_40259_759_1691 299
12 3300046457 Ga0495590_0093275 Ga0495590_0093275_137_1042 301
13 3300049664 Ga0501224_000329 Ga0501224_000329_3421_4380 301
14 3300049778 Ga0501282_000048 Ga0501282_000048_13325_14284 301
15 3300006038 Ga0075365_10002903 Ga0075365_100029038 302
16 3300035111 Ga0373923_0007720 Ga0373923_0007720_458_1399 302
17 3300035724 Ga0373933_0001324 Ga0373933_0001324_7414_8355 302
18 3300036401 Ga0373937_0007329 Ga0373937_0007329_1034_1975 302
19 3300046454 Ga0495592_0002287 Ga0495592_0002287_4654_5595 302
20 3300046463 Ga0495653_0014349 Ga0495653_0014349_4489_5430 302
21 3300046511 Ga0495608_0018525 Ga0495608_0018525_2804_3745 302
22 3300046536 Ga0495587_0070409 Ga0495587_0070409_509_1450 302
23 3300046642 Ga0495634_0008151 Ga0495634_0008151_5387_6328 302
24 3300046663 Ga0495635_0006348 Ga0495635_0006348_683_1624 302
25 3300046809 Ga0495600_0018788 Ga0495600_0018788_665_1606 302
26 3300047317 Ga0495604_0024846 Ga0495604_0024846_2804_3745 302
27 3300047322 Ga0495680_0019445 Ga0495680_0019445_2116_3057 302
28 3300047444 Ga0495675_0003845 Ga0495675_0003845_1631_2572 302
29 3300053085 Ga0495619_0010048 Ga0495619_0010048_823_1764 302
30 3300005339 Ga0070660_100010451 Ga0070660_1000104517 303
31 3300005563 Ga0068855_100067050 Ga0068855_1000670504 303
32 3300006051 Ga0075364_10220909 Ga0075364_102209092 303
33 3300009093 Ga0105240_10125926 Ga0105240_101259262 303
34 3300025909 Ga0207705_10251711 Ga0207705_102517112 303
35 3300025924 Ga0207694_10341034 Ga0207694_103410342 303
36 3300025273 Ga0209673_1021109 Ga0209673_10211093 304
37 3300025298 Ga0209050_1005408 Ga0209050_10054085 304
38 3300025303 Ga0209051_1004454 Ga0209051_10044544 304
39 3300025304 Ga0209257_1004031 Ga0209257_100403111 304
40 3300005289 Ga0065704_10147643 Ga0065704_101476431 305
41 3300005937 Ga0081455_10014422 Ga0081455_100144229 305
42 3300009176 Ga0105242_10006667 Ga0105242_100066675 305
43 3300025934 Ga0207686_10004843 Ga0207686_100048436 305
44 3300025934 Ga0207686_10305411 Ga0207686_103054111 305
45 3300031238 Ga0265332_10000083 Ga0265332_100000839 305
46 3300048924 Ga0496121_0030039 Ga0496121_0030039_2530_3480 305
47 3300005338 Ga0068868_100090463 Ga0068868_1000904634 306
48 3300005436 Ga0070713_100000019 Ga0070713_10000001925 306
49 3300005614 Ga0068856_100035912 Ga0068856_1000359122 306
50 3300005983 Ga0081540_1024303 Ga0081540_10243034 306
51 3300006175 Ga0070712_100162399 Ga0070712_1001623992 306
52 3300006195 Ga0075366_10151950 Ga0075366_101519501 306
53 3300025917 Ga0207660_10261282 Ga0207660_102612822 306
54 3300025928 Ga0207700_10000035 Ga0207700_1000003554 306
55 3300026023 Ga0207677_10254566 Ga0207677_102545662 306
56 3300026078 Ga0207702_10112622 Ga0207702_101126222 306
57 3300028666 Ga0265336_10000003 Ga0265336_1000000341 306
58 3300029957 Ga0265324_10003293 Ga0265324_100032934 306
59 3300031456 Ga0307513_10000006 Ga0307513_10000006232 306
60 3300038443 Ga0395901_0124818 Ga0395901_0124818_198_1154 306
61 3300038742 Ga0400486_17406 Ga0400486_17406_85_1041 306
62 3300039447 Ga0436361_0193139 Ga0436361_0193139_603_1556 306
63 3300045051 Ga0451576_0050999 Ga0451576_0050999_776_1723 306
64 3300046542 Ga0495597_0001231 Ga0495597_0001231_1611_2570 306
65 3300048907 Ga0496104_0087093 Ga0496104_0087093_671_1624 306
66 3300048907 Ga0496104_0197721 Ga0496104_0197721_198_1151 306
67 3300048908 Ga0496105_0000572 Ga0496105_0000572_10316_11269 306
68 3300048908 Ga0496105_0112640 Ga0496105_0112640_605_1558 306
69 3300048918 Ga0496115_0060886 Ga0496115_0060886_603_1556 306
70 3300048922 Ga0496119_0000213 Ga0496119_0000213_61571_62524 306
71 3300003775 Ga0055524_1029023 Ga0055524_10290232 307
72 3300003794 Ga0055531_10008251 Ga0055531_100082514 307
73 3300005338 Ga0068868_100086716 Ga0068868_1000867162 307
74 3300005364 Ga0070673_100032621 Ga0070673_1000326213 307
75 3300005459 Ga0068867_100001878 Ga0068867_1000018784 307
76 3300005543 Ga0070672_100040583 Ga0070672_1000405834 307
77 3300005564 Ga0070664_100119385 Ga0070664_1001193853 307
78 3300005577 Ga0068857_100171775 Ga0068857_1001717752 307
79 3300005937 Ga0081455_10006640 Ga0081455_100066402 307
80 3300006942 Ga0099824_1039673 Ga0099824_10396731 307
81 3300006944 Ga0099823_1000138 Ga0099823_100013829 307
82 3300006946 Ga0079104_1000007 Ga0079104_10000072 307
83 3300021377 Ga0213874_10019036 Ga0213874_100190362 307
84 3300021384 Ga0213876_10045174 Ga0213876_100451742 307
85 3300025299 Ga0209256_1000840 Ga0209256_100084029 307
86 3300025893 Ga0207682_10044025 Ga0207682_100440251 307
87 3300025927 Ga0207687_10241108 Ga0207687_102411082 307
88 3300025927 Ga0207687_10334515 Ga0207687_103345151 307
89 3300025933 Ga0207706_10156774 Ga0207706_101567742 307
90 3300025935 Ga0207709_10000172 Ga0207709_1000017213 307
91 3300025940 Ga0207691_10006862 Ga0207691_100068624 307
92 3300025942 Ga0207689_10007180 Ga0207689_100071804 307
93 3300025945 Ga0207679_10427917 Ga0207679_104279171 307
94 3300026089 Ga0207648_10000984 Ga0207648_1000098422 307
95 3300026116 Ga0207674_10017659 Ga0207674_100176599 307
96 3300026121 Ga0207683_10028651 Ga0207683_100286514 307
97 3300027111 Ga0209281_1000020 Ga0209281_1000020495 307
98 3300027296 Ga0209389_1023254 Ga0209389_10232544 307
99 3300028794 Ga0307515_10000737 Ga0307515_1000073744 307
100 3300031251 Ga0265327_10001335 Ga0265327_1000133528 307
101 3300031456 Ga0307513_10010252 Ga0307513_100102524 307
102 3300031548 Ga0307408_100000029 Ga0307408_10000002981 307
103 3300031548 Ga0307408_100498244 Ga0307408_1004982441 307
104 3300031649 Ga0307514_10000408 Ga0307514_1000040825 307
105 3300038726 Ga0400490_31337 Ga0400490_31337_10250_11206 307
106 3300038726 Ga0400490_35285 Ga0400490_35285_6478_7434 307
107 3300038727 Ga0400491_06486 Ga0400491_06486_538_1494 307
108 3300038741 Ga0400488_05117 Ga0400488_05117_324_1280 307
109 3300039110 Ga0400487_41767 Ga0400487_41767_88_1044 307
110 3300039437 Ga0436365_0921695 Ga0436365_0921695_2057_3028 307
111 3300039450 Ga0436363_0030776 Ga0436363_0030776_716_1687 307
112 3300046475 Ga0495639_0100548 Ga0495639_0100548_47_997 307
113 3300046530 Ga0495654_0012961 Ga0495654_0012961_2022_2978 307
114 3300005434 Ga0070709_10000424 Ga0070709_1000042421 308
115 3300005437 Ga0070710_10021505 Ga0070710_100215053 308
116 3300005439 Ga0070711_100010642 Ga0070711_1000106422 308
117 3300005843 Ga0068860_100000101 Ga0068860_10000010163 308
118 3300006028 Ga0070717_10248702 Ga0070717_102487022 308
119 3300006173 Ga0070716_100109504 Ga0070716_1001095042 308
120 3300006195 Ga0075366_10006834 Ga0075366_100068344 308
121 3300006852 Ga0075433_10032292 Ga0075433_100322925 308
122 3300007076 Ga0075435_100018531 Ga0075435_1000185313 308
123 3300009101 Ga0105247_10184776 Ga0105247_101847762 308
124 3300009147 Ga0114129_10008622 Ga0114129_1000862214 308
125 3300009545 Ga0105237_10015974 Ga0105237_100159745 308
126 3300009545 Ga0105237_10430063 Ga0105237_104300632 308
127 3300010375 Ga0105239_10025714 Ga0105239_100257145 308
128 3300025898 Ga0207692_10000738 Ga0207692_1000073812 308
129 3300025906 Ga0207699_10000465 Ga0207699_100004651 308
130 3300025914 Ga0207671_10080063 Ga0207671_100800632 308
131 3300025915 Ga0207693_10003980 Ga0207693_100039808 308
132 3300025929 Ga0207664_10010239 Ga0207664_100102394 308
133 3300025939 Ga0207665_10035614 Ga0207665_100356142 308
134 3300026035 Ga0207703_10250156 Ga0207703_102501562 308
135 3300026121 Ga0207683_10279075 Ga0207683_102790751 308
136 3300028381 Ga0268264_10000030 Ga0268264_10000030167 308
137 3300028556 Ga0265337_1001439 Ga0265337_100143910 308
138 3300028563 Ga0265319_1002798 Ga0265319_10027983 308
139 3300028573 Ga0265334_10005637 Ga0265334_100056375 308
140 3300028653 Ga0265323_10000992 Ga0265323_100009929 308
141 3300028654 Ga0265322_10005607 Ga0265322_100056072 308
142 3300028666 Ga0265336_10000063 Ga0265336_1000006383 308
143 3300028800 Ga0265338_10000154 Ga0265338_1000015411 308
144 3300029957 Ga0265324_10001590 Ga0265324_100015905 308
145 3300031238 Ga0265332_10057278 Ga0265332_100572782 308
146 3300031241 Ga0265325_10002402 Ga0265325_100024022 308
147 3300031249 Ga0265339_10017132 Ga0265339_100171324 308
148 3300031595 Ga0265313_10067376 Ga0265313_100673761 308
149 3300031730 Ga0307516_10008117 Ga0307516_1000811711 308
150 3300031731 Ga0307405_10001234 Ga0307405_1000123411 308
151 3300031903 Ga0307407_10017891 Ga0307407_100178912 308
152 3300031911 Ga0307412_10004520 Ga0307412_100045203 308
153 3300031995 Ga0307409_100005343 Ga0307409_1000053435 308
154 3300032002 Ga0307416_100005644 Ga0307416_1000056445 308
155 3300032005 Ga0307411_10003401 Ga0307411_100034018 308
156 3300035086 Ga0373934_0078727 Ga0373934_0078727_185_1144 308
157 3300035117 Ga0373953_0000542 Ga0373953_0000542_2015_2974 308
158 3300035118 Ga0373954_0000323 Ga0373954_0000323_4228_5187 308
159 3300036401 Ga0373937_0154145 Ga0373937_0154145_379_1338 308
160 3300038741 Ga0400488_14976 Ga0400488_14976_1116_2078 308
161 3300039062 Ga0400483_215880 Ga0400483_215880_1000_1962 308
162 3300039110 Ga0400487_34028 Ga0400487_34028_17399_18358 308
163 3300039450 Ga0436363_1481785 Ga0436363_1481785_50_1009 308
164 3300044712 Ga0453684_0140562 Ga0453684_0140562_1707_2666 308
165 3300046459 Ga0495629_0013834 Ga0495629_0013834_627_1586 308
166 3300046678 Ga0495599_0004863 Ga0495599_0004863_6481_7440 308
167 3300048924 Ga0496121_0000089 Ga0496121_0000089_66841_67800 308
168 3300048927 Ga0496124_0003747 Ga0496124_0003747_442_1401 308
169 3300048928 Ga0496125_0030798 Ga0496125_0030798_1399_2370 308
170 3300053177 Ga0500636_0088542 Ga0500636_0088542_583_1542 308
171 3300021441 Ga0213871_10006411 Ga0213871_100064112 309
172 3300028794 Ga0307515_10066530 Ga0307515_100665303 309
173 3300031616 Ga0307508_10000282 Ga0307508_1000028235 309
174 3300032004 Ga0307414_10028494 Ga0307414_100284944 309
175 3300032005 Ga0307411_10000218 Ga0307411_100002189 309
176 3300037471 Ga0395905_0010810 Ga0395905_0010810_4273_5238 309
177 3300038741 Ga0400488_34208 Ga0400488_34208_3752_4708 309
178 3300049568 Ga0501031_0001824 Ga0501031_0001824_7576_8535 309
179 3300049663 Ga0501223_023254 Ga0501223_023254_213_1175 309
180 3300049706 Ga0501229_005806 Ga0501229_005806_273_1232 309
181 3300053096 Ga0500641_0005553 Ga0500641_0005553_1150_2079 309
182 iso_pu_bacteria 2643221598 2643999135 309
183 3300003203 JGI25406J46586_10051383 JGI25406J46586_100513831 310
184 3300005336 Ga0070680_100131673 Ga0070680_1001316731 310
185 3300005577 Ga0068857_100290543 Ga0068857_1002905432 310
186 3300005614 Ga0068856_100062674 Ga0068856_1000626742 310
187 3300005616 Ga0068852_100007943 Ga0068852_1000079439 310
188 3300005937 Ga0081455_10012116 Ga0081455_100121168 310
189 3300005983 Ga0081540_1028089 Ga0081540_10280892 310
190 3300005985 Ga0081539_10000220 Ga0081539_1000022014 310
191 3300005985 Ga0081539_10031999 Ga0081539_100319994 310
192 3300005985 Ga0081539_10053536 Ga0081539_100535363 310
193 3300013105 Ga0157369_10296307 Ga0157369_102963072 310
194 3300025949 Ga0207667_10123088 Ga0207667_101230882 310
195 3300028794 Ga0307515_10039959 Ga0307515_100399591 310
196 3300030521 Ga0307511_10048394 Ga0307511_100483943 310
197 3300031247 Ga0265340_10050275 Ga0265340_100502752 310
198 3300031616 Ga0307508_10189174 Ga0307508_101891742 310
199 3300031730 Ga0307516_10190035 Ga0307516_101900352 310
200 3300033179 Ga0307507_10052214 Ga0307507_100522144 310
201 3300035695 Ga0373927_0010672 Ga0373927_0010672_3483_4442 310
202 3300035695 Ga0373927_0026821 Ga0373927_0026821_2626_3585 310
203 3300035725 Ga0373947_0024761 Ga0373947_0024761_1667_2626 310
204 3300037068 Ga0373925_0077084 Ga0373925_0077084_1346_2305 310
205 3300042876 Ga0451577_0000235 Ga0451577_0000235_65326_66294 310
206 3300044712 Ga0453684_0000906 Ga0453684_0000906_54451_55419 310
207 3300049649 Ga0501198_000037 Ga0501198_000037_47747_48706 310
208 3300049662 Ga0501222_000032 Ga0501222_000032_10518_11477 310
209 3300053154 Ga0500619_000038 Ga0500619_000038_25541_26500 310
210 iso_pu_bacteria 2897803580 2897808573 310
211 3300005293 Ga0065715_10130447 Ga0065715_101304472 311
212 3300005331 Ga0070670_100000863 Ga0070670_10000086310 311
213 3300005340 Ga0070689_100310839 Ga0070689_1003108391 311
214 3300005353 Ga0070669_100003725 Ga0070669_1000037253 311
215 3300005354 Ga0070675_100000605 Ga0070675_10000060511 311
216 3300005355 Ga0070671_100023448 Ga0070671_1000234483 311
217 3300005364 Ga0070673_100012312 Ga0070673_1000123123 311
218 3300005367 Ga0070667_100279130 Ga0070667_1002791301 311
219 3300005459 Ga0068867_100007933 Ga0068867_1000079335 311
220 3300005466 Ga0070685_10165248 Ga0070685_101652482 311
221 3300005543 Ga0070672_100003662 Ga0070672_1000036627 311
222 3300005548 Ga0070665_100162688 Ga0070665_1001626882 311
223 3300005616 Ga0068852_100128342 Ga0068852_1001283422 311
224 3300005618 Ga0068864_100095161 Ga0068864_1000951612 311
225 3300006237 Ga0097621_100016909 Ga0097621_1000169093 311
226 3300006358 Ga0068871_100025108 Ga0068871_1000251082 311
227 3300009177 Ga0105248_10022581 Ga0105248_100225815 311
228 3300013306 Ga0163162_10170219 Ga0163162_101702192 311
229 3300013308 Ga0157375_10042879 Ga0157375_100428792 311
230 3300025315 Ga0207697_10012568 Ga0207697_100125683 311
231 3300025893 Ga0207682_10001822 Ga0207682_100018227 311
232 3300025901 Ga0207688_10100146 Ga0207688_101001462 311
233 3300025903 Ga0207680_10095411 Ga0207680_100954112 311
234 3300025923 Ga0207681_10023667 Ga0207681_100236673 311
235 3300025925 Ga0207650_10000326 Ga0207650_1000032610 311
236 3300025926 Ga0207659_10000299 Ga0207659_1000029924 311
237 3300025931 Ga0207644_10001354 Ga0207644_100013549 311
238 3300025940 Ga0207691_10000049 Ga0207691_1000004927 311
239 3300025940 Ga0207691_10133760 Ga0207691_101337601 311
240 3300025960 Ga0207651_10000834 Ga0207651_1000083411 311
241 3300025972 Ga0207668_10224891 Ga0207668_102248912 311
242 3300025986 Ga0207658_10025492 Ga0207658_100254925 311
243 3300026089 Ga0207648_10002748 Ga0207648_100027483 311
244 3300026095 Ga0207676_10059072 Ga0207676_100590724 311
245 3300028379 Ga0268266_10136602 Ga0268266_101366022 311
246 3300047472 Ga0495686_0192075 Ga0495686_0192075_51_986 311
247 3300048919 Ga0496116_0039687 Ga0496116_0039687_2042_2977 311
248 3300048924 Ga0496121_0127710 Ga0496121_0127710_757_1692 311
249 3300049580 Ga0501046_0116743 Ga0501046_0116743_877_1812 311
250 iso_pu_bacteria 642555112 642594997 311
251 3300005334 Ga0068869_100017832 Ga0068869_1000178326 312
252 3300006038 Ga0075365_10011690 Ga0075365_100116905 312
253 3300006042 Ga0075368_10001375 Ga0075368_100013758 312
254 3300006048 Ga0075363_100080769 Ga0075363_1000807692 312
255 3300006051 Ga0075364_10001926 Ga0075364_100019268 312
256 3300006178 Ga0075367_10006610 Ga0075367_100066104 312
257 3300021384 Ga0213876_10072141 Ga0213876_100721412 312
258 3300028794 Ga0307515_10087967 Ga0307515_100879674 312
259 3300031852 Ga0307410_10137867 Ga0307410_101378672 312
260 3300035398 Ga0316574_0028981 Ga0316574_0028981_974_1912 312
261 3300039437 Ga0436365_0523972 Ga0436365_0523972_5473_6432 312
262 3300039453 Ga0436362_0198186 Ga0436362_0198186_2055_3014 312
263 3300050489 nmdc:mga03683_64086_c1 nmdc:mga03683_64086_c1_609_1547 312
264 3300050490 nmdc:mga03n38_23268_c1 nmdc:mga03n38_23268_c1_325_1263 312
265 3300050491 nmdc:mga00v17_5502_c1 nmdc:mga00v17_5502_c1_2823_3761 312
266 3300050516 nmdc:mga0sz30_11794_c1 nmdc:mga0sz30_11794_c1_618_1556 312
267 3300053091 Ga0500647_0007202 Ga0500647_0007202_1687_2625 312
268 3300053153 Ga0500616_0035401 Ga0500616_0035401_1283_2221 312
269 iso_pu_bacteria 2896184354 2896186541 312
270 iso_pu_bacteria 2896253425 2896253888 312
271 iso_pu_bacteria 2919034639 2919037802 312
272 iso_pu_bacteria 3000865235 3000867503 312
273 3300005353 Ga0070669_100115925 Ga0070669_1001159251 313
274 3300006846 Ga0075430_100320366 Ga0075430_1003203661 313
275 3300006847 Ga0075431_100154509 Ga0075431_1001545093 313
276 3300006880 Ga0075429_100044872 Ga0075429_1000448722 313
277 3300028800 Ga0265338_10010111 Ga0265338_100101116 313
278 3300029957 Ga0265324_10040385 Ga0265324_100403852 313
279 3300031251 Ga0265327_10001037 Ga0265327_1000103717 313
280 3300032168 Ga0316593_10003817 Ga0316593_100038171 313
281 3300037418 Ga0395900_0036907 Ga0395900_0036907_2587_3528 313
282 3300039062 Ga0400483_035654 Ga0400483_035654_717_1658 313
283 3300039093 Ga0400489_33603 Ga0400489_33603_230_1174 313
284 3300046689 Ga0495613_0000380 Ga0495613_0000380_35210_36151 313
285 3300048924 Ga0496121_0001529 Ga0496121_0001529_10726_11667 313
286 3300049571 Ga0501034_0164347 Ga0501034_0164347_249_1193 313
287 3300050508 nmdc:mga09592_75950_c1 nmdc:mga09592_75950_c1_1335_2276 313
288 3300050509 nmdc:mga0qj67_145461_c1 nmdc:mga0qj67_145461_c1_340_1281 313
289 3300050510 nmdc:mga06r32_290840_c1 nmdc:mga06r32_290840_c1_651_1592 313
290 3300053156 Ga0500622_0003799 Ga0500622_0003799_5256_6197 313
291 iso_pu_bacteria 2547132374 2548500316 313
292 iso_pu_bacteria 2643221544 2643745043 313
293 iso_pu_bacteria 2643221570 2643864649 313
294 iso_pu_bacteria 2643221596 2643992736 313
295 iso_pu_bacteria 2643221646 2644258146 313
296 iso_pu_bacteria 2643221652 2644296445 313
297 iso_pu_bacteria 2643221717 2644647135 313
298 iso_pu_bacteria 2738541296 2738821393 313
299 iso_pu_bacteria 2738541298 2738833876 313
300 iso_pu_bacteria 2738541306 2738875079 313
301 iso_pu_bacteria 2738543002 2739187033 313
302 iso_pu_bacteria 2738543008 2739221677 313
303 iso_pu_bacteria 2744054900 2746091608 313
304 iso_pu_bacteria 2744054901 2746099237 313
305 iso_pu_bacteria 2881101125 2881105146 313
306 iso_pu_bacteria 2904483920 2904485821 313
307 iso_pu_bacteria 2919527303 2919533641 313
308 iso_pu_bacteria 2932422444 2932422644 313
309 iso_pu_bacteria 2939631187 2939632350 313
310 iso_pu_bacteria 2990710928 2990715231 313
311 3300003322 rootL2_10253676 rootL2_102536762 314
312 3300005548 Ga0070665_100038890 Ga0070665_1000388904 314
313 3300009093 Ga0105240_10106099 Ga0105240_101060992 314
314 3300009553 Ga0105249_10021555 Ga0105249_100215556 314
315 3300025913 Ga0207695_10078715 Ga0207695_100787154 314
316 3300025961 Ga0207712_10021719 Ga0207712_100217193 314
317 3300028379 Ga0268266_10012901 Ga0268266_100129016 314
318 3300030878 Ga0265770_1004563 Ga0265770_10045632 314
319 3300031727 Ga0316576_10004360 Ga0316576_100043604 314
320 3300031728 Ga0316578_10089391 Ga0316578_100893912 314
321 3300036712 Ga0316584_0120326 Ga0316584_0120326_308_1252 314
322 3300039062 Ga0400483_237740 Ga0400483_237740_1084_2031 314
323 3300039437 Ga0436365_0817445 Ga0436365_0817445_118_1062 314
324 3300048922 Ga0496119_0138711 Ga0496119_0138711_185_1129 314
325 3300048929 Ga0496126_0464343 Ga0496126_0464343_57_1001 314
326 3300049571 Ga0501034_0030987 Ga0501034_0030987_3580_4524 314
327 3300049572 Ga0501036_0055476 Ga0501036_0055476_886_1830 314
328 3300049581 Ga0501047_0139777 Ga0501047_0139777_1213_2157 314
329 3300049823 Ga0501044_0202965 Ga0501044_0202965_673_1617 314
330 3300050492 nmdc:mga0yw44_169796_c1 nmdc:mga0yw44_169796_c1_66_1010 314
331 3300053087 Ga0500643_000295 Ga0500643_000295_31107_32051 314
332 3300053156 Ga0500622_0001376 Ga0500622_0001376_1305_2249 314
333 3300053730 Ga0500645_000215 Ga0500645_000215_31107_32051 314
334 iso_pu_bacteria 2585428062 2587756660 314
335 iso_pu_bacteria 2738541337 2739053723 314
336 iso_pu_bacteria 2831864461 2831867257 314
337 3300003322 rootL2_10143951 rootL2_101439512 315
338 3300005295 Ga0065707_10175098 Ga0065707_101750982 315
339 3300005337 Ga0070682_100001299 Ga0070682_1000012991 315
340 3300005445 Ga0070708_100144370 Ga0070708_1001443702 315
341 3300005518 Ga0070699_100064156 Ga0070699_1000641562 315
342 3300005536 Ga0070697_100062075 Ga0070697_1000620752 315
343 3300005563 Ga0068855_100210698 Ga0068855_1002106984 315
344 3300006195 Ga0075366_10048036 Ga0075366_100480362 315
345 3300006880 Ga0075429_100002086 Ga0075429_1000020863 315
346 3300009094 Ga0111539_10183792 Ga0111539_101837923 315
347 3300016635 Ga0183361_10005 Ga0183361_10005213 315
348 3300021361 Ga0213872_10034574 Ga0213872_100345742 315
349 3300025941 Ga0207711_10038852 Ga0207711_100388525 315
350 3300025960 Ga0207651_10311190 Ga0207651_103111902 315
351 3300028794 Ga0307515_10000658 Ga0307515_1000065852 315
352 3300028794 Ga0307515_10041913 Ga0307515_100419132 315
353 3300039062 Ga0400483_046831 Ga0400483_046831_325363_326313 315
354 3300039062 Ga0400483_115198 Ga0400483_115198_343_1290 315
355 3300039062 Ga0400483_269750 Ga0400483_269750_3788_4735 315
356 3300039062 Ga0400483_278860 Ga0400483_278860_1535_2482 315
357 3300039062 Ga0400483_280629 Ga0400483_280629_1405_2352 315
358 3300039447 Ga0436361_0178809 Ga0436361_0178809_7107_8054 315
359 3300044712 Ga0453684_0591900 Ga0453684_0591900_180_1127 315
360 3300050508 nmdc:mga09592_15523_c1 nmdc:mga09592_15523_c1_4439_5386 315
361 3300050509 nmdc:mga0qj67_748_c1 nmdc:mga0qj67_748_c1_18891_19838 315
362 3300050510 nmdc:mga06r32_679_c1 nmdc:mga06r32_679_c1_2208_3155 315
363 3300050511 nmdc:mga08y16_153193_c1 nmdc:mga08y16_153193_c1_444_1391 315
364 3300053156 Ga0500622_0002997 Ga0500622_0002997_10156_11103 315
365 3300053730 Ga0500645_018935 Ga0500645_018935_209_1156 315
366 iso_pu_bacteria 2574179768 2574433015 315
367 iso_pu_bacteria 2643221609 2644058349 315
368 iso_pu_bacteria 2643221611 2644073401 315
369 iso_pu_bacteria 2643221639 2644222261 315
370 iso_pu_bacteria 2721755523 2722883085 315
371 iso_pu_bacteria 2738543012 2739244309 315
372 iso_pu_bacteria 2816332133 2816469740 315
373 iso_pu_bacteria 2839138175 2839141436 315
374 iso_pu_bacteria 2886848708 2886853711 315
375 iso_pu_bacteria 639633007 639787691 315
376 3300005288 Ga0065714_10100934 Ga0065714_101009342 316
377 3300005290 Ga0065712_10132380 Ga0065712_101323802 316
378 3300005293 Ga0065715_10092009 Ga0065715_100920095 316
379 3300005328 Ga0070676_10061960 Ga0070676_100619602 316
380 3300005328 Ga0070676_10082141 Ga0070676_100821412 316
381 3300005333 Ga0070677_10113734 Ga0070677_101137341 316
382 3300005341 Ga0070691_10092199 Ga0070691_100921992 316
383 3300005343 Ga0070687_100023538 Ga0070687_1000235382 316
384 3300005344 Ga0070661_100058507 Ga0070661_1000585074 316
385 3300005347 Ga0070668_100001288 Ga0070668_10000128814 316
386 3300005347 Ga0070668_100033275 Ga0070668_1000332753 316
387 3300005353 Ga0070669_100025855 Ga0070669_1000258555 316
388 3300005354 Ga0070675_100001805 Ga0070675_1000018055 316
389 3300005356 Ga0070674_100021184 Ga0070674_1000211843 316
390 3300005364 Ga0070673_100114527 Ga0070673_1001145272 316
391 3300005365 Ga0070688_100052265 Ga0070688_1000522653 316
392 3300005435 Ga0070714_100005361 Ga0070714_1000053617 316
393 3300005435 Ga0070714_100559068 Ga0070714_1005590681 316
394 3300005436 Ga0070713_100031317 Ga0070713_1000313173 316
395 3300005436 Ga0070713_100162474 Ga0070713_1001624742 316
396 3300005437 Ga0070710_10044662 Ga0070710_100446621 316
397 3300005439 Ga0070711_100075095 Ga0070711_1000750952 316
398 3300005439 Ga0070711_100176400 Ga0070711_1001764002 316
399 3300005455 Ga0070663_100145261 Ga0070663_1001452612 316
400 3300005457 Ga0070662_100009085 Ga0070662_1000090854 316
401 3300005457 Ga0070662_100032685 Ga0070662_1000326853 316
402 3300005457 Ga0070662_100046971 Ga0070662_1000469714 316
403 3300005458 Ga0070681_10148615 Ga0070681_101486152 316
404 3300005459 Ga0068867_100011208 Ga0068867_1000112082 316
405 3300005466 Ga0070685_10011760 Ga0070685_100117602 316
406 3300005466 Ga0070685_10020748 Ga0070685_100207484 316
407 3300005467 Ga0070706_100017917 Ga0070706_1000179176 316
408 3300005467 Ga0070706_100322896 Ga0070706_1003228962 316
409 3300005468 Ga0070707_100093503 Ga0070707_1000935033 316
410 3300005471 Ga0070698_100003926 Ga0070698_1000039266 316
411 3300005471 Ga0070698_100024152 Ga0070698_1000241526 316
412 3300005518 Ga0070699_100015206 Ga0070699_1000152066 316
413 3300005535 Ga0070684_100004488 Ga0070684_1000044882 316
414 3300005536 Ga0070697_100333651 Ga0070697_1003336512 316
415 3300005543 Ga0070672_100034503 Ga0070672_1000345032 316
416 3300005543 Ga0070672_100037307 Ga0070672_1000373073 316
417 3300005546 Ga0070696_100093657 Ga0070696_1000936572 316
418 3300005549 Ga0070704_100054933 Ga0070704_1000549332 316
419 3300005563 Ga0068855_100121444 Ga0068855_1001214442 316
420 3300005614 Ga0068856_100025977 Ga0068856_1000259773 316
421 3300005614 Ga0068856_100311090 Ga0068856_1003110902 316
422 3300005615 Ga0070702_100058676 Ga0070702_1000586762 316
423 3300005617 Ga0068859_100005230 Ga0068859_1000052304 316
424 3300005618 Ga0068864_100011966 Ga0068864_1000119665 316
425 3300005719 Ga0068861_100001297 Ga0068861_1000012977 316
426 3300005840 Ga0068870_10016152 Ga0068870_100161523 316
427 3300005841 Ga0068863_100004078 Ga0068863_10000407813 316
428 3300005844 Ga0068862_100000710 Ga0068862_10000071017 316
429 3300005844 Ga0068862_100000773 Ga0068862_10000077318 316
430 3300005844 Ga0068862_100013059 Ga0068862_1000130596 316
431 3300005983 Ga0081540_1000120 Ga0081540_100012026 316
432 3300006028 Ga0070717_10023098 Ga0070717_100230985 316
433 3300006028 Ga0070717_10157585 Ga0070717_101575852 316
434 3300006038 Ga0075365_10056486 Ga0075365_100564862 316
435 3300006048 Ga0075363_100055898 Ga0075363_1000558982 316
436 3300006051 Ga0075364_10046560 Ga0075364_100465603 316
437 3300006173 Ga0070716_100013555 Ga0070716_1000135554 316
438 3300006177 Ga0075362_10017271 Ga0075362_100172712 316
439 3300006178 Ga0075367_10046202 Ga0075367_100462023 316
440 3300006195 Ga0075366_10185661 Ga0075366_101856612 316
441 3300006237 Ga0097621_100104236 Ga0097621_1001042362 316
442 3300006844 Ga0075428_100008323 Ga0075428_1000083239 316
443 3300006846 Ga0075430_100134843 Ga0075430_1001348432 316
444 3300006847 Ga0075431_100024976 Ga0075431_1000249765 316
445 3300006847 Ga0075431_100379179 Ga0075431_1003791792 316
446 3300006852 Ga0075433_10061285 Ga0075433_100612853 316
447 3300006871 Ga0075434_100039179 Ga0075434_1000391792 316
448 3300006871 Ga0075434_100050704 Ga0075434_1000507043 316
449 3300006914 Ga0075436_100131287 Ga0075436_1001312872 316
450 3300006931 Ga0097620_100005230 Ga0097620_1000052304 316
451 3300007076 Ga0075435_100054421 Ga0075435_1000544212 316
452 3300009094 Ga0111539_10042128 Ga0111539_100421286 316
453 3300009147 Ga0114129_10009237 Ga0114129_100092374 316
454 3300009147 Ga0114129_10144548 Ga0114129_101445482 316
455 3300009148 Ga0105243_10173305 Ga0105243_101733052 316
456 3300009174 Ga0105241_10056190 Ga0105241_100561904 316
457 3300009177 Ga0105248_10003190 Ga0105248_1000319013 316
458 3300009553 Ga0105249_10015849 Ga0105249_100158497 316
459 3300009553 Ga0105249_10038996 Ga0105249_100389963 316
460 3300013297 Ga0157378_10098716 Ga0157378_100987162 316
461 3300013306 Ga0163162_10024014 Ga0163162_100240145 316
462 3300013308 Ga0157375_10000261 Ga0157375_1000026126 316
463 3300013308 Ga0157375_10320181 Ga0157375_103201812 316
464 3300013308 Ga0157375_10654592 Ga0157375_106545921 316
465 3300014325 Ga0163163_10000639 Ga0163163_1000063921 316
466 3300014326 Ga0157380_10160015 Ga0157380_101600151 316
467 3300014968 Ga0157379_10075337 Ga0157379_100753374 316
468 3300020077 Ga0206351_10639124 Ga0206351_106391242 316
469 3300020080 Ga0206350_10380697 Ga0206350_103806974 316
470 3300020081 Ga0206354_11423707 Ga0206354_114237072 316
471 3300021388 Ga0213875_10118570 Ga0213875_101185702 316
472 3300022467 Ga0224712_10024103 Ga0224712_100241032 316
473 3300024225 Ga0224572_1000229 Ga0224572_10002292 316
474 3300025898 Ga0207692_10022718 Ga0207692_100227183 316
475 3300025898 Ga0207692_10032685 Ga0207692_100326853 316
476 3300025907 Ga0207645_10013208 Ga0207645_100132084 316
477 3300025910 Ga0207684_10060092 Ga0207684_100600923 316
478 3300025912 Ga0207707_10052812 Ga0207707_100528124 316
479 3300025916 Ga0207663_10020666 Ga0207663_100206664 316
480 3300025916 Ga0207663_10072159 Ga0207663_100721592 316
481 3300025916 Ga0207663_10277948 Ga0207663_102779482 316
482 3300025918 Ga0207662_10024547 Ga0207662_100245472 316
483 3300025921 Ga0207652_10039498 Ga0207652_100394983 316
484 3300025922 Ga0207646_10036712 Ga0207646_100367124 316
485 3300025922 Ga0207646_10120025 Ga0207646_101200252 316
486 3300025922 Ga0207646_10191660 Ga0207646_101916602 316
487 3300025923 Ga0207681_10003681 Ga0207681_100036815 316
488 3300025926 Ga0207659_10003803 Ga0207659_100038037 316
489 3300025928 Ga0207700_10004029 Ga0207700_100040292 316
490 3300025928 Ga0207700_10177250 Ga0207700_101772502 316
491 3300025929 Ga0207664_10004452 Ga0207664_100044526 316
492 3300025929 Ga0207664_10024659 Ga0207664_100246595 316
493 3300025933 Ga0207706_10000606 Ga0207706_1000060618 316
494 3300025933 Ga0207706_10004288 Ga0207706_1000428812 316
495 3300025933 Ga0207706_10047194 Ga0207706_100471944 316
496 3300025935 Ga0207709_10115703 Ga0207709_101157032 316
497 3300025937 Ga0207669_10084624 Ga0207669_100846242 316
498 3300025937 Ga0207669_10358360 Ga0207669_103583602 316
499 3300025938 Ga0207704_10111667 Ga0207704_101116671 316
500 3300025938 Ga0207704_10346326 Ga0207704_103463261 316
501 3300025939 Ga0207665_10016681 Ga0207665_100166813 316
502 3300025940 Ga0207691_10002506 Ga0207691_1000250616 316
503 3300025940 Ga0207691_10050698 Ga0207691_100506984 316
504 3300025942 Ga0207689_10015453 Ga0207689_100154537 316
505 3300025944 Ga0207661_10000444 Ga0207661_1000044423 316
506 3300025945 Ga0207679_10002985 Ga0207679_1000298510 316
507 3300025949 Ga0207667_10239885 Ga0207667_102398852 316
508 3300025961 Ga0207712_10021950 Ga0207712_100219505 316
509 3300025961 Ga0207712_10032944 Ga0207712_100329443 316
510 3300025972 Ga0207668_10054702 Ga0207668_100547024 316
511 3300026035 Ga0207703_10052950 Ga0207703_100529502 316
512 3300026067 Ga0207678_10062549 Ga0207678_100625492 316
513 3300026075 Ga0207708_10123386 Ga0207708_101233862 316
514 3300026078 Ga0207702_10249627 Ga0207702_102496272 316
515 3300026088 Ga0207641_10013507 Ga0207641_100135074 316
516 3300026089 Ga0207648_10002321 Ga0207648_100023213 316
517 3300026089 Ga0207648_10085045 Ga0207648_100850452 316
518 3300026095 Ga0207676_10002345 Ga0207676_100023458 316
519 3300026116 Ga0207674_10014643 Ga0207674_100146439 316
520 3300026116 Ga0207674_10026083 Ga0207674_100260832 316
521 3300026118 Ga0207675_100015598 Ga0207675_1000155987 316
522 3300026118 Ga0207675_100021807 Ga0207675_1000218077 316
523 3300027552 Ga0209982_1000525 Ga0209982_10005252 316
524 3300027617 Ga0210002_1000631 Ga0210002_10006314 316
525 3300027682 Ga0209971_1003298 Ga0209971_10032984 316
526 3300027876 Ga0209974_10005216 Ga0209974_100052164 316
527 3300027907 Ga0207428_10019081 Ga0207428_100190814 316
528 3300027907 Ga0207428_10035182 Ga0207428_100351822 316
529 3300028380 Ga0268265_10001103 Ga0268265_100011035 316
530 3300028380 Ga0268265_10005116 Ga0268265_100051164 316
531 3300028380 Ga0268265_10008379 Ga0268265_100083796 316
532 3300028556 Ga0265337_1000042 Ga0265337_100004248 316
533 3300028558 Ga0265326_10021531 Ga0265326_100215311 316
534 3300028563 Ga0265319_1002822 Ga0265319_10028225 316
535 3300028577 Ga0265318_10000962 Ga0265318_100009625 316
536 3300028577 Ga0265318_10028484 Ga0265318_100284842 316
537 3300028666 Ga0265336_10008217 Ga0265336_100082172 316
538 3300028794 Ga0307515_10000494 Ga0307515_1000049438 316
539 3300028794 Ga0307515_10132053 Ga0307515_101320534 316
540 3300028800 Ga0265338_10004381 Ga0265338_100043812 316
541 3300028800 Ga0265338_10007488 Ga0265338_100074882 316
542 3300029957 Ga0265324_10001160 Ga0265324_1000116016 316
543 3300031238 Ga0265332_10000626 Ga0265332_100006262 316
544 3300031238 Ga0265332_10018655 Ga0265332_100186554 316
545 3300031238 Ga0265332_10042179 Ga0265332_100421792 316
546 3300031240 Ga0265320_10017209 Ga0265320_100172095 316
547 3300031240 Ga0265320_10042687 Ga0265320_100426873 316
548 3300031241 Ga0265325_10000929 Ga0265325_1000092911 316
549 3300031241 Ga0265325_10103867 Ga0265325_101038672 316
550 3300031247 Ga0265340_10005079 Ga0265340_100050792 316
551 3300031249 Ga0265339_10031160 Ga0265339_100311604 316
552 3300031250 Ga0265331_10134556 Ga0265331_101345561 316
553 3300031344 Ga0265316_10021381 Ga0265316_100213816 316
554 3300031456 Ga0307513_10032606 Ga0307513_100326064 316
555 3300031507 Ga0307509_10207183 Ga0307509_102071832 316
556 3300031548 Ga0307408_100007410 Ga0307408_1000074105 316
557 3300031595 Ga0265313_10000779 Ga0265313_1000077925 316
558 3300031595 Ga0265313_10001164 Ga0265313_1000116411 316
559 3300031595 Ga0265313_10024584 Ga0265313_100245842 316
560 3300031711 Ga0265314_10002116 Ga0265314_1000211611 316
561 3300031711 Ga0265314_10008410 Ga0265314_100084102 316
562 3300031711 Ga0265314_10015177 Ga0265314_100151775 316
563 3300031711 Ga0265314_10096259 Ga0265314_100962593 316
564 3300031712 Ga0265342_10005960 Ga0265342_100059602 316
565 3300031727 Ga0316576_10093532 Ga0316576_100935322 316
566 3300031731 Ga0307405_10020308 Ga0307405_100203083 316
567 3300031824 Ga0307413_10119822 Ga0307413_101198222 316
568 3300031852 Ga0307410_10045742 Ga0307410_100457422 316
569 3300031901 Ga0307406_10181751 Ga0307406_101817512 316
570 3300031901 Ga0307406_10192770 Ga0307406_101927702 316
571 3300031901 Ga0307406_10256893 Ga0307406_102568932 316
572 3300031911 Ga0307412_10036277 Ga0307412_100362772 316
573 3300032002 Ga0307416_100067494 Ga0307416_1000674944 316
574 3300032004 Ga0307414_10071457 Ga0307414_100714573 316
575 3300032005 Ga0307411_10230273 Ga0307411_102302732 316
576 3300034817 Ga0373948_0007373 Ga0373948_0007373_574_1524 316
577 3300034819 Ga0373958_0017674 Ga0373958_0017674_184_1134 316
578 3300035084 Ga0373928_0008496 Ga0373928_0008496_241_1191 316
579 3300035086 Ga0373934_0001020 Ga0373934_0001020_5248_6207 316
580 3300035086 Ga0373934_0003290 Ga0373934_0003290_3652_4602 316
581 3300035086 Ga0373934_0011045 Ga0373934_0011045_2285_3235 316
582 3300035088 Ga0373940_0010606 Ga0373940_0010606_995_1945 316
583 3300035091 Ga0373951_0015605 Ga0373951_0015605_606_1556 316
584 3300035111 Ga0373923_0002059 Ga0373923_0002059_136_1086 316
585 3300035113 Ga0373936_0022611 Ga0373936_0022611_143_1093 316
586 3300035117 Ga0373953_0000026 Ga0373953_0000026_30061_31020 316
587 3300035117 Ga0373953_0008838 Ga0373953_0008838_1161_2111 316
588 3300035118 Ga0373954_0000865 Ga0373954_0000865_786_1745 316
589 3300035118 Ga0373954_0026368 Ga0373954_0026368_1693_2643 316
590 3300035119 Ga0373956_0000442 Ga0373956_0000442_5877_6836 316
591 3300035119 Ga0373956_0081153 Ga0373956_0081153_117_1067 316
592 3300035120 Ga0373957_0000038 Ga0373957_0000038_31197_32156 316
593 3300035172 Ga0373955_0000231 Ga0373955_0000231_8616_9575 316
594 3300035172 Ga0373955_0006619 Ga0373955_0006619_652_1602 316
595 3300035172 Ga0373955_0104747 Ga0373955_0104747_550_1500 316
596 3300035242 Ga0373962_0006157 Ga0373962_0006157_600_1550 316
597 3300035398 Ga0316574_0069336 Ga0316574_0069336_100_1050 316
598 3300035410 Ga0373924_0003392 Ga0373924_0003392_3711_4661 316
599 3300035410 Ga0373924_0037134 Ga0373924_0037134_61_1011 316
600 3300035691 Ga0373931_0018319 Ga0373931_0018319_1788_2738 316
601 3300035695 Ga0373927_0060355 Ga0373927_0060355_484_1446 316
602 3300035724 Ga0373933_0000604 Ga0373933_0000604_18120_19070 316
603 3300035724 Ga0373933_0000839 Ga0373933_0000839_7807_8766 316
604 3300035725 Ga0373947_0033853 Ga0373947_0033853_1663_2613 316
605 3300036401 Ga0373937_0000138 Ga0373937_0000138_20596_21555 316
606 3300036401 Ga0373937_0014264 Ga0373937_0014264_4942_5904 316
607 3300036401 Ga0373937_0031919 Ga0373937_0031919_328_1278 316
608 3300036401 Ga0373937_0088464 Ga0373937_0088464_491_1441 316
609 3300036401 Ga0373937_0117828 Ga0373937_0117828_522_1472 316
610 3300036401 Ga0373937_0185616 Ga0373937_0185616_133_1083 316
611 3300037068 Ga0373925_0026089 Ga0373925_0026089_3174_4124 316
612 3300037068 Ga0373925_0056446 Ga0373925_0056446_982_1932 316
613 3300037853 Ga0436364_0992730 Ga0436364_0992730_1504_2454 316
614 3300038726 Ga0400490_43931 Ga0400490_43931_28344_29294 316
615 3300038727 Ga0400491_04736 Ga0400491_04736_599_1549 316
616 3300039110 Ga0400487_42799 Ga0400487_42799_17036_17986 316
617 3300041413 Ga0439465_0095430 Ga0439465_0095430_47_1006 316
618 3300042876 Ga0451577_0015823 Ga0451577_0015823_5377_6327 316
619 3300044656 Ga0466969_0011838 Ga0466969_0011838_174_1124 316
620 3300044684 Ga0466966_0035156 Ga0466966_0035156_2188_3138 316
621 3300044693 Ga0466961_0012926 Ga0466961_0012926_736_1686 316
622 3300046454 Ga0495592_0000041 Ga0495592_0000041_73959_74918 316
623 3300046455 Ga0495603_0027174 Ga0495603_0027174_547_1497 316
624 3300046459 Ga0495629_0014811 Ga0495629_0014811_2875_3825 316
625 3300046459 Ga0495629_0067077 Ga0495629_0067077_1542_2492 316
626 3300046461 Ga0495641_0022013 Ga0495641_0022013_2143_3093 316
627 3300046462 Ga0495651_0000018 Ga0495651_0000018_48514_49473 316
628 3300046462 Ga0495651_0003600 Ga0495651_0003600_3588_4538 316
629 3300046462 Ga0495651_0021971 Ga0495651_0021971_2528_3478 316
630 3300046462 Ga0495651_0085282 Ga0495651_0085282_868_1818 316
631 3300046463 Ga0495653_0019823 Ga0495653_0019823_3207_4157 316
632 3300046463 Ga0495653_0037741 Ga0495653_0037741_1667_2617 316
633 3300046463 Ga0495653_0068638 Ga0495653_0068638_1667_2617 316
634 3300046472 Ga0495580_0012366 Ga0495580_0012366_3708_4658 316
635 3300046472 Ga0495580_0112906 Ga0495580_0112906_242_1204 316
636 3300046473 Ga0495582_0003548 Ga0495582_0003548_679_1629 316
637 3300046475 Ga0495639_0009195 Ga0495639_0009195_80_1030 316
638 3300046476 Ga0495662_0042130 Ga0495662_0042130_1029_1979 316
639 3300046477 Ga0495664_0052111 Ga0495664_0052111_42_992 316
640 3300046477 Ga0495664_0064262 Ga0495664_0064262_566_1516 316
641 3300046511 Ga0495608_0000039 Ga0495608_0000039_48514_49473 316
642 3300046511 Ga0495608_0012184 Ga0495608_0012184_215_1165 316
643 3300046511 Ga0495608_0034635 Ga0495608_0034635_1105_2055 316
644 3300046514 Ga0495618_0014687 Ga0495618_0014687_2451_3401 316
645 3300046514 Ga0495618_0049428 Ga0495618_0049428_789_1739 316
646 3300046516 Ga0495628_0000219 Ga0495628_0000219_30085_31044 316
647 3300046517 Ga0495630_0011003 Ga0495630_0011003_2016_2978 316
648 3300046517 Ga0495630_0011057 Ga0495630_0011057_2938_3888 316
649 3300046517 Ga0495630_0171798 Ga0495630_0171798_41_991 316
650 3300046526 Ga0495666_0038237 Ga0495666_0038237_235_1185 316
651 3300046529 Ga0495652_0000092 Ga0495652_0000092_73723_74682 316
652 3300046529 Ga0495652_0013473 Ga0495652_0013473_1274_2224 316
653 3300046529 Ga0495652_0039030 Ga0495652_0039030_2548_3498 316
654 3300046531 Ga0495665_0013248 Ga0495665_0013248_859_1809 316
655 3300046536 Ga0495587_0000034 Ga0495587_0000034_73960_74919 316
656 3300046536 Ga0495587_0021836 Ga0495587_0021836_2731_3681 316
657 3300046536 Ga0495587_0118048 Ga0495587_0118048_98_1060 316
658 3300046543 Ga0495645_0015569 Ga0495645_0015569_1956_2906 316
659 3300046543 Ga0495645_0024809 Ga0495645_0024809_194_1144 316
660 3300046543 Ga0495645_0034491 Ga0495645_0034491_1612_2562 316
661 3300046559 Ga0495667_0002416 Ga0495667_0002416_8087_9037 316
662 3300046559 Ga0495667_0002599 Ga0495667_0002599_1030_1989 316
663 3300046559 Ga0495667_0036966 Ga0495667_0036966_1116_2066 316
664 3300046559 Ga0495667_0107748 Ga0495667_0107748_111_1061 316
665 3300046642 Ga0495634_0020326 Ga0495634_0020326_2320_3270 316
666 3300046642 Ga0495634_0034901 Ga0495634_0034901_1214_2164 316
667 3300046663 Ga0495635_0008259 Ga0495635_0008259_2320_3270 316
668 3300046663 Ga0495635_0171464 Ga0495635_0171464_102_1064 316
669 3300046675 Ga0495657_0013370 Ga0495657_0013370_4623_5573 316
670 3300046675 Ga0495657_0033050 Ga0495657_0033050_2285_3247 316
671 3300046675 Ga0495657_0075109 Ga0495657_0075109_635_1585 316
672 3300046678 Ga0495599_0000108 Ga0495599_0000108_6677_7636 316
673 3300046678 Ga0495599_0008955 Ga0495599_0008955_3751_4701 316
674 3300046678 Ga0495599_0013304 Ga0495599_0013304_2733_3683 316
675 3300046679 Ga0495623_0000287 Ga0495623_0000287_15682_16641 316
676 3300046679 Ga0495623_0014003 Ga0495623_0014003_2229_3179 316
677 3300046679 Ga0495623_0015327 Ga0495623_0015327_780_1730 316
678 3300046680 Ga0495646_0015716 Ga0495646_0015716_383_1345 316
679 3300046680 Ga0495646_0016018 Ga0495646_0016018_1321_2280 316
680 3300046680 Ga0495646_0040810 Ga0495646_0040810_163_1113 316
681 3300046681 Ga0495647_0014431 Ga0495647_0014431_1571_2521 316
682 3300046683 Ga0495658_0009052 Ga0495658_0009052_1431_2381 316
683 3300046689 Ga0495613_0015491 Ga0495613_0015491_842_1792 316
684 3300046689 Ga0495613_0276241 Ga0495613_0276241_42_992 316
685 3300046690 Ga0495624_0105690 Ga0495624_0105690_41_991 316
686 3300046809 Ga0495600_0096933 Ga0495600_0096933_237_1187 316
687 3300046809 Ga0495600_0100038 Ga0495600_0100038_261_1211 316
688 3300046809 Ga0495600_0123427 Ga0495600_0123427_297_1247 316
689 3300047315 Ga0495581_0007236 Ga0495581_0007236_2929_3879 316
690 3300047315 Ga0495581_0032115 Ga0495581_0032115_688_1638 316
691 3300047317 Ga0495604_0000039 Ga0495604_0000039_73959_74918 316
692 3300047317 Ga0495604_0007655 Ga0495604_0007655_4620_5570 316
693 3300047317 Ga0495604_0055840 Ga0495604_0055840_2015_2977 316
694 3300047317 Ga0495604_0063469 Ga0495604_0063469_1620_2570 316
695 3300047317 Ga0495604_0136822 Ga0495604_0136822_41_991 316
696 3300047319 Ga0495674_0042962 Ga0495674_0042962_2667_3617 316
697 3300047319 Ga0495674_0065760 Ga0495674_0065760_520_1482 316
698 3300047319 Ga0495674_0162704 Ga0495674_0162704_228_1178 316
699 3300047319 Ga0495674_0176440 Ga0495674_0176440_661_1611 316
700 3300047320 Ga0495672_0068131 Ga0495672_0068131_627_1577 316
701 3300047321 Ga0495676_0064879 Ga0495676_0064879_1828_2778 316
702 3300047321 Ga0495676_0067632 Ga0495676_0067632_1614_2564 316
703 3300047322 Ga0495680_0000028 Ga0495680_0000028_37948_38907 316
704 3300047322 Ga0495680_0006442 Ga0495680_0006442_2768_3718 316
705 3300047322 Ga0495680_0008757 Ga0495680_0008757_6301_7251 316
706 3300047322 Ga0495680_0018186 Ga0495680_0018186_3362_4312 316
707 3300047322 Ga0495680_0096509 Ga0495680_0096509_597_1547 316
708 3300047444 Ga0495675_0000355 Ga0495675_0000355_16006_16965 316
709 3300047444 Ga0495675_0013496 Ga0495675_0013496_1241_2191 316
710 3300047444 Ga0495675_0102863 Ga0495675_0102863_598_1548 316
711 3300047444 Ga0495675_0138468 Ga0495675_0138468_172_1122 316
712 3300047471 Ga0495684_0039388 Ga0495684_0039388_661_1611 316
713 3300047471 Ga0495684_0069496 Ga0495684_0069496_204_1154 316
714 3300047673 Ga0495593_0007376 Ga0495593_0007376_796_1758 316
715 3300047673 Ga0495593_0010087 Ga0495593_0010087_853_1803 316
716 3300047673 Ga0495593_0010226 Ga0495593_0010226_2982_3932 316
717 3300048088 Ga0495602_0000043 Ga0495602_0000043_73959_74918 316
718 3300048088 Ga0495602_0014212 Ga0495602_0014212_3496_4446 316
719 3300048088 Ga0495602_0047037 Ga0495602_0047037_414_1364 316
720 3300048088 Ga0495602_0077837 Ga0495602_0077837_239_1189 316
721 3300048088 Ga0495602_0084968 Ga0495602_0084968_284_1234 316
722 3300048903 Ga0496100_0063051 Ga0496100_0063051_1165_2115 316
723 3300048904 Ga0496101_0012928 Ga0496101_0012928_1242_2192 316
724 3300048904 Ga0496101_0048231 Ga0496101_0048231_946_1896 316
725 3300048905 Ga0496102_0002985 Ga0496102_0002985_3264_4214 316
726 3300048905 Ga0496102_0125396 Ga0496102_0125396_980_1930 316
727 3300048906 Ga0496103_0002185 Ga0496103_0002185_2268_3218 316
728 3300048907 Ga0496104_0454717 Ga0496104_0454717_178_1128 316
729 3300048908 Ga0496105_0085406 Ga0496105_0085406_1090_2040 316
730 3300048910 Ga0496107_0307824 Ga0496107_0307824_34_984 316
731 3300048911 Ga0496108_0038970 Ga0496108_0038970_1757_2707 316
732 3300048912 Ga0496109_0020379 Ga0496109_0020379_1825_2775 316
733 3300048912 Ga0496109_0061236 Ga0496109_0061236_310_1260 316
734 3300048913 Ga0496110_0007760 Ga0496110_0007760_2668_3618 316
735 3300048913 Ga0496110_0038516 Ga0496110_0038516_3145_4095 316
736 3300048914 Ga0496111_0000082 Ga0496111_0000082_24646_25596 316
737 3300048917 Ga0496114_0020996 Ga0496114_0020996_3443_4393 316
738 3300048927 Ga0496124_0000919 Ga0496124_0000919_44702_45652 316
739 3300048928 Ga0496125_0027360 Ga0496125_0027360_2419_3369 316
740 3300048929 Ga0496126_0062889 Ga0496126_0062889_2218_3168 316
741 3300048929 Ga0496126_0080106 Ga0496126_0080106_405_1355 316
742 3300049583 Ga0501067_0022409 Ga0501067_0022409_2391_3341 316
743 3300049741 Ga0501079_0142818 Ga0501079_0142818_187_1137 316
744 3300050491 nmdc:mga00v17_19064_c1 nmdc:mga00v17_19064_c1_469_1422 316
745 3300050493 nmdc:mga0k408_56008_c1 nmdc:mga0k408_56008_c1_903_1862 316
746 3300050496 nmdc:mga07m45_37757_c1 nmdc:mga07m45_37757_c1_462_1421 316
747 3300050496 nmdc:mga07m45_53549_c1 nmdc:mga07m45_53549_c1_1102_2052 316
748 3300050507 nmdc:mga05p37_172666_c1 nmdc:mga05p37_172666_c1_1672_2622 316
749 3300050507 nmdc:mga05p37_195_c1 nmdc:mga05p37_195_c1_59425_60375 316
750 3300050509 nmdc:mga0qj67_6146_c1 nmdc:mga0qj67_6146_c1_804_1754 316
751 3300050510 nmdc:mga06r32_149437_c1 nmdc:mga06r32_149437_c1_1169_2119 316
752 3300050510 nmdc:mga06r32_157235_c1 nmdc:mga06r32_157235_c1_1096_2046 316
753 3300050510 nmdc:mga06r32_50376_c1 nmdc:mga06r32_50376_c1_1500_2450 316
754 3300050511 nmdc:mga08y16_146914_c1 nmdc:mga08y16_146914_c1_1258_2208 316
755 3300050512 nmdc:mga0n895_103219_c1 nmdc:mga0n895_103219_c1_1494_2444 316
756 3300050513 nmdc:mga0rr50_62340_c1 nmdc:mga0rr50_62340_c1_408_1358 316
757 3300050514 nmdc:mga08x19_165786_c1 nmdc:mga08x19_165786_c1_411_1361 316
758 3300050514 nmdc:mga08x19_23217_c1 nmdc:mga08x19_23217_c1_2864_3814 316
759 3300050515 nmdc:mga0a205_12356_c1 nmdc:mga0a205_12356_c1_4788_5738 316
760 3300053077 Ga0495601_0126239 Ga0495601_0126239_676_1626 316
761 3300053077 Ga0495601_0142219 Ga0495601_0142219_323_1273 316
762 3300053085 Ga0495619_0275864 Ga0495619_0275864_101_1051 316
763 3300053094 Ga0500566_0138516 Ga0500566_0138516_236_1195 316
764 3300053121 Ga0500607_000006 Ga0500607_000006_118781_119740 316
765 3300053136 Ga0500559_0000698 Ga0500559_0000698_3276_4235 316
766 3300053136 Ga0500559_0004182 Ga0500559_0004182_2352_3311 316
767 3300053178 Ga0500637_0002011 Ga0500637_0002011_5570_6529 316
768 3300053730 Ga0500645_006747 Ga0500645_006747_1881_2840 316
769 iso_pu_bacteria 2902682994 2902689585 316
770 3300001989 JGI24739J22299_10003739 JGI24739J22299_100037393 317
771 3300003214 JGI25165J46597_1001146 JGI25165J46597_100114616 317
772 3300003756 Ga0055533_1000064 Ga0055533_100006473 317
773 3300003758 Ga0055532_1000013 Ga0055532_1000013296 317
774 3300003760 Ga0055527_1000010 Ga0055527_100001074 317
775 3300003761 Ga0055535_1000010 Ga0055535_1000010296 317
776 3300003762 Ga0055542_1000016 Ga0055542_1000016296 317
777 3300003763 Ga0055529_1000012 Ga0055529_1000012296 317
778 3300005530 Ga0070679_100010795 Ga0070679_1000107953 317
779 3300025226 Ga0209674_100011 Ga0209674_10001172 317
780 3300025228 Ga0209672_100002 Ga0209672_10000272 317
781 3300025229 Ga0209147_100003 Ga0209147_10000372 317
782 3300025230 Ga0209563_100729 Ga0209563_1007295 317
783 3300025231 Ga0207427_100230 Ga0207427_10023031 317
784 3300025242 Ga0209258_100042 Ga0209258_100042288 317
785 3300025254 Ga0209148_1000006 Ga0209148_100000672 317
786 3300025261 Ga0209233_1000033 Ga0209233_1000033477 317
787 3300025272 Ga0209455_1000003 Ga0209455_100000372 317
788 3300025921 Ga0207652_10044388 Ga0207652_100443883 317
789 3300028794 Ga0307515_10006133 Ga0307515_100061335 317
790 3300031247 Ga0265340_10040161 Ga0265340_100401613 317
791 3300031911 Ga0307412_10000857 Ga0307412_1000085710 317
792 3300037312 Ga0395899_0001283 Ga0395899_0001283_7880_8833 317
793 3300037418 Ga0395900_0032994 Ga0395900_0032994_1404_2357 317
794 3300037418 Ga0395900_0045778 Ga0395900_0045778_1428_2381 317
795 3300037471 Ga0395905_0000138 Ga0395905_0000138_118950_119903 317
796 3300037471 Ga0395905_0006240 Ga0395905_0006240_4945_5901 317
797 3300037471 Ga0395905_0026512 Ga0395905_0026512_3943_4896 317
798 3300037471 Ga0395905_0095477 Ga0395905_0095477_1785_2738 317
799 3300037471 Ga0395905_0113073 Ga0395905_0113073_51_1004 317
800 3300038443 Ga0395901_0030455 Ga0395901_0030455_1539_2492 317
801 3300038443 Ga0395901_0071636 Ga0395901_0071636_804_1757 317
802 3300038735 Ga0400485_10823 Ga0400485_10823_2528_3487 317
803 3300045051 Ga0451576_0015435 Ga0451576_0015435_4141_5094 317
804 3300046471 Ga0495650_0001834 Ga0495650_0001834_8564_9517 317
805 3300046471 Ga0495650_0047442 Ga0495650_0047442_555_1508 317
806 3300046500 Ga0495596_0119890 Ga0495596_0119890_15_968 317
807 3300046507 Ga0495606_0008456 Ga0495606_0008456_4889_5842 317
808 3300046507 Ga0495606_0127099 Ga0495606_0127099_294_1247 317
809 3300046516 Ga0495628_0004882 Ga0495628_0004882_9800_10753 317
810 3300046524 Ga0495648_0001735 Ga0495648_0001735_13771_14724 317
811 3300046524 Ga0495648_0009710 Ga0495648_0009710_5425_6378 317
812 3300046616 Ga0495668_0000018 Ga0495668_0000018_175499_176452 317
813 3300046642 Ga0495634_0030347 Ga0495634_0030347_2692_3645 317
814 3300046660 Ga0495625_0002034 Ga0495625_0002034_6231_7184 317
815 3300046665 Ga0495661_0058809 Ga0495661_0058809_130_1083 317
816 3300046678 Ga0495599_0023534 Ga0495599_0023534_2337_3290 317
817 3300046679 Ga0495623_0002882 Ga0495623_0002882_7592_8545 317
818 3300046690 Ga0495624_0014434 Ga0495624_0014434_4090_5043 317
819 3300046694 Ga0495649_0010900 Ga0495649_0010900_4075_5028 317
820 3300047317 Ga0495604_0000893 Ga0495604_0000893_10981_11934 317
821 3300047319 Ga0495674_0092293 Ga0495674_0092293_1488_2441 317
822 3300047320 Ga0495672_0053599 Ga0495672_0053599_524_1477 317
823 3300047322 Ga0495680_0029149 Ga0495680_0029149_936_1889 317
824 3300047322 Ga0495680_0160993 Ga0495680_0160993_371_1324 317
825 3300047323 Ga0495683_0003543 Ga0495683_0003543_2373_3326 317
826 3300047323 Ga0495683_0004867 Ga0495683_0004867_2272_3225 317
827 3300047444 Ga0495675_0041332 Ga0495675_0041332_381_1334 317
828 3300047469 Ga0495673_0013392 Ga0495673_0013392_2570_3523 317
829 3300047472 Ga0495686_0003011 Ga0495686_0003011_3826_4779 317
830 3300048088 Ga0495602_0001190 Ga0495602_0001190_15191_16144 317
831 3300048088 Ga0495602_0065072 Ga0495602_0065072_658_1611 317
832 3300048924 Ga0496121_0010277 Ga0496121_0010277_9613_10566 317
833 3300048928 Ga0496125_0030887 Ga0496125_0030887_886_1842 317
834 3300048929 Ga0496126_0001434 Ga0496126_0001434_8554_9507 317
835 3300049459 Ga0495678_018911 Ga0495678_018911_650_1603 317
836 3300050493 nmdc:mga0k408_221_c1 nmdc:mga0k408_221_c1_16814_17779 317
837 3300050493 nmdc:mga0k408_84793_c1 nmdc:mga0k408_84793_c1_394_1347 317
838 3300003763 Ga0055529_1001271 Ga0055529_10012715 318
839 3300003792 Ga0055540_1001334 Ga0055540_10013346 318
840 3300003794 Ga0055531_10001335 Ga0055531_100013353 318
841 3300005293 Ga0065715_10142885 Ga0065715_101428852 318
842 3300005344 Ga0070661_100237738 Ga0070661_1002377381 318
843 3300005347 Ga0070668_100238741 Ga0070668_1002387412 318
844 3300005354 Ga0070675_100025023 Ga0070675_1000250236 318
845 3300005364 Ga0070673_100238138 Ga0070673_1002381382 318
846 3300005455 Ga0070663_100043069 Ga0070663_1000430693 318
847 3300005617 Ga0068859_100216229 Ga0068859_1002162292 318
848 3300006353 Ga0075370_10040788 Ga0075370_100407882 318
849 3300006846 Ga0075430_100175926 Ga0075430_1001759262 318
850 3300006931 Ga0097620_100216229 Ga0097620_1002162292 318
851 3300009093 Ga0105240_10073489 Ga0105240_100734894 318
852 3300009094 Ga0111539_10373123 Ga0111539_103731232 318
853 3300009174 Ga0105241_10030921 Ga0105241_100309214 318
854 3300010375 Ga0105239_10461852 Ga0105239_104618522 318
855 3300025272 Ga0209455_1000337 Ga0209455_100033712 318
856 3300025284 Ga0209130_1010519 Ga0209130_10105192 318
857 3300025303 Ga0209051_1000055 Ga0209051_1000055243 318
858 3300025304 Ga0209257_1000101 Ga0209257_1000101217 318
859 3300025924 Ga0207694_10057390 Ga0207694_100573903 318
860 3300025960 Ga0207651_10338064 Ga0207651_103380642 318
861 3300026118 Ga0207675_100514665 Ga0207675_1005146652 318
862 3300028573 Ga0265334_10058479 Ga0265334_100584792 318
863 3300031344 Ga0265316_10032233 Ga0265316_100322336 318
864 3300031456 Ga0307513_10010205 Ga0307513_100102058 318
865 3300031456 Ga0307513_10070175 Ga0307513_100701752 318
866 3300031649 Ga0307514_10001033 Ga0307514_1000103335 318
867 3300031727 Ga0316576_10142533 Ga0316576_101425332 318
868 3300031727 Ga0316576_10146759 Ga0316576_101467593 318
869 3300031728 Ga0316578_10106884 Ga0316578_101068842 318
870 3300031903 Ga0307407_10090797 Ga0307407_100907971 318
871 3300035170 Ga0373943_0146870 Ga0373943_0146870_43_999 318
872 3300035398 Ga0316574_0128007 Ga0316574_0128007_506_1480 318
873 3300037312 Ga0395899_0011366 Ga0395899_0011366_1487_2443 318
874 3300037418 Ga0395900_0026724 Ga0395900_0026724_953_1915 318
875 3300037466 Ga0395898_0037745 Ga0395898_0037745_455_1411 318
876 3300037471 Ga0395905_0000043 Ga0395905_0000043_5639_6595 318
877 3300037471 Ga0395905_0031618 Ga0395905_0031618_1627_2583 318
878 3300037471 Ga0395905_0038385 Ga0395905_0038385_1898_2854 318
879 3300038443 Ga0395901_0075467 Ga0395901_0075467_982_1938 318
880 3300039062 Ga0400483_018531 Ga0400483_018531_44467_45423 318
881 3300039062 Ga0400483_219255 Ga0400483_219255_7856_8812 318
882 3300039110 Ga0400487_27682 Ga0400487_27682_550_1506 318
883 3300041999 Ga0439433_0026479 Ga0439433_0026479_287_1243 318
884 3300042007 Ga0439449_0060268 Ga0439449_0060268_126_1082 318
885 3300042876 Ga0451577_0333803 Ga0451577_0333803_170_1129 318
886 3300044673 Ga0453683_0011905 Ga0453683_0011905_241_1197 318
887 3300044712 Ga0453684_0000583 Ga0453684_0000583_125715_126674 318
888 3300045049 Ga0466959_0175644 Ga0466959_0175644_57_1013 318
889 3300045051 Ga0451576_0000137 Ga0451576_0000137_9267_10226 318
890 3300046460 Ga0495638_0000710 Ga0495638_0000710_3629_4585 318
891 3300046474 Ga0495605_0006813 Ga0495605_0006813_614_1570 318
892 3300046506 Ga0495583_0003737 Ga0495583_0003737_9713_10669 318
893 3300046528 Ga0495642_0005224 Ga0495642_0005224_3554_4510 318
894 3300046542 Ga0495597_0003270 Ga0495597_0003270_2706_3662 318
895 3300046616 Ga0495668_0057580 Ga0495668_0057580_806_1762 318
896 3300046691 Ga0495670_0000076 Ga0495670_0000076_42197_43153 318
897 3300049574 Ga0501038_0065221 Ga0501038_0065221_2037_2999 318
898 3300049575 Ga0501039_0072770 Ga0501039_0072770_1614_2576 318
899 3300049576 Ga0501040_0031012 Ga0501040_0031012_144_1106 318
900 3300049577 Ga0501041_0032257 Ga0501041_0032257_1149_2111 318
901 3300049585 Ga0501069_0086023 Ga0501069_0086023_448_1410 318
902 3300049587 Ga0501071_0092472 Ga0501071_0092472_78_1040 318
903 3300049588 Ga0501072_0047097 Ga0501072_0047097_862_1824 318
904 3300049592 Ga0501076_0325269 Ga0501076_0325269_56_1018 318
905 3300049822 Ga0501035_0038030 Ga0501035_0038030_1243_2202 318
906 3300049823 Ga0501044_0000515 Ga0501044_0000515_39203_40162 318
907 3300049824 Ga0501045_0014064 Ga0501045_0014064_1798_2760 318
908 3300050493 nmdc:mga0k408_104155_c1 nmdc:mga0k408_104155_c1_249_1205 318
909 3300050509 nmdc:mga0qj67_18502_c1 nmdc:mga0qj67_18502_c1_3873_4829 318
910 3300050511 nmdc:mga08y16_192423_c1 nmdc:mga08y16_192423_c1_661_1620 318
911 3300060353 Ga0501082_0076865 Ga0501082_0076865_1866_2834 318
912 3300003775 Ga0055524_1000117 Ga0055524_100011748 319
913 3300003794 Ga0055531_10001376 Ga0055531_1000137616 319
914 3300005262 Ga0065165_1000323 Ga0065165_100032357 319
915 3300005356 Ga0070674_100010407 Ga0070674_1000104074 319
916 3300005456 Ga0070678_100195244 Ga0070678_1001952442 319
917 3300006353 Ga0075370_10044816 Ga0075370_100448163 319
918 3300006844 Ga0075428_100005334 Ga0075428_1000053349 319
919 3300006847 Ga0075431_100009471 Ga0075431_1000094718 319
920 3300006880 Ga0075429_100029740 Ga0075429_1000297402 319
921 3300009094 Ga0111539_10046075 Ga0111539_100460752 319
922 3300009147 Ga0114129_10171988 Ga0114129_101719883 319
923 3300012497 Ga0157319_1000240 Ga0157319_10002402 319
924 3300013308 Ga0157375_10140086 Ga0157375_101400862 319
925 3300021361 Ga0213872_10000134 Ga0213872_1000013412 319
926 3300025253 Ga0209677_100280 Ga0209677_1002806 319
927 3300025261 Ga0209233_1002614 Ga0209233_10026144 319
928 3300025272 Ga0209455_1001166 Ga0209455_10011665 319
929 3300025272 Ga0209455_1006539 Ga0209455_10065392 319
930 3300025273 Ga0209673_1019006 Ga0209673_10190063 319
931 3300025295 Ga0209564_1000097 Ga0209564_1000097104 319
932 3300025299 Ga0209256_1000075 Ga0209256_100007584 319
933 3300025304 Ga0209257_1000244 Ga0209257_100024475 319
934 3300026089 Ga0207648_10124336 Ga0207648_101243362 319
935 3300026121 Ga0207683_10320388 Ga0207683_103203881 319
936 3300031247 Ga0265340_10005895 Ga0265340_100058952 319
937 3300031249 Ga0265339_10001335 Ga0265339_100013352 319
938 3300031852 Ga0307410_10172071 Ga0307410_101720712 319
939 3300034817 Ga0373948_0000494 Ga0373948_0000494_1828_2787 319
940 3300034820 Ga0373959_0002211 Ga0373959_0002211_448_1407 319
941 3300035114 Ga0373939_0000469 Ga0373939_0000469_6300_7259 319
942 3300035241 Ga0373961_0004472 Ga0373961_0004472_2018_2977 319
943 3300035242 Ga0373962_0001611 Ga0373962_0001611_2342_3301 319
944 3300035691 Ga0373931_0000097 Ga0373931_0000097_19759_20718 319
945 3300037471 Ga0395905_0078767 Ga0395905_0078767_1776_2741 319
946 3300039437 Ga0436365_1486157 Ga0436365_1486157_5030_5995 319
947 3300039447 Ga0436361_0455065 Ga0436361_0455065_15688_16647 319
948 3300041509 Ga0451843_1214629 Ga0451843_1214629_57_1016 319
949 3300041997 Ga0439431_0004185 Ga0439431_0004185_252_1214 319
950 3300042129 Ga0450891_001745 Ga0450891_001745_1114_2073 319
951 3300042130 Ga0450892_001022 Ga0450892_001022_501_1460 319
952 3300042438 Ga0439459_0001486 Ga0439459_0001486_837_1796 319
953 3300042876 Ga0451577_0302917 Ga0451577_0302917_327_1286 319
954 3300044842 Ga0466957_0160086 Ga0466957_0160086_187_1146 319
955 3300048917 Ga0496114_0141306 Ga0496114_0141306_694_1656 319
956 3300048921 Ga0496118_0014666 Ga0496118_0014666_4897_5856 319
957 3300048929 Ga0496126_0158743 Ga0496126_0158743_651_1625 319
958 3300049571 Ga0501034_0111063 Ga0501034_0111063_503_1465 319
959 3300049764 Ga0501267_002028 Ga0501267_002028_540_1499 319
960 3300050507 nmdc:mga05p37_176319_c1 nmdc:mga05p37_176319_c1_1613_2587 319
961 3300050508 nmdc:mga09592_31262_c1 nmdc:mga09592_31262_c1_651_1625 319
962 3300050510 nmdc:mga06r32_16238_c1 nmdc:mga06r32_16238_c1_1177_2151 319
963 3300050511 nmdc:mga08y16_143407_c1 nmdc:mga08y16_143407_c1_288_1262 319
964 3300053117 Ga0500593_000250 Ga0500593_000250_10120_11079 319
965 3300053139 Ga0500568_0011569 Ga0500568_0011569_1203_2162 319
966 3300053156 Ga0500622_0000970 Ga0500622_0000970_23298_24257 319
967 3300053156 Ga0500622_0006287 Ga0500622_0006287_5842_6801 319
968 3300053177 Ga0500636_0099119 Ga0500636_0099119_632_1603 319
969 2162886006 SwRhRL3b_contig_1627834 SwRhRL3b_0101.00001050 320
970 3300004625 Ga0055543_1004964 Ga0055543_10049642 320
971 3300005262 Ga0065165_1000864 Ga0065165_100086414 320
972 3300005331 Ga0070670_100187346 Ga0070670_1001873462 320
973 3300006177 Ga0075362_10066530 Ga0075362_100665302 320
974 3300006195 Ga0075366_10008288 Ga0075366_100082885 320
975 3300009092 Ga0105250_10000186 Ga0105250_100001864 320
976 3300014968 Ga0157379_10000207 Ga0157379_1000020742 320
977 3300025711 Ga0207696_1000072 Ga0207696_1000072196 320
978 3300031691 Ga0316579_10004261 Ga0316579_100042613 320
979 3300031727 Ga0316576_10147348 Ga0316576_101473482 320
980 3300031728 Ga0316578_10011530 Ga0316578_100115302 320
981 3300031733 Ga0316577_10100242 Ga0316577_101002422 320
982 3300032139 Ga0316580_10008604 Ga0316580_100086042 320
983 3300034818 Ga0373950_0003278 Ga0373950_0003278_420_1382 320
984 3300035121 Ga0373960_0002150 Ga0373960_0002150_339_1301 320
985 3300035398 Ga0316574_0019069 Ga0316574_0019069_1977_2963 320
986 3300036647 Ga0316582_0000235 Ga0316582_0000235_1084_2070 320
987 3300046471 Ga0495650_0013002 Ga0495650_0013002_3090_4052 320
988 3300047472 Ga0495686_0065500 Ga0495686_0065500_1134_2099 320
989 3300048907 Ga0496104_0079087 Ga0496104_0079087_1895_2863 320
990 3300048908 Ga0496105_0194455 Ga0496105_0194455_29_997 320
991 3300049568 Ga0501031_0002425 Ga0501031_0002425_982_1956 320
992 3300049568 Ga0501031_0017107 Ga0501031_0017107_277_1251 320
993 3300049570 Ga0501033_0008619 Ga0501033_0008619_3676_4650 320
994 3300049571 Ga0501034_0020044 Ga0501034_0020044_1160_2134 320
995 3300049571 Ga0501034_0046424 Ga0501034_0046424_1075_2049 320
996 3300049572 Ga0501036_0005963 Ga0501036_0005963_4825_5799 320
997 3300049573 Ga0501037_0013273 Ga0501037_0013273_3158_4132 320
998 3300049573 Ga0501037_0017406 Ga0501037_0017406_1979_2953 320
999 3300049579 Ga0501043_0011565 Ga0501043_0011565_4360_5334 320
1000 3300049579 Ga0501043_0099256 Ga0501043_0099256_565_1539 320
1001 3300049580 Ga0501046_0048422 Ga0501046_0048422_2038_3012 320
1002 3300049581 Ga0501047_0005052 Ga0501047_0005052_9107_10081 320
1003 3300049822 Ga0501035_0002048 Ga0501035_0002048_1921_2895 320
1004 3300049823 Ga0501044_0007899 Ga0501044_0007899_7630_8604 320
1005 3300050493 nmdc:mga0k408_44082_c1 nmdc:mga0k408_44082_c1_447_1409 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19858

OxRdtase_C

Bacterial oxidoreductases, C-terminal

158

320

1

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

5

124

0.96

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

136

256

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a3g-assembly1.cif.gz_B levoglucosan dehydrogenase, complex with nadh 0.8724 5 318
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8718 1 318
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8715 5 318
5ya8-assembly1.cif.gz_D crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol 0.8701 5 320
6a3f-assembly1.cif.gz_B-2 levoglucosan dehydrogenase, apo form 0.8681 3 318
ID Description Score Start End Superfamily
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9667 5 122 3.40.50.720
af_Q9VJH7_91_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9542 5 121 3.40.50.720
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 5 122 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9507 5 122 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9491 5 120 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3B8QQM0-F1-model_v4 Oxidoreductase 0.9782 120 316
AF-A0A6N8URL0-F1-model_v4 deleted 0.9725 1 95
AF-A0A3B8QQM0-F1-model_v4 Oxidoreductase 0.9638 120 316
AF-A0A3D0M678-F1-model_v4 Dehydrogenase 0.9593 3 143 GO:0000166
AF-A0A7W0GP34-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9553 2 142 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map