F484190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 447 | 862 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_101610594|Ga0307415_1016105942 |
| Length | 104 |
| Sequence | MAHKKGGGSTRNGRDSNAQRLGVKKFGGERVRAGNIIIRQRGTKFHPGANVGIGSDDTLFALVDGLVTFGRKDRDRKKVSVLPFSAFEAEAAELPTDVTEAAAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 3 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 4 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 5 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 6 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 7 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 8 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 9 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 10 | 3300003159 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 236 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 252 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 274 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 283 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 284 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 287 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 288 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 289 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 290 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 293 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 294 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 295 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 296 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 297 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 298 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 299 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 300 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 301 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 345 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 401 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 406 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 409 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 410 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 411 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 412 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 413 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 414 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 416 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 417 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 418 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 420 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 427 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 428 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 431 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 432 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 436 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 438 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 447 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.8 |
| Metatranscriptomes | 5.17 |
| Isolates | 1.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.81 |
| Nodule | 0 |
| Rhizoplane | 1.72 |
| Rhizosphere | 84.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC49637_b1 | 2010549000 | Bacteria | 875 |
| 2 | Ga0006771J45828_102739 | 3300003159 | Bacteria | 659 |
| 3 | Ga0006765J45826_108928 | 3300003161 | Bacteria | 519 |
| 4 | Ga0006759J45824_1021461 | 3300003163 | Bacteria | 642 |
| 5 | JGI25153J46596_10001505 | 3300003215 | Bacteria | 13889 |
| 6 | Ga0007417J51691_1040523 | 3300003544 | Bacteria | 638 |
| 7 | Ga0032354_1014035 | 3300003693 | Bacteria | 775 |
| 8 | Ga0032354_1100925 | 3300003693 | Bacteria | 521 |
| 9 | Ga0055531_10021622 | 3300003794 | Bacteria | 2487 |
| 10 | Ga0058860_12049493 | 3300004801 | Bacteria | 626 |
| 11 | Ga0065704_10072444 | 3300005289 | Bacteria | 8516 |
| 12 | Ga0065704_10311985 | 3300005289 | Bacteria | 867 |
| 13 | Ga0070658_10014007 | 3300005327 | Bacteria | 6438 |
| 14 | Ga0070658_10061090 | 3300005327 | Bacteria | 3069 |
| 15 | Ga0070683_100001211 | 3300005329 | Bacteria | 19600 |
| 16 | Ga0070683_100332912 | 3300005329 | Bacteria | 1445 |
| 17 | Ga0070683_102336919 | 3300005329 | Unclassified | 513 |
| 18 | Ga0070690_100324858 | 3300005330 | Bacteria | 1110 |
| 19 | Ga0070670_100021890 | 3300005331 | Bacteria | 5500 |
| 20 | Ga0068869_100001837 | 3300005334 | Bacteria | 12760 |
| 21 | Ga0068869_100642032 | 3300005334 | Bacteria | 900 |
| 22 | Ga0068869_100862558 | 3300005334 | Bacteria | 782 |
| 23 | Ga0070666_10198828 | 3300005335 | Bacteria | 1410 |
| 24 | Ga0070666_10431705 | 3300005335 | Bacteria | 950 |
| 25 | Ga0070666_11460322 | 3300005335 | Bacteria | 511 |
| 26 | Ga0068868_100004900 | 3300005338 | Bacteria | 9401 |
| 27 | Ga0068868_100007490 | 3300005338 | Bacteria | 7776 |
| 28 | Ga0070660_100415098 | 3300005339 | Bacteria | 1114 |
| 29 | Ga0070661_100005387 | 3300005344 | Bacteria | 8819 |
| 30 | Ga0070661_100107053 | 3300005344 | Bacteria | 2085 |
| 31 | Ga0070668_100493276 | 3300005347 | Bacteria | 1059 |
| 32 | Ga0070669_100008790 | 3300005353 | Bacteria | 7206 |
| 33 | Ga0070669_100281085 | 3300005353 | Bacteria | 1334 |
| 34 | Ga0070669_101690405 | 3300005353 | Bacteria | 552 |
| 35 | Ga0070675_100993008 | 3300005354 | Bacteria | 771 |
| 36 | Ga0070671_100040612 | 3300005355 | Bacteria | 3865 |
| 37 | Ga0070671_100090147 | 3300005355 | Bacteria | 2567 |
| 38 | Ga0070674_100054340 | 3300005356 | Bacteria | 2770 |
| 39 | Ga0070674_100084170 | 3300005356 | Bacteria | 2280 |
| 40 | Ga0070688_101527846 | 3300005365 | Bacteria | 544 |
| 41 | Ga0070667_100005595 | 3300005367 | Bacteria | 10493 |
| 42 | Ga0070667_101165405 | 3300005367 | Bacteria | 721 |
| 43 | Ga0070714_100050959 | 3300005435 | Bacteria | 3529 |
| 44 | Ga0070714_100378014 | 3300005435 | Bacteria | 1335 |
| 45 | Ga0070713_101090290 | 3300005436 | Bacteria | 772 |
| 46 | Ga0070710_10167496 | 3300005437 | Bacteria | 1367 |
| 47 | Ga0070711_100112806 | 3300005439 | Bacteria | 1998 |
| 48 | Ga0070711_101067854 | 3300005439 | Bacteria | 695 |
| 49 | Ga0070705_100375867 | 3300005440 | Bacteria | 1044 |
| 50 | Ga0070705_100864354 | 3300005440 | Bacteria | 725 |
| 51 | Ga0070700_100506033 | 3300005441 | Bacteria | 930 |
| 52 | Ga0070708_101007379 | 3300005445 | Bacteria | 781 |
| 53 | Ga0070708_101097764 | 3300005445 | Bacteria | 745 |
| 54 | Ga0070663_102015109 | 3300005455 | Bacteria | 520 |
| 55 | Ga0070678_100606996 | 3300005456 | Bacteria | 977 |
| 56 | Ga0070678_101661282 | 3300005456 | Bacteria | 600 |
| 57 | Ga0070681_10251756 | 3300005458 | Bacteria | 1679 |
| 58 | Ga0068867_100341612 | 3300005459 | Bacteria | 1247 |
| 59 | Ga0070706_100197905 | 3300005467 | Bacteria | 1877 |
| 60 | Ga0070706_101529863 | 3300005467 | Bacteria | 609 |
| 61 | Ga0070707_100157444 | 3300005468 | Bacteria | 2213 |
| 62 | Ga0070707_101185530 | 3300005468 | Bacteria | 730 |
| 63 | Ga0070698_100626424 | 3300005471 | Bacteria | 1016 |
| 64 | Ga0070679_101559392 | 3300005530 | Bacteria | 608 |
| 65 | Ga0070684_100011471 | 3300005535 | Bacteria | 7058 |
| 66 | Ga0070684_100228194 | 3300005535 | Bacteria | 1700 |
| 67 | Ga0068853_100250593 | 3300005539 | Bacteria | 1625 |
| 68 | Ga0068853_100313409 | 3300005539 | Bacteria | 1453 |
| 69 | Ga0068853_101275828 | 3300005539 | Bacteria | 710 |
| 70 | Ga0068853_102492998 | 3300005539 | Bacteria | 501 |
| 71 | Ga0070672_101843893 | 3300005543 | Bacteria | 544 |
| 72 | Ga0070686_100223163 | 3300005544 | Bacteria | 1363 |
| 73 | Ga0070696_101822468 | 3300005546 | Bacteria | 526 |
| 74 | Ga0070665_100154539 | 3300005548 | Bacteria | 2296 |
| 75 | Ga0070665_100685797 | 3300005548 | Bacteria | 1037 |
| 76 | Ga0070665_100865750 | 3300005548 | Bacteria | 917 |
| 77 | Ga0070704_100122034 | 3300005549 | Bacteria | 2004 |
| 78 | Ga0068855_100000872 | 3300005563 | Bacteria | 37469 |
| 79 | Ga0068855_100018642 | 3300005563 | Bacteria | 8346 |
| 80 | Ga0068855_101113995 | 3300005563 | Bacteria | 825 |
| 81 | Ga0070664_100102401 | 3300005564 | Bacteria | 2491 |
| 82 | Ga0070664_101683220 | 3300005564 | Bacteria | 601 |
| 83 | Ga0070664_101951841 | 3300005564 | Bacteria | 557 |
| 84 | Ga0068857_100014330 | 3300005577 | Bacteria | 6909 |
| 85 | Ga0068857_100615082 | 3300005577 | Bacteria | 1028 |
| 86 | Ga0068857_100785092 | 3300005577 | Bacteria | 909 |
| 87 | Ga0068854_100410490 | 3300005578 | Bacteria | 1122 |
| 88 | Ga0068854_100766745 | 3300005578 | Bacteria | 838 |
| 89 | Ga0068856_100008202 | 3300005614 | Bacteria | 10186 |
| 90 | Ga0068856_100438372 | 3300005614 | Bacteria | 1327 |
| 91 | Ga0068856_101098719 | 3300005614 | Bacteria | 813 |
| 92 | Ga0068856_101167549 | 3300005614 | Bacteria | 786 |
| 93 | Ga0068852_100000015 | 3300005616 | Bacteria | 134085 |
| 94 | Ga0068852_100029234 | 3300005616 | Bacteria | 4524 |
| 95 | Ga0068852_101516901 | 3300005616 | Unclassified | 692 |
| 96 | Ga0068859_100008964 | 3300005617 | Bacteria | 10104 |
| 97 | Ga0068859_100825558 | 3300005617 | Bacteria | 1014 |
| 98 | Ga0068864_100006989 | 3300005618 | Bacteria | 9259 |
| 99 | Ga0068864_102184838 | 3300005618 | Bacteria | 560 |
| 100 | Ga0068861_100694630 | 3300005719 | Bacteria | 945 |
| 101 | Ga0068851_10005020 | 3300005834 | Bacteria | 5998 |
| 102 | Ga0068851_10006556 | 3300005834 | Bacteria | 5320 |
| 103 | Ga0068851_10975631 | 3300005834 | Bacteria | 534 |
| 104 | Ga0068870_11138186 | 3300005840 | Bacteria | 563 |
| 105 | Ga0068863_100003161 | 3300005841 | Bacteria | 16271 |
| 106 | Ga0068858_100001902 | 3300005842 | Bacteria | 21302 |
| 107 | Ga0068860_100000809 | 3300005843 | Bacteria | 35018 |
| 108 | Ga0068860_102281767 | 3300005843 | Bacteria | 562 |
| 109 | Ga0068862_100009301 | 3300005844 | Bacteria | 8135 |
| 110 | Ga0068862_100011360 | 3300005844 | Bacteria | 7353 |
| 111 | Ga0068862_100302218 | 3300005844 | Bacteria | 1472 |
| 112 | Ga0081455_10004869 | 3300005937 | Bacteria | 14891 |
| 113 | Ga0081455_10046010 | 3300005937 | Unclassified | 3791 |
| 114 | Ga0081455_10201084 | 3300005937 | Bacteria | 1492 |
| 115 | Ga0081455_10982842 | 3300005937 | Bacteria | 523 |
| 116 | Ga0081540_1212760 | 3300005983 | Bacteria | 694 |
| 117 | Ga0081539_10065440 | 3300005985 | Bacteria | 1974 |
| 118 | Ga0070717_10909874 | 3300006028 | Bacteria | 801 |
| 119 | Ga0075364_10009158 | 3300006051 | Bacteria | 5931 |
| 120 | Ga0070715_10226637 | 3300006163 | Bacteria | 964 |
| 121 | Ga0070712_100340940 | 3300006175 | Bacteria | 1224 |
| 122 | Ga0075362_10096835 | 3300006177 | Bacteria | 1376 |
| 123 | Ga0075362_10295735 | 3300006177 | Bacteria | 803 |
| 124 | Ga0075362_10445905 | 3300006177 | Bacteria | 657 |
| 125 | Ga0075367_10537675 | 3300006178 | Bacteria | 742 |
| 126 | Ga0075366_10001813 | 3300006195 | Bacteria | 10789 |
| 127 | Ga0075366_10240061 | 3300006195 | Bacteria | 1105 |
| 128 | Ga0075366_10460424 | 3300006195 | Bacteria | 785 |
| 129 | Ga0097621_100009947 | 3300006237 | Bacteria | 6931 |
| 130 | Ga0075370_10368488 | 3300006353 | Bacteria | 860 |
| 131 | Ga0068871_100139822 | 3300006358 | Bacteria | 2058 |
| 132 | Ga0068871_101617491 | 3300006358 | Bacteria | 613 |
| 133 | Ga0068871_101755968 | 3300006358 | Bacteria | 589 |
| 134 | Ga0075428_100880074 | 3300006844 | Unclassified | 950 |
| 135 | Ga0075428_101135696 | 3300006844 | Bacteria | 825 |
| 136 | Ga0075428_102175600 | 3300006844 | Bacteria | 572 |
| 137 | Ga0075431_100061803 | 3300006847 | Bacteria | 3865 |
| 138 | Ga0075431_100487712 | 3300006847 | Bacteria | 1224 |
| 139 | Ga0075431_100639006 | 3300006847 | Bacteria | 1045 |
| 140 | Ga0075431_100647412 | 3300006847 | Bacteria | 1037 |
| 141 | Ga0075431_100884428 | 3300006847 | Bacteria | 863 |
| 142 | Ga0075431_101335087 | 3300006847 | Bacteria | 677 |
| 143 | Ga0075433_10164977 | 3300006852 | Bacteria | 1971 |
| 144 | Ga0075433_10394147 | 3300006852 | Bacteria | 1222 |
| 145 | Ga0075433_10983799 | 3300006852 | Bacteria | 735 |
| 146 | Ga0075434_100907915 | 3300006871 | Bacteria | 896 |
| 147 | Ga0075429_100596824 | 3300006880 | Bacteria | 967 |
| 148 | Ga0068865_100470783 | 3300006881 | Bacteria | 1042 |
| 149 | Ga0097620_100008964 | 3300006931 | Bacteria | 10104 |
| 150 | Ga0097620_100825400 | 3300006931 | Bacteria | 1014 |
| 151 | Ga0075435_100321182 | 3300007076 | Bacteria | 1325 |
| 152 | Ga0105251_10440078 | 3300009011 | Bacteria | 603 |
| 153 | Ga0105240_10000181 | 3300009093 | Bacteria | 128067 |
| 154 | Ga0105240_10003931 | 3300009093 | Bacteria | 22956 |
| 155 | Ga0105240_10599373 | 3300009093 | Bacteria | 1213 |
| 156 | Ga0105240_10916213 | 3300009093 | Bacteria | 942 |
| 157 | Ga0105240_11446537 | 3300009093 | Bacteria | 722 |
| 158 | Ga0105240_11620700 | 3300009093 | Bacteria | 677 |
| 159 | Ga0105240_11717552 | 3300009093 | Unclassified | 655 |
| 160 | Ga0111539_10053174 | 3300009094 | Bacteria | 4820 |
| 161 | Ga0111539_10643372 | 3300009094 | Bacteria | 1235 |
| 162 | Ga0111539_10943369 | 3300009094 | Bacteria | 1003 |
| 163 | Ga0111539_12990888 | 3300009094 | Bacteria | 546 |
| 164 | Ga0105245_10010929 | 3300009098 | Bacteria | 7898 |
| 165 | Ga0105245_10012850 | 3300009098 | Bacteria | 7295 |
| 166 | Ga0105247_10024995 | 3300009101 | Bacteria | 3602 |
| 167 | Ga0105247_10112463 | 3300009101 | Bacteria | 1754 |
| 168 | Ga0114129_10687122 | 3300009147 | Bacteria | 1317 |
| 169 | Ga0114129_11574453 | 3300009147 | Bacteria | 805 |
| 170 | Ga0114129_13037071 | 3300009147 | Unclassified | 551 |
| 171 | Ga0114129_13071937 | 3300009147 | Unclassified | 547 |
| 172 | Ga0105243_11732571 | 3300009148 | Bacteria | 654 |
| 173 | Ga0105241_10000076 | 3300009174 | Bacteria | 74496 |
| 174 | Ga0105241_10004665 | 3300009174 | Bacteria | 10129 |
| 175 | Ga0105241_10484211 | 3300009174 | Bacteria | 1100 |
| 176 | Ga0105241_11473968 | 3300009174 | Bacteria | 654 |
| 177 | Ga0105241_11735213 | 3300009174 | Bacteria | 607 |
| 178 | Ga0105242_10011064 | 3300009176 | Bacteria | 6932 |
| 179 | Ga0105248_10093271 | 3300009177 | Bacteria | 3390 |
| 180 | Ga0105248_11033458 | 3300009177 | Bacteria | 928 |
| 181 | Ga0105248_11103110 | 3300009177 | Bacteria | 897 |
| 182 | Ga0105248_11584326 | 3300009177 | Bacteria | 742 |
| 183 | Ga0105237_10007181 | 3300009545 | Bacteria | 12235 |
| 184 | Ga0105237_10101571 | 3300009545 | Bacteria | 2868 |
| 185 | Ga0105237_10583491 | 3300009545 | Bacteria | 1125 |
| 186 | Ga0105237_11177676 | 3300009545 | Bacteria | 773 |
| 187 | Ga0105238_10008228 | 3300009551 | Bacteria | 10432 |
| 188 | Ga0105238_10009668 | 3300009551 | Bacteria | 9651 |
| 189 | Ga0105238_10021454 | 3300009551 | Bacteria | 6578 |
| 190 | Ga0105238_10859662 | 3300009551 | Bacteria | 924 |
| 191 | Ga0105238_12120466 | 3300009551 | Bacteria | 596 |
| 192 | Ga0105249_10238483 | 3300009553 | Bacteria | 1797 |
| 193 | Ga0105239_10098590 | 3300010375 | Bacteria | 3230 |
| 194 | Ga0105239_10099080 | 3300010375 | Bacteria | 3222 |
| 195 | Ga0105239_10204266 | 3300010375 | Bacteria | 2214 |
| 196 | Ga0105239_11452286 | 3300010375 | Unclassified | 792 |
| 197 | Ga0105239_12152431 | 3300010375 | Bacteria | 648 |
| 198 | Ga0105246_10003503 | 3300011119 | Bacteria | 9500 |
| 199 | Ga0157373_10066560 | 3300013100 | Bacteria | 2548 |
| 200 | Ga0157373_10715598 | 3300013100 | Bacteria | 734 |
| 201 | Ga0157373_11075886 | 3300013100 | Bacteria | 602 |
| 202 | Ga0157373_11256781 | 3300013100 | Bacteria | 559 |
| 203 | Ga0157371_10046851 | 3300013102 | Bacteria | 3073 |
| 204 | Ga0157370_10000196 | 3300013104 | Bacteria | 75917 |
| 205 | Ga0157369_10000241 | 3300013105 | Bacteria | 75794 |
| 206 | Ga0157369_10015458 | 3300013105 | Bacteria | 8600 |
| 207 | Ga0157369_10063405 | 3300013105 | Unclassified | 3982 |
| 208 | Ga0157369_10143969 | 3300013105 | Bacteria | 2520 |
| 209 | Ga0157369_10451149 | 3300013105 | Bacteria | 1332 |
| 210 | Ga0157369_10681824 | 3300013105 | Unclassified | 1059 |
| 211 | Ga0157374_10011932 | 3300013296 | Bacteria | 7542 |
| 212 | Ga0157374_10055775 | 3300013296 | Unclassified | 3688 |
| 213 | Ga0157374_10093790 | 3300013296 | Bacteria | 2867 |
| 214 | Ga0157374_10094415 | 3300013296 | Bacteria | 2858 |
| 215 | Ga0157374_10471857 | 3300013296 | Bacteria | 1257 |
| 216 | Ga0157374_11653258 | 3300013296 | Bacteria | 665 |
| 217 | Ga0157378_10025125 | 3300013297 | Bacteria | 5248 |
| 218 | Ga0157378_10250805 | 3300013297 | Bacteria | 1694 |
| 219 | Ga0163162_10179923 | 3300013306 | Bacteria | 2240 |
| 220 | Ga0163162_10838192 | 3300013306 | Bacteria | 1035 |
| 221 | Ga0163162_12795497 | 3300013306 | Bacteria | 562 |
| 222 | Ga0157372_10000197 | 3300013307 | Bacteria | 66368 |
| 223 | Ga0157372_10005898 | 3300013307 | Bacteria | 13040 |
| 224 | Ga0157372_10101037 | 3300013307 | Bacteria | 3292 |
| 225 | Ga0157372_10257589 | 3300013307 | Bacteria | 2026 |
| 226 | Ga0157372_10670785 | 3300013307 | Bacteria | 1207 |
| 227 | Ga0157372_11388256 | 3300013307 | Bacteria | 810 |
| 228 | Ga0157375_10005518 | 3300013308 | Bacteria | 11007 |
| 229 | Ga0157375_10032187 | 3300013308 | Bacteria | 4971 |
| 230 | Ga0157375_11737436 | 3300013308 | Bacteria | 739 |
| 231 | Ga0157375_11964651 | 3300013308 | Bacteria | 695 |
| 232 | Ga0157375_12277894 | 3300013308 | Bacteria | 646 |
| 233 | Ga0157375_12892096 | 3300013308 | Bacteria | 574 |
| 234 | Ga0163163_10001103 | 3300014325 | Bacteria | 22908 |
| 235 | Ga0157380_10103788 | 3300014326 | Bacteria | 2373 |
| 236 | Ga0157379_10000092 | 3300014968 | Bacteria | 60487 |
| 237 | Ga0157379_10072593 | 3300014968 | Bacteria | 3079 |
| 238 | Ga0157379_10295212 | 3300014968 | Bacteria | 1476 |
| 239 | Ga0157376_10001138 | 3300014969 | Bacteria | 17451 |
| 240 | Ga0157376_10010621 | 3300014969 | Bacteria | 6743 |
| 241 | Ga0157376_11777445 | 3300014969 | Bacteria | 652 |
| 242 | Ga0157376_12903748 | 3300014969 | Bacteria | 519 |
| 243 | Ga0163161_10877528 | 3300017792 | Bacteria | 759 |
| 244 | Ga0197907_10371255 | 3300020069 | Bacteria | 1514 |
| 245 | Ga0206356_10144882 | 3300020070 | Bacteria | 631 |
| 246 | Ga0206349_1174937 | 3300020075 | Bacteria | 1116 |
| 247 | Ga0206355_1316834 | 3300020076 | Bacteria | 1812 |
| 248 | Ga0206351_10796194 | 3300020077 | Unclassified | 916 |
| 249 | Ga0206352_11254640 | 3300020078 | Bacteria | 1961 |
| 250 | Ga0206350_11185957 | 3300020080 | Bacteria | 1413 |
| 251 | Ga0206354_10521497 | 3300020081 | Bacteria | 810 |
| 252 | Ga0206354_11484000 | 3300020081 | Unclassified | 988 |
| 253 | Ga0154015_1280778 | 3300020610 | Bacteria | 632 |
| 254 | Ga0213874_10109898 | 3300021377 | Bacteria | 926 |
| 255 | Ga0213874_10384451 | 3300021377 | Bacteria | 543 |
| 256 | Ga0213876_10394154 | 3300021384 | Bacteria | 736 |
| 257 | Ga0213875_10053554 | 3300021388 | Bacteria | 1890 |
| 258 | Ga0224712_10099893 | 3300022467 | Bacteria | 1229 |
| 259 | Ga0209758_1000060 | 3300025297 | Bacteria | 324326 |
| 260 | Ga0209050_1003616 | 3300025298 | Bacteria | 11210 |
| 261 | Ga0209051_1068666 | 3300025303 | Bacteria | 1078 |
| 262 | Ga0209257_1000589 | 3300025304 | Bacteria | 60641 |
| 263 | Ga0207656_10019549 | 3300025321 | Bacteria | 2680 |
| 264 | Ga0207656_10582918 | 3300025321 | Bacteria | 571 |
| 265 | Ga0207653_10261502 | 3300025885 | Bacteria | 665 |
| 266 | Ga0207642_10313005 | 3300025899 | Bacteria | 914 |
| 267 | Ga0207710_10002483 | 3300025900 | Bacteria | 8535 |
| 268 | Ga0207688_10356825 | 3300025901 | Bacteria | 901 |
| 269 | Ga0207680_10498227 | 3300025903 | Bacteria | 867 |
| 270 | Ga0207680_10690005 | 3300025903 | Bacteria | 732 |
| 271 | Ga0207647_10130798 | 3300025904 | Bacteria | 1475 |
| 272 | Ga0207685_10205860 | 3300025905 | Bacteria | 927 |
| 273 | Ga0207643_10977793 | 3300025908 | Bacteria | 548 |
| 274 | Ga0207705_10066203 | 3300025909 | Bacteria | 2613 |
| 275 | Ga0207705_10132720 | 3300025909 | Bacteria | 1854 |
| 276 | Ga0207705_11102940 | 3300025909 | Bacteria | 611 |
| 277 | Ga0207684_10347471 | 3300025910 | Bacteria | 1277 |
| 278 | Ga0207684_10885696 | 3300025910 | Bacteria | 751 |
| 279 | Ga0207654_10000025 | 3300025911 | Bacteria | 143807 |
| 280 | Ga0207654_10000035 | 3300025911 | Bacteria | 112494 |
| 281 | Ga0207654_10000682 | 3300025911 | Bacteria | 19017 |
| 282 | Ga0207654_10636562 | 3300025911 | Bacteria | 763 |
| 283 | Ga0207654_10733351 | 3300025911 | Bacteria | 711 |
| 284 | Ga0207654_11234484 | 3300025911 | Unclassified | 545 |
| 285 | Ga0207707_10303295 | 3300025912 | Bacteria | 1381 |
| 286 | Ga0207707_10785072 | 3300025912 | Bacteria | 794 |
| 287 | Ga0207695_10000069 | 3300025913 | Bacteria | 319955 |
| 288 | Ga0207695_10000314 | 3300025913 | Bacteria | 116506 |
| 289 | Ga0207695_10174637 | 3300025913 | Bacteria | 2072 |
| 290 | Ga0207695_11152662 | 3300025913 | Bacteria | 655 |
| 291 | Ga0207695_11682570 | 3300025913 | Bacteria | 515 |
| 292 | Ga0207671_10002931 | 3300025914 | Bacteria | 17583 |
| 293 | Ga0207671_10123572 | 3300025914 | Bacteria | 1980 |
| 294 | Ga0207671_10435488 | 3300025914 | Bacteria | 1044 |
| 295 | Ga0207671_10862354 | 3300025914 | Bacteria | 717 |
| 296 | Ga0207693_10638839 | 3300025915 | Bacteria | 827 |
| 297 | Ga0207693_11357758 | 3300025915 | Bacteria | 529 |
| 298 | Ga0207663_10533746 | 3300025916 | Bacteria | 915 |
| 299 | Ga0207663_11003777 | 3300025916 | Bacteria | 669 |
| 300 | Ga0207649_10323819 | 3300025920 | Bacteria | 1133 |
| 301 | Ga0207649_10821401 | 3300025920 | Bacteria | 726 |
| 302 | Ga0207649_10891506 | 3300025920 | Bacteria | 697 |
| 303 | Ga0207646_10108845 | 3300025922 | Bacteria | 2487 |
| 304 | Ga0207646_11304519 | 3300025922 | Bacteria | 634 |
| 305 | Ga0207681_10081987 | 3300025923 | Bacteria | 2279 |
| 306 | Ga0207681_10262972 | 3300025923 | Bacteria | 1351 |
| 307 | Ga0207694_10001968 | 3300025924 | Bacteria | 16996 |
| 308 | Ga0207694_10202911 | 3300025924 | Bacteria | 1614 |
| 309 | Ga0207694_10250443 | 3300025924 | Bacteria | 1449 |
| 310 | Ga0207694_10776372 | 3300025924 | Bacteria | 809 |
| 311 | Ga0207650_10011074 | 3300025925 | Bacteria | 6201 |
| 312 | Ga0207687_10007042 | 3300025927 | Bacteria | 7412 |
| 313 | Ga0207687_10168503 | 3300025927 | Bacteria | 1687 |
| 314 | Ga0207664_10287335 | 3300025929 | Bacteria | 1444 |
| 315 | Ga0207664_10655602 | 3300025929 | Bacteria | 943 |
| 316 | Ga0207664_11492578 | 3300025929 | Bacteria | 597 |
| 317 | Ga0207644_10009369 | 3300025931 | Bacteria | 6431 |
| 318 | Ga0207644_10028764 | 3300025931 | Bacteria | 3851 |
| 319 | Ga0207644_10637441 | 3300025931 | Bacteria | 886 |
| 320 | Ga0207686_10005026 | 3300025934 | Bacteria | 7119 |
| 321 | Ga0207709_10699424 | 3300025935 | Bacteria | 811 |
| 322 | Ga0207669_10092981 | 3300025937 | Bacteria | 1969 |
| 323 | Ga0207669_10140090 | 3300025937 | Bacteria | 1677 |
| 324 | Ga0207704_10242211 | 3300025938 | Bacteria | 1348 |
| 325 | Ga0207704_10355622 | 3300025938 | Bacteria | 1142 |
| 326 | Ga0207665_10635632 | 3300025939 | Bacteria | 836 |
| 327 | Ga0207711_10103727 | 3300025941 | Bacteria | 2518 |
| 328 | Ga0207711_10571149 | 3300025941 | Bacteria | 1055 |
| 329 | Ga0207689_10003813 | 3300025942 | Bacteria | 13740 |
| 330 | Ga0207661_10030494 | 3300025944 | Bacteria | 4154 |
| 331 | Ga0207661_11638208 | 3300025944 | Bacteria | 588 |
| 332 | Ga0207679_10292687 | 3300025945 | Bacteria | 1400 |
| 333 | Ga0207679_10304259 | 3300025945 | Bacteria | 1375 |
| 334 | Ga0207679_11038793 | 3300025945 | Bacteria | 751 |
| 335 | Ga0207667_10011113 | 3300025949 | Bacteria | 10482 |
| 336 | Ga0207667_10238278 | 3300025949 | Bacteria | 1862 |
| 337 | Ga0207667_11441625 | 3300025949 | Bacteria | 661 |
| 338 | Ga0207667_12146998 | 3300025949 | Bacteria | 516 |
| 339 | Ga0207712_10145284 | 3300025961 | Bacteria | 1825 |
| 340 | Ga0207712_11411319 | 3300025961 | Bacteria | 623 |
| 341 | Ga0207668_11876898 | 3300025972 | Bacteria | 540 |
| 342 | Ga0207640_10311147 | 3300025981 | Bacteria | 1250 |
| 343 | Ga0207640_10737603 | 3300025981 | Unclassified | 848 |
| 344 | Ga0207658_10004440 | 3300025986 | Bacteria | 9756 |
| 345 | Ga0207658_10758538 | 3300025986 | Bacteria | 879 |
| 346 | Ga0207658_10939172 | 3300025986 | Bacteria | 788 |
| 347 | Ga0207677_10000104 | 3300026023 | Bacteria | 70036 |
| 348 | Ga0207677_10167947 | 3300026023 | Bacteria | 1712 |
| 349 | Ga0207703_10001493 | 3300026035 | Bacteria | 21338 |
| 350 | Ga0207639_10001965 | 3300026041 | Bacteria | 13822 |
| 351 | Ga0207639_10002214 | 3300026041 | Bacteria | 13095 |
| 352 | Ga0207639_10459529 | 3300026041 | Bacteria | 1157 |
| 353 | Ga0207639_10933026 | 3300026041 | Bacteria | 812 |
| 354 | Ga0207639_11950938 | 3300026041 | Bacteria | 548 |
| 355 | Ga0207678_10176897 | 3300026067 | Bacteria | 1822 |
| 356 | Ga0207678_10927039 | 3300026067 | Bacteria | 770 |
| 357 | Ga0207708_10586807 | 3300026075 | Bacteria | 943 |
| 358 | Ga0207702_10023448 | 3300026078 | Bacteria | 5118 |
| 359 | Ga0207702_10517983 | 3300026078 | Bacteria | 1164 |
| 360 | Ga0207702_10559119 | 3300026078 | Bacteria | 1120 |
| 361 | Ga0207641_10000809 | 3300026088 | Bacteria | 33415 |
| 362 | Ga0207648_10221843 | 3300026089 | Bacteria | 1680 |
| 363 | Ga0207648_10591210 | 3300026089 | Bacteria | 1022 |
| 364 | Ga0207676_10000862 | 3300026095 | Bacteria | 23512 |
| 365 | Ga0207676_12203674 | 3300026095 | Bacteria | 549 |
| 366 | Ga0207674_10003615 | 3300026116 | Bacteria | 18846 |
| 367 | Ga0207674_10150239 | 3300026116 | Bacteria | 2287 |
| 368 | Ga0207674_10883178 | 3300026116 | Bacteria | 862 |
| 369 | Ga0207675_100022885 | 3300026118 | Bacteria | 5813 |
| 370 | Ga0207675_100685028 | 3300026118 | Bacteria | 1033 |
| 371 | Ga0207683_10616014 | 3300026121 | Bacteria | 1005 |
| 372 | Ga0207683_11325060 | 3300026121 | Bacteria | 666 |
| 373 | Ga0207698_10000006 | 3300026142 | Bacteria | 291847 |
| 374 | Ga0207698_10042739 | 3300026142 | Bacteria | 3389 |
| 375 | Ga0207698_10228774 | 3300026142 | Bacteria | 1686 |
| 376 | Ga0207698_11230778 | 3300026142 | Bacteria | 763 |
| 377 | Ga0207698_11387992 | 3300026142 | Bacteria | 717 |
| 378 | Ga0209969_1032591 | 3300027360 | Bacteria | 798 |
| 379 | Ga0209995_1011891 | 3300027471 | Bacteria | 1417 |
| 380 | Ga0209968_1098309 | 3300027526 | Bacteria | 533 |
| 381 | Ga0210002_1009035 | 3300027617 | Bacteria | 1521 |
| 382 | Ga0209983_1135632 | 3300027665 | Bacteria | 563 |
| 383 | Ga0209971_1011208 | 3300027682 | Bacteria | 2123 |
| 384 | Ga0209974_10094884 | 3300027876 | Bacteria | 1037 |
| 385 | Ga0209974_10274054 | 3300027876 | Bacteria | 640 |
| 386 | Ga0207428_10056948 | 3300027907 | Unclassified | 3105 |
| 387 | Ga0207428_10425227 | 3300027907 | Bacteria | 970 |
| 388 | Ga0268266_10012086 | 3300028379 | Bacteria | 7471 |
| 389 | Ga0268265_10006082 | 3300028380 | Bacteria | 8197 |
| 390 | Ga0268265_10041752 | 3300028380 | Bacteria | 3398 |
| 391 | Ga0268265_11597889 | 3300028380 | Bacteria | 657 |
| 392 | Ga0268264_10001031 | 3300028381 | Bacteria | 28009 |
| 393 | Ga0268264_10851745 | 3300028381 | Bacteria | 913 |
| 394 | Ga0265337_1000286 | 3300028556 | Bacteria | 27344 |
| 395 | Ga0265326_10000350 | 3300028558 | Bacteria | 19576 |
| 396 | Ga0265326_10039899 | 3300028558 | Bacteria | 1333 |
| 397 | Ga0265326_10041653 | 3300028558 | Bacteria | 1304 |
| 398 | Ga0265326_10239133 | 3300028558 | Bacteria | 524 |
| 399 | Ga0265319_1000346 | 3300028563 | Bacteria | 33963 |
| 400 | Ga0265319_1007043 | 3300028563 | Bacteria | 5112 |
| 401 | Ga0265334_10001979 | 3300028573 | Bacteria | 9740 |
| 402 | Ga0265318_10000921 | 3300028577 | Bacteria | 19069 |
| 403 | Ga0265318_10041897 | 3300028577 | Bacteria | 1738 |
| 404 | Ga0265318_10220345 | 3300028577 | Unclassified | 693 |
| 405 | Ga0265323_10000609 | 3300028653 | Bacteria | 19714 |
| 406 | Ga0265323_10151069 | 3300028653 | Bacteria | 744 |
| 407 | Ga0265322_10000064 | 3300028654 | Bacteria | 52341 |
| 408 | Ga0265322_10001372 | 3300028654 | Bacteria | 8041 |
| 409 | Ga0265322_10001389 | 3300028654 | Bacteria | 7985 |
| 410 | Ga0265322_10036758 | 3300028654 | Bacteria | 1395 |
| 411 | Ga0265336_10000088 | 3300028666 | Bacteria | 70739 |
| 412 | Ga0307517_10572697 | 3300028786 | Bacteria | 560 |
| 413 | Ga0307515_10005786 | 3300028794 | Bacteria | 24955 |
| 414 | Ga0307515_10045397 | 3300028794 | Bacteria | 6752 |
| 415 | Ga0265338_10000783 | 3300028800 | Bacteria | 53845 |
| 416 | Ga0265338_10002272 | 3300028800 | Bacteria | 29267 |
| 417 | Ga0265338_10003453 | 3300028800 | Bacteria | 22250 |
| 418 | Ga0265338_10003505 | 3300028800 | Bacteria | 22005 |
| 419 | Ga0265338_10007366 | 3300028800 | Bacteria | 13691 |
| 420 | Ga0265338_10011065 | 3300028800 | Bacteria | 10463 |
| 421 | Ga0265338_10042888 | 3300028800 | Bacteria | 4205 |
| 422 | Ga0265338_10100984 | 3300028800 | Bacteria | 2350 |
| 423 | Ga0265338_10366481 | 3300028800 | Bacteria | 1032 |
| 424 | Ga0265338_10701813 | 3300028800 | Bacteria | 698 |
| 425 | Ga0265338_10878674 | 3300028800 | Bacteria | 611 |
| 426 | Ga0265324_10003377 | 3300029957 | Bacteria | 7628 |
| 427 | Ga0265324_10005065 | 3300029957 | Bacteria | 5770 |
| 428 | Ga0265324_10015573 | 3300029957 | Bacteria | 2793 |
| 429 | Ga0265324_10200638 | 3300029957 | Bacteria | 677 |
| 430 | Ga0307512_10087049 | 3300030522 | Bacteria | 2203 |
| 431 | Ga0265330_10001755 | 3300031235 | Bacteria | 12177 |
| 432 | Ga0265330_10157856 | 3300031235 | Unclassified | 963 |
| 433 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 434 | Ga0265332_10000125 | 3300031238 | Bacteria | 63932 |
| 435 | Ga0265332_10008075 | 3300031238 | Bacteria | 4733 |
| 436 | Ga0265332_10151220 | 3300031238 | Bacteria | 971 |
| 437 | Ga0265328_10001890 | 3300031239 | Bacteria | 9513 |
| 438 | Ga0265320_10000957 | 3300031240 | Bacteria | 21510 |
| 439 | Ga0265320_10004168 | 3300031240 | Bacteria | 9500 |
| 440 | Ga0265320_10263729 | 3300031240 | Bacteria | 763 |
| 441 | Ga0265325_10006585 | 3300031241 | Bacteria | 7036 |
| 442 | Ga0265325_10034346 | 3300031241 | Bacteria | 2699 |
| 443 | Ga0265325_10115242 | 3300031241 | Bacteria | 1301 |
| 444 | Ga0265329_10001200 | 3300031242 | Bacteria | 12718 |
| 445 | Ga0265329_10349787 | 3300031242 | Bacteria | 506 |
| 446 | Ga0265340_10000443 | 3300031247 | Bacteria | 22336 |
| 447 | Ga0265340_10029762 | 3300031247 | Bacteria | 2742 |
| 448 | Ga0265339_10003757 | 3300031249 | Bacteria | 10588 |
| 449 | Ga0265339_10070329 | 3300031249 | Bacteria | 1867 |
| 450 | Ga0265339_10084308 | 3300031249 | Bacteria | 1675 |
| 451 | Ga0265339_10450883 | 3300031249 | Bacteria | 597 |
| 452 | Ga0265331_10005438 | 3300031250 | Bacteria | 7687 |
| 453 | Ga0265331_10217005 | 3300031250 | Unclassified | 860 |
| 454 | Ga0265327_10510055 | 3300031251 | Bacteria | 518 |
| 455 | Ga0265316_10006910 | 3300031344 | Bacteria | 10766 |
| 456 | Ga0265316_10050281 | 3300031344 | Bacteria | 3279 |
| 457 | Ga0265316_10136783 | 3300031344 | Bacteria | 1843 |
| 458 | Ga0265316_10208442 | 3300031344 | Bacteria | 1446 |
| 459 | Ga0265316_10287124 | 3300031344 | Bacteria | 1201 |
| 460 | Ga0265316_10294658 | 3300031344 | Bacteria | 1183 |
| 461 | Ga0265316_10468551 | 3300031344 | Bacteria | 902 |
| 462 | Ga0307513_10026448 | 3300031456 | Bacteria | 6689 |
| 463 | Ga0307513_10097010 | 3300031456 | Bacteria | 2984 |
| 464 | Ga0307513_10169064 | 3300031456 | Bacteria | 2066 |
| 465 | Ga0307513_10213773 | 3300031456 | Bacteria | 1757 |
| 466 | Ga0307513_10248331 | 3300031456 | Bacteria | 1578 |
| 467 | Ga0307513_10871811 | 3300031456 | Bacteria | 607 |
| 468 | Ga0307509_10624940 | 3300031507 | Bacteria | 748 |
| 469 | Ga0307408_100291031 | 3300031548 | Bacteria | 1364 |
| 470 | Ga0307408_100444376 | 3300031548 | Bacteria | 1123 |
| 471 | Ga0307408_100799984 | 3300031548 | Bacteria | 856 |
| 472 | Ga0307408_101523386 | 3300031548 | Bacteria | 633 |
| 473 | Ga0265313_10002254 | 3300031595 | Bacteria | 16946 |
| 474 | Ga0265313_10081198 | 3300031595 | Bacteria | 1472 |
| 475 | Ga0307508_10320450 | 3300031616 | Bacteria | 1142 |
| 476 | Ga0307508_10476913 | 3300031616 | Bacteria | 841 |
| 477 | Ga0307514_10000920 | 3300031649 | Bacteria | 44996 |
| 478 | Ga0316575_10089796 | 3300031665 | Bacteria | 1244 |
| 479 | Ga0316575_10146813 | 3300031665 | Bacteria | 972 |
| 480 | Ga0316575_10332986 | 3300031665 | Bacteria | 645 |
| 481 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 482 | Ga0265314_10023669 | 3300031711 | Bacteria | 4676 |
| 483 | Ga0265314_10047836 | 3300031711 | Bacteria | 3007 |
| 484 | Ga0265314_10104963 | 3300031711 | Unclassified | 1808 |
| 485 | Ga0265314_10416167 | 3300031711 | Bacteria | 723 |
| 486 | Ga0265314_10628997 | 3300031711 | Bacteria | 550 |
| 487 | Ga0265342_10005611 | 3300031712 | Bacteria | 9512 |
| 488 | Ga0265342_10017036 | 3300031712 | Bacteria | 4732 |
| 489 | Ga0265342_10470604 | 3300031712 | Bacteria | 643 |
| 490 | Ga0265342_10712404 | 3300031712 | Bacteria | 501 |
| 491 | Ga0316576_10366875 | 3300031727 | Bacteria | 1070 |
| 492 | Ga0316576_10877605 | 3300031727 | Bacteria | 643 |
| 493 | Ga0316578_10289981 | 3300031728 | Bacteria | 979 |
| 494 | Ga0316578_10420100 | 3300031728 | Bacteria | 792 |
| 495 | Ga0307516_10078566 | 3300031730 | Bacteria | 3146 |
| 496 | Ga0307516_10309237 | 3300031730 | Bacteria | 1254 |
| 497 | Ga0307516_10505428 | 3300031730 | Bacteria | 863 |
| 498 | Ga0307405_10319132 | 3300031731 | Bacteria | 1186 |
| 499 | Ga0307405_10681859 | 3300031731 | Bacteria | 849 |
| 500 | Ga0307405_11680257 | 3300031731 | Bacteria | 562 |
| 501 | Ga0307405_11841687 | 3300031731 | Bacteria | 539 |
| 502 | Ga0316577_10437463 | 3300031733 | Bacteria | 743 |
| 503 | Ga0307413_10034193 | 3300031824 | Bacteria | 2902 |
| 504 | Ga0307413_10722126 | 3300031824 | Bacteria | 830 |
| 505 | Ga0307410_10017964 | 3300031852 | Bacteria | 4261 |
| 506 | Ga0307410_10163591 | 3300031852 | Bacteria | 1670 |
| 507 | Ga0307410_11380741 | 3300031852 | Bacteria | 618 |
| 508 | Ga0307406_10036832 | 3300031901 | Bacteria | 3017 |
| 509 | Ga0307407_10066639 | 3300031903 | Bacteria | 2124 |
| 510 | Ga0307407_10335844 | 3300031903 | Bacteria | 1065 |
| 511 | Ga0307412_10337484 | 3300031911 | Bacteria | 1205 |
| 512 | Ga0307412_10673558 | 3300031911 | Bacteria | 885 |
| 513 | Ga0307412_11889713 | 3300031911 | Bacteria | 551 |
| 514 | Ga0307409_100437126 | 3300031995 | Bacteria | 1259 |
| 515 | Ga0307409_100593712 | 3300031995 | Bacteria | 1093 |
| 516 | Ga0307409_102395469 | 3300031995 | Bacteria | 557 |
| 517 | Ga0307416_100067170 | 3300032002 | Bacteria | 2956 |
| 518 | Ga0307416_100925299 | 3300032002 | Bacteria | 973 |
| 519 | Ga0307416_101703994 | 3300032002 | Bacteria | 735 |
| 520 | Ga0307414_10090894 | 3300032004 | Bacteria | 2267 |
| 521 | Ga0307411_10040085 | 3300032005 | Bacteria | 2968 |
| 522 | Ga0307411_11024632 | 3300032005 | Bacteria | 740 |
| 523 | Ga0307415_100123909 | 3300032126 | Bacteria | 1944 |
| 524 | Ga0307415_100128491 | 3300032126 | Bacteria | 1914 |
| 525 | Ga0307415_101610594 | 3300032126 | Bacteria | 624 |
| 526 | Ga0316583_10004920 | 3300032133 | Bacteria | 4774 |
| 527 | Ga0316583_10029998 | 3300032133 | Bacteria | 1937 |
| 528 | Ga0316583_10124071 | 3300032133 | Bacteria | 900 |
| 529 | Ga0316585_10161193 | 3300032137 | Bacteria | 741 |
| 530 | Ga0316585_10293375 | 3300032137 | Bacteria | 540 |
| 531 | Ga0316593_10199397 | 3300032168 | Bacteria | 739 |
| 532 | Ga0316593_10212686 | 3300032168 | Bacteria | 717 |
| 533 | Ga0307510_10554259 | 3300033180 | Bacteria | 596 |
| 534 | Ga0307510_10659202 | 3300033180 | Bacteria | 506 |
| 535 | Ga0316592_1059674 | 3300033524 | Bacteria | 856 |
| 536 | Ga0316586_1040824 | 3300033527 | Bacteria | 815 |
| 537 | Ga0316586_1082457 | 3300033527 | Bacteria | 601 |
| 538 | Ga0316586_1084297 | 3300033527 | Bacteria | 596 |
| 539 | Ga0316587_1081526 | 3300033529 | Bacteria | 612 |
| 540 | Ga0316587_1090703 | 3300033529 | Bacteria | 583 |
| 541 | Ga0316596_1042366 | 3300033541 | Bacteria | 1198 |
| 542 | Ga0316596_1055954 | 3300033541 | Unclassified | 1048 |
| 543 | Ga0316596_1232317 | 3300033541 | Bacteria | 518 |
| 544 | Ga0373950_0109911 | 3300034818 | Bacteria | 601 |
| 545 | Ga0373926_0413961 | 3300035083 | Bacteria | 533 |
| 546 | Ga0373923_0692527 | 3300035111 | Bacteria | 506 |
| 547 | Ga0373932_0386017 | 3300035112 | Bacteria | 539 |
| 548 | Ga0373939_0118936 | 3300035114 | Unclassified | 930 |
| 549 | Ga0373943_0107900 | 3300035170 | Bacteria | 1465 |
| 550 | Ga0373946_0414562 | 3300035171 | Bacteria | 682 |
| 551 | Ga0373955_0455528 | 3300035172 | Bacteria | 780 |
| 552 | Ga0316574_0017340 | 3300035398 | Bacteria | 4214 |
| 553 | Ga0316574_0746664 | 3300035398 | Unclassified | 598 |
| 554 | Ga0373931_0409292 | 3300035691 | Bacteria | 860 |
| 555 | Ga0373935_0755546 | 3300035692 | Bacteria | 717 |
| 556 | Ga0373935_0838132 | 3300035692 | Bacteria | 680 |
| 557 | Ga0373927_0182230 | 3300035695 | Bacteria | 1378 |
| 558 | Ga0373927_0818875 | 3300035695 | Bacteria | 615 |
| 559 | Ga0373933_0297274 | 3300035724 | Bacteria | 1045 |
| 560 | Ga0373947_0561376 | 3300035725 | Bacteria | 777 |
| 561 | Ga0373947_0614593 | 3300035725 | Bacteria | 741 |
| 562 | Ga0373937_0090909 | 3300036401 | Bacteria | 2828 |
| 563 | Ga0373937_0905455 | 3300036401 | Bacteria | 831 |
| 564 | Ga0373937_1042337 | 3300036401 | Bacteria | 767 |
| 565 | Ga0373937_1158296 | 3300036401 | Bacteria | 722 |
| 566 | Ga0316582_0166264 | 3300036647 | Bacteria | 1496 |
| 567 | Ga0316582_0445132 | 3300036647 | Bacteria | 893 |
| 568 | Ga0316584_0072229 | 3300036712 | Bacteria | 2586 |
| 569 | Ga0316584_0228010 | 3300036712 | Bacteria | 1366 |
| 570 | Ga0316584_0893251 | 3300036712 | Bacteria | 599 |
| 571 | Ga0373925_0327193 | 3300037068 | Bacteria | 1241 |
| 572 | Ga0395900_0201928 | 3300037418 | Bacteria | 2011 |
| 573 | Ga0395905_0001245 | 3300037471 | Bacteria | 31535 |
| 574 | Ga0436364_0661109 | 3300037853 | Bacteria | 1656 |
| 575 | Ga0436364_0755656 | 3300037853 | Bacteria | 52627 |
| 576 | Ga0436365_0142396 | 3300039437 | Bacteria | 1373 |
| 577 | Ga0436365_0257100 | 3300039437 | Bacteria | 890 |
| 578 | Ga0436365_0429969 | 3300039437 | Bacteria | 624 |
| 579 | Ga0436365_0760636 | 3300039437 | Bacteria | 785 |
| 580 | Ga0436365_1153303 | 3300039437 | Bacteria | 2247 |
| 581 | Ga0436365_1303455 | 3300039437 | Bacteria | 1203 |
| 582 | Ga0436361_0470064 | 3300039447 | Bacteria | 1328 |
| 583 | Ga0436363_0344193 | 3300039450 | Bacteria | 1115 |
| 584 | Ga0436363_0995645 | 3300039450 | Bacteria | 755 |
| 585 | Ga0436363_1402859 | 3300039450 | Unclassified | 730 |
| 586 | Ga0436362_1204042 | 3300039453 | Bacteria | 1257 |
| 587 | Ga0439453_0189804 | 3300041408 | Bacteria | 505 |
| 588 | Ga0451793_0596990 | 3300041452 | Bacteria | 955 |
| 589 | Ga0451795_0149206 | 3300041456 | Bacteria | 513 |
| 590 | Ga0451805_019949 | 3300041461 | Unclassified | 817 |
| 591 | Ga0451805_051563 | 3300041461 | Bacteria | 742 |
| 592 | Ga0451837_0156795 | 3300041494 | Bacteria | 1068 |
| 593 | Ga0451839_1632871 | 3300041496 | Bacteria | 535 |
| 594 | Ga0451847_0573443 | 3300041503 | Bacteria | 652 |
| 595 | Ga0451849_0242008 | 3300041505 | Bacteria | 664 |
| 596 | Ga0451853_1096528 | 3300041512 | Bacteria | 685 |
| 597 | Ga0451853_1978603 | 3300041512 | Bacteria | 1314 |
| 598 | Ga0439441_042766 | 3300042001 | Bacteria | 913 |
| 599 | Ga0439445_0249593 | 3300042004 | Bacteria | 530 |
| 600 | Ga0439434_0304473 | 3300042435 | Bacteria | 551 |
| 601 | Ga0439435_0029672 | 3300042436 | Bacteria | 1478 |
| 602 | Ga0439459_0057414 | 3300042438 | Bacteria | 871 |
| 603 | Ga0451577_0003993 | 3300042876 | Bacteria | 15885 |
| 604 | Ga0451577_0004474 | 3300042876 | Bacteria | 14756 |
| 605 | Ga0451577_0012787 | 3300042876 | Bacteria | 7876 |
| 606 | Ga0451577_0031677 | 3300042876 | Bacteria | 4770 |
| 607 | Ga0451577_0270634 | 3300042876 | Bacteria | 1539 |
| 608 | Ga0451577_0380747 | 3300042876 | Bacteria | 1280 |
| 609 | Ga0466966_0872174 | 3300044684 | Bacteria | 543 |
| 610 | Ga0466961_0001485 | 3300044693 | Bacteria | 14575 |
| 611 | Ga0466961_0057455 | 3300044693 | Bacteria | 2477 |
| 612 | Ga0466963_0072801 | 3300044694 | Bacteria | 2315 |
| 613 | Ga0453684_0004729 | 3300044712 | Bacteria | 28145 |
| 614 | Ga0453684_0007706 | 3300044712 | Bacteria | 19671 |
| 615 | Ga0453684_0029590 | 3300044712 | Bacteria | 7769 |
| 616 | Ga0453684_0197742 | 3300044712 | Bacteria | 2346 |
| 617 | Ga0453684_0433350 | 3300044712 | Bacteria | 1466 |
| 618 | Ga0453684_1276545 | 3300044712 | Bacteria | 767 |
| 619 | Ga0466968_0010626 | 3300044735 | Bacteria | 3574 |
| 620 | Ga0466959_0129678 | 3300045049 | Bacteria | 1787 |
| 621 | Ga0466959_0913084 | 3300045049 | Bacteria | 586 |
| 622 | Ga0451576_0000968 | 3300045051 | Bacteria | 53566 |
| 623 | Ga0451576_0023205 | 3300045051 | Bacteria | 6721 |
| 624 | Ga0451576_0050377 | 3300045051 | Bacteria | 4367 |
| 625 | Ga0451576_1020422 | 3300045051 | Bacteria | 867 |
| 626 | Ga0451576_1074070 | 3300045051 | Bacteria | 843 |
| 627 | Ga0451576_1441934 | 3300045051 | Bacteria | 716 |
| 628 | Ga0466967_0000716 | 3300045976 | Bacteria | 16921 |
| 629 | Ga0495617_236732 | 3300046452 | Bacteria | 565 |
| 630 | Ga0495629_0322261 | 3300046459 | Bacteria | 1056 |
| 631 | Ga0495638_0068933 | 3300046460 | Bacteria | 2168 |
| 632 | Ga0495638_0281712 | 3300046460 | Bacteria | 903 |
| 633 | Ga0495638_0573909 | 3300046460 | Bacteria | 557 |
| 634 | Ga0495651_0808895 | 3300046462 | Bacteria | 578 |
| 635 | Ga0495580_0053212 | 3300046472 | Bacteria | 2858 |
| 636 | Ga0495580_0604330 | 3300046472 | Bacteria | 725 |
| 637 | Ga0495580_0741765 | 3300046472 | Bacteria | 640 |
| 638 | Ga0495606_0589319 | 3300046507 | Bacteria | 547 |
| 639 | Ga0495616_0097836 | 3300046513 | Bacteria | 1380 |
| 640 | Ga0495618_0764145 | 3300046514 | Bacteria | 565 |
| 641 | Ga0495643_0000286 | 3300046522 | Bacteria | 72166 |
| 642 | Ga0495652_0482754 | 3300046529 | Bacteria | 862 |
| 643 | Ga0495654_0006530 | 3300046530 | Bacteria | 6612 |
| 644 | Ga0495665_0498233 | 3300046531 | Bacteria | 614 |
| 645 | Ga0495640_0203276 | 3300046533 | Bacteria | 1255 |
| 646 | Ga0495633_0000563 | 3300046558 | Bacteria | 36212 |
| 647 | Ga0495656_0233678 | 3300046615 | Bacteria | 923 |
| 648 | Ga0495668_0382538 | 3300046616 | Bacteria | 773 |
| 649 | Ga0495668_0613754 | 3300046616 | Bacteria | 601 |
| 650 | Ga0495634_0339132 | 3300046642 | Bacteria | 902 |
| 651 | Ga0495611_0218573 | 3300046648 | Bacteria | 887 |
| 652 | Ga0495625_0252534 | 3300046660 | Bacteria | 1144 |
| 653 | Ga0495625_0640658 | 3300046660 | Bacteria | 634 |
| 654 | Ga0495599_0258323 | 3300046678 | Bacteria | 1059 |
| 655 | Ga0495669_0638658 | 3300046684 | Bacteria | 518 |
| 656 | Ga0495613_0013649 | 3300046689 | Bacteria | 6028 |
| 657 | Ga0495613_0131731 | 3300046689 | Bacteria | 1790 |
| 658 | Ga0495649_0431163 | 3300046694 | Bacteria | 660 |
| 659 | Ga0495604_0232835 | 3300047317 | Bacteria | 1263 |
| 660 | Ga0495674_0292484 | 3300047319 | Bacteria | 1332 |
| 661 | Ga0495683_0240425 | 3300047323 | Bacteria | 799 |
| 662 | Ga0495684_0502201 | 3300047471 | Bacteria | 834 |
| 663 | Ga0495602_0157610 | 3300048088 | Bacteria | 1776 |
| 664 | Ga0496100_0014533 | 3300048903 | Bacteria | 4573 |
| 665 | Ga0496101_0005626 | 3300048904 | Bacteria | 7991 |
| 666 | Ga0496104_0011960 | 3300048907 | Bacteria | 7787 |
| 667 | Ga0496104_1292314 | 3300048907 | Bacteria | 633 |
| 668 | Ga0496105_0179639 | 3300048908 | Bacteria | 1733 |
| 669 | Ga0496107_0078761 | 3300048910 | Bacteria | 2402 |
| 670 | Ga0496109_0000023 | 3300048912 | Bacteria | 187904 |
| 671 | Ga0496110_0051931 | 3300048913 | Bacteria | 3603 |
| 672 | Ga0496114_0722210 | 3300048917 | Bacteria | 872 |
| 673 | Ga0496115_0053576 | 3300048918 | Bacteria | 3237 |
| 674 | Ga0496115_0252433 | 3300048918 | Bacteria | 1452 |
| 675 | Ga0496116_0321293 | 3300048919 | Bacteria | 725 |
| 676 | Ga0496122_0007634 | 3300048925 | Bacteria | 11943 |
| 677 | Ga0496122_0386203 | 3300048925 | Bacteria | 716 |
| 678 | Ga0496123_0136278 | 3300048926 | Bacteria | 1350 |
| 679 | Ga0496124_0309277 | 3300048927 | Bacteria | 1137 |
| 680 | Ga0496125_0006034 | 3300048928 | Bacteria | 13252 |
| 681 | Ga0496126_0025269 | 3300048929 | Bacteria | 5718 |
| 682 | Ga0501306_017923 | 3300049127 | Bacteria | 964 |
| 683 | Ga0501305_076619 | 3300049161 | Bacteria | 595 |
| 684 | Ga0501307_040396 | 3300049162 | Bacteria | 676 |
| 685 | Ga0495682_0337860 | 3300049460 | Bacteria | 531 |
| 686 | Ga0501313_070236 | 3300049529 | Bacteria | 506 |
| 687 | Ga0501314_041627 | 3300049530 | Bacteria | 537 |
| 688 | Ga0501317_033174 | 3300049533 | Bacteria | 759 |
| 689 | Ga0501317_034341 | 3300049533 | Bacteria | 750 |
| 690 | Ga0501031_0233950 | 3300049568 | Bacteria | 1195 |
| 691 | Ga0501032_0001422 | 3300049569 | Bacteria | 19011 |
| 692 | Ga0501032_0641078 | 3300049569 | Bacteria | 675 |
| 693 | Ga0501032_1067427 | 3300049569 | Bacteria | 506 |
| 694 | Ga0501033_0005041 | 3300049570 | Bacteria | 10517 |
| 695 | Ga0501033_0128466 | 3300049570 | Bacteria | 1837 |
| 696 | Ga0501033_0148183 | 3300049570 | Bacteria | 1694 |
| 697 | Ga0501033_0230338 | 3300049570 | Bacteria | 1316 |
| 698 | Ga0501034_0057268 | 3300049571 | Bacteria | 3918 |
| 699 | Ga0501034_0529974 | 3300049571 | Bacteria | 1089 |
| 700 | Ga0501036_0085234 | 3300049572 | Bacteria | 2670 |
| 701 | Ga0501036_0622444 | 3300049572 | Bacteria | 895 |
| 702 | Ga0501037_0008897 | 3300049573 | Bacteria | 7353 |
| 703 | Ga0501037_0218500 | 3300049573 | Bacteria | 1342 |
| 704 | Ga0501037_0259210 | 3300049573 | Bacteria | 1215 |
| 705 | Ga0501038_0021894 | 3300049574 | Bacteria | 5734 |
| 706 | Ga0501038_0104377 | 3300049574 | Bacteria | 2355 |
| 707 | Ga0501038_0314079 | 3300049574 | Bacteria | 1227 |
| 708 | Ga0501039_0004832 | 3300049575 | Bacteria | 10204 |
| 709 | Ga0501039_0590998 | 3300049575 | Bacteria | 870 |
| 710 | Ga0501043_0002349 | 3300049579 | Bacteria | 16039 |
| 711 | Ga0501043_0215283 | 3300049579 | Bacteria | 1488 |
| 712 | Ga0501046_0001586 | 3300049580 | Bacteria | 21746 |
| 713 | Ga0501046_0195515 | 3300049580 | Bacteria | 1507 |
| 714 | Ga0501047_0017656 | 3300049581 | Bacteria | 6837 |
| 715 | Ga0501047_0023291 | 3300049581 | Bacteria | 5946 |
| 716 | Ga0501047_0135035 | 3300049581 | Bacteria | 2348 |
| 717 | Ga0501047_0732000 | 3300049581 | Bacteria | 806 |
| 718 | Ga0501048_0119263 | 3300049582 | Bacteria | 1864 |
| 719 | Ga0501067_0024472 | 3300049583 | Bacteria | 3349 |
| 720 | Ga0501067_0405423 | 3300049583 | Bacteria | 760 |
| 721 | Ga0501068_0015914 | 3300049584 | Bacteria | 4331 |
| 722 | Ga0501068_0026472 | 3300049584 | Bacteria | 3417 |
| 723 | Ga0501068_0232786 | 3300049584 | Bacteria | 1172 |
| 724 | Ga0501068_0585048 | 3300049584 | Bacteria | 727 |
| 725 | Ga0501069_0000190 | 3300049585 | Bacteria | 27163 |
| 726 | Ga0501069_0057232 | 3300049585 | Bacteria | 2173 |
| 727 | Ga0501070_0001037 | 3300049586 | Bacteria | 25015 |
| 728 | Ga0501070_0184654 | 3300049586 | Bacteria | 1715 |
| 729 | Ga0501070_0449226 | 3300049586 | Bacteria | 1039 |
| 730 | Ga0501071_0699848 | 3300049587 | Bacteria | 780 |
| 731 | Ga0501071_0784925 | 3300049587 | Bacteria | 734 |
| 732 | Ga0501072_0368721 | 3300049588 | Bacteria | 1140 |
| 733 | Ga0501072_0392382 | 3300049588 | Bacteria | 1101 |
| 734 | Ga0501073_0003174 | 3300049589 | Bacteria | 12336 |
| 735 | Ga0501073_0011356 | 3300049589 | Bacteria | 6515 |
| 736 | Ga0501073_0077405 | 3300049589 | Bacteria | 2314 |
| 737 | Ga0501073_0265944 | 3300049589 | Bacteria | 1183 |
| 738 | Ga0501073_0321404 | 3300049589 | Bacteria | 1068 |
| 739 | Ga0501074_0037087 | 3300049590 | Bacteria | 3533 |
| 740 | Ga0501074_0560633 | 3300049590 | Bacteria | 809 |
| 741 | Ga0501074_0656757 | 3300049590 | Bacteria | 741 |
| 742 | Ga0501075_0836560 | 3300049591 | Bacteria | 700 |
| 743 | Ga0501075_0988697 | 3300049591 | Unclassified | 639 |
| 744 | Ga0501076_0128334 | 3300049592 | Bacteria | 2056 |
| 745 | Ga0501076_0358010 | 3300049592 | Bacteria | 1199 |
| 746 | Ga0501077_0236396 | 3300049593 | Bacteria | 1161 |
| 747 | Ga0501257_209474 | 3300049686 | Bacteria | 564 |
| 748 | Ga0501079_0171794 | 3300049741 | Bacteria | 1690 |
| 749 | Ga0501079_1174696 | 3300049741 | Bacteria | 605 |
| 750 | Ga0501080_0001815 | 3300049742 | Bacteria | 18292 |
| 751 | Ga0501080_0050487 | 3300049742 | Bacteria | 3871 |
| 752 | Ga0501080_0067793 | 3300049742 | Bacteria | 3319 |
| 753 | Ga0501080_0095799 | 3300049742 | Bacteria | 2755 |
| 754 | Ga0501080_0212433 | 3300049742 | Bacteria | 1773 |
| 755 | Ga0501080_0802919 | 3300049742 | Bacteria | 825 |
| 756 | Ga0501081_0628739 | 3300049743 | Viruses | 804 |
| 757 | Ga0501081_1175557 | 3300049743 | Unclassified | 581 |
| 758 | Ga0501083_0011803 | 3300049744 | Bacteria | 6122 |
| 759 | Ga0501083_0024181 | 3300049744 | Bacteria | 4211 |
| 760 | Ga0501083_0069065 | 3300049744 | Bacteria | 2351 |
| 761 | Ga0501035_0021710 | 3300049822 | Bacteria | 5902 |
| 762 | Ga0501035_0538856 | 3300049822 | Bacteria | 957 |
| 763 | Ga0501044_0004911 | 3300049823 | Bacteria | 14944 |
| 764 | Ga0501044_0014858 | 3300049823 | Bacteria | 8392 |
| 765 | Ga0501044_0056277 | 3300049823 | Bacteria | 4038 |
| 766 | Ga0501044_0071661 | 3300049823 | Bacteria | 3523 |
| 767 | Ga0501044_0590552 | 3300049823 | Bacteria | 1004 |
| 768 | Ga0501044_1054123 | 3300049823 | Bacteria | 683 |
| 769 | Ga0501045_0065790 | 3300049824 | Bacteria | 2662 |
| 770 | nmdc:mga03683_108372_c1 | 3300050489 | Bacteria | 1226 |
| 771 | nmdc:mga00v17_23278_c1 | 3300050491 | Bacteria | 3582 |
| 772 | nmdc:mga0k408_131008_c2 | 3300050493 | Bacteria | 847 |
| 773 | nmdc:mga0k408_5607_c1 | 3300050493 | Bacteria | 6670 |
| 774 | nmdc:mga07m45_176203_c2 | 3300050496 | Bacteria | 948 |
| 775 | nmdc:mga05p37_331725_c1 | 3300050507 | Bacteria | 1797 |
| 776 | nmdc:mga05p37_54904_c1 | 3300050507 | Bacteria | 4900 |
| 777 | nmdc:mga05p37_64916_c1 | 3300050507 | Bacteria | 4492 |
| 778 | nmdc:mga09592_1178515_c1 | 3300050508 | Bacteria | 634 |
| 779 | nmdc:mga09592_1442352_c1 | 3300050508 | Bacteria | 562 |
| 780 | nmdc:mga09592_564011_c1 | 3300050508 | Bacteria | 977 |
| 781 | nmdc:mga0qj67_1102760_c1 | 3300050509 | Bacteria | 620 |
| 782 | nmdc:mga06r32_1339475_c1 | 3300050510 | Bacteria | 659 |
| 783 | nmdc:mga06r32_390755_c1 | 3300050510 | Bacteria | 1374 |
| 784 | nmdc:mga06r32_53958_c1 | 3300050510 | Bacteria | 3853 |
| 785 | nmdc:mga06r32_572598_c1 | 3300050510 | Bacteria | 1102 |
| 786 | nmdc:mga08y16_14338_c1 | 3300050511 | Bacteria | 8343 |
| 787 | nmdc:mga08y16_2037200_c1 | 3300050511 | Bacteria | 523 |
| 788 | nmdc:mga0n895_546066_c1 | 3300050512 | Unclassified | 1165 |
| 789 | nmdc:mga0n895_782032_c1 | 3300050512 | Bacteria | 946 |
| 790 | nmdc:mga0rr50_643995_c1 | 3300050513 | Bacteria | 904 |
| 791 | nmdc:mga08x19_1293612_c1 | 3300050514 | Bacteria | 516 |
| 792 | nmdc:mga08x19_810544_c1 | 3300050514 | Bacteria | 665 |
| 793 | nmdc:mga0a205_263238_c1 | 3300050515 | Bacteria | 1602 |
| 794 | nmdc:mga0a205_474934_c1 | 3300050515 | Bacteria | 1109 |
| 795 | Ga0500578_0346513 | 3300053086 | Bacteria | 869 |
| 796 | Ga0500578_0724073 | 3300053086 | Bacteria | 533 |
| 797 | Ga0500644_0026438 | 3300053088 | Bacteria | 1796 |
| 798 | Ga0500646_0030665 | 3300053090 | Bacteria | 1476 |
| 799 | Ga0500646_0084229 | 3300053090 | Bacteria | 975 |
| 800 | Ga0500641_0001835 | 3300053096 | Bacteria | 7532 |
| 801 | Ga0500641_0070968 | 3300053096 | Bacteria | 1466 |
| 802 | Ga0500650_0026482 | 3300053098 | Bacteria | 2602 |
| 803 | Ga0500554_150671 | 3300053102 | Bacteria | 786 |
| 804 | Ga0500555_001003 | 3300053103 | Bacteria | 9655 |
| 805 | Ga0500555_004963 | 3300053103 | Bacteria | 3775 |
| 806 | Ga0500556_0066361 | 3300053104 | Bacteria | 1340 |
| 807 | Ga0500557_105121 | 3300053105 | Bacteria | 938 |
| 808 | Ga0500562_019709 | 3300053108 | Bacteria | 1747 |
| 809 | Ga0500562_137602 | 3300053108 | Bacteria | 666 |
| 810 | Ga0500569_058510 | 3300053109 | Bacteria | 1184 |
| 811 | Ga0500592_006310 | 3300053116 | Bacteria | 1889 |
| 812 | Ga0500593_305065 | 3300053117 | Bacteria | 507 |
| 813 | Ga0500594_0028275 | 3300053118 | Bacteria | 1458 |
| 814 | Ga0500595_000854 | 3300053119 | Bacteria | 17395 |
| 815 | Ga0500614_018705 | 3300053123 | Bacteria | 1579 |
| 816 | Ga0500621_235392 | 3300053126 | Bacteria | 625 |
| 817 | Ga0500628_000289 | 3300053129 | Bacteria | 9601 |
| 818 | Ga0500642_0134168 | 3300053130 | Bacteria | 1160 |
| 819 | Ga0500642_0203549 | 3300053130 | Bacteria | 920 |
| 820 | Ga0500642_0226575 | 3300053130 | Bacteria | 864 |
| 821 | Ga0500652_109312 | 3300053131 | Bacteria | 1155 |
| 822 | Ga0500658_0010908 | 3300053134 | Bacteria | 3352 |
| 823 | Ga0500658_0508971 | 3300053134 | Bacteria | 544 |
| 824 | Ga0500561_0232084 | 3300053137 | Bacteria | 586 |
| 825 | Ga0500568_0053865 | 3300053139 | Bacteria | 1575 |
| 826 | Ga0500577_0266024 | 3300053142 | Bacteria | 746 |
| 827 | Ga0500588_0012131 | 3300053146 | Bacteria | 2129 |
| 828 | Ga0500588_0039414 | 3300053146 | Bacteria | 1414 |
| 829 | Ga0500588_0210417 | 3300053146 | Bacteria | 722 |
| 830 | Ga0500616_0001666 | 3300053153 | Bacteria | 20490 |
| 831 | Ga0500616_0114013 | 3300053153 | Bacteria | 1301 |
| 832 | Ga0500616_0238181 | 3300053153 | Bacteria | 784 |
| 833 | Ga0500622_0272661 | 3300053156 | Bacteria | 733 |
| 834 | Ga0500624_042680 | 3300053157 | Bacteria | 820 |
| 835 | Ga0500627_0394321 | 3300053158 | Bacteria | 591 |
| 836 | Ga0500633_0254390 | 3300053160 | Bacteria | 652 |
| 837 | Ga0500634_0097376 | 3300053161 | Bacteria | 1480 |
| 838 | Ga0500611_227728 | 3300053727 | Bacteria | 533 |
| 839 | Ga0500609_000322 | 3300053731 | Bacteria | 7089 |
| 840 | Ga0500609_012306 | 3300053731 | Bacteria | 1157 |
| 841 | Ga0500656_050547 | 3300053732 | Bacteria | 603 |
| 842 | Ga0501084_0043078 | 3300054114 | Bacteria | 3776 |
| 843 | Ga0501084_0074473 | 3300054114 | Unclassified | 2843 |
| 844 | Ga0501084_0365780 | 3300054114 | Bacteria | 1219 |
| 845 | Ga0501084_0596286 | 3300054114 | Bacteria | 933 |
| 846 | Ga0501084_0615504 | 3300054114 | Bacteria | 917 |
| 847 | Ga0590071_147419 | 3300059421 | Bacteria | 609 |
| 848 | Ga0590075_045809 | 3300059424 | Bacteria | 1120 |
| 849 | Ga0590077_161701 | 3300059426 | Bacteria | 538 |
| 850 | Ga0587070_192949 | 3300059491 | Bacteria | 537 |
| 851 | Ga0587085_053028 | 3300059506 | Bacteria | 745 |
| 852 | Ga0587086_062123 | 3300059507 | Bacteria | 625 |
| 853 | Ga0587067_063942 | 3300059640 | Bacteria | 778 |
| 854 | Ga0587076_084777 | 3300059645 | Bacteria | 682 |
| 855 | Ga0587119_039652 | 3300059658 | Bacteria | 672 |
| 856 | Ga0587111_0232838 | 3300060346 | Bacteria | 537 |
| 857 | Ga0501082_0000993 | 3300060353 | Bacteria | 25057 |
| 858 | Ga0501082_0002008 | 3300060353 | Bacteria | 17888 |
| 859 | Ga0501082_0360254 | 3300060353 | Bacteria | 1268 |
| 860 | Ga0501082_0507394 | 3300060353 | Bacteria | 1054 |
| 861 | Ga0501082_1311700 | 3300060353 | Bacteria | 632 |
| 862 | Ga0466962_0051036 | 3300061719 | Bacteria | 1978 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006178 | Ga0075367_10537675 | Ga0075367_105376751 | 82 |
| 2 | 3300041456 | Ga0451795_0149206 | Ga0451795_0149206_198_476 | 82 |
| 3 | 3300005335 | Ga0070666_10431705 | Ga0070666_104317051 | 83 |
| 4 | 3300005335 | Ga0070666_11460322 | Ga0070666_114603221 | 83 |
| 5 | 3300005467 | Ga0070706_101529863 | Ga0070706_1015298632 | 83 |
| 6 | 3300005468 | Ga0070707_101185530 | Ga0070707_1011855301 | 83 |
| 7 | 3300013306 | Ga0163162_12795497 | Ga0163162_127954972 | 83 |
| 8 | 3300013307 | Ga0157372_11388256 | Ga0157372_113882562 | 83 |
| 9 | 3300025903 | Ga0207680_10498227 | Ga0207680_104982272 | 83 |
| 10 | 3300025922 | Ga0207646_11304519 | Ga0207646_113045192 | 83 |
| 11 | 3300025931 | Ga0207644_10637441 | Ga0207644_106374412 | 83 |
| 12 | 3300025986 | Ga0207658_10758538 | Ga0207658_107585381 | 83 |
| 13 | 3300028556 | Ga0265337_1000286 | Ga0265337_10002866 | 83 |
| 14 | 3300028558 | Ga0265326_10000350 | Ga0265326_1000035020 | 83 |
| 15 | 3300028558 | Ga0265326_10039899 | Ga0265326_100398992 | 83 |
| 16 | 3300028563 | Ga0265319_1000346 | Ga0265319_100034617 | 83 |
| 17 | 3300028563 | Ga0265319_1007043 | Ga0265319_10070436 | 83 |
| 18 | 3300028573 | Ga0265334_10001979 | Ga0265334_100019791 | 83 |
| 19 | 3300028577 | Ga0265318_10000921 | Ga0265318_1000092116 | 83 |
| 20 | 3300028577 | Ga0265318_10041897 | Ga0265318_100418972 | 83 |
| 21 | 3300028577 | Ga0265318_10220345 | Ga0265318_102203451 | 83 |
| 22 | 3300028653 | Ga0265323_10000609 | Ga0265323_1000060920 | 83 |
| 23 | 3300028654 | Ga0265322_10000064 | Ga0265322_100000644 | 83 |
| 24 | 3300028654 | Ga0265322_10001372 | Ga0265322_100013727 | 83 |
| 25 | 3300028654 | Ga0265322_10001389 | Ga0265322_100013895 | 83 |
| 26 | 3300028666 | Ga0265336_10000088 | Ga0265336_1000008818 | 83 |
| 27 | 3300028800 | Ga0265338_10000783 | Ga0265338_1000078331 | 83 |
| 28 | 3300028800 | Ga0265338_10002272 | Ga0265338_100022728 | 83 |
| 29 | 3300028800 | Ga0265338_10003505 | Ga0265338_100035058 | 83 |
| 30 | 3300029957 | Ga0265324_10003377 | Ga0265324_100033777 | 83 |
| 31 | 3300029957 | Ga0265324_10005065 | Ga0265324_100050652 | 83 |
| 32 | 3300029957 | Ga0265324_10015573 | Ga0265324_100155733 | 83 |
| 33 | 3300031235 | Ga0265330_10001755 | Ga0265330_1000175510 | 83 |
| 34 | 3300031235 | Ga0265330_10157856 | Ga0265330_101578562 | 83 |
| 35 | 3300031238 | Ga0265332_10008075 | Ga0265332_100080752 | 83 |
| 36 | 3300031238 | Ga0265332_10151220 | Ga0265332_101512202 | 83 |
| 37 | 3300031239 | Ga0265328_10001890 | Ga0265328_100018901 | 83 |
| 38 | 3300031240 | Ga0265320_10000957 | Ga0265320_1000095714 | 83 |
| 39 | 3300031240 | Ga0265320_10004168 | Ga0265320_1000416811 | 83 |
| 40 | 3300031240 | Ga0265320_10263729 | Ga0265320_102637292 | 83 |
| 41 | 3300031241 | Ga0265325_10006585 | Ga0265325_100065858 | 83 |
| 42 | 3300031241 | Ga0265325_10034346 | Ga0265325_100343463 | 83 |
| 43 | 3300031242 | Ga0265329_10001200 | Ga0265329_100012005 | 83 |
| 44 | 3300031242 | Ga0265329_10349787 | Ga0265329_103497871 | 83 |
| 45 | 3300031247 | Ga0265340_10000443 | Ga0265340_1000044315 | 83 |
| 46 | 3300031249 | Ga0265339_10003757 | Ga0265339_1000375710 | 83 |
| 47 | 3300031249 | Ga0265339_10070329 | Ga0265339_100703291 | 83 |
| 48 | 3300031250 | Ga0265331_10005438 | Ga0265331_100054386 | 83 |
| 49 | 3300031250 | Ga0265331_10217005 | Ga0265331_102170052 | 83 |
| 50 | 3300031251 | Ga0265327_10510055 | Ga0265327_105100552 | 83 |
| 51 | 3300031344 | Ga0265316_10006910 | Ga0265316_1000691010 | 83 |
| 52 | 3300031344 | Ga0265316_10050281 | Ga0265316_100502813 | 83 |
| 53 | 3300031344 | Ga0265316_10208442 | Ga0265316_102084422 | 83 |
| 54 | 3300031344 | Ga0265316_10287124 | Ga0265316_102871242 | 83 |
| 55 | 3300031344 | Ga0265316_10294658 | Ga0265316_102946582 | 83 |
| 56 | 3300031595 | Ga0265313_10002254 | Ga0265313_1000225418 | 83 |
| 57 | 3300031595 | Ga0265313_10081198 | Ga0265313_100811982 | 83 |
| 58 | 3300031665 | Ga0316575_10332986 | Ga0316575_103329862 | 83 |
| 59 | 3300031711 | Ga0265314_10047836 | Ga0265314_100478363 | 83 |
| 60 | 3300031711 | Ga0265314_10104963 | Ga0265314_101049632 | 83 |
| 61 | 3300031712 | Ga0265342_10005611 | Ga0265342_100056118 | 83 |
| 62 | 3300031712 | Ga0265342_10017036 | Ga0265342_100170363 | 83 |
| 63 | 3300031712 | Ga0265342_10712404 | Ga0265342_107124042 | 83 |
| 64 | 3300031727 | Ga0316576_10366875 | Ga0316576_103668752 | 83 |
| 65 | 3300031728 | Ga0316578_10420100 | Ga0316578_104201001 | 83 |
| 66 | 3300031733 | Ga0316577_10437463 | Ga0316577_104374632 | 83 |
| 67 | 3300032133 | Ga0316583_10029998 | Ga0316583_100299983 | 83 |
| 68 | 3300032137 | Ga0316585_10161193 | Ga0316585_101611932 | 83 |
| 69 | 3300036647 | Ga0316582_0445132 | Ga0316582_0445132_247_501 | 83 |
| 70 | 3300036712 | Ga0316584_0072229 | Ga0316584_0072229_437_691 | 83 |
| 71 | 3300041461 | Ga0451805_019949 | Ga0451805_019949_338_592 | 83 |
| 72 | 3300042876 | Ga0451577_0003993 | Ga0451577_0003993_11992_12246 | 83 |
| 73 | 3300044712 | Ga0453684_0004729 | Ga0453684_0004729_25217_25471 | 83 |
| 74 | 3300044712 | Ga0453684_0007706 | Ga0453684_0007706_6290_6577 | 83 |
| 75 | 3300003159 | Ga0006771J45828_102739 | Ga0006771J45828_1027392 | 84 |
| 76 | 3300003161 | Ga0006765J45826_108928 | Ga0006765J45826_1089282 | 84 |
| 77 | 3300003163 | Ga0006759J45824_1021461 | Ga0006759J45824_10214612 | 84 |
| 78 | 3300003544 | Ga0007417J51691_1040523 | Ga0007417J51691_10405232 | 84 |
| 79 | 3300003693 | Ga0032354_1100925 | Ga0032354_11009252 | 84 |
| 80 | 3300005289 | Ga0065704_10072444 | Ga0065704_100724446 | 84 |
| 81 | 3300005334 | Ga0068869_100862558 | Ga0068869_1008625582 | 84 |
| 82 | 3300005353 | Ga0070669_100281085 | Ga0070669_1002810851 | 84 |
| 83 | 3300005353 | Ga0070669_101690405 | Ga0070669_1016904051 | 84 |
| 84 | 3300005354 | Ga0070675_100993008 | Ga0070675_1009930082 | 84 |
| 85 | 3300005356 | Ga0070674_100084170 | Ga0070674_1000841702 | 84 |
| 86 | 3300005435 | Ga0070714_100378014 | Ga0070714_1003780142 | 84 |
| 87 | 3300005439 | Ga0070711_100112806 | Ga0070711_1001128063 | 84 |
| 88 | 3300005456 | Ga0070678_100606996 | Ga0070678_1006069962 | 84 |
| 89 | 3300005456 | Ga0070678_101661282 | Ga0070678_1016612821 | 84 |
| 90 | 3300005459 | Ga0068867_100341612 | Ga0068867_1003416123 | 84 |
| 91 | 3300005471 | Ga0070698_100626424 | Ga0070698_1006264241 | 84 |
| 92 | 3300005548 | Ga0070665_100154539 | Ga0070665_1001545393 | 84 |
| 93 | 3300005548 | Ga0070665_100685797 | Ga0070665_1006857973 | 84 |
| 94 | 3300005577 | Ga0068857_100615082 | Ga0068857_1006150822 | 84 |
| 95 | 3300005840 | Ga0068870_11138186 | Ga0068870_111381862 | 84 |
| 96 | 3300006028 | Ga0070717_10909874 | Ga0070717_109098741 | 84 |
| 97 | 3300006051 | Ga0075364_10009158 | Ga0075364_100091583 | 84 |
| 98 | 3300006358 | Ga0068871_101617491 | Ga0068871_1016174912 | 84 |
| 99 | 3300009176 | Ga0105242_10011064 | Ga0105242_100110645 | 84 |
| 100 | 3300013308 | Ga0157375_12892096 | Ga0157375_128920961 | 84 |
| 101 | 3300020610 | Ga0154015_1280778 | Ga0154015_12807782 | 84 |
| 102 | 3300025901 | Ga0207688_10356825 | Ga0207688_103568252 | 84 |
| 103 | 3300025908 | Ga0207643_10977793 | Ga0207643_109777932 | 84 |
| 104 | 3300025910 | Ga0207684_10885696 | Ga0207684_108856961 | 84 |
| 105 | 3300025920 | Ga0207649_10821401 | Ga0207649_108214012 | 84 |
| 106 | 3300025923 | Ga0207681_10262972 | Ga0207681_102629722 | 84 |
| 107 | 3300025929 | Ga0207664_10655602 | Ga0207664_106556021 | 84 |
| 108 | 3300025929 | Ga0207664_11492578 | Ga0207664_114925781 | 84 |
| 109 | 3300025934 | Ga0207686_10005026 | Ga0207686_100050265 | 84 |
| 110 | 3300025937 | Ga0207669_10092981 | Ga0207669_100929813 | 84 |
| 111 | 3300025938 | Ga0207704_10355622 | Ga0207704_103556222 | 84 |
| 112 | 3300025961 | Ga0207712_11411319 | Ga0207712_114113192 | 84 |
| 113 | 3300026078 | Ga0207702_10559119 | Ga0207702_105591193 | 84 |
| 114 | 3300026089 | Ga0207648_10591210 | Ga0207648_105912103 | 84 |
| 115 | 3300026121 | Ga0207683_10616014 | Ga0207683_106160142 | 84 |
| 116 | 3300026121 | Ga0207683_11325060 | Ga0207683_113250602 | 84 |
| 117 | 3300027360 | Ga0209969_1032591 | Ga0209969_10325912 | 84 |
| 118 | 3300027471 | Ga0209995_1011891 | Ga0209995_10118912 | 84 |
| 119 | 3300027526 | Ga0209968_1098309 | Ga0209968_10983091 | 84 |
| 120 | 3300027617 | Ga0210002_1009035 | Ga0210002_10090352 | 84 |
| 121 | 3300027665 | Ga0209983_1135632 | Ga0209983_11356321 | 84 |
| 122 | 3300027682 | Ga0209971_1011208 | Ga0209971_10112081 | 84 |
| 123 | 3300027876 | Ga0209974_10094884 | Ga0209974_100948842 | 84 |
| 124 | 3300027876 | Ga0209974_10274054 | Ga0209974_102740542 | 84 |
| 125 | 3300028379 | Ga0268266_10012086 | Ga0268266_100120862 | 84 |
| 126 | 3300028653 | Ga0265323_10151069 | Ga0265323_101510691 | 84 |
| 127 | 3300028654 | Ga0265322_10036758 | Ga0265322_100367582 | 84 |
| 128 | 3300031238 | Ga0265332_10000125 | Ga0265332_100001255 | 84 |
| 129 | 3300031665 | Ga0316575_10146813 | Ga0316575_101468132 | 84 |
| 130 | 3300031712 | Ga0265342_10470604 | Ga0265342_104706041 | 84 |
| 131 | 3300031727 | Ga0316576_10877605 | Ga0316576_108776052 | 84 |
| 132 | 3300031728 | Ga0316578_10289981 | Ga0316578_102899812 | 84 |
| 133 | 3300031730 | Ga0307516_10309237 | Ga0307516_103092373 | 84 |
| 134 | 3300032133 | Ga0316583_10124071 | Ga0316583_101240711 | 84 |
| 135 | 3300032137 | Ga0316585_10293375 | Ga0316585_102933751 | 84 |
| 136 | 3300032168 | Ga0316593_10212686 | Ga0316593_102126862 | 84 |
| 137 | 3300033524 | Ga0316592_1059674 | Ga0316592_10596742 | 84 |
| 138 | 3300033527 | Ga0316586_1082457 | Ga0316586_10824572 | 84 |
| 139 | 3300033527 | Ga0316586_1084297 | Ga0316586_10842972 | 84 |
| 140 | 3300033529 | Ga0316587_1081526 | Ga0316587_10815262 | 84 |
| 141 | 3300033529 | Ga0316587_1090703 | Ga0316587_10907032 | 84 |
| 142 | 3300034818 | Ga0373950_0109911 | Ga0373950_0109911_137_394 | 84 |
| 143 | 3300035398 | Ga0316574_0017340 | Ga0316574_0017340_624_881 | 84 |
| 144 | 3300035725 | Ga0373947_0614593 | Ga0373947_0614593_350_607 | 84 |
| 145 | 3300036647 | Ga0316582_0166264 | Ga0316582_0166264_141_398 | 84 |
| 146 | 3300036712 | Ga0316584_0228010 | Ga0316584_0228010_905_1162 | 84 |
| 147 | 3300036712 | Ga0316584_0893251 | Ga0316584_0893251_113_370 | 84 |
| 148 | 3300037418 | Ga0395900_0201928 | Ga0395900_0201928_1714_1971 | 84 |
| 149 | 3300037471 | Ga0395905_0001245 | Ga0395905_0001245_9929_10186 | 84 |
| 150 | 3300041496 | Ga0451839_1632871 | Ga0451839_1632871_49_306 | 84 |
| 151 | 3300042876 | Ga0451577_0031677 | Ga0451577_0031677_3303_3560 | 84 |
| 152 | 3300042876 | Ga0451577_0270634 | Ga0451577_0270634_1266_1523 | 84 |
| 153 | 3300042876 | Ga0451577_0380747 | Ga0451577_0380747_848_1105 | 84 |
| 154 | 3300044712 | Ga0453684_0029590 | Ga0453684_0029590_5606_5863 | 84 |
| 155 | 3300044712 | Ga0453684_0433350 | Ga0453684_0433350_45_302 | 84 |
| 156 | 3300044712 | Ga0453684_1276545 | Ga0453684_1276545_36_293 | 84 |
| 157 | 3300045051 | Ga0451576_0023205 | Ga0451576_0023205_248_505 | 84 |
| 158 | 3300048925 | Ga0496122_0386203 | Ga0496122_0386203_223_480 | 84 |
| 159 | 3300048926 | Ga0496123_0136278 | Ga0496123_0136278_870_1127 | 84 |
| 160 | 3300048927 | Ga0496124_0309277 | Ga0496124_0309277_676_933 | 84 |
| 161 | 3300048928 | Ga0496125_0006034 | Ga0496125_0006034_12348_12605 | 84 |
| 162 | 3300048929 | Ga0496126_0025269 | Ga0496126_0025269_2213_2470 | 84 |
| 163 | 3300049127 | Ga0501306_017923 | Ga0501306_017923_309_566 | 84 |
| 164 | 3300049530 | Ga0501314_041627 | Ga0501314_041627_173_430 | 84 |
| 165 | 3300049574 | Ga0501038_0021894 | Ga0501038_0021894_2300_2557 | 84 |
| 166 | 3300050491 | nmdc:mga00v17_23278_c1 | nmdc:mga00v17_23278_c1_198_455 | 84 |
| 167 | 3300053117 | Ga0500593_305065 | Ga0500593_305065_93_353 | 84 |
| 168 | 3300059491 | Ga0587070_192949 | Ga0587070_192949_223_480 | 84 |
| 169 | 3300059645 | Ga0587076_084777 | Ga0587076_084777_42_299 | 84 |
| 170 | 3300004801 | Ga0058860_12049493 | Ga0058860_120494931 | 85 |
| 171 | 3300005289 | Ga0065704_10311985 | Ga0065704_103119851 | 85 |
| 172 | 3300005327 | Ga0070658_10014007 | Ga0070658_100140073 | 85 |
| 173 | 3300005329 | Ga0070683_100001211 | Ga0070683_1000012113 | 85 |
| 174 | 3300005331 | Ga0070670_100021890 | Ga0070670_1000218903 | 85 |
| 175 | 3300005334 | Ga0068869_100001837 | Ga0068869_1000018373 | 85 |
| 176 | 3300005334 | Ga0068869_100642032 | Ga0068869_1006420322 | 85 |
| 177 | 3300005335 | Ga0070666_10198828 | Ga0070666_101988282 | 85 |
| 178 | 3300005338 | Ga0068868_100004900 | Ga0068868_1000049005 | 85 |
| 179 | 3300005338 | Ga0068868_100007490 | Ga0068868_1000074906 | 85 |
| 180 | 3300005344 | Ga0070661_100107053 | Ga0070661_1001070532 | 85 |
| 181 | 3300005347 | Ga0070668_100493276 | Ga0070668_1004932761 | 85 |
| 182 | 3300005353 | Ga0070669_100008790 | Ga0070669_1000087904 | 85 |
| 183 | 3300005355 | Ga0070671_100040612 | Ga0070671_1000406124 | 85 |
| 184 | 3300005356 | Ga0070674_100054340 | Ga0070674_1000543402 | 85 |
| 185 | 3300005367 | Ga0070667_100005595 | Ga0070667_1000055957 | 85 |
| 186 | 3300005437 | Ga0070710_10167496 | Ga0070710_101674962 | 85 |
| 187 | 3300005440 | Ga0070705_100864354 | Ga0070705_1008643542 | 85 |
| 188 | 3300005441 | Ga0070700_100506033 | Ga0070700_1005060332 | 85 |
| 189 | 3300005445 | Ga0070708_101097764 | Ga0070708_1010977642 | 85 |
| 190 | 3300005458 | Ga0070681_10251756 | Ga0070681_102517561 | 85 |
| 191 | 3300005467 | Ga0070706_100197905 | Ga0070706_1001979052 | 85 |
| 192 | 3300005530 | Ga0070679_101559392 | Ga0070679_1015593921 | 85 |
| 193 | 3300005535 | Ga0070684_100011471 | Ga0070684_1000114712 | 85 |
| 194 | 3300005539 | Ga0068853_100250593 | Ga0068853_1002505932 | 85 |
| 195 | 3300005539 | Ga0068853_100313409 | Ga0068853_1003134093 | 85 |
| 196 | 3300005539 | Ga0068853_101275828 | Ga0068853_1012758282 | 85 |
| 197 | 3300005543 | Ga0070672_101843893 | Ga0070672_1018438932 | 85 |
| 198 | 3300005563 | Ga0068855_101113995 | Ga0068855_1011139952 | 85 |
| 199 | 3300005564 | Ga0070664_101683220 | Ga0070664_1016832202 | 85 |
| 200 | 3300005564 | Ga0070664_101951841 | Ga0070664_1019518412 | 85 |
| 201 | 3300005577 | Ga0068857_100014330 | Ga0068857_1000143303 | 85 |
| 202 | 3300005614 | Ga0068856_100008202 | Ga0068856_1000082027 | 85 |
| 203 | 3300005614 | Ga0068856_100438372 | Ga0068856_1004383722 | 85 |
| 204 | 3300005616 | Ga0068852_100029234 | Ga0068852_1000292343 | 85 |
| 205 | 3300005617 | Ga0068859_100008964 | Ga0068859_10000896410 | 85 |
| 206 | 3300005618 | Ga0068864_100006989 | Ga0068864_1000069896 | 85 |
| 207 | 3300005618 | Ga0068864_102184838 | Ga0068864_1021848381 | 85 |
| 208 | 3300005834 | Ga0068851_10006556 | Ga0068851_100065565 | 85 |
| 209 | 3300005834 | Ga0068851_10975631 | Ga0068851_109756311 | 85 |
| 210 | 3300005841 | Ga0068863_100003161 | Ga0068863_1000031614 | 85 |
| 211 | 3300005842 | Ga0068858_100001902 | Ga0068858_10000190220 | 85 |
| 212 | 3300005843 | Ga0068860_100000809 | Ga0068860_1000008093 | 85 |
| 213 | 3300005844 | Ga0068862_100009301 | Ga0068862_1000093014 | 85 |
| 214 | 3300005844 | Ga0068862_100302218 | Ga0068862_1003022182 | 85 |
| 215 | 3300005937 | Ga0081455_10004869 | Ga0081455_1000486914 | 85 |
| 216 | 3300005937 | Ga0081455_10046010 | Ga0081455_100460102 | 85 |
| 217 | 3300006163 | Ga0070715_10226637 | Ga0070715_102266372 | 85 |
| 218 | 3300006175 | Ga0070712_100340940 | Ga0070712_1003409404 | 85 |
| 219 | 3300006177 | Ga0075362_10096835 | Ga0075362_100968352 | 85 |
| 220 | 3300006177 | Ga0075362_10295735 | Ga0075362_102957352 | 85 |
| 221 | 3300006177 | Ga0075362_10445905 | Ga0075362_104459052 | 85 |
| 222 | 3300006195 | Ga0075366_10001813 | Ga0075366_100018135 | 85 |
| 223 | 3300006195 | Ga0075366_10240061 | Ga0075366_102400612 | 85 |
| 224 | 3300006195 | Ga0075366_10460424 | Ga0075366_104604242 | 85 |
| 225 | 3300006237 | Ga0097621_100009947 | Ga0097621_1000099476 | 85 |
| 226 | 3300006353 | Ga0075370_10368488 | Ga0075370_103684882 | 85 |
| 227 | 3300006358 | Ga0068871_100139822 | Ga0068871_1001398224 | 85 |
| 228 | 3300006358 | Ga0068871_101755968 | Ga0068871_1017559682 | 85 |
| 229 | 3300006844 | Ga0075428_100880074 | Ga0075428_1008800741 | 85 |
| 230 | 3300006844 | Ga0075428_101135696 | Ga0075428_1011356961 | 85 |
| 231 | 3300006844 | Ga0075428_102175600 | Ga0075428_1021756002 | 85 |
| 232 | 3300006847 | Ga0075431_100061803 | Ga0075431_1000618035 | 85 |
| 233 | 3300006847 | Ga0075431_100487712 | Ga0075431_1004877123 | 85 |
| 234 | 3300006847 | Ga0075431_100647412 | Ga0075431_1006474121 | 85 |
| 235 | 3300006847 | Ga0075431_100884428 | Ga0075431_1008844281 | 85 |
| 236 | 3300006847 | Ga0075431_101335087 | Ga0075431_1013350872 | 85 |
| 237 | 3300006852 | Ga0075433_10164977 | Ga0075433_101649772 | 85 |
| 238 | 3300006852 | Ga0075433_10394147 | Ga0075433_103941472 | 85 |
| 239 | 3300006871 | Ga0075434_100907915 | Ga0075434_1009079151 | 85 |
| 240 | 3300006880 | Ga0075429_100596824 | Ga0075429_1005968242 | 85 |
| 241 | 3300006881 | Ga0068865_100470783 | Ga0068865_1004707832 | 85 |
| 242 | 3300006931 | Ga0097620_100008964 | Ga0097620_1000089643 | 85 |
| 243 | 3300009093 | Ga0105240_10003931 | Ga0105240_100039314 | 85 |
| 244 | 3300009093 | Ga0105240_10599373 | Ga0105240_105993732 | 85 |
| 245 | 3300009093 | Ga0105240_11620700 | Ga0105240_116207002 | 85 |
| 246 | 3300009094 | Ga0111539_10053174 | Ga0111539_100531745 | 85 |
| 247 | 3300009094 | Ga0111539_10643372 | Ga0111539_106433722 | 85 |
| 248 | 3300009094 | Ga0111539_10943369 | Ga0111539_109433691 | 85 |
| 249 | 3300009098 | Ga0105245_10010929 | Ga0105245_100109295 | 85 |
| 250 | 3300009098 | Ga0105245_10012850 | Ga0105245_100128503 | 85 |
| 251 | 3300009101 | Ga0105247_10024995 | Ga0105247_100249955 | 85 |
| 252 | 3300009147 | Ga0114129_10687122 | Ga0114129_106871222 | 85 |
| 253 | 3300009147 | Ga0114129_11574453 | Ga0114129_115744532 | 85 |
| 254 | 3300009147 | Ga0114129_13037071 | Ga0114129_130370711 | 85 |
| 255 | 3300009147 | Ga0114129_13071937 | Ga0114129_130719371 | 85 |
| 256 | 3300009148 | Ga0105243_11732571 | Ga0105243_117325712 | 85 |
| 257 | 3300009174 | Ga0105241_10004665 | Ga0105241_100046658 | 85 |
| 258 | 3300009174 | Ga0105241_11735213 | Ga0105241_117352132 | 85 |
| 259 | 3300009177 | Ga0105248_10093271 | Ga0105248_100932714 | 85 |
| 260 | 3300009177 | Ga0105248_11584326 | Ga0105248_115843262 | 85 |
| 261 | 3300009545 | Ga0105237_10007181 | Ga0105237_100071815 | 85 |
| 262 | 3300009545 | Ga0105237_10101571 | Ga0105237_101015715 | 85 |
| 263 | 3300009545 | Ga0105237_11177676 | Ga0105237_111776762 | 85 |
| 264 | 3300009551 | Ga0105238_10008228 | Ga0105238_100082283 | 85 |
| 265 | 3300009551 | Ga0105238_10021454 | Ga0105238_100214545 | 85 |
| 266 | 3300009551 | Ga0105238_10859662 | Ga0105238_108596622 | 85 |
| 267 | 3300009553 | Ga0105249_10238483 | Ga0105249_102384833 | 85 |
| 268 | 3300010375 | Ga0105239_10098590 | Ga0105239_100985902 | 85 |
| 269 | 3300010375 | Ga0105239_10099080 | Ga0105239_100990803 | 85 |
| 270 | 3300011119 | Ga0105246_10003503 | Ga0105246_100035037 | 85 |
| 271 | 3300013105 | Ga0157369_10015458 | Ga0157369_100154588 | 85 |
| 272 | 3300013296 | Ga0157374_10055775 | Ga0157374_100557753 | 85 |
| 273 | 3300013296 | Ga0157374_10093790 | Ga0157374_100937905 | 85 |
| 274 | 3300013296 | Ga0157374_10471857 | Ga0157374_104718572 | 85 |
| 275 | 3300013297 | Ga0157378_10025125 | Ga0157378_100251252 | 85 |
| 276 | 3300013297 | Ga0157378_10250805 | Ga0157378_102508053 | 85 |
| 277 | 3300013306 | Ga0163162_10179923 | Ga0163162_101799232 | 85 |
| 278 | 3300013306 | Ga0163162_10838192 | Ga0163162_108381922 | 85 |
| 279 | 3300013307 | Ga0157372_10101037 | Ga0157372_101010372 | 85 |
| 280 | 3300013307 | Ga0157372_10670785 | Ga0157372_106707852 | 85 |
| 281 | 3300013308 | Ga0157375_10005518 | Ga0157375_100055182 | 85 |
| 282 | 3300013308 | Ga0157375_10032187 | Ga0157375_100321875 | 85 |
| 283 | 3300013308 | Ga0157375_11964651 | Ga0157375_119646512 | 85 |
| 284 | 3300014325 | Ga0163163_10001103 | Ga0163163_100011033 | 85 |
| 285 | 3300014326 | Ga0157380_10103788 | Ga0157380_101037884 | 85 |
| 286 | 3300014968 | Ga0157379_10000092 | Ga0157379_100000924 | 85 |
| 287 | 3300014968 | Ga0157379_10295212 | Ga0157379_102952122 | 85 |
| 288 | 3300014969 | Ga0157376_10001138 | Ga0157376_1000113813 | 85 |
| 289 | 3300014969 | Ga0157376_11777445 | Ga0157376_117774452 | 85 |
| 290 | 3300017792 | Ga0163161_10877528 | Ga0163161_108775282 | 85 |
| 291 | 3300025321 | Ga0207656_10582918 | Ga0207656_105829181 | 85 |
| 292 | 3300025899 | Ga0207642_10313005 | Ga0207642_103130052 | 85 |
| 293 | 3300025900 | Ga0207710_10002483 | Ga0207710_100024836 | 85 |
| 294 | 3300025903 | Ga0207680_10690005 | Ga0207680_106900052 | 85 |
| 295 | 3300025904 | Ga0207647_10130798 | Ga0207647_101307982 | 85 |
| 296 | 3300025909 | Ga0207705_10066203 | Ga0207705_100662033 | 85 |
| 297 | 3300025909 | Ga0207705_11102940 | Ga0207705_111029402 | 85 |
| 298 | 3300025910 | Ga0207684_10347471 | Ga0207684_103474713 | 85 |
| 299 | 3300025911 | Ga0207654_10000682 | Ga0207654_100006823 | 85 |
| 300 | 3300025911 | Ga0207654_10733351 | Ga0207654_107333512 | 85 |
| 301 | 3300025912 | Ga0207707_10303295 | Ga0207707_103032953 | 85 |
| 302 | 3300025912 | Ga0207707_10785072 | Ga0207707_107850721 | 85 |
| 303 | 3300025913 | Ga0207695_10000314 | Ga0207695_100003144 | 85 |
| 304 | 3300025913 | Ga0207695_10174637 | Ga0207695_101746373 | 85 |
| 305 | 3300025913 | Ga0207695_11682570 | Ga0207695_116825702 | 85 |
| 306 | 3300025914 | Ga0207671_10002931 | Ga0207671_100029314 | 85 |
| 307 | 3300025914 | Ga0207671_10435488 | Ga0207671_104354882 | 85 |
| 308 | 3300025914 | Ga0207671_10862354 | Ga0207671_108623542 | 85 |
| 309 | 3300025915 | Ga0207693_11357758 | Ga0207693_113577582 | 85 |
| 310 | 3300025916 | Ga0207663_10533746 | Ga0207663_105337462 | 85 |
| 311 | 3300025920 | Ga0207649_10891506 | Ga0207649_108915062 | 85 |
| 312 | 3300025923 | Ga0207681_10081987 | Ga0207681_100819874 | 85 |
| 313 | 3300025924 | Ga0207694_10001968 | Ga0207694_100019682 | 85 |
| 314 | 3300025924 | Ga0207694_10250443 | Ga0207694_102504432 | 85 |
| 315 | 3300025924 | Ga0207694_10776372 | Ga0207694_107763722 | 85 |
| 316 | 3300025925 | Ga0207650_10011074 | Ga0207650_100110747 | 85 |
| 317 | 3300025927 | Ga0207687_10007042 | Ga0207687_100070426 | 85 |
| 318 | 3300025927 | Ga0207687_10168503 | Ga0207687_101685031 | 85 |
| 319 | 3300025931 | Ga0207644_10009369 | Ga0207644_100093692 | 85 |
| 320 | 3300025935 | Ga0207709_10699424 | Ga0207709_106994241 | 85 |
| 321 | 3300025937 | Ga0207669_10140090 | Ga0207669_101400902 | 85 |
| 322 | 3300025938 | Ga0207704_10242211 | Ga0207704_102422112 | 85 |
| 323 | 3300025939 | Ga0207665_10635632 | Ga0207665_106356322 | 85 |
| 324 | 3300025941 | Ga0207711_10103727 | Ga0207711_101037272 | 85 |
| 325 | 3300025942 | Ga0207689_10003813 | Ga0207689_100038139 | 85 |
| 326 | 3300025944 | Ga0207661_10030494 | Ga0207661_100304943 | 85 |
| 327 | 3300025945 | Ga0207679_10304259 | Ga0207679_103042593 | 85 |
| 328 | 3300025945 | Ga0207679_11038793 | Ga0207679_110387932 | 85 |
| 329 | 3300025949 | Ga0207667_12146998 | Ga0207667_121469981 | 85 |
| 330 | 3300025961 | Ga0207712_10145284 | Ga0207712_101452843 | 85 |
| 331 | 3300025972 | Ga0207668_11876898 | Ga0207668_118768982 | 85 |
| 332 | 3300025986 | Ga0207658_10004440 | Ga0207658_100044404 | 85 |
| 333 | 3300026023 | Ga0207677_10000104 | Ga0207677_1000010463 | 85 |
| 334 | 3300026023 | Ga0207677_10167947 | Ga0207677_101679473 | 85 |
| 335 | 3300026035 | Ga0207703_10001493 | Ga0207703_1000149319 | 85 |
| 336 | 3300026041 | Ga0207639_10001965 | Ga0207639_100019659 | 85 |
| 337 | 3300026041 | Ga0207639_10002214 | Ga0207639_100022149 | 85 |
| 338 | 3300026041 | Ga0207639_10933026 | Ga0207639_109330262 | 85 |
| 339 | 3300026067 | Ga0207678_10176897 | Ga0207678_101768973 | 85 |
| 340 | 3300026075 | Ga0207708_10586807 | Ga0207708_105868071 | 85 |
| 341 | 3300026078 | Ga0207702_10023448 | Ga0207702_100234484 | 85 |
| 342 | 3300026088 | Ga0207641_10000809 | Ga0207641_1000080929 | 85 |
| 343 | 3300026089 | Ga0207648_10221843 | Ga0207648_102218433 | 85 |
| 344 | 3300026095 | Ga0207676_10000862 | Ga0207676_100008624 | 85 |
| 345 | 3300026116 | Ga0207674_10003615 | Ga0207674_100036153 | 85 |
| 346 | 3300026118 | Ga0207675_100022885 | Ga0207675_1000228857 | 85 |
| 347 | 3300026142 | Ga0207698_10228774 | Ga0207698_102287742 | 85 |
| 348 | 3300026142 | Ga0207698_11387992 | Ga0207698_113879921 | 85 |
| 349 | 3300027907 | Ga0207428_10056948 | Ga0207428_100569484 | 85 |
| 350 | 3300027907 | Ga0207428_10425227 | Ga0207428_104252272 | 85 |
| 351 | 3300028380 | Ga0268265_10041752 | Ga0268265_100417525 | 85 |
| 352 | 3300028381 | Ga0268264_10001031 | Ga0268264_100010314 | 85 |
| 353 | 3300028794 | Ga0307515_10005786 | Ga0307515_100057868 | 85 |
| 354 | 3300028794 | Ga0307515_10045397 | Ga0307515_100453977 | 85 |
| 355 | 3300031238 | Ga0265332_10000028 | Ga0265332_10000028111 | 85 |
| 356 | 3300031241 | Ga0265325_10115242 | Ga0265325_101152422 | 85 |
| 357 | 3300031247 | Ga0265340_10029762 | Ga0265340_100297622 | 85 |
| 358 | 3300031344 | Ga0265316_10136783 | Ga0265316_101367834 | 85 |
| 359 | 3300031344 | Ga0265316_10468551 | Ga0265316_104685512 | 85 |
| 360 | 3300031456 | Ga0307513_10026448 | Ga0307513_100264485 | 85 |
| 361 | 3300031456 | Ga0307513_10248331 | Ga0307513_102483312 | 85 |
| 362 | 3300031548 | Ga0307408_100444376 | Ga0307408_1004443761 | 85 |
| 363 | 3300031649 | Ga0307514_10000920 | Ga0307514_1000092025 | 85 |
| 364 | 3300031711 | Ga0265314_10000054 | Ga0265314_10000054111 | 85 |
| 365 | 3300031711 | Ga0265314_10628997 | Ga0265314_106289972 | 85 |
| 366 | 3300031731 | Ga0307405_10319132 | Ga0307405_103191322 | 85 |
| 367 | 3300031731 | Ga0307405_11841687 | Ga0307405_118416872 | 85 |
| 368 | 3300031824 | Ga0307413_10034193 | Ga0307413_100341932 | 85 |
| 369 | 3300031852 | Ga0307410_10017964 | Ga0307410_100179643 | 85 |
| 370 | 3300031901 | Ga0307406_10036832 | Ga0307406_100368323 | 85 |
| 371 | 3300031903 | Ga0307407_10066639 | Ga0307407_100666391 | 85 |
| 372 | 3300031911 | Ga0307412_10337484 | Ga0307412_103374842 | 85 |
| 373 | 3300031911 | Ga0307412_10673558 | Ga0307412_106735582 | 85 |
| 374 | 3300031995 | Ga0307409_100437126 | Ga0307409_1004371262 | 85 |
| 375 | 3300032002 | Ga0307416_100067170 | Ga0307416_1000671704 | 85 |
| 376 | 3300032004 | Ga0307414_10090894 | Ga0307414_100908942 | 85 |
| 377 | 3300032005 | Ga0307411_10040085 | Ga0307411_100400852 | 85 |
| 378 | 3300032126 | Ga0307415_100123909 | Ga0307415_1001239092 | 85 |
| 379 | 3300032126 | Ga0307415_100128491 | Ga0307415_1001284912 | 85 |
| 380 | 3300032133 | Ga0316583_10004920 | Ga0316583_100049204 | 85 |
| 381 | 3300032168 | Ga0316593_10199397 | Ga0316593_101993972 | 85 |
| 382 | 3300033180 | Ga0307510_10659202 | Ga0307510_106592021 | 85 |
| 383 | 3300033527 | Ga0316586_1040824 | Ga0316586_10408242 | 85 |
| 384 | 3300035083 | Ga0373926_0413961 | Ga0373926_0413961_128_385 | 85 |
| 385 | 3300035111 | Ga0373923_0692527 | Ga0373923_0692527_181_438 | 85 |
| 386 | 3300035114 | Ga0373939_0118936 | Ga0373939_0118936_29_289 | 85 |
| 387 | 3300035170 | Ga0373943_0107900 | Ga0373943_0107900_547_804 | 85 |
| 388 | 3300035171 | Ga0373946_0414562 | Ga0373946_0414562_148_405 | 85 |
| 389 | 3300035172 | Ga0373955_0455528 | Ga0373955_0455528_152_409 | 85 |
| 390 | 3300035398 | Ga0316574_0746664 | Ga0316574_0746664_275_535 | 85 |
| 391 | 3300035691 | Ga0373931_0409292 | Ga0373931_0409292_433_690 | 85 |
| 392 | 3300035692 | Ga0373935_0755546 | Ga0373935_0755546_89_346 | 85 |
| 393 | 3300035692 | Ga0373935_0838132 | Ga0373935_0838132_60_317 | 85 |
| 394 | 3300035695 | Ga0373927_0182230 | Ga0373927_0182230_502_759 | 85 |
| 395 | 3300035695 | Ga0373927_0818875 | Ga0373927_0818875_320_577 | 85 |
| 396 | 3300035724 | Ga0373933_0297274 | Ga0373933_0297274_75_335 | 85 |
| 397 | 3300035725 | Ga0373947_0561376 | Ga0373947_0561376_418_675 | 85 |
| 398 | 3300036401 | Ga0373937_0090909 | Ga0373937_0090909_1827_2084 | 85 |
| 399 | 3300037068 | Ga0373925_0327193 | Ga0373925_0327193_471_728 | 85 |
| 400 | 3300039447 | Ga0436361_0470064 | Ga0436361_0470064_193_450 | 85 |
| 401 | 3300041408 | Ga0439453_0189804 | Ga0439453_0189804_180_437 | 85 |
| 402 | 3300041494 | Ga0451837_0156795 | Ga0451837_0156795_329_589 | 85 |
| 403 | 3300042001 | Ga0439441_042766 | Ga0439441_042766_504_761 | 85 |
| 404 | 3300042436 | Ga0439435_0029672 | Ga0439435_0029672_1158_1415 | 85 |
| 405 | 3300042876 | Ga0451577_0004474 | Ga0451577_0004474_111_371 | 85 |
| 406 | 3300042876 | Ga0451577_0012787 | Ga0451577_0012787_4359_4619 | 85 |
| 407 | 3300044712 | Ga0453684_0197742 | Ga0453684_0197742_1699_1959 | 85 |
| 408 | 3300045051 | Ga0451576_0000968 | Ga0451576_0000968_37354_37614 | 85 |
| 409 | 3300045051 | Ga0451576_0050377 | Ga0451576_0050377_3882_4163 | 85 |
| 410 | 3300046460 | Ga0495638_0573909 | Ga0495638_0573909_91_348 | 85 |
| 411 | 3300046472 | Ga0495580_0604330 | Ga0495580_0604330_195_452 | 85 |
| 412 | 3300046529 | Ga0495652_0482754 | Ga0495652_0482754_148_408 | 85 |
| 413 | 3300046530 | Ga0495654_0006530 | Ga0495654_0006530_3614_3874 | 85 |
| 414 | 3300046558 | Ga0495633_0000563 | Ga0495633_0000563_16756_17016 | 85 |
| 415 | 3300046615 | Ga0495656_0233678 | Ga0495656_0233678_284_541 | 85 |
| 416 | 3300046616 | Ga0495668_0613754 | Ga0495668_0613754_159_419 | 85 |
| 417 | 3300046684 | Ga0495669_0638658 | Ga0495669_0638658_31_288 | 85 |
| 418 | 3300047323 | Ga0495683_0240425 | Ga0495683_0240425_520_780 | 85 |
| 419 | 3300047471 | Ga0495684_0502201 | Ga0495684_0502201_267_524 | 85 |
| 420 | 3300049161 | Ga0501305_076619 | Ga0501305_076619_51_308 | 85 |
| 421 | 3300049162 | Ga0501307_040396 | Ga0501307_040396_116_376 | 85 |
| 422 | 3300049529 | Ga0501313_070236 | Ga0501313_070236_227_487 | 85 |
| 423 | 3300049533 | Ga0501317_033174 | Ga0501317_033174_450_707 | 85 |
| 424 | 3300049533 | Ga0501317_034341 | Ga0501317_034341_421_681 | 85 |
| 425 | 3300049587 | Ga0501071_0784925 | Ga0501071_0784925_32_289 | 85 |
| 426 | 3300049591 | Ga0501075_0836560 | Ga0501075_0836560_356_613 | 85 |
| 427 | 3300049591 | Ga0501075_0988697 | Ga0501075_0988697_191_451 | 85 |
| 428 | 3300049592 | Ga0501076_0128334 | Ga0501076_0128334_1286_1543 | 85 |
| 429 | 3300049593 | Ga0501077_0236396 | Ga0501077_0236396_216_473 | 85 |
| 430 | 3300049686 | Ga0501257_209474 | Ga0501257_209474_12_269 | 85 |
| 431 | 3300049742 | Ga0501080_0802919 | Ga0501080_0802919_416_697 | 85 |
| 432 | 3300049743 | Ga0501081_0628739 | Ga0501081_0628739_96_356 | 85 |
| 433 | 3300049743 | Ga0501081_1175557 | Ga0501081_1175557_35_310 | 85 |
| 434 | 3300049824 | Ga0501045_0065790 | Ga0501045_0065790_1352_1612 | 85 |
| 435 | 3300050489 | nmdc:mga03683_108372_c1 | nmdc:mga03683_108372_c1_707_964 | 85 |
| 436 | 3300050493 | nmdc:mga0k408_131008_c2 | nmdc:mga0k408_131008_c2_505_762 | 85 |
| 437 | 3300050493 | nmdc:mga0k408_5607_c1 | nmdc:mga0k408_5607_c1_3108_3368 | 85 |
| 438 | 3300050496 | nmdc:mga07m45_176203_c2 | nmdc:mga07m45_176203_c2_407_667 | 85 |
| 439 | 3300050507 | nmdc:mga05p37_331725_c1 | nmdc:mga05p37_331725_c1_236_493 | 85 |
| 440 | 3300050507 | nmdc:mga05p37_54904_c1 | nmdc:mga05p37_54904_c1_3946_4206 | 85 |
| 441 | 3300050507 | nmdc:mga05p37_64916_c1 | nmdc:mga05p37_64916_c1_565_825 | 85 |
| 442 | 3300050508 | nmdc:mga09592_1178515_c1 | nmdc:mga09592_1178515_c1_37_294 | 85 |
| 443 | 3300050508 | nmdc:mga09592_1442352_c1 | nmdc:mga09592_1442352_c1_18_278 | 85 |
| 444 | 3300050508 | nmdc:mga09592_564011_c1 | nmdc:mga09592_564011_c1_139_399 | 85 |
| 445 | 3300050509 | nmdc:mga0qj67_1102760_c1 | nmdc:mga0qj67_1102760_c1_329_586 | 85 |
| 446 | 3300050510 | nmdc:mga06r32_1339475_c1 | nmdc:mga06r32_1339475_c1_135_395 | 85 |
| 447 | 3300050510 | nmdc:mga06r32_390755_c1 | nmdc:mga06r32_390755_c1_17_277 | 85 |
| 448 | 3300050510 | nmdc:mga06r32_53958_c1 | nmdc:mga06r32_53958_c1_2678_2938 | 85 |
| 449 | 3300050511 | nmdc:mga08y16_14338_c1 | nmdc:mga08y16_14338_c1_1653_1913 | 85 |
| 450 | 3300050511 | nmdc:mga08y16_2037200_c1 | nmdc:mga08y16_2037200_c1_43_300 | 85 |
| 451 | 3300050512 | nmdc:mga0n895_546066_c1 | nmdc:mga0n895_546066_c1_195_455 | 85 |
| 452 | 3300050512 | nmdc:mga0n895_782032_c1 | nmdc:mga0n895_782032_c1_629_889 | 85 |
| 453 | 3300050514 | nmdc:mga08x19_1293612_c1 | nmdc:mga08x19_1293612_c1_236_496 | 85 |
| 454 | 3300050514 | nmdc:mga08x19_810544_c1 | nmdc:mga08x19_810544_c1_127_384 | 85 |
| 455 | 3300050515 | nmdc:mga0a205_263238_c1 | nmdc:mga0a205_263238_c1_687_947 | 85 |
| 456 | 3300050515 | nmdc:mga0a205_474934_c1 | nmdc:mga0a205_474934_c1_404_664 | 85 |
| 457 | 3300053153 | Ga0500616_0114013 | Ga0500616_0114013_904_1164 | 85 |
| 458 | 3300053157 | Ga0500624_042680 | Ga0500624_042680_41_301 | 85 |
| 459 | 3300053161 | Ga0500634_0097376 | Ga0500634_0097376_304_564 | 85 |
| 460 | 3300054114 | Ga0501084_0074473 | Ga0501084_0074473_473_733 | 85 |
| 461 | 3300054114 | Ga0501084_0365780 | Ga0501084_0365780_277_534 | 85 |
| 462 | 3300059421 | Ga0590071_147419 | Ga0590071_147419_191_448 | 85 |
| 463 | 3300005327 | Ga0070658_10061090 | Ga0070658_100610904 | 86 |
| 464 | 3300005329 | Ga0070683_100332912 | Ga0070683_1003329123 | 86 |
| 465 | 3300005329 | Ga0070683_102336919 | Ga0070683_1023369191 | 86 |
| 466 | 3300005339 | Ga0070660_100415098 | Ga0070660_1004150983 | 86 |
| 467 | 3300005344 | Ga0070661_100005387 | Ga0070661_1000053877 | 86 |
| 468 | 3300005435 | Ga0070714_100050959 | Ga0070714_1000509593 | 86 |
| 469 | 3300005436 | Ga0070713_101090290 | Ga0070713_1010902901 | 86 |
| 470 | 3300005439 | Ga0070711_101067854 | Ga0070711_1010678541 | 86 |
| 471 | 3300005440 | Ga0070705_100375867 | Ga0070705_1003758672 | 86 |
| 472 | 3300005455 | Ga0070663_102015109 | Ga0070663_1020151091 | 86 |
| 473 | 3300005535 | Ga0070684_100228194 | Ga0070684_1002281942 | 86 |
| 474 | 3300005563 | Ga0068855_100000872 | Ga0068855_1000008728 | 86 |
| 475 | 3300005563 | Ga0068855_100018642 | Ga0068855_1000186426 | 86 |
| 476 | 3300005564 | Ga0070664_100102401 | Ga0070664_1001024015 | 86 |
| 477 | 3300005577 | Ga0068857_100785092 | Ga0068857_1007850922 | 86 |
| 478 | 3300005578 | Ga0068854_100410490 | Ga0068854_1004104902 | 86 |
| 479 | 3300005614 | Ga0068856_101098719 | Ga0068856_1010987191 | 86 |
| 480 | 3300005614 | Ga0068856_101167549 | Ga0068856_1011675492 | 86 |
| 481 | 3300005616 | Ga0068852_100000015 | Ga0068852_10000001569 | 86 |
| 482 | 3300005616 | Ga0068852_101516901 | Ga0068852_1015169012 | 86 |
| 483 | 3300005834 | Ga0068851_10005020 | Ga0068851_100050205 | 86 |
| 484 | 3300005937 | Ga0081455_10982842 | Ga0081455_109828422 | 86 |
| 485 | 3300009093 | Ga0105240_10000181 | Ga0105240_1000018160 | 86 |
| 486 | 3300009093 | Ga0105240_10916213 | Ga0105240_109162131 | 86 |
| 487 | 3300009093 | Ga0105240_11717552 | Ga0105240_117175521 | 86 |
| 488 | 3300009094 | Ga0111539_12990888 | Ga0111539_129908882 | 86 |
| 489 | 3300009101 | Ga0105247_10112463 | Ga0105247_101124632 | 86 |
| 490 | 3300009174 | Ga0105241_10000076 | Ga0105241_1000007658 | 86 |
| 491 | 3300009174 | Ga0105241_10484211 | Ga0105241_104842112 | 86 |
| 492 | 3300009174 | Ga0105241_11473968 | Ga0105241_114739682 | 86 |
| 493 | 3300009177 | Ga0105248_11033458 | Ga0105248_110334582 | 86 |
| 494 | 3300009545 | Ga0105237_10583491 | Ga0105237_105834912 | 86 |
| 495 | 3300009551 | Ga0105238_10009668 | Ga0105238_100096684 | 86 |
| 496 | 3300010375 | Ga0105239_10204266 | Ga0105239_102042663 | 86 |
| 497 | 3300010375 | Ga0105239_11452286 | Ga0105239_114522862 | 86 |
| 498 | 3300013100 | Ga0157373_10066560 | Ga0157373_100665603 | 86 |
| 499 | 3300013100 | Ga0157373_10715598 | Ga0157373_107155982 | 86 |
| 500 | 3300013102 | Ga0157371_10046851 | Ga0157371_100468513 | 86 |
| 501 | 3300013104 | Ga0157370_10000196 | Ga0157370_1000019658 | 86 |
| 502 | 3300013105 | Ga0157369_10000241 | Ga0157369_1000024166 | 86 |
| 503 | 3300013105 | Ga0157369_10063405 | Ga0157369_100634055 | 86 |
| 504 | 3300013105 | Ga0157369_10143969 | Ga0157369_101439694 | 86 |
| 505 | 3300013105 | Ga0157369_10681824 | Ga0157369_106818242 | 86 |
| 506 | 3300013296 | Ga0157374_10011932 | Ga0157374_100119323 | 86 |
| 507 | 3300013296 | Ga0157374_10094415 | Ga0157374_100944153 | 86 |
| 508 | 3300013296 | Ga0157374_11653258 | Ga0157374_116532581 | 86 |
| 509 | 3300013307 | Ga0157372_10000197 | Ga0157372_1000019759 | 86 |
| 510 | 3300013307 | Ga0157372_10005898 | Ga0157372_100058985 | 86 |
| 511 | 3300013308 | Ga0157375_11737436 | Ga0157375_117374361 | 86 |
| 512 | 3300014968 | Ga0157379_10072593 | Ga0157379_100725933 | 86 |
| 513 | 3300014969 | Ga0157376_10010621 | Ga0157376_100106215 | 86 |
| 514 | 3300014969 | Ga0157376_12903748 | Ga0157376_129037482 | 86 |
| 515 | 3300020069 | Ga0197907_10371255 | Ga0197907_103712552 | 86 |
| 516 | 3300020075 | Ga0206349_1174937 | Ga0206349_11749372 | 86 |
| 517 | 3300020076 | Ga0206355_1316834 | Ga0206355_13168342 | 86 |
| 518 | 3300020077 | Ga0206351_10796194 | Ga0206351_107961941 | 86 |
| 519 | 3300020078 | Ga0206352_11254640 | Ga0206352_112546403 | 86 |
| 520 | 3300020080 | Ga0206350_11185957 | Ga0206350_111859572 | 86 |
| 521 | 3300020081 | Ga0206354_11484000 | Ga0206354_114840002 | 86 |
| 522 | 3300022467 | Ga0224712_10099893 | Ga0224712_100998932 | 86 |
| 523 | 3300025321 | Ga0207656_10019549 | Ga0207656_100195493 | 86 |
| 524 | 3300025909 | Ga0207705_10132720 | Ga0207705_101327203 | 86 |
| 525 | 3300025911 | Ga0207654_10000025 | Ga0207654_1000002590 | 86 |
| 526 | 3300025911 | Ga0207654_10000035 | Ga0207654_1000003511 | 86 |
| 527 | 3300025911 | Ga0207654_10636562 | Ga0207654_106365622 | 86 |
| 528 | 3300025911 | Ga0207654_11234484 | Ga0207654_112344842 | 86 |
| 529 | 3300025913 | Ga0207695_10000069 | Ga0207695_10000069217 | 86 |
| 530 | 3300025915 | Ga0207693_10638839 | Ga0207693_106388391 | 86 |
| 531 | 3300025916 | Ga0207663_11003777 | Ga0207663_110037771 | 86 |
| 532 | 3300025920 | Ga0207649_10323819 | Ga0207649_103238193 | 86 |
| 533 | 3300025924 | Ga0207694_10202911 | Ga0207694_102029112 | 86 |
| 534 | 3300025929 | Ga0207664_10287335 | Ga0207664_102873353 | 86 |
| 535 | 3300025944 | Ga0207661_11638208 | Ga0207661_116382082 | 86 |
| 536 | 3300025945 | Ga0207679_10292687 | Ga0207679_102926871 | 86 |
| 537 | 3300025949 | Ga0207667_10011113 | Ga0207667_100111136 | 86 |
| 538 | 3300025949 | Ga0207667_10238278 | Ga0207667_102382783 | 86 |
| 539 | 3300025981 | Ga0207640_10311147 | Ga0207640_103111472 | 86 |
| 540 | 3300025981 | Ga0207640_10737603 | Ga0207640_107376032 | 86 |
| 541 | 3300026041 | Ga0207639_10459529 | Ga0207639_104595292 | 86 |
| 542 | 3300026067 | Ga0207678_10927039 | Ga0207678_109270392 | 86 |
| 543 | 3300026078 | Ga0207702_10517983 | Ga0207702_105179832 | 86 |
| 544 | 3300026116 | Ga0207674_10150239 | Ga0207674_101502393 | 86 |
| 545 | 3300026142 | Ga0207698_10000006 | Ga0207698_1000000659 | 86 |
| 546 | 3300026142 | Ga0207698_10042739 | Ga0207698_100427392 | 86 |
| 547 | 3300028800 | Ga0265338_10003453 | Ga0265338_100034535 | 86 |
| 548 | 3300028800 | Ga0265338_10878674 | Ga0265338_108786742 | 86 |
| 549 | 3300029957 | Ga0265324_10200638 | Ga0265324_102006382 | 86 |
| 550 | 3300031249 | Ga0265339_10084308 | Ga0265339_100843082 | 86 |
| 551 | 3300031249 | Ga0265339_10450883 | Ga0265339_104508832 | 86 |
| 552 | 3300031711 | Ga0265314_10416167 | Ga0265314_104161672 | 86 |
| 553 | 3300033541 | Ga0316596_1055954 | Ga0316596_10559542 | 86 |
| 554 | 3300035112 | Ga0373932_0386017 | Ga0373932_0386017_223_501 | 86 |
| 555 | 3300036401 | Ga0373937_0905455 | Ga0373937_0905455_388_651 | 86 |
| 556 | 3300036401 | Ga0373937_1042337 | Ga0373937_1042337_416_679 | 86 |
| 557 | 3300039450 | Ga0436363_1402859 | Ga0436363_1402859_340_603 | 86 |
| 558 | 3300044694 | Ga0466963_0072801 | Ga0466963_0072801_485_748 | 86 |
| 559 | 3300045976 | Ga0466967_0000716 | Ga0466967_0000716_8878_9141 | 86 |
| 560 | 3300046459 | Ga0495629_0322261 | Ga0495629_0322261_271_534 | 86 |
| 561 | 3300046462 | Ga0495651_0808895 | Ga0495651_0808895_162_425 | 86 |
| 562 | 3300046472 | Ga0495580_0053212 | Ga0495580_0053212_1491_1754 | 86 |
| 563 | 3300046472 | Ga0495580_0741765 | Ga0495580_0741765_284_547 | 86 |
| 564 | 3300046514 | Ga0495618_0764145 | Ga0495618_0764145_95_358 | 86 |
| 565 | 3300046531 | Ga0495665_0498233 | Ga0495665_0498233_209_472 | 86 |
| 566 | 3300046533 | Ga0495640_0203276 | Ga0495640_0203276_142_405 | 86 |
| 567 | 3300046642 | Ga0495634_0339132 | Ga0495634_0339132_441_704 | 86 |
| 568 | 3300046678 | Ga0495599_0258323 | Ga0495599_0258323_614_877 | 86 |
| 569 | 3300046689 | Ga0495613_0013649 | Ga0495613_0013649_75_338 | 86 |
| 570 | 3300046689 | Ga0495613_0131731 | Ga0495613_0131731_506_769 | 86 |
| 571 | 3300047317 | Ga0495604_0232835 | Ga0495604_0232835_468_731 | 86 |
| 572 | 3300047319 | Ga0495674_0292484 | Ga0495674_0292484_310_573 | 86 |
| 573 | 3300048088 | Ga0495602_0157610 | Ga0495602_0157610_589_852 | 86 |
| 574 | 3300048903 | Ga0496100_0014533 | Ga0496100_0014533_4155_4418 | 86 |
| 575 | 3300048904 | Ga0496101_0005626 | Ga0496101_0005626_2309_2572 | 86 |
| 576 | 3300048907 | Ga0496104_0011960 | Ga0496104_0011960_126_389 | 86 |
| 577 | 3300048907 | Ga0496104_1292314 | Ga0496104_1292314_62_325 | 86 |
| 578 | 3300048908 | Ga0496105_0179639 | Ga0496105_0179639_518_781 | 86 |
| 579 | 3300048910 | Ga0496107_0078761 | Ga0496107_0078761_65_328 | 86 |
| 580 | 3300048912 | Ga0496109_0000023 | Ga0496109_0000023_21905_22183 | 86 |
| 581 | 3300048913 | Ga0496110_0051931 | Ga0496110_0051931_101_364 | 86 |
| 582 | 3300048917 | Ga0496114_0722210 | Ga0496114_0722210_583_846 | 86 |
| 583 | 3300048918 | Ga0496115_0053576 | Ga0496115_0053576_392_655 | 86 |
| 584 | 3300021388 | Ga0213875_10053554 | Ga0213875_100535541 | 87 |
| 585 | 3300025949 | Ga0207667_11441625 | Ga0207667_114416252 | 87 |
| 586 | 3300028558 | Ga0265326_10041653 | Ga0265326_100416532 | 87 |
| 587 | 3300028558 | Ga0265326_10239133 | Ga0265326_102391331 | 87 |
| 588 | 3300028800 | Ga0265338_10011065 | Ga0265338_100110653 | 87 |
| 589 | 3300028800 | Ga0265338_10042888 | Ga0265338_100428886 | 87 |
| 590 | 3300028800 | Ga0265338_10100984 | Ga0265338_101009843 | 87 |
| 591 | 3300028800 | Ga0265338_10366481 | Ga0265338_103664812 | 87 |
| 592 | 3300031711 | Ga0265314_10023669 | Ga0265314_100236692 | 87 |
| 593 | 3300036401 | Ga0373937_1158296 | Ga0373937_1158296_318_584 | 87 |
| 594 | 3300037853 | Ga0436364_0755656 | Ga0436364_0755656_7915_8187 | 87 |
| 595 | 3300039437 | Ga0436365_0142396 | Ga0436365_0142396_857_1123 | 87 |
| 596 | 3300039437 | Ga0436365_0257100 | Ga0436365_0257100_180_446 | 87 |
| 597 | 3300039453 | Ga0436362_1204042 | Ga0436362_1204042_683_949 | 87 |
| 598 | 3300041505 | Ga0451849_0242008 | Ga0451849_0242008_219_482 | 87 |
| 599 | 3300041512 | Ga0451853_1096528 | Ga0451853_1096528_193_465 | 87 |
| 600 | 3300045049 | Ga0466959_0913084 | Ga0466959_0913084_89_361 | 87 |
| 601 | 3300048918 | Ga0496115_0252433 | Ga0496115_0252433_1071_1337 | 87 |
| 602 | 3300049581 | Ga0501047_0732000 | Ga0501047_0732000_69_341 | 87 |
| 603 | 3300053096 | Ga0500641_0070968 | Ga0500641_0070968_1134_1421 | 87 |
| 604 | 3300053103 | Ga0500555_004963 | Ga0500555_004963_2364_2651 | 87 |
| 605 | 3300053108 | Ga0500562_019709 | Ga0500562_019709_291_578 | 87 |
| 606 | 3300021377 | Ga0213874_10109898 | Ga0213874_101098982 | 88 |
| 607 | 3300028800 | Ga0265338_10007366 | Ga0265338_100073664 | 88 |
| 608 | 3300028800 | Ga0265338_10701813 | Ga0265338_107018132 | 88 |
| 609 | 3300031995 | Ga0307409_100593712 | Ga0307409_1005937121 | 88 |
| 610 | 3300032002 | Ga0307416_100925299 | Ga0307416_1009252992 | 88 |
| 611 | 3300033541 | Ga0316596_1042366 | Ga0316596_10423662 | 88 |
| 612 | 3300039437 | Ga0436365_0429969 | Ga0436365_0429969_262_531 | 88 |
| 613 | 3300039450 | Ga0436363_0344193 | Ga0436363_0344193_667_936 | 88 |
| 614 | 3300044684 | Ga0466966_0872174 | Ga0466966_0872174_207_518 | 88 |
| 615 | 3300044693 | Ga0466961_0057455 | Ga0466961_0057455_1954_2265 | 88 |
| 616 | 3300044735 | Ga0466968_0010626 | Ga0466968_0010626_1824_2135 | 88 |
| 617 | 3300045049 | Ga0466959_0129678 | Ga0466959_0129678_205_516 | 88 |
| 618 | 3300048919 | Ga0496116_0321293 | Ga0496116_0321293_360_671 | 88 |
| 619 | 3300048925 | Ga0496122_0007634 | Ga0496122_0007634_2306_2617 | 88 |
| 620 | 3300049570 | Ga0501033_0128466 | Ga0501033_0128466_1404_1673 | 88 |
| 621 | 3300049589 | Ga0501073_0321404 | Ga0501073_0321404_671_937 | 88 |
| 622 | 3300053153 | Ga0500616_0238181 | Ga0500616_0238181_61_327 | 88 |
| 623 | 3300059426 | Ga0590077_161701 | Ga0590077_161701_169_459 | 88 |
| 624 | 3300059640 | Ga0587067_063942 | Ga0587067_063942_402_716 | 88 |
| 625 | 3300060353 | Ga0501082_0000993 | Ga0501082_0000993_1813_2079 | 88 |
| 626 | 3300061719 | Ga0466962_0051036 | Ga0466962_0051036_798_1109 | 88 |
| 627 | iso_pu_bacteria | 2585428059 | 2587740447 | 88 |
| 628 | iso_pu_bacteria | 2643221676 | 2644426655 | 88 |
| 629 | iso_pu_bacteria | 2818991459 | 2819672880 | 88 |
| 630 | iso_pu_bacteria | 2857453340 | 2857456610 | 88 |
| 631 | iso_pu_bacteria | 2904755435 | 2904756243 | 88 |
| 632 | iso_pu_bacteria | 2919425241 | 2919432086 | 88 |
| 633 | iso_pu_bacteria | 2971410472 | 2971414083 | 88 |
| 634 | iso_pu_bacteria | 2980182181 | 2980185166 | 88 |
| 635 | iso_pu_bacteria | 8056533031 | 8056539162 | 88 |
| 636 | 3300003693 | Ga0032354_1014035 | Ga0032354_10140352 | 89 |
| 637 | 3300031731 | Ga0307405_11680257 | Ga0307405_116802571 | 89 |
| 638 | 3300049592 | Ga0501076_0358010 | Ga0501076_0358010_720_989 | 89 |
| 639 | 3300053102 | Ga0500554_150671 | Ga0500554_150671_382_675 | 89 |
| 640 | 3300053129 | Ga0500628_000289 | Ga0500628_000289_3117_3410 | 89 |
| 641 | 3300005445 | Ga0070708_101007379 | Ga0070708_1010073792 | 90 |
| 642 | 3300005468 | Ga0070707_100157444 | Ga0070707_1001574442 | 90 |
| 643 | 3300005544 | Ga0070686_100223163 | Ga0070686_1002231633 | 90 |
| 644 | 3300005546 | Ga0070696_101822468 | Ga0070696_1018224681 | 90 |
| 645 | 3300005549 | Ga0070704_100122034 | Ga0070704_1001220343 | 90 |
| 646 | 3300006852 | Ga0075433_10983799 | Ga0075433_109837992 | 90 |
| 647 | 3300007076 | Ga0075435_100321182 | Ga0075435_1003211823 | 90 |
| 648 | 3300013307 | Ga0157372_10257589 | Ga0157372_102575893 | 90 |
| 649 | 3300020081 | Ga0206354_10521497 | Ga0206354_105214971 | 90 |
| 650 | 3300021384 | Ga0213876_10394154 | Ga0213876_103941542 | 90 |
| 651 | 3300025885 | Ga0207653_10261502 | Ga0207653_102615021 | 90 |
| 652 | 3300025905 | Ga0207685_10205860 | Ga0207685_102058601 | 90 |
| 653 | 3300025922 | Ga0207646_10108845 | Ga0207646_101088452 | 90 |
| 654 | 3300028380 | Ga0268265_11597889 | Ga0268265_115978892 | 90 |
| 655 | 3300031548 | Ga0307408_100291031 | Ga0307408_1002910312 | 90 |
| 656 | 3300031665 | Ga0316575_10089796 | Ga0316575_100897962 | 90 |
| 657 | 3300031731 | Ga0307405_10681859 | Ga0307405_106818592 | 90 |
| 658 | 3300031824 | Ga0307413_10722126 | Ga0307413_107221262 | 90 |
| 659 | 3300031852 | Ga0307410_10163591 | Ga0307410_101635912 | 90 |
| 660 | 3300031903 | Ga0307407_10335844 | Ga0307407_103358442 | 90 |
| 661 | 3300032005 | Ga0307411_11024632 | Ga0307411_110246322 | 90 |
| 662 | 3300037853 | Ga0436364_0661109 | Ga0436364_0661109_108_380 | 90 |
| 663 | 3300039437 | Ga0436365_0760636 | Ga0436365_0760636_458_730 | 90 |
| 664 | 3300039437 | Ga0436365_1153303 | Ga0436365_1153303_1496_1768 | 90 |
| 665 | 3300039437 | Ga0436365_1303455 | Ga0436365_1303455_309_581 | 90 |
| 666 | 3300045051 | Ga0451576_1074070 | Ga0451576_1074070_122_397 | 90 |
| 667 | 3300049569 | Ga0501032_1067427 | Ga0501032_1067427_210_488 | 90 |
| 668 | 3300049570 | Ga0501033_0230338 | Ga0501033_0230338_351_629 | 90 |
| 669 | 3300049573 | Ga0501037_0259210 | Ga0501037_0259210_865_1143 | 90 |
| 670 | 3300049579 | Ga0501043_0215283 | Ga0501043_0215283_695_973 | 90 |
| 671 | 3300049581 | Ga0501047_0135035 | Ga0501047_0135035_1721_1999 | 90 |
| 672 | 3300049584 | Ga0501068_0232786 | Ga0501068_0232786_96_374 | 90 |
| 673 | 3300049586 | Ga0501070_0449226 | Ga0501070_0449226_346_624 | 90 |
| 674 | 3300049589 | Ga0501073_0011356 | Ga0501073_0011356_758_1036 | 90 |
| 675 | 3300049590 | Ga0501074_0656757 | Ga0501074_0656757_306_584 | 90 |
| 676 | 3300049742 | Ga0501080_0050487 | Ga0501080_0050487_1300_1578 | 90 |
| 677 | 3300049744 | Ga0501083_0024181 | Ga0501083_0024181_1355_1633 | 90 |
| 678 | 3300049823 | Ga0501044_0056277 | Ga0501044_0056277_1441_1719 | 90 |
| 679 | 3300049823 | Ga0501044_1054123 | Ga0501044_1054123_23_301 | 90 |
| 680 | 3300050513 | nmdc:mga0rr50_643995_c1 | nmdc:mga0rr50_643995_c1_339_614 | 90 |
| 681 | 3300054114 | Ga0501084_0615504 | Ga0501084_0615504_385_663 | 90 |
| 682 | 3300060353 | Ga0501082_0507394 | Ga0501082_0507394_572_850 | 90 |
| 683 | 3300005330 | Ga0070690_100324858 | Ga0070690_1003248582 | 91 |
| 684 | 3300006847 | Ga0075431_100639006 | Ga0075431_1006390062 | 91 |
| 685 | 3300013308 | Ga0157375_12277894 | Ga0157375_122778942 | 91 |
| 686 | 3300021377 | Ga0213874_10384451 | Ga0213874_103844512 | 91 |
| 687 | 3300031548 | Ga0307408_100799984 | Ga0307408_1007999842 | 91 |
| 688 | 3300031548 | Ga0307408_101523386 | Ga0307408_1015233862 | 91 |
| 689 | 3300031852 | Ga0307410_11380741 | Ga0307410_113807412 | 91 |
| 690 | 3300031911 | Ga0307412_11889713 | Ga0307412_118897132 | 91 |
| 691 | 3300031995 | Ga0307409_102395469 | Ga0307409_1023954692 | 91 |
| 692 | 3300032002 | Ga0307416_101703994 | Ga0307416_1017039942 | 91 |
| 693 | 3300032126 | Ga0307415_101610594 | Ga0307415_1016105942 | 91 |
| 694 | 3300033541 | Ga0316596_1232317 | Ga0316596_12323172 | 91 |
| 695 | 3300039450 | Ga0436363_0995645 | Ga0436363_0995645_209_508 | 91 |
| 696 | 3300042004 | Ga0439445_0249593 | Ga0439445_0249593_25_300 | 91 |
| 697 | 3300042435 | Ga0439434_0304473 | Ga0439434_0304473_97_372 | 91 |
| 698 | 3300044693 | Ga0466961_0001485 | Ga0466961_0001485_8000_8302 | 91 |
| 699 | 3300045051 | Ga0451576_1020422 | Ga0451576_1020422_274_558 | 91 |
| 700 | 3300046522 | Ga0495643_0000286 | Ga0495643_0000286_14924_15223 | 91 |
| 701 | 3300049568 | Ga0501031_0233950 | Ga0501031_0233950_893_1168 | 91 |
| 702 | 3300049569 | Ga0501032_0001422 | Ga0501032_0001422_4456_4731 | 91 |
| 703 | 3300049570 | Ga0501033_0005041 | Ga0501033_0005041_6000_6275 | 91 |
| 704 | 3300049571 | Ga0501034_0057268 | Ga0501034_0057268_1526_1801 | 91 |
| 705 | 3300049572 | Ga0501036_0085234 | Ga0501036_0085234_2117_2392 | 91 |
| 706 | 3300049573 | Ga0501037_0008897 | Ga0501037_0008897_4455_4730 | 91 |
| 707 | 3300049574 | Ga0501038_0104377 | Ga0501038_0104377_1857_2132 | 91 |
| 708 | 3300049575 | Ga0501039_0004832 | Ga0501039_0004832_146_421 | 91 |
| 709 | 3300049579 | Ga0501043_0002349 | Ga0501043_0002349_8783_9058 | 91 |
| 710 | 3300049580 | Ga0501046_0001586 | Ga0501046_0001586_1647_1922 | 91 |
| 711 | 3300049581 | Ga0501047_0017656 | Ga0501047_0017656_5864_6139 | 91 |
| 712 | 3300049582 | Ga0501048_0119263 | Ga0501048_0119263_308_583 | 91 |
| 713 | 3300049583 | Ga0501067_0024472 | Ga0501067_0024472_2198_2473 | 91 |
| 714 | 3300049585 | Ga0501069_0000190 | Ga0501069_0000190_7815_8090 | 91 |
| 715 | 3300049586 | Ga0501070_0001037 | Ga0501070_0001037_8516_8791 | 91 |
| 716 | 3300049588 | Ga0501072_0392382 | Ga0501072_0392382_10_285 | 91 |
| 717 | 3300049589 | Ga0501073_0003174 | Ga0501073_0003174_3647_3922 | 91 |
| 718 | 3300049590 | Ga0501074_0037087 | Ga0501074_0037087_274_549 | 91 |
| 719 | 3300049741 | Ga0501079_0171794 | Ga0501079_0171794_1354_1629 | 91 |
| 720 | 3300049742 | Ga0501080_0001815 | Ga0501080_0001815_13091_13366 | 91 |
| 721 | 3300049744 | Ga0501083_0011803 | Ga0501083_0011803_1593_1868 | 91 |
| 722 | 3300049822 | Ga0501035_0021710 | Ga0501035_0021710_1661_1936 | 91 |
| 723 | 3300049823 | Ga0501044_0004911 | Ga0501044_0004911_8352_8627 | 91 |
| 724 | 3300050510 | nmdc:mga06r32_572598_c1 | nmdc:mga06r32_572598_c1_660_935 | 91 |
| 725 | 3300054114 | Ga0501084_0043078 | Ga0501084_0043078_3329_3604 | 91 |
| 726 | 3300059424 | Ga0590075_045809 | Ga0590075_045809_248_523 | 91 |
| 727 | 3300060353 | Ga0501082_0002008 | Ga0501082_0002008_12618_12893 | 91 |
| 728 | 3300003215 | JGI25153J46596_10001505 | JGI25153J46596_1000150510 | 92 |
| 729 | 3300003794 | Ga0055531_10021622 | Ga0055531_100216222 | 92 |
| 730 | 3300005355 | Ga0070671_100090147 | Ga0070671_1000901473 | 92 |
| 731 | 3300005365 | Ga0070688_101527846 | Ga0070688_1015278462 | 92 |
| 732 | 3300005367 | Ga0070667_101165405 | Ga0070667_1011654051 | 92 |
| 733 | 3300005539 | Ga0068853_102492998 | Ga0068853_1024929981 | 92 |
| 734 | 3300005548 | Ga0070665_100865750 | Ga0070665_1008657502 | 92 |
| 735 | 3300005578 | Ga0068854_100766745 | Ga0068854_1007667452 | 92 |
| 736 | 3300005617 | Ga0068859_100825558 | Ga0068859_1008255581 | 92 |
| 737 | 3300005719 | Ga0068861_100694630 | Ga0068861_1006946301 | 92 |
| 738 | 3300005843 | Ga0068860_102281767 | Ga0068860_1022817671 | 92 |
| 739 | 3300005844 | Ga0068862_100011360 | Ga0068862_1000113602 | 92 |
| 740 | 3300005937 | Ga0081455_10201084 | Ga0081455_102010842 | 92 |
| 741 | 3300005983 | Ga0081540_1212760 | Ga0081540_12127602 | 92 |
| 742 | 3300005985 | Ga0081539_10065440 | Ga0081539_100654402 | 92 |
| 743 | 3300006931 | Ga0097620_100825400 | Ga0097620_1008254003 | 92 |
| 744 | 3300009011 | Ga0105251_10440078 | Ga0105251_104400782 | 92 |
| 745 | 3300009177 | Ga0105248_11103110 | Ga0105248_111031101 | 92 |
| 746 | 3300009551 | Ga0105238_12120466 | Ga0105238_121204662 | 92 |
| 747 | 3300010375 | Ga0105239_12152431 | Ga0105239_121524311 | 92 |
| 748 | 3300013100 | Ga0157373_11256781 | Ga0157373_112567811 | 92 |
| 749 | 3300025297 | Ga0209758_1000060 | Ga0209758_1000060262 | 92 |
| 750 | 3300025298 | Ga0209050_1003616 | Ga0209050_100361610 | 92 |
| 751 | 3300025303 | Ga0209051_1068666 | Ga0209051_10686662 | 92 |
| 752 | 3300025304 | Ga0209257_1000589 | Ga0209257_100058948 | 92 |
| 753 | 3300025931 | Ga0207644_10028764 | Ga0207644_100287643 | 92 |
| 754 | 3300025941 | Ga0207711_10571149 | Ga0207711_105711492 | 92 |
| 755 | 3300025986 | Ga0207658_10939172 | Ga0207658_109391722 | 92 |
| 756 | 3300026116 | Ga0207674_10883178 | Ga0207674_108831782 | 92 |
| 757 | 3300026118 | Ga0207675_100685028 | Ga0207675_1006850282 | 92 |
| 758 | 3300026142 | Ga0207698_11230778 | Ga0207698_112307781 | 92 |
| 759 | 3300028380 | Ga0268265_10006082 | Ga0268265_100060826 | 92 |
| 760 | 3300028381 | Ga0268264_10851745 | Ga0268264_108517451 | 92 |
| 761 | 3300028786 | Ga0307517_10572697 | Ga0307517_105726971 | 92 |
| 762 | 3300030522 | Ga0307512_10087049 | Ga0307512_100870494 | 92 |
| 763 | 3300031616 | Ga0307508_10320450 | Ga0307508_103204502 | 92 |
| 764 | 3300031730 | Ga0307516_10078566 | Ga0307516_100785662 | 92 |
| 765 | 3300031730 | Ga0307516_10505428 | Ga0307516_105054281 | 92 |
| 766 | 3300041461 | Ga0451805_051563 | Ga0451805_051563_427_705 | 92 |
| 767 | 3300042438 | Ga0439459_0057414 | Ga0439459_0057414_572_850 | 92 |
| 768 | 3300046507 | Ga0495606_0589319 | Ga0495606_0589319_214_492 | 92 |
| 769 | 3300046616 | Ga0495668_0382538 | Ga0495668_0382538_384_662 | 92 |
| 770 | 3300046660 | Ga0495625_0252534 | Ga0495625_0252534_562_840 | 92 |
| 771 | 3300046694 | Ga0495649_0431163 | Ga0495649_0431163_196_474 | 92 |
| 772 | 3300049460 | Ga0495682_0337860 | Ga0495682_0337860_82_360 | 92 |
| 773 | 3300049569 | Ga0501032_0641078 | Ga0501032_0641078_368_646 | 92 |
| 774 | 3300049570 | Ga0501033_0148183 | Ga0501033_0148183_627_905 | 92 |
| 775 | 3300049571 | Ga0501034_0529974 | Ga0501034_0529974_44_322 | 92 |
| 776 | 3300049572 | Ga0501036_0622444 | Ga0501036_0622444_431_709 | 92 |
| 777 | 3300049573 | Ga0501037_0218500 | Ga0501037_0218500_252_530 | 92 |
| 778 | 3300049574 | Ga0501038_0314079 | Ga0501038_0314079_37_315 | 92 |
| 779 | 3300049575 | Ga0501039_0590998 | Ga0501039_0590998_330_608 | 92 |
| 780 | 3300049580 | Ga0501046_0195515 | Ga0501046_0195515_557_835 | 92 |
| 781 | 3300049581 | Ga0501047_0023291 | Ga0501047_0023291_930_1208 | 92 |
| 782 | 3300049583 | Ga0501067_0405423 | Ga0501067_0405423_365_643 | 92 |
| 783 | 3300049584 | Ga0501068_0026472 | Ga0501068_0026472_2149_2427 | 92 |
| 784 | 3300049584 | Ga0501068_0585048 | Ga0501068_0585048_420_698 | 92 |
| 785 | 3300049585 | Ga0501069_0057232 | Ga0501069_0057232_1479_1757 | 92 |
| 786 | 3300049586 | Ga0501070_0184654 | Ga0501070_0184654_939_1217 | 92 |
| 787 | 3300049587 | Ga0501071_0699848 | Ga0501071_0699848_188_466 | 92 |
| 788 | 3300049588 | Ga0501072_0368721 | Ga0501072_0368721_341_619 | 92 |
| 789 | 3300049589 | Ga0501073_0077405 | Ga0501073_0077405_874_1152 | 92 |
| 790 | 3300049590 | Ga0501074_0560633 | Ga0501074_0560633_46_324 | 92 |
| 791 | 3300049741 | Ga0501079_1174696 | Ga0501079_1174696_177_455 | 92 |
| 792 | 3300049742 | Ga0501080_0067793 | Ga0501080_0067793_202_480 | 92 |
| 793 | 3300049742 | Ga0501080_0095799 | Ga0501080_0095799_2328_2606 | 92 |
| 794 | 3300049744 | Ga0501083_0069065 | Ga0501083_0069065_2008_2286 | 92 |
| 795 | 3300049822 | Ga0501035_0538856 | Ga0501035_0538856_591_869 | 92 |
| 796 | 3300049823 | Ga0501044_0014858 | Ga0501044_0014858_851_1129 | 92 |
| 797 | 3300049823 | Ga0501044_0071661 | Ga0501044_0071661_979_1257 | 92 |
| 798 | 3300053086 | Ga0500578_0346513 | Ga0500578_0346513_449_727 | 92 |
| 799 | 3300053088 | Ga0500644_0026438 | Ga0500644_0026438_1195_1473 | 92 |
| 800 | 3300053090 | Ga0500646_0030665 | Ga0500646_0030665_668_946 | 92 |
| 801 | 3300053098 | Ga0500650_0026482 | Ga0500650_0026482_159_437 | 92 |
| 802 | 3300053108 | Ga0500562_137602 | Ga0500562_137602_344_622 | 92 |
| 803 | 3300053109 | Ga0500569_058510 | Ga0500569_058510_164_442 | 92 |
| 804 | 3300053116 | Ga0500592_006310 | Ga0500592_006310_1474_1752 | 92 |
| 805 | 3300053118 | Ga0500594_0028275 | Ga0500594_0028275_346_624 | 92 |
| 806 | 3300053130 | Ga0500642_0203549 | Ga0500642_0203549_33_311 | 92 |
| 807 | 3300053130 | Ga0500642_0226575 | Ga0500642_0226575_492_770 | 92 |
| 808 | 3300053131 | Ga0500652_109312 | Ga0500652_109312_716_994 | 92 |
| 809 | 3300053134 | Ga0500658_0508971 | Ga0500658_0508971_245_523 | 92 |
| 810 | 3300053137 | Ga0500561_0232084 | Ga0500561_0232084_271_549 | 92 |
| 811 | 3300053146 | Ga0500588_0039414 | Ga0500588_0039414_1035_1313 | 92 |
| 812 | 3300053146 | Ga0500588_0210417 | Ga0500588_0210417_271_549 | 92 |
| 813 | 3300053160 | Ga0500633_0254390 | Ga0500633_0254390_168_446 | 92 |
| 814 | 3300053727 | Ga0500611_227728 | Ga0500611_227728_20_298 | 92 |
| 815 | 3300053731 | Ga0500609_000322 | Ga0500609_000322_703_981 | 92 |
| 816 | 3300053732 | Ga0500656_050547 | Ga0500656_050547_307_585 | 92 |
| 817 | 3300054114 | Ga0501084_0596286 | Ga0501084_0596286_23_301 | 92 |
| 818 | 3300059506 | Ga0587085_053028 | Ga0587085_053028_368_652 | 92 |
| 819 | 3300059507 | Ga0587086_062123 | Ga0587086_062123_38_316 | 92 |
| 820 | 3300059658 | Ga0587119_039652 | Ga0587119_039652_355_639 | 92 |
| 821 | 3300060346 | Ga0587111_0232838 | Ga0587111_0232838_112_390 | 92 |
| 822 | 3300060353 | Ga0501082_0360254 | Ga0501082_0360254_399_677 | 92 |
| 823 | 3300060353 | Ga0501082_1311700 | Ga0501082_1311700_67_345 | 92 |
| 824 | 2010549000 | RicEn_FSXC49637_b1 | RicEn_443990 | 93 |
| 825 | 3300009093 | Ga0105240_11446537 | Ga0105240_114465372 | 93 |
| 826 | 3300013100 | Ga0157373_11075886 | Ga0157373_110758862 | 93 |
| 827 | 3300013105 | Ga0157369_10451149 | Ga0157369_104511491 | 93 |
| 828 | 3300020070 | Ga0206356_10144882 | Ga0206356_101448821 | 93 |
| 829 | 3300025913 | Ga0207695_11152662 | Ga0207695_111526621 | 93 |
| 830 | 3300025914 | Ga0207671_10123572 | Ga0207671_101235723 | 93 |
| 831 | 3300026041 | Ga0207639_11950938 | Ga0207639_119509381 | 93 |
| 832 | 3300026095 | Ga0207676_12203674 | Ga0207676_122036741 | 93 |
| 833 | 3300031456 | Ga0307513_10097010 | Ga0307513_100970103 | 93 |
| 834 | 3300031456 | Ga0307513_10169064 | Ga0307513_101690642 | 93 |
| 835 | 3300031456 | Ga0307513_10213773 | Ga0307513_102137731 | 93 |
| 836 | 3300031456 | Ga0307513_10871811 | Ga0307513_108718112 | 93 |
| 837 | 3300031507 | Ga0307509_10624940 | Ga0307509_106249401 | 93 |
| 838 | 3300031616 | Ga0307508_10476913 | Ga0307508_104769132 | 93 |
| 839 | 3300033180 | Ga0307510_10554259 | Ga0307510_105542592 | 93 |
| 840 | 3300041452 | Ga0451793_0596990 | Ga0451793_0596990_376_660 | 93 |
| 841 | 3300041503 | Ga0451847_0573443 | Ga0451847_0573443_90_371 | 93 |
| 842 | 3300041512 | Ga0451853_1978603 | Ga0451853_1978603_176_460 | 93 |
| 843 | 3300045051 | Ga0451576_1441934 | Ga0451576_1441934_219_500 | 93 |
| 844 | 3300046452 | Ga0495617_236732 | Ga0495617_236732_137_418 | 93 |
| 845 | 3300046460 | Ga0495638_0068933 | Ga0495638_0068933_1058_1339 | 93 |
| 846 | 3300046460 | Ga0495638_0281712 | Ga0495638_0281712_170_451 | 93 |
| 847 | 3300046513 | Ga0495616_0097836 | Ga0495616_0097836_706_987 | 93 |
| 848 | 3300046648 | Ga0495611_0218573 | Ga0495611_0218573_169_453 | 93 |
| 849 | 3300046660 | Ga0495625_0640658 | Ga0495625_0640658_314_595 | 93 |
| 850 | 3300049584 | Ga0501068_0015914 | Ga0501068_0015914_3770_4051 | 93 |
| 851 | 3300049589 | Ga0501073_0265944 | Ga0501073_0265944_129_410 | 93 |
| 852 | 3300049742 | Ga0501080_0212433 | Ga0501080_0212433_925_1206 | 93 |
| 853 | 3300049823 | Ga0501044_0590552 | Ga0501044_0590552_570_851 | 93 |
| 854 | 3300053086 | Ga0500578_0724073 | Ga0500578_0724073_70_357 | 93 |
| 855 | 3300053090 | Ga0500646_0084229 | Ga0500646_0084229_571_852 | 93 |
| 856 | 3300053096 | Ga0500641_0001835 | Ga0500641_0001835_4519_4812 | 93 |
| 857 | 3300053103 | Ga0500555_001003 | Ga0500555_001003_239_523 | 93 |
| 858 | 3300053104 | Ga0500556_0066361 | Ga0500556_0066361_359_655 | 93 |
| 859 | 3300053105 | Ga0500557_105121 | Ga0500557_105121_136_420 | 93 |
| 860 | 3300053119 | Ga0500595_000854 | Ga0500595_000854_10736_11020 | 93 |
| 861 | 3300053123 | Ga0500614_018705 | Ga0500614_018705_447_728 | 93 |
| 862 | 3300053126 | Ga0500621_235392 | Ga0500621_235392_20_301 | 93 |
| 863 | 3300053130 | Ga0500642_0134168 | Ga0500642_0134168_819_1100 | 93 |
| 864 | 3300053134 | Ga0500658_0010908 | Ga0500658_0010908_2863_3144 | 93 |
| 865 | 3300053139 | Ga0500568_0053865 | Ga0500568_0053865_803_1084 | 93 |
| 866 | 3300053142 | Ga0500577_0266024 | Ga0500577_0266024_232_528 | 93 |
| 867 | 3300053146 | Ga0500588_0012131 | Ga0500588_0012131_1145_1441 | 93 |
| 868 | 3300053153 | Ga0500616_0001666 | Ga0500616_0001666_17018_17299 | 93 |
| 869 | 3300053156 | Ga0500622_0272661 | Ga0500622_0272661_20_316 | 93 |
| 870 | 3300053158 | Ga0500627_0394321 | Ga0500627_0394321_237_530 | 93 |
| 871 | 3300053731 | Ga0500609_012306 | Ga0500609_012306_858_1139 | 93 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9601 | 20 | 85 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9462 | 20 | 85 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9362 | 19 | 84 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9255 | 19 | 84 |
| 8c95-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9109 | 19 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9601 | 20 | 85 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9462 | 20 | 85 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9114 | 29 | 83 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8953 | 29 | 83 | 2.40.50.100 |
| af_Q9VKJ4_10_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8844 | 31 | 81 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328ESH9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9713 | 20 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A660TPI7-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9576 | 19 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A328ESH9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.957 | 20 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A351YBM2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9531 | 21 | 87 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A351YBM2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9395 | 21 | 87 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar