F484190

General Info

Members Datasets Scaffolds Average Seq Length
871 447 862 88

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_101610594|Ga0307415_1016105942
Length 104
Sequence MAHKKGGGSTRNGRDSNAQRLGVKKFGGERVRAGNIIIRQRGTKFHPGANVGIGSDDTLFALVDGLVTFGRKDRDRKKVSVLPFSAFEAEAAELPTDVTEAAAD

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
3 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
4 2818991459 Paenibacillus sp. 597 Isolate Unclassified
5 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
6 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
7 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
8 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
9 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
10 3300003159 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
208 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
209 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
214 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
236 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
252 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
274 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
284 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
285 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
286 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
287 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
288 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
289 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
290 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
293 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
294 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
295 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
296 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
401 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
402 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
405 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
406 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
407 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
408 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
409 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
410 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
411 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
412 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
413 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
414 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
415 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
416 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
417 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
424 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
427 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
428 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
429 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
430 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
431 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
432 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
433 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
436 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
437 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
438 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
447 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 5.17
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.81
Nodule 0
Rhizoplane 1.72
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC49637_b1 2010549000 Bacteria 875
2 Ga0006771J45828_102739 3300003159 Bacteria 659
3 Ga0006765J45826_108928 3300003161 Bacteria 519
4 Ga0006759J45824_1021461 3300003163 Bacteria 642
5 JGI25153J46596_10001505 3300003215 Bacteria 13889
6 Ga0007417J51691_1040523 3300003544 Bacteria 638
7 Ga0032354_1014035 3300003693 Bacteria 775
8 Ga0032354_1100925 3300003693 Bacteria 521
9 Ga0055531_10021622 3300003794 Bacteria 2487
10 Ga0058860_12049493 3300004801 Bacteria 626
11 Ga0065704_10072444 3300005289 Bacteria 8516
12 Ga0065704_10311985 3300005289 Bacteria 867
13 Ga0070658_10014007 3300005327 Bacteria 6438
14 Ga0070658_10061090 3300005327 Bacteria 3069
15 Ga0070683_100001211 3300005329 Bacteria 19600
16 Ga0070683_100332912 3300005329 Bacteria 1445
17 Ga0070683_102336919 3300005329 Unclassified 513
18 Ga0070690_100324858 3300005330 Bacteria 1110
19 Ga0070670_100021890 3300005331 Bacteria 5500
20 Ga0068869_100001837 3300005334 Bacteria 12760
21 Ga0068869_100642032 3300005334 Bacteria 900
22 Ga0068869_100862558 3300005334 Bacteria 782
23 Ga0070666_10198828 3300005335 Bacteria 1410
24 Ga0070666_10431705 3300005335 Bacteria 950
25 Ga0070666_11460322 3300005335 Bacteria 511
26 Ga0068868_100004900 3300005338 Bacteria 9401
27 Ga0068868_100007490 3300005338 Bacteria 7776
28 Ga0070660_100415098 3300005339 Bacteria 1114
29 Ga0070661_100005387 3300005344 Bacteria 8819
30 Ga0070661_100107053 3300005344 Bacteria 2085
31 Ga0070668_100493276 3300005347 Bacteria 1059
32 Ga0070669_100008790 3300005353 Bacteria 7206
33 Ga0070669_100281085 3300005353 Bacteria 1334
34 Ga0070669_101690405 3300005353 Bacteria 552
35 Ga0070675_100993008 3300005354 Bacteria 771
36 Ga0070671_100040612 3300005355 Bacteria 3865
37 Ga0070671_100090147 3300005355 Bacteria 2567
38 Ga0070674_100054340 3300005356 Bacteria 2770
39 Ga0070674_100084170 3300005356 Bacteria 2280
40 Ga0070688_101527846 3300005365 Bacteria 544
41 Ga0070667_100005595 3300005367 Bacteria 10493
42 Ga0070667_101165405 3300005367 Bacteria 721
43 Ga0070714_100050959 3300005435 Bacteria 3529
44 Ga0070714_100378014 3300005435 Bacteria 1335
45 Ga0070713_101090290 3300005436 Bacteria 772
46 Ga0070710_10167496 3300005437 Bacteria 1367
47 Ga0070711_100112806 3300005439 Bacteria 1998
48 Ga0070711_101067854 3300005439 Bacteria 695
49 Ga0070705_100375867 3300005440 Bacteria 1044
50 Ga0070705_100864354 3300005440 Bacteria 725
51 Ga0070700_100506033 3300005441 Bacteria 930
52 Ga0070708_101007379 3300005445 Bacteria 781
53 Ga0070708_101097764 3300005445 Bacteria 745
54 Ga0070663_102015109 3300005455 Bacteria 520
55 Ga0070678_100606996 3300005456 Bacteria 977
56 Ga0070678_101661282 3300005456 Bacteria 600
57 Ga0070681_10251756 3300005458 Bacteria 1679
58 Ga0068867_100341612 3300005459 Bacteria 1247
59 Ga0070706_100197905 3300005467 Bacteria 1877
60 Ga0070706_101529863 3300005467 Bacteria 609
61 Ga0070707_100157444 3300005468 Bacteria 2213
62 Ga0070707_101185530 3300005468 Bacteria 730
63 Ga0070698_100626424 3300005471 Bacteria 1016
64 Ga0070679_101559392 3300005530 Bacteria 608
65 Ga0070684_100011471 3300005535 Bacteria 7058
66 Ga0070684_100228194 3300005535 Bacteria 1700
67 Ga0068853_100250593 3300005539 Bacteria 1625
68 Ga0068853_100313409 3300005539 Bacteria 1453
69 Ga0068853_101275828 3300005539 Bacteria 710
70 Ga0068853_102492998 3300005539 Bacteria 501
71 Ga0070672_101843893 3300005543 Bacteria 544
72 Ga0070686_100223163 3300005544 Bacteria 1363
73 Ga0070696_101822468 3300005546 Bacteria 526
74 Ga0070665_100154539 3300005548 Bacteria 2296
75 Ga0070665_100685797 3300005548 Bacteria 1037
76 Ga0070665_100865750 3300005548 Bacteria 917
77 Ga0070704_100122034 3300005549 Bacteria 2004
78 Ga0068855_100000872 3300005563 Bacteria 37469
79 Ga0068855_100018642 3300005563 Bacteria 8346
80 Ga0068855_101113995 3300005563 Bacteria 825
81 Ga0070664_100102401 3300005564 Bacteria 2491
82 Ga0070664_101683220 3300005564 Bacteria 601
83 Ga0070664_101951841 3300005564 Bacteria 557
84 Ga0068857_100014330 3300005577 Bacteria 6909
85 Ga0068857_100615082 3300005577 Bacteria 1028
86 Ga0068857_100785092 3300005577 Bacteria 909
87 Ga0068854_100410490 3300005578 Bacteria 1122
88 Ga0068854_100766745 3300005578 Bacteria 838
89 Ga0068856_100008202 3300005614 Bacteria 10186
90 Ga0068856_100438372 3300005614 Bacteria 1327
91 Ga0068856_101098719 3300005614 Bacteria 813
92 Ga0068856_101167549 3300005614 Bacteria 786
93 Ga0068852_100000015 3300005616 Bacteria 134085
94 Ga0068852_100029234 3300005616 Bacteria 4524
95 Ga0068852_101516901 3300005616 Unclassified 692
96 Ga0068859_100008964 3300005617 Bacteria 10104
97 Ga0068859_100825558 3300005617 Bacteria 1014
98 Ga0068864_100006989 3300005618 Bacteria 9259
99 Ga0068864_102184838 3300005618 Bacteria 560
100 Ga0068861_100694630 3300005719 Bacteria 945
101 Ga0068851_10005020 3300005834 Bacteria 5998
102 Ga0068851_10006556 3300005834 Bacteria 5320
103 Ga0068851_10975631 3300005834 Bacteria 534
104 Ga0068870_11138186 3300005840 Bacteria 563
105 Ga0068863_100003161 3300005841 Bacteria 16271
106 Ga0068858_100001902 3300005842 Bacteria 21302
107 Ga0068860_100000809 3300005843 Bacteria 35018
108 Ga0068860_102281767 3300005843 Bacteria 562
109 Ga0068862_100009301 3300005844 Bacteria 8135
110 Ga0068862_100011360 3300005844 Bacteria 7353
111 Ga0068862_100302218 3300005844 Bacteria 1472
112 Ga0081455_10004869 3300005937 Bacteria 14891
113 Ga0081455_10046010 3300005937 Unclassified 3791
114 Ga0081455_10201084 3300005937 Bacteria 1492
115 Ga0081455_10982842 3300005937 Bacteria 523
116 Ga0081540_1212760 3300005983 Bacteria 694
117 Ga0081539_10065440 3300005985 Bacteria 1974
118 Ga0070717_10909874 3300006028 Bacteria 801
119 Ga0075364_10009158 3300006051 Bacteria 5931
120 Ga0070715_10226637 3300006163 Bacteria 964
121 Ga0070712_100340940 3300006175 Bacteria 1224
122 Ga0075362_10096835 3300006177 Bacteria 1376
123 Ga0075362_10295735 3300006177 Bacteria 803
124 Ga0075362_10445905 3300006177 Bacteria 657
125 Ga0075367_10537675 3300006178 Bacteria 742
126 Ga0075366_10001813 3300006195 Bacteria 10789
127 Ga0075366_10240061 3300006195 Bacteria 1105
128 Ga0075366_10460424 3300006195 Bacteria 785
129 Ga0097621_100009947 3300006237 Bacteria 6931
130 Ga0075370_10368488 3300006353 Bacteria 860
131 Ga0068871_100139822 3300006358 Bacteria 2058
132 Ga0068871_101617491 3300006358 Bacteria 613
133 Ga0068871_101755968 3300006358 Bacteria 589
134 Ga0075428_100880074 3300006844 Unclassified 950
135 Ga0075428_101135696 3300006844 Bacteria 825
136 Ga0075428_102175600 3300006844 Bacteria 572
137 Ga0075431_100061803 3300006847 Bacteria 3865
138 Ga0075431_100487712 3300006847 Bacteria 1224
139 Ga0075431_100639006 3300006847 Bacteria 1045
140 Ga0075431_100647412 3300006847 Bacteria 1037
141 Ga0075431_100884428 3300006847 Bacteria 863
142 Ga0075431_101335087 3300006847 Bacteria 677
143 Ga0075433_10164977 3300006852 Bacteria 1971
144 Ga0075433_10394147 3300006852 Bacteria 1222
145 Ga0075433_10983799 3300006852 Bacteria 735
146 Ga0075434_100907915 3300006871 Bacteria 896
147 Ga0075429_100596824 3300006880 Bacteria 967
148 Ga0068865_100470783 3300006881 Bacteria 1042
149 Ga0097620_100008964 3300006931 Bacteria 10104
150 Ga0097620_100825400 3300006931 Bacteria 1014
151 Ga0075435_100321182 3300007076 Bacteria 1325
152 Ga0105251_10440078 3300009011 Bacteria 603
153 Ga0105240_10000181 3300009093 Bacteria 128067
154 Ga0105240_10003931 3300009093 Bacteria 22956
155 Ga0105240_10599373 3300009093 Bacteria 1213
156 Ga0105240_10916213 3300009093 Bacteria 942
157 Ga0105240_11446537 3300009093 Bacteria 722
158 Ga0105240_11620700 3300009093 Bacteria 677
159 Ga0105240_11717552 3300009093 Unclassified 655
160 Ga0111539_10053174 3300009094 Bacteria 4820
161 Ga0111539_10643372 3300009094 Bacteria 1235
162 Ga0111539_10943369 3300009094 Bacteria 1003
163 Ga0111539_12990888 3300009094 Bacteria 546
164 Ga0105245_10010929 3300009098 Bacteria 7898
165 Ga0105245_10012850 3300009098 Bacteria 7295
166 Ga0105247_10024995 3300009101 Bacteria 3602
167 Ga0105247_10112463 3300009101 Bacteria 1754
168 Ga0114129_10687122 3300009147 Bacteria 1317
169 Ga0114129_11574453 3300009147 Bacteria 805
170 Ga0114129_13037071 3300009147 Unclassified 551
171 Ga0114129_13071937 3300009147 Unclassified 547
172 Ga0105243_11732571 3300009148 Bacteria 654
173 Ga0105241_10000076 3300009174 Bacteria 74496
174 Ga0105241_10004665 3300009174 Bacteria 10129
175 Ga0105241_10484211 3300009174 Bacteria 1100
176 Ga0105241_11473968 3300009174 Bacteria 654
177 Ga0105241_11735213 3300009174 Bacteria 607
178 Ga0105242_10011064 3300009176 Bacteria 6932
179 Ga0105248_10093271 3300009177 Bacteria 3390
180 Ga0105248_11033458 3300009177 Bacteria 928
181 Ga0105248_11103110 3300009177 Bacteria 897
182 Ga0105248_11584326 3300009177 Bacteria 742
183 Ga0105237_10007181 3300009545 Bacteria 12235
184 Ga0105237_10101571 3300009545 Bacteria 2868
185 Ga0105237_10583491 3300009545 Bacteria 1125
186 Ga0105237_11177676 3300009545 Bacteria 773
187 Ga0105238_10008228 3300009551 Bacteria 10432
188 Ga0105238_10009668 3300009551 Bacteria 9651
189 Ga0105238_10021454 3300009551 Bacteria 6578
190 Ga0105238_10859662 3300009551 Bacteria 924
191 Ga0105238_12120466 3300009551 Bacteria 596
192 Ga0105249_10238483 3300009553 Bacteria 1797
193 Ga0105239_10098590 3300010375 Bacteria 3230
194 Ga0105239_10099080 3300010375 Bacteria 3222
195 Ga0105239_10204266 3300010375 Bacteria 2214
196 Ga0105239_11452286 3300010375 Unclassified 792
197 Ga0105239_12152431 3300010375 Bacteria 648
198 Ga0105246_10003503 3300011119 Bacteria 9500
199 Ga0157373_10066560 3300013100 Bacteria 2548
200 Ga0157373_10715598 3300013100 Bacteria 734
201 Ga0157373_11075886 3300013100 Bacteria 602
202 Ga0157373_11256781 3300013100 Bacteria 559
203 Ga0157371_10046851 3300013102 Bacteria 3073
204 Ga0157370_10000196 3300013104 Bacteria 75917
205 Ga0157369_10000241 3300013105 Bacteria 75794
206 Ga0157369_10015458 3300013105 Bacteria 8600
207 Ga0157369_10063405 3300013105 Unclassified 3982
208 Ga0157369_10143969 3300013105 Bacteria 2520
209 Ga0157369_10451149 3300013105 Bacteria 1332
210 Ga0157369_10681824 3300013105 Unclassified 1059
211 Ga0157374_10011932 3300013296 Bacteria 7542
212 Ga0157374_10055775 3300013296 Unclassified 3688
213 Ga0157374_10093790 3300013296 Bacteria 2867
214 Ga0157374_10094415 3300013296 Bacteria 2858
215 Ga0157374_10471857 3300013296 Bacteria 1257
216 Ga0157374_11653258 3300013296 Bacteria 665
217 Ga0157378_10025125 3300013297 Bacteria 5248
218 Ga0157378_10250805 3300013297 Bacteria 1694
219 Ga0163162_10179923 3300013306 Bacteria 2240
220 Ga0163162_10838192 3300013306 Bacteria 1035
221 Ga0163162_12795497 3300013306 Bacteria 562
222 Ga0157372_10000197 3300013307 Bacteria 66368
223 Ga0157372_10005898 3300013307 Bacteria 13040
224 Ga0157372_10101037 3300013307 Bacteria 3292
225 Ga0157372_10257589 3300013307 Bacteria 2026
226 Ga0157372_10670785 3300013307 Bacteria 1207
227 Ga0157372_11388256 3300013307 Bacteria 810
228 Ga0157375_10005518 3300013308 Bacteria 11007
229 Ga0157375_10032187 3300013308 Bacteria 4971
230 Ga0157375_11737436 3300013308 Bacteria 739
231 Ga0157375_11964651 3300013308 Bacteria 695
232 Ga0157375_12277894 3300013308 Bacteria 646
233 Ga0157375_12892096 3300013308 Bacteria 574
234 Ga0163163_10001103 3300014325 Bacteria 22908
235 Ga0157380_10103788 3300014326 Bacteria 2373
236 Ga0157379_10000092 3300014968 Bacteria 60487
237 Ga0157379_10072593 3300014968 Bacteria 3079
238 Ga0157379_10295212 3300014968 Bacteria 1476
239 Ga0157376_10001138 3300014969 Bacteria 17451
240 Ga0157376_10010621 3300014969 Bacteria 6743
241 Ga0157376_11777445 3300014969 Bacteria 652
242 Ga0157376_12903748 3300014969 Bacteria 519
243 Ga0163161_10877528 3300017792 Bacteria 759
244 Ga0197907_10371255 3300020069 Bacteria 1514
245 Ga0206356_10144882 3300020070 Bacteria 631
246 Ga0206349_1174937 3300020075 Bacteria 1116
247 Ga0206355_1316834 3300020076 Bacteria 1812
248 Ga0206351_10796194 3300020077 Unclassified 916
249 Ga0206352_11254640 3300020078 Bacteria 1961
250 Ga0206350_11185957 3300020080 Bacteria 1413
251 Ga0206354_10521497 3300020081 Bacteria 810
252 Ga0206354_11484000 3300020081 Unclassified 988
253 Ga0154015_1280778 3300020610 Bacteria 632
254 Ga0213874_10109898 3300021377 Bacteria 926
255 Ga0213874_10384451 3300021377 Bacteria 543
256 Ga0213876_10394154 3300021384 Bacteria 736
257 Ga0213875_10053554 3300021388 Bacteria 1890
258 Ga0224712_10099893 3300022467 Bacteria 1229
259 Ga0209758_1000060 3300025297 Bacteria 324326
260 Ga0209050_1003616 3300025298 Bacteria 11210
261 Ga0209051_1068666 3300025303 Bacteria 1078
262 Ga0209257_1000589 3300025304 Bacteria 60641
263 Ga0207656_10019549 3300025321 Bacteria 2680
264 Ga0207656_10582918 3300025321 Bacteria 571
265 Ga0207653_10261502 3300025885 Bacteria 665
266 Ga0207642_10313005 3300025899 Bacteria 914
267 Ga0207710_10002483 3300025900 Bacteria 8535
268 Ga0207688_10356825 3300025901 Bacteria 901
269 Ga0207680_10498227 3300025903 Bacteria 867
270 Ga0207680_10690005 3300025903 Bacteria 732
271 Ga0207647_10130798 3300025904 Bacteria 1475
272 Ga0207685_10205860 3300025905 Bacteria 927
273 Ga0207643_10977793 3300025908 Bacteria 548
274 Ga0207705_10066203 3300025909 Bacteria 2613
275 Ga0207705_10132720 3300025909 Bacteria 1854
276 Ga0207705_11102940 3300025909 Bacteria 611
277 Ga0207684_10347471 3300025910 Bacteria 1277
278 Ga0207684_10885696 3300025910 Bacteria 751
279 Ga0207654_10000025 3300025911 Bacteria 143807
280 Ga0207654_10000035 3300025911 Bacteria 112494
281 Ga0207654_10000682 3300025911 Bacteria 19017
282 Ga0207654_10636562 3300025911 Bacteria 763
283 Ga0207654_10733351 3300025911 Bacteria 711
284 Ga0207654_11234484 3300025911 Unclassified 545
285 Ga0207707_10303295 3300025912 Bacteria 1381
286 Ga0207707_10785072 3300025912 Bacteria 794
287 Ga0207695_10000069 3300025913 Bacteria 319955
288 Ga0207695_10000314 3300025913 Bacteria 116506
289 Ga0207695_10174637 3300025913 Bacteria 2072
290 Ga0207695_11152662 3300025913 Bacteria 655
291 Ga0207695_11682570 3300025913 Bacteria 515
292 Ga0207671_10002931 3300025914 Bacteria 17583
293 Ga0207671_10123572 3300025914 Bacteria 1980
294 Ga0207671_10435488 3300025914 Bacteria 1044
295 Ga0207671_10862354 3300025914 Bacteria 717
296 Ga0207693_10638839 3300025915 Bacteria 827
297 Ga0207693_11357758 3300025915 Bacteria 529
298 Ga0207663_10533746 3300025916 Bacteria 915
299 Ga0207663_11003777 3300025916 Bacteria 669
300 Ga0207649_10323819 3300025920 Bacteria 1133
301 Ga0207649_10821401 3300025920 Bacteria 726
302 Ga0207649_10891506 3300025920 Bacteria 697
303 Ga0207646_10108845 3300025922 Bacteria 2487
304 Ga0207646_11304519 3300025922 Bacteria 634
305 Ga0207681_10081987 3300025923 Bacteria 2279
306 Ga0207681_10262972 3300025923 Bacteria 1351
307 Ga0207694_10001968 3300025924 Bacteria 16996
308 Ga0207694_10202911 3300025924 Bacteria 1614
309 Ga0207694_10250443 3300025924 Bacteria 1449
310 Ga0207694_10776372 3300025924 Bacteria 809
311 Ga0207650_10011074 3300025925 Bacteria 6201
312 Ga0207687_10007042 3300025927 Bacteria 7412
313 Ga0207687_10168503 3300025927 Bacteria 1687
314 Ga0207664_10287335 3300025929 Bacteria 1444
315 Ga0207664_10655602 3300025929 Bacteria 943
316 Ga0207664_11492578 3300025929 Bacteria 597
317 Ga0207644_10009369 3300025931 Bacteria 6431
318 Ga0207644_10028764 3300025931 Bacteria 3851
319 Ga0207644_10637441 3300025931 Bacteria 886
320 Ga0207686_10005026 3300025934 Bacteria 7119
321 Ga0207709_10699424 3300025935 Bacteria 811
322 Ga0207669_10092981 3300025937 Bacteria 1969
323 Ga0207669_10140090 3300025937 Bacteria 1677
324 Ga0207704_10242211 3300025938 Bacteria 1348
325 Ga0207704_10355622 3300025938 Bacteria 1142
326 Ga0207665_10635632 3300025939 Bacteria 836
327 Ga0207711_10103727 3300025941 Bacteria 2518
328 Ga0207711_10571149 3300025941 Bacteria 1055
329 Ga0207689_10003813 3300025942 Bacteria 13740
330 Ga0207661_10030494 3300025944 Bacteria 4154
331 Ga0207661_11638208 3300025944 Bacteria 588
332 Ga0207679_10292687 3300025945 Bacteria 1400
333 Ga0207679_10304259 3300025945 Bacteria 1375
334 Ga0207679_11038793 3300025945 Bacteria 751
335 Ga0207667_10011113 3300025949 Bacteria 10482
336 Ga0207667_10238278 3300025949 Bacteria 1862
337 Ga0207667_11441625 3300025949 Bacteria 661
338 Ga0207667_12146998 3300025949 Bacteria 516
339 Ga0207712_10145284 3300025961 Bacteria 1825
340 Ga0207712_11411319 3300025961 Bacteria 623
341 Ga0207668_11876898 3300025972 Bacteria 540
342 Ga0207640_10311147 3300025981 Bacteria 1250
343 Ga0207640_10737603 3300025981 Unclassified 848
344 Ga0207658_10004440 3300025986 Bacteria 9756
345 Ga0207658_10758538 3300025986 Bacteria 879
346 Ga0207658_10939172 3300025986 Bacteria 788
347 Ga0207677_10000104 3300026023 Bacteria 70036
348 Ga0207677_10167947 3300026023 Bacteria 1712
349 Ga0207703_10001493 3300026035 Bacteria 21338
350 Ga0207639_10001965 3300026041 Bacteria 13822
351 Ga0207639_10002214 3300026041 Bacteria 13095
352 Ga0207639_10459529 3300026041 Bacteria 1157
353 Ga0207639_10933026 3300026041 Bacteria 812
354 Ga0207639_11950938 3300026041 Bacteria 548
355 Ga0207678_10176897 3300026067 Bacteria 1822
356 Ga0207678_10927039 3300026067 Bacteria 770
357 Ga0207708_10586807 3300026075 Bacteria 943
358 Ga0207702_10023448 3300026078 Bacteria 5118
359 Ga0207702_10517983 3300026078 Bacteria 1164
360 Ga0207702_10559119 3300026078 Bacteria 1120
361 Ga0207641_10000809 3300026088 Bacteria 33415
362 Ga0207648_10221843 3300026089 Bacteria 1680
363 Ga0207648_10591210 3300026089 Bacteria 1022
364 Ga0207676_10000862 3300026095 Bacteria 23512
365 Ga0207676_12203674 3300026095 Bacteria 549
366 Ga0207674_10003615 3300026116 Bacteria 18846
367 Ga0207674_10150239 3300026116 Bacteria 2287
368 Ga0207674_10883178 3300026116 Bacteria 862
369 Ga0207675_100022885 3300026118 Bacteria 5813
370 Ga0207675_100685028 3300026118 Bacteria 1033
371 Ga0207683_10616014 3300026121 Bacteria 1005
372 Ga0207683_11325060 3300026121 Bacteria 666
373 Ga0207698_10000006 3300026142 Bacteria 291847
374 Ga0207698_10042739 3300026142 Bacteria 3389
375 Ga0207698_10228774 3300026142 Bacteria 1686
376 Ga0207698_11230778 3300026142 Bacteria 763
377 Ga0207698_11387992 3300026142 Bacteria 717
378 Ga0209969_1032591 3300027360 Bacteria 798
379 Ga0209995_1011891 3300027471 Bacteria 1417
380 Ga0209968_1098309 3300027526 Bacteria 533
381 Ga0210002_1009035 3300027617 Bacteria 1521
382 Ga0209983_1135632 3300027665 Bacteria 563
383 Ga0209971_1011208 3300027682 Bacteria 2123
384 Ga0209974_10094884 3300027876 Bacteria 1037
385 Ga0209974_10274054 3300027876 Bacteria 640
386 Ga0207428_10056948 3300027907 Unclassified 3105
387 Ga0207428_10425227 3300027907 Bacteria 970
388 Ga0268266_10012086 3300028379 Bacteria 7471
389 Ga0268265_10006082 3300028380 Bacteria 8197
390 Ga0268265_10041752 3300028380 Bacteria 3398
391 Ga0268265_11597889 3300028380 Bacteria 657
392 Ga0268264_10001031 3300028381 Bacteria 28009
393 Ga0268264_10851745 3300028381 Bacteria 913
394 Ga0265337_1000286 3300028556 Bacteria 27344
395 Ga0265326_10000350 3300028558 Bacteria 19576
396 Ga0265326_10039899 3300028558 Bacteria 1333
397 Ga0265326_10041653 3300028558 Bacteria 1304
398 Ga0265326_10239133 3300028558 Bacteria 524
399 Ga0265319_1000346 3300028563 Bacteria 33963
400 Ga0265319_1007043 3300028563 Bacteria 5112
401 Ga0265334_10001979 3300028573 Bacteria 9740
402 Ga0265318_10000921 3300028577 Bacteria 19069
403 Ga0265318_10041897 3300028577 Bacteria 1738
404 Ga0265318_10220345 3300028577 Unclassified 693
405 Ga0265323_10000609 3300028653 Bacteria 19714
406 Ga0265323_10151069 3300028653 Bacteria 744
407 Ga0265322_10000064 3300028654 Bacteria 52341
408 Ga0265322_10001372 3300028654 Bacteria 8041
409 Ga0265322_10001389 3300028654 Bacteria 7985
410 Ga0265322_10036758 3300028654 Bacteria 1395
411 Ga0265336_10000088 3300028666 Bacteria 70739
412 Ga0307517_10572697 3300028786 Bacteria 560
413 Ga0307515_10005786 3300028794 Bacteria 24955
414 Ga0307515_10045397 3300028794 Bacteria 6752
415 Ga0265338_10000783 3300028800 Bacteria 53845
416 Ga0265338_10002272 3300028800 Bacteria 29267
417 Ga0265338_10003453 3300028800 Bacteria 22250
418 Ga0265338_10003505 3300028800 Bacteria 22005
419 Ga0265338_10007366 3300028800 Bacteria 13691
420 Ga0265338_10011065 3300028800 Bacteria 10463
421 Ga0265338_10042888 3300028800 Bacteria 4205
422 Ga0265338_10100984 3300028800 Bacteria 2350
423 Ga0265338_10366481 3300028800 Bacteria 1032
424 Ga0265338_10701813 3300028800 Bacteria 698
425 Ga0265338_10878674 3300028800 Bacteria 611
426 Ga0265324_10003377 3300029957 Bacteria 7628
427 Ga0265324_10005065 3300029957 Bacteria 5770
428 Ga0265324_10015573 3300029957 Bacteria 2793
429 Ga0265324_10200638 3300029957 Bacteria 677
430 Ga0307512_10087049 3300030522 Bacteria 2203
431 Ga0265330_10001755 3300031235 Bacteria 12177
432 Ga0265330_10157856 3300031235 Unclassified 963
433 Ga0265332_10000028 3300031238 Bacteria 184029
434 Ga0265332_10000125 3300031238 Bacteria 63932
435 Ga0265332_10008075 3300031238 Bacteria 4733
436 Ga0265332_10151220 3300031238 Bacteria 971
437 Ga0265328_10001890 3300031239 Bacteria 9513
438 Ga0265320_10000957 3300031240 Bacteria 21510
439 Ga0265320_10004168 3300031240 Bacteria 9500
440 Ga0265320_10263729 3300031240 Bacteria 763
441 Ga0265325_10006585 3300031241 Bacteria 7036
442 Ga0265325_10034346 3300031241 Bacteria 2699
443 Ga0265325_10115242 3300031241 Bacteria 1301
444 Ga0265329_10001200 3300031242 Bacteria 12718
445 Ga0265329_10349787 3300031242 Bacteria 506
446 Ga0265340_10000443 3300031247 Bacteria 22336
447 Ga0265340_10029762 3300031247 Bacteria 2742
448 Ga0265339_10003757 3300031249 Bacteria 10588
449 Ga0265339_10070329 3300031249 Bacteria 1867
450 Ga0265339_10084308 3300031249 Bacteria 1675
451 Ga0265339_10450883 3300031249 Bacteria 597
452 Ga0265331_10005438 3300031250 Bacteria 7687
453 Ga0265331_10217005 3300031250 Unclassified 860
454 Ga0265327_10510055 3300031251 Bacteria 518
455 Ga0265316_10006910 3300031344 Bacteria 10766
456 Ga0265316_10050281 3300031344 Bacteria 3279
457 Ga0265316_10136783 3300031344 Bacteria 1843
458 Ga0265316_10208442 3300031344 Bacteria 1446
459 Ga0265316_10287124 3300031344 Bacteria 1201
460 Ga0265316_10294658 3300031344 Bacteria 1183
461 Ga0265316_10468551 3300031344 Bacteria 902
462 Ga0307513_10026448 3300031456 Bacteria 6689
463 Ga0307513_10097010 3300031456 Bacteria 2984
464 Ga0307513_10169064 3300031456 Bacteria 2066
465 Ga0307513_10213773 3300031456 Bacteria 1757
466 Ga0307513_10248331 3300031456 Bacteria 1578
467 Ga0307513_10871811 3300031456 Bacteria 607
468 Ga0307509_10624940 3300031507 Bacteria 748
469 Ga0307408_100291031 3300031548 Bacteria 1364
470 Ga0307408_100444376 3300031548 Bacteria 1123
471 Ga0307408_100799984 3300031548 Bacteria 856
472 Ga0307408_101523386 3300031548 Bacteria 633
473 Ga0265313_10002254 3300031595 Bacteria 16946
474 Ga0265313_10081198 3300031595 Bacteria 1472
475 Ga0307508_10320450 3300031616 Bacteria 1142
476 Ga0307508_10476913 3300031616 Bacteria 841
477 Ga0307514_10000920 3300031649 Bacteria 44996
478 Ga0316575_10089796 3300031665 Bacteria 1244
479 Ga0316575_10146813 3300031665 Bacteria 972
480 Ga0316575_10332986 3300031665 Bacteria 645
481 Ga0265314_10000054 3300031711 Bacteria 184029
482 Ga0265314_10023669 3300031711 Bacteria 4676
483 Ga0265314_10047836 3300031711 Bacteria 3007
484 Ga0265314_10104963 3300031711 Unclassified 1808
485 Ga0265314_10416167 3300031711 Bacteria 723
486 Ga0265314_10628997 3300031711 Bacteria 550
487 Ga0265342_10005611 3300031712 Bacteria 9512
488 Ga0265342_10017036 3300031712 Bacteria 4732
489 Ga0265342_10470604 3300031712 Bacteria 643
490 Ga0265342_10712404 3300031712 Bacteria 501
491 Ga0316576_10366875 3300031727 Bacteria 1070
492 Ga0316576_10877605 3300031727 Bacteria 643
493 Ga0316578_10289981 3300031728 Bacteria 979
494 Ga0316578_10420100 3300031728 Bacteria 792
495 Ga0307516_10078566 3300031730 Bacteria 3146
496 Ga0307516_10309237 3300031730 Bacteria 1254
497 Ga0307516_10505428 3300031730 Bacteria 863
498 Ga0307405_10319132 3300031731 Bacteria 1186
499 Ga0307405_10681859 3300031731 Bacteria 849
500 Ga0307405_11680257 3300031731 Bacteria 562
501 Ga0307405_11841687 3300031731 Bacteria 539
502 Ga0316577_10437463 3300031733 Bacteria 743
503 Ga0307413_10034193 3300031824 Bacteria 2902
504 Ga0307413_10722126 3300031824 Bacteria 830
505 Ga0307410_10017964 3300031852 Bacteria 4261
506 Ga0307410_10163591 3300031852 Bacteria 1670
507 Ga0307410_11380741 3300031852 Bacteria 618
508 Ga0307406_10036832 3300031901 Bacteria 3017
509 Ga0307407_10066639 3300031903 Bacteria 2124
510 Ga0307407_10335844 3300031903 Bacteria 1065
511 Ga0307412_10337484 3300031911 Bacteria 1205
512 Ga0307412_10673558 3300031911 Bacteria 885
513 Ga0307412_11889713 3300031911 Bacteria 551
514 Ga0307409_100437126 3300031995 Bacteria 1259
515 Ga0307409_100593712 3300031995 Bacteria 1093
516 Ga0307409_102395469 3300031995 Bacteria 557
517 Ga0307416_100067170 3300032002 Bacteria 2956
518 Ga0307416_100925299 3300032002 Bacteria 973
519 Ga0307416_101703994 3300032002 Bacteria 735
520 Ga0307414_10090894 3300032004 Bacteria 2267
521 Ga0307411_10040085 3300032005 Bacteria 2968
522 Ga0307411_11024632 3300032005 Bacteria 740
523 Ga0307415_100123909 3300032126 Bacteria 1944
524 Ga0307415_100128491 3300032126 Bacteria 1914
525 Ga0307415_101610594 3300032126 Bacteria 624
526 Ga0316583_10004920 3300032133 Bacteria 4774
527 Ga0316583_10029998 3300032133 Bacteria 1937
528 Ga0316583_10124071 3300032133 Bacteria 900
529 Ga0316585_10161193 3300032137 Bacteria 741
530 Ga0316585_10293375 3300032137 Bacteria 540
531 Ga0316593_10199397 3300032168 Bacteria 739
532 Ga0316593_10212686 3300032168 Bacteria 717
533 Ga0307510_10554259 3300033180 Bacteria 596
534 Ga0307510_10659202 3300033180 Bacteria 506
535 Ga0316592_1059674 3300033524 Bacteria 856
536 Ga0316586_1040824 3300033527 Bacteria 815
537 Ga0316586_1082457 3300033527 Bacteria 601
538 Ga0316586_1084297 3300033527 Bacteria 596
539 Ga0316587_1081526 3300033529 Bacteria 612
540 Ga0316587_1090703 3300033529 Bacteria 583
541 Ga0316596_1042366 3300033541 Bacteria 1198
542 Ga0316596_1055954 3300033541 Unclassified 1048
543 Ga0316596_1232317 3300033541 Bacteria 518
544 Ga0373950_0109911 3300034818 Bacteria 601
545 Ga0373926_0413961 3300035083 Bacteria 533
546 Ga0373923_0692527 3300035111 Bacteria 506
547 Ga0373932_0386017 3300035112 Bacteria 539
548 Ga0373939_0118936 3300035114 Unclassified 930
549 Ga0373943_0107900 3300035170 Bacteria 1465
550 Ga0373946_0414562 3300035171 Bacteria 682
551 Ga0373955_0455528 3300035172 Bacteria 780
552 Ga0316574_0017340 3300035398 Bacteria 4214
553 Ga0316574_0746664 3300035398 Unclassified 598
554 Ga0373931_0409292 3300035691 Bacteria 860
555 Ga0373935_0755546 3300035692 Bacteria 717
556 Ga0373935_0838132 3300035692 Bacteria 680
557 Ga0373927_0182230 3300035695 Bacteria 1378
558 Ga0373927_0818875 3300035695 Bacteria 615
559 Ga0373933_0297274 3300035724 Bacteria 1045
560 Ga0373947_0561376 3300035725 Bacteria 777
561 Ga0373947_0614593 3300035725 Bacteria 741
562 Ga0373937_0090909 3300036401 Bacteria 2828
563 Ga0373937_0905455 3300036401 Bacteria 831
564 Ga0373937_1042337 3300036401 Bacteria 767
565 Ga0373937_1158296 3300036401 Bacteria 722
566 Ga0316582_0166264 3300036647 Bacteria 1496
567 Ga0316582_0445132 3300036647 Bacteria 893
568 Ga0316584_0072229 3300036712 Bacteria 2586
569 Ga0316584_0228010 3300036712 Bacteria 1366
570 Ga0316584_0893251 3300036712 Bacteria 599
571 Ga0373925_0327193 3300037068 Bacteria 1241
572 Ga0395900_0201928 3300037418 Bacteria 2011
573 Ga0395905_0001245 3300037471 Bacteria 31535
574 Ga0436364_0661109 3300037853 Bacteria 1656
575 Ga0436364_0755656 3300037853 Bacteria 52627
576 Ga0436365_0142396 3300039437 Bacteria 1373
577 Ga0436365_0257100 3300039437 Bacteria 890
578 Ga0436365_0429969 3300039437 Bacteria 624
579 Ga0436365_0760636 3300039437 Bacteria 785
580 Ga0436365_1153303 3300039437 Bacteria 2247
581 Ga0436365_1303455 3300039437 Bacteria 1203
582 Ga0436361_0470064 3300039447 Bacteria 1328
583 Ga0436363_0344193 3300039450 Bacteria 1115
584 Ga0436363_0995645 3300039450 Bacteria 755
585 Ga0436363_1402859 3300039450 Unclassified 730
586 Ga0436362_1204042 3300039453 Bacteria 1257
587 Ga0439453_0189804 3300041408 Bacteria 505
588 Ga0451793_0596990 3300041452 Bacteria 955
589 Ga0451795_0149206 3300041456 Bacteria 513
590 Ga0451805_019949 3300041461 Unclassified 817
591 Ga0451805_051563 3300041461 Bacteria 742
592 Ga0451837_0156795 3300041494 Bacteria 1068
593 Ga0451839_1632871 3300041496 Bacteria 535
594 Ga0451847_0573443 3300041503 Bacteria 652
595 Ga0451849_0242008 3300041505 Bacteria 664
596 Ga0451853_1096528 3300041512 Bacteria 685
597 Ga0451853_1978603 3300041512 Bacteria 1314
598 Ga0439441_042766 3300042001 Bacteria 913
599 Ga0439445_0249593 3300042004 Bacteria 530
600 Ga0439434_0304473 3300042435 Bacteria 551
601 Ga0439435_0029672 3300042436 Bacteria 1478
602 Ga0439459_0057414 3300042438 Bacteria 871
603 Ga0451577_0003993 3300042876 Bacteria 15885
604 Ga0451577_0004474 3300042876 Bacteria 14756
605 Ga0451577_0012787 3300042876 Bacteria 7876
606 Ga0451577_0031677 3300042876 Bacteria 4770
607 Ga0451577_0270634 3300042876 Bacteria 1539
608 Ga0451577_0380747 3300042876 Bacteria 1280
609 Ga0466966_0872174 3300044684 Bacteria 543
610 Ga0466961_0001485 3300044693 Bacteria 14575
611 Ga0466961_0057455 3300044693 Bacteria 2477
612 Ga0466963_0072801 3300044694 Bacteria 2315
613 Ga0453684_0004729 3300044712 Bacteria 28145
614 Ga0453684_0007706 3300044712 Bacteria 19671
615 Ga0453684_0029590 3300044712 Bacteria 7769
616 Ga0453684_0197742 3300044712 Bacteria 2346
617 Ga0453684_0433350 3300044712 Bacteria 1466
618 Ga0453684_1276545 3300044712 Bacteria 767
619 Ga0466968_0010626 3300044735 Bacteria 3574
620 Ga0466959_0129678 3300045049 Bacteria 1787
621 Ga0466959_0913084 3300045049 Bacteria 586
622 Ga0451576_0000968 3300045051 Bacteria 53566
623 Ga0451576_0023205 3300045051 Bacteria 6721
624 Ga0451576_0050377 3300045051 Bacteria 4367
625 Ga0451576_1020422 3300045051 Bacteria 867
626 Ga0451576_1074070 3300045051 Bacteria 843
627 Ga0451576_1441934 3300045051 Bacteria 716
628 Ga0466967_0000716 3300045976 Bacteria 16921
629 Ga0495617_236732 3300046452 Bacteria 565
630 Ga0495629_0322261 3300046459 Bacteria 1056
631 Ga0495638_0068933 3300046460 Bacteria 2168
632 Ga0495638_0281712 3300046460 Bacteria 903
633 Ga0495638_0573909 3300046460 Bacteria 557
634 Ga0495651_0808895 3300046462 Bacteria 578
635 Ga0495580_0053212 3300046472 Bacteria 2858
636 Ga0495580_0604330 3300046472 Bacteria 725
637 Ga0495580_0741765 3300046472 Bacteria 640
638 Ga0495606_0589319 3300046507 Bacteria 547
639 Ga0495616_0097836 3300046513 Bacteria 1380
640 Ga0495618_0764145 3300046514 Bacteria 565
641 Ga0495643_0000286 3300046522 Bacteria 72166
642 Ga0495652_0482754 3300046529 Bacteria 862
643 Ga0495654_0006530 3300046530 Bacteria 6612
644 Ga0495665_0498233 3300046531 Bacteria 614
645 Ga0495640_0203276 3300046533 Bacteria 1255
646 Ga0495633_0000563 3300046558 Bacteria 36212
647 Ga0495656_0233678 3300046615 Bacteria 923
648 Ga0495668_0382538 3300046616 Bacteria 773
649 Ga0495668_0613754 3300046616 Bacteria 601
650 Ga0495634_0339132 3300046642 Bacteria 902
651 Ga0495611_0218573 3300046648 Bacteria 887
652 Ga0495625_0252534 3300046660 Bacteria 1144
653 Ga0495625_0640658 3300046660 Bacteria 634
654 Ga0495599_0258323 3300046678 Bacteria 1059
655 Ga0495669_0638658 3300046684 Bacteria 518
656 Ga0495613_0013649 3300046689 Bacteria 6028
657 Ga0495613_0131731 3300046689 Bacteria 1790
658 Ga0495649_0431163 3300046694 Bacteria 660
659 Ga0495604_0232835 3300047317 Bacteria 1263
660 Ga0495674_0292484 3300047319 Bacteria 1332
661 Ga0495683_0240425 3300047323 Bacteria 799
662 Ga0495684_0502201 3300047471 Bacteria 834
663 Ga0495602_0157610 3300048088 Bacteria 1776
664 Ga0496100_0014533 3300048903 Bacteria 4573
665 Ga0496101_0005626 3300048904 Bacteria 7991
666 Ga0496104_0011960 3300048907 Bacteria 7787
667 Ga0496104_1292314 3300048907 Bacteria 633
668 Ga0496105_0179639 3300048908 Bacteria 1733
669 Ga0496107_0078761 3300048910 Bacteria 2402
670 Ga0496109_0000023 3300048912 Bacteria 187904
671 Ga0496110_0051931 3300048913 Bacteria 3603
672 Ga0496114_0722210 3300048917 Bacteria 872
673 Ga0496115_0053576 3300048918 Bacteria 3237
674 Ga0496115_0252433 3300048918 Bacteria 1452
675 Ga0496116_0321293 3300048919 Bacteria 725
676 Ga0496122_0007634 3300048925 Bacteria 11943
677 Ga0496122_0386203 3300048925 Bacteria 716
678 Ga0496123_0136278 3300048926 Bacteria 1350
679 Ga0496124_0309277 3300048927 Bacteria 1137
680 Ga0496125_0006034 3300048928 Bacteria 13252
681 Ga0496126_0025269 3300048929 Bacteria 5718
682 Ga0501306_017923 3300049127 Bacteria 964
683 Ga0501305_076619 3300049161 Bacteria 595
684 Ga0501307_040396 3300049162 Bacteria 676
685 Ga0495682_0337860 3300049460 Bacteria 531
686 Ga0501313_070236 3300049529 Bacteria 506
687 Ga0501314_041627 3300049530 Bacteria 537
688 Ga0501317_033174 3300049533 Bacteria 759
689 Ga0501317_034341 3300049533 Bacteria 750
690 Ga0501031_0233950 3300049568 Bacteria 1195
691 Ga0501032_0001422 3300049569 Bacteria 19011
692 Ga0501032_0641078 3300049569 Bacteria 675
693 Ga0501032_1067427 3300049569 Bacteria 506
694 Ga0501033_0005041 3300049570 Bacteria 10517
695 Ga0501033_0128466 3300049570 Bacteria 1837
696 Ga0501033_0148183 3300049570 Bacteria 1694
697 Ga0501033_0230338 3300049570 Bacteria 1316
698 Ga0501034_0057268 3300049571 Bacteria 3918
699 Ga0501034_0529974 3300049571 Bacteria 1089
700 Ga0501036_0085234 3300049572 Bacteria 2670
701 Ga0501036_0622444 3300049572 Bacteria 895
702 Ga0501037_0008897 3300049573 Bacteria 7353
703 Ga0501037_0218500 3300049573 Bacteria 1342
704 Ga0501037_0259210 3300049573 Bacteria 1215
705 Ga0501038_0021894 3300049574 Bacteria 5734
706 Ga0501038_0104377 3300049574 Bacteria 2355
707 Ga0501038_0314079 3300049574 Bacteria 1227
708 Ga0501039_0004832 3300049575 Bacteria 10204
709 Ga0501039_0590998 3300049575 Bacteria 870
710 Ga0501043_0002349 3300049579 Bacteria 16039
711 Ga0501043_0215283 3300049579 Bacteria 1488
712 Ga0501046_0001586 3300049580 Bacteria 21746
713 Ga0501046_0195515 3300049580 Bacteria 1507
714 Ga0501047_0017656 3300049581 Bacteria 6837
715 Ga0501047_0023291 3300049581 Bacteria 5946
716 Ga0501047_0135035 3300049581 Bacteria 2348
717 Ga0501047_0732000 3300049581 Bacteria 806
718 Ga0501048_0119263 3300049582 Bacteria 1864
719 Ga0501067_0024472 3300049583 Bacteria 3349
720 Ga0501067_0405423 3300049583 Bacteria 760
721 Ga0501068_0015914 3300049584 Bacteria 4331
722 Ga0501068_0026472 3300049584 Bacteria 3417
723 Ga0501068_0232786 3300049584 Bacteria 1172
724 Ga0501068_0585048 3300049584 Bacteria 727
725 Ga0501069_0000190 3300049585 Bacteria 27163
726 Ga0501069_0057232 3300049585 Bacteria 2173
727 Ga0501070_0001037 3300049586 Bacteria 25015
728 Ga0501070_0184654 3300049586 Bacteria 1715
729 Ga0501070_0449226 3300049586 Bacteria 1039
730 Ga0501071_0699848 3300049587 Bacteria 780
731 Ga0501071_0784925 3300049587 Bacteria 734
732 Ga0501072_0368721 3300049588 Bacteria 1140
733 Ga0501072_0392382 3300049588 Bacteria 1101
734 Ga0501073_0003174 3300049589 Bacteria 12336
735 Ga0501073_0011356 3300049589 Bacteria 6515
736 Ga0501073_0077405 3300049589 Bacteria 2314
737 Ga0501073_0265944 3300049589 Bacteria 1183
738 Ga0501073_0321404 3300049589 Bacteria 1068
739 Ga0501074_0037087 3300049590 Bacteria 3533
740 Ga0501074_0560633 3300049590 Bacteria 809
741 Ga0501074_0656757 3300049590 Bacteria 741
742 Ga0501075_0836560 3300049591 Bacteria 700
743 Ga0501075_0988697 3300049591 Unclassified 639
744 Ga0501076_0128334 3300049592 Bacteria 2056
745 Ga0501076_0358010 3300049592 Bacteria 1199
746 Ga0501077_0236396 3300049593 Bacteria 1161
747 Ga0501257_209474 3300049686 Bacteria 564
748 Ga0501079_0171794 3300049741 Bacteria 1690
749 Ga0501079_1174696 3300049741 Bacteria 605
750 Ga0501080_0001815 3300049742 Bacteria 18292
751 Ga0501080_0050487 3300049742 Bacteria 3871
752 Ga0501080_0067793 3300049742 Bacteria 3319
753 Ga0501080_0095799 3300049742 Bacteria 2755
754 Ga0501080_0212433 3300049742 Bacteria 1773
755 Ga0501080_0802919 3300049742 Bacteria 825
756 Ga0501081_0628739 3300049743 Viruses 804
757 Ga0501081_1175557 3300049743 Unclassified 581
758 Ga0501083_0011803 3300049744 Bacteria 6122
759 Ga0501083_0024181 3300049744 Bacteria 4211
760 Ga0501083_0069065 3300049744 Bacteria 2351
761 Ga0501035_0021710 3300049822 Bacteria 5902
762 Ga0501035_0538856 3300049822 Bacteria 957
763 Ga0501044_0004911 3300049823 Bacteria 14944
764 Ga0501044_0014858 3300049823 Bacteria 8392
765 Ga0501044_0056277 3300049823 Bacteria 4038
766 Ga0501044_0071661 3300049823 Bacteria 3523
767 Ga0501044_0590552 3300049823 Bacteria 1004
768 Ga0501044_1054123 3300049823 Bacteria 683
769 Ga0501045_0065790 3300049824 Bacteria 2662
770 nmdc:mga03683_108372_c1 3300050489 Bacteria 1226
771 nmdc:mga00v17_23278_c1 3300050491 Bacteria 3582
772 nmdc:mga0k408_131008_c2 3300050493 Bacteria 847
773 nmdc:mga0k408_5607_c1 3300050493 Bacteria 6670
774 nmdc:mga07m45_176203_c2 3300050496 Bacteria 948
775 nmdc:mga05p37_331725_c1 3300050507 Bacteria 1797
776 nmdc:mga05p37_54904_c1 3300050507 Bacteria 4900
777 nmdc:mga05p37_64916_c1 3300050507 Bacteria 4492
778 nmdc:mga09592_1178515_c1 3300050508 Bacteria 634
779 nmdc:mga09592_1442352_c1 3300050508 Bacteria 562
780 nmdc:mga09592_564011_c1 3300050508 Bacteria 977
781 nmdc:mga0qj67_1102760_c1 3300050509 Bacteria 620
782 nmdc:mga06r32_1339475_c1 3300050510 Bacteria 659
783 nmdc:mga06r32_390755_c1 3300050510 Bacteria 1374
784 nmdc:mga06r32_53958_c1 3300050510 Bacteria 3853
785 nmdc:mga06r32_572598_c1 3300050510 Bacteria 1102
786 nmdc:mga08y16_14338_c1 3300050511 Bacteria 8343
787 nmdc:mga08y16_2037200_c1 3300050511 Bacteria 523
788 nmdc:mga0n895_546066_c1 3300050512 Unclassified 1165
789 nmdc:mga0n895_782032_c1 3300050512 Bacteria 946
790 nmdc:mga0rr50_643995_c1 3300050513 Bacteria 904
791 nmdc:mga08x19_1293612_c1 3300050514 Bacteria 516
792 nmdc:mga08x19_810544_c1 3300050514 Bacteria 665
793 nmdc:mga0a205_263238_c1 3300050515 Bacteria 1602
794 nmdc:mga0a205_474934_c1 3300050515 Bacteria 1109
795 Ga0500578_0346513 3300053086 Bacteria 869
796 Ga0500578_0724073 3300053086 Bacteria 533
797 Ga0500644_0026438 3300053088 Bacteria 1796
798 Ga0500646_0030665 3300053090 Bacteria 1476
799 Ga0500646_0084229 3300053090 Bacteria 975
800 Ga0500641_0001835 3300053096 Bacteria 7532
801 Ga0500641_0070968 3300053096 Bacteria 1466
802 Ga0500650_0026482 3300053098 Bacteria 2602
803 Ga0500554_150671 3300053102 Bacteria 786
804 Ga0500555_001003 3300053103 Bacteria 9655
805 Ga0500555_004963 3300053103 Bacteria 3775
806 Ga0500556_0066361 3300053104 Bacteria 1340
807 Ga0500557_105121 3300053105 Bacteria 938
808 Ga0500562_019709 3300053108 Bacteria 1747
809 Ga0500562_137602 3300053108 Bacteria 666
810 Ga0500569_058510 3300053109 Bacteria 1184
811 Ga0500592_006310 3300053116 Bacteria 1889
812 Ga0500593_305065 3300053117 Bacteria 507
813 Ga0500594_0028275 3300053118 Bacteria 1458
814 Ga0500595_000854 3300053119 Bacteria 17395
815 Ga0500614_018705 3300053123 Bacteria 1579
816 Ga0500621_235392 3300053126 Bacteria 625
817 Ga0500628_000289 3300053129 Bacteria 9601
818 Ga0500642_0134168 3300053130 Bacteria 1160
819 Ga0500642_0203549 3300053130 Bacteria 920
820 Ga0500642_0226575 3300053130 Bacteria 864
821 Ga0500652_109312 3300053131 Bacteria 1155
822 Ga0500658_0010908 3300053134 Bacteria 3352
823 Ga0500658_0508971 3300053134 Bacteria 544
824 Ga0500561_0232084 3300053137 Bacteria 586
825 Ga0500568_0053865 3300053139 Bacteria 1575
826 Ga0500577_0266024 3300053142 Bacteria 746
827 Ga0500588_0012131 3300053146 Bacteria 2129
828 Ga0500588_0039414 3300053146 Bacteria 1414
829 Ga0500588_0210417 3300053146 Bacteria 722
830 Ga0500616_0001666 3300053153 Bacteria 20490
831 Ga0500616_0114013 3300053153 Bacteria 1301
832 Ga0500616_0238181 3300053153 Bacteria 784
833 Ga0500622_0272661 3300053156 Bacteria 733
834 Ga0500624_042680 3300053157 Bacteria 820
835 Ga0500627_0394321 3300053158 Bacteria 591
836 Ga0500633_0254390 3300053160 Bacteria 652
837 Ga0500634_0097376 3300053161 Bacteria 1480
838 Ga0500611_227728 3300053727 Bacteria 533
839 Ga0500609_000322 3300053731 Bacteria 7089
840 Ga0500609_012306 3300053731 Bacteria 1157
841 Ga0500656_050547 3300053732 Bacteria 603
842 Ga0501084_0043078 3300054114 Bacteria 3776
843 Ga0501084_0074473 3300054114 Unclassified 2843
844 Ga0501084_0365780 3300054114 Bacteria 1219
845 Ga0501084_0596286 3300054114 Bacteria 933
846 Ga0501084_0615504 3300054114 Bacteria 917
847 Ga0590071_147419 3300059421 Bacteria 609
848 Ga0590075_045809 3300059424 Bacteria 1120
849 Ga0590077_161701 3300059426 Bacteria 538
850 Ga0587070_192949 3300059491 Bacteria 537
851 Ga0587085_053028 3300059506 Bacteria 745
852 Ga0587086_062123 3300059507 Bacteria 625
853 Ga0587067_063942 3300059640 Bacteria 778
854 Ga0587076_084777 3300059645 Bacteria 682
855 Ga0587119_039652 3300059658 Bacteria 672
856 Ga0587111_0232838 3300060346 Bacteria 537
857 Ga0501082_0000993 3300060353 Bacteria 25057
858 Ga0501082_0002008 3300060353 Bacteria 17888
859 Ga0501082_0360254 3300060353 Bacteria 1268
860 Ga0501082_0507394 3300060353 Bacteria 1054
861 Ga0501082_1311700 3300060353 Bacteria 632
862 Ga0466962_0051036 3300061719 Bacteria 1978

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10537675 Ga0075367_105376751 82
2 3300041456 Ga0451795_0149206 Ga0451795_0149206_198_476 82
3 3300005335 Ga0070666_10431705 Ga0070666_104317051 83
4 3300005335 Ga0070666_11460322 Ga0070666_114603221 83
5 3300005467 Ga0070706_101529863 Ga0070706_1015298632 83
6 3300005468 Ga0070707_101185530 Ga0070707_1011855301 83
7 3300013306 Ga0163162_12795497 Ga0163162_127954972 83
8 3300013307 Ga0157372_11388256 Ga0157372_113882562 83
9 3300025903 Ga0207680_10498227 Ga0207680_104982272 83
10 3300025922 Ga0207646_11304519 Ga0207646_113045192 83
11 3300025931 Ga0207644_10637441 Ga0207644_106374412 83
12 3300025986 Ga0207658_10758538 Ga0207658_107585381 83
13 3300028556 Ga0265337_1000286 Ga0265337_10002866 83
14 3300028558 Ga0265326_10000350 Ga0265326_1000035020 83
15 3300028558 Ga0265326_10039899 Ga0265326_100398992 83
16 3300028563 Ga0265319_1000346 Ga0265319_100034617 83
17 3300028563 Ga0265319_1007043 Ga0265319_10070436 83
18 3300028573 Ga0265334_10001979 Ga0265334_100019791 83
19 3300028577 Ga0265318_10000921 Ga0265318_1000092116 83
20 3300028577 Ga0265318_10041897 Ga0265318_100418972 83
21 3300028577 Ga0265318_10220345 Ga0265318_102203451 83
22 3300028653 Ga0265323_10000609 Ga0265323_1000060920 83
23 3300028654 Ga0265322_10000064 Ga0265322_100000644 83
24 3300028654 Ga0265322_10001372 Ga0265322_100013727 83
25 3300028654 Ga0265322_10001389 Ga0265322_100013895 83
26 3300028666 Ga0265336_10000088 Ga0265336_1000008818 83
27 3300028800 Ga0265338_10000783 Ga0265338_1000078331 83
28 3300028800 Ga0265338_10002272 Ga0265338_100022728 83
29 3300028800 Ga0265338_10003505 Ga0265338_100035058 83
30 3300029957 Ga0265324_10003377 Ga0265324_100033777 83
31 3300029957 Ga0265324_10005065 Ga0265324_100050652 83
32 3300029957 Ga0265324_10015573 Ga0265324_100155733 83
33 3300031235 Ga0265330_10001755 Ga0265330_1000175510 83
34 3300031235 Ga0265330_10157856 Ga0265330_101578562 83
35 3300031238 Ga0265332_10008075 Ga0265332_100080752 83
36 3300031238 Ga0265332_10151220 Ga0265332_101512202 83
37 3300031239 Ga0265328_10001890 Ga0265328_100018901 83
38 3300031240 Ga0265320_10000957 Ga0265320_1000095714 83
39 3300031240 Ga0265320_10004168 Ga0265320_1000416811 83
40 3300031240 Ga0265320_10263729 Ga0265320_102637292 83
41 3300031241 Ga0265325_10006585 Ga0265325_100065858 83
42 3300031241 Ga0265325_10034346 Ga0265325_100343463 83
43 3300031242 Ga0265329_10001200 Ga0265329_100012005 83
44 3300031242 Ga0265329_10349787 Ga0265329_103497871 83
45 3300031247 Ga0265340_10000443 Ga0265340_1000044315 83
46 3300031249 Ga0265339_10003757 Ga0265339_1000375710 83
47 3300031249 Ga0265339_10070329 Ga0265339_100703291 83
48 3300031250 Ga0265331_10005438 Ga0265331_100054386 83
49 3300031250 Ga0265331_10217005 Ga0265331_102170052 83
50 3300031251 Ga0265327_10510055 Ga0265327_105100552 83
51 3300031344 Ga0265316_10006910 Ga0265316_1000691010 83
52 3300031344 Ga0265316_10050281 Ga0265316_100502813 83
53 3300031344 Ga0265316_10208442 Ga0265316_102084422 83
54 3300031344 Ga0265316_10287124 Ga0265316_102871242 83
55 3300031344 Ga0265316_10294658 Ga0265316_102946582 83
56 3300031595 Ga0265313_10002254 Ga0265313_1000225418 83
57 3300031595 Ga0265313_10081198 Ga0265313_100811982 83
58 3300031665 Ga0316575_10332986 Ga0316575_103329862 83
59 3300031711 Ga0265314_10047836 Ga0265314_100478363 83
60 3300031711 Ga0265314_10104963 Ga0265314_101049632 83
61 3300031712 Ga0265342_10005611 Ga0265342_100056118 83
62 3300031712 Ga0265342_10017036 Ga0265342_100170363 83
63 3300031712 Ga0265342_10712404 Ga0265342_107124042 83
64 3300031727 Ga0316576_10366875 Ga0316576_103668752 83
65 3300031728 Ga0316578_10420100 Ga0316578_104201001 83
66 3300031733 Ga0316577_10437463 Ga0316577_104374632 83
67 3300032133 Ga0316583_10029998 Ga0316583_100299983 83
68 3300032137 Ga0316585_10161193 Ga0316585_101611932 83
69 3300036647 Ga0316582_0445132 Ga0316582_0445132_247_501 83
70 3300036712 Ga0316584_0072229 Ga0316584_0072229_437_691 83
71 3300041461 Ga0451805_019949 Ga0451805_019949_338_592 83
72 3300042876 Ga0451577_0003993 Ga0451577_0003993_11992_12246 83
73 3300044712 Ga0453684_0004729 Ga0453684_0004729_25217_25471 83
74 3300044712 Ga0453684_0007706 Ga0453684_0007706_6290_6577 83
75 3300003159 Ga0006771J45828_102739 Ga0006771J45828_1027392 84
76 3300003161 Ga0006765J45826_108928 Ga0006765J45826_1089282 84
77 3300003163 Ga0006759J45824_1021461 Ga0006759J45824_10214612 84
78 3300003544 Ga0007417J51691_1040523 Ga0007417J51691_10405232 84
79 3300003693 Ga0032354_1100925 Ga0032354_11009252 84
80 3300005289 Ga0065704_10072444 Ga0065704_100724446 84
81 3300005334 Ga0068869_100862558 Ga0068869_1008625582 84
82 3300005353 Ga0070669_100281085 Ga0070669_1002810851 84
83 3300005353 Ga0070669_101690405 Ga0070669_1016904051 84
84 3300005354 Ga0070675_100993008 Ga0070675_1009930082 84
85 3300005356 Ga0070674_100084170 Ga0070674_1000841702 84
86 3300005435 Ga0070714_100378014 Ga0070714_1003780142 84
87 3300005439 Ga0070711_100112806 Ga0070711_1001128063 84
88 3300005456 Ga0070678_100606996 Ga0070678_1006069962 84
89 3300005456 Ga0070678_101661282 Ga0070678_1016612821 84
90 3300005459 Ga0068867_100341612 Ga0068867_1003416123 84
91 3300005471 Ga0070698_100626424 Ga0070698_1006264241 84
92 3300005548 Ga0070665_100154539 Ga0070665_1001545393 84
93 3300005548 Ga0070665_100685797 Ga0070665_1006857973 84
94 3300005577 Ga0068857_100615082 Ga0068857_1006150822 84
95 3300005840 Ga0068870_11138186 Ga0068870_111381862 84
96 3300006028 Ga0070717_10909874 Ga0070717_109098741 84
97 3300006051 Ga0075364_10009158 Ga0075364_100091583 84
98 3300006358 Ga0068871_101617491 Ga0068871_1016174912 84
99 3300009176 Ga0105242_10011064 Ga0105242_100110645 84
100 3300013308 Ga0157375_12892096 Ga0157375_128920961 84
101 3300020610 Ga0154015_1280778 Ga0154015_12807782 84
102 3300025901 Ga0207688_10356825 Ga0207688_103568252 84
103 3300025908 Ga0207643_10977793 Ga0207643_109777932 84
104 3300025910 Ga0207684_10885696 Ga0207684_108856961 84
105 3300025920 Ga0207649_10821401 Ga0207649_108214012 84
106 3300025923 Ga0207681_10262972 Ga0207681_102629722 84
107 3300025929 Ga0207664_10655602 Ga0207664_106556021 84
108 3300025929 Ga0207664_11492578 Ga0207664_114925781 84
109 3300025934 Ga0207686_10005026 Ga0207686_100050265 84
110 3300025937 Ga0207669_10092981 Ga0207669_100929813 84
111 3300025938 Ga0207704_10355622 Ga0207704_103556222 84
112 3300025961 Ga0207712_11411319 Ga0207712_114113192 84
113 3300026078 Ga0207702_10559119 Ga0207702_105591193 84
114 3300026089 Ga0207648_10591210 Ga0207648_105912103 84
115 3300026121 Ga0207683_10616014 Ga0207683_106160142 84
116 3300026121 Ga0207683_11325060 Ga0207683_113250602 84
117 3300027360 Ga0209969_1032591 Ga0209969_10325912 84
118 3300027471 Ga0209995_1011891 Ga0209995_10118912 84
119 3300027526 Ga0209968_1098309 Ga0209968_10983091 84
120 3300027617 Ga0210002_1009035 Ga0210002_10090352 84
121 3300027665 Ga0209983_1135632 Ga0209983_11356321 84
122 3300027682 Ga0209971_1011208 Ga0209971_10112081 84
123 3300027876 Ga0209974_10094884 Ga0209974_100948842 84
124 3300027876 Ga0209974_10274054 Ga0209974_102740542 84
125 3300028379 Ga0268266_10012086 Ga0268266_100120862 84
126 3300028653 Ga0265323_10151069 Ga0265323_101510691 84
127 3300028654 Ga0265322_10036758 Ga0265322_100367582 84
128 3300031238 Ga0265332_10000125 Ga0265332_100001255 84
129 3300031665 Ga0316575_10146813 Ga0316575_101468132 84
130 3300031712 Ga0265342_10470604 Ga0265342_104706041 84
131 3300031727 Ga0316576_10877605 Ga0316576_108776052 84
132 3300031728 Ga0316578_10289981 Ga0316578_102899812 84
133 3300031730 Ga0307516_10309237 Ga0307516_103092373 84
134 3300032133 Ga0316583_10124071 Ga0316583_101240711 84
135 3300032137 Ga0316585_10293375 Ga0316585_102933751 84
136 3300032168 Ga0316593_10212686 Ga0316593_102126862 84
137 3300033524 Ga0316592_1059674 Ga0316592_10596742 84
138 3300033527 Ga0316586_1082457 Ga0316586_10824572 84
139 3300033527 Ga0316586_1084297 Ga0316586_10842972 84
140 3300033529 Ga0316587_1081526 Ga0316587_10815262 84
141 3300033529 Ga0316587_1090703 Ga0316587_10907032 84
142 3300034818 Ga0373950_0109911 Ga0373950_0109911_137_394 84
143 3300035398 Ga0316574_0017340 Ga0316574_0017340_624_881 84
144 3300035725 Ga0373947_0614593 Ga0373947_0614593_350_607 84
145 3300036647 Ga0316582_0166264 Ga0316582_0166264_141_398 84
146 3300036712 Ga0316584_0228010 Ga0316584_0228010_905_1162 84
147 3300036712 Ga0316584_0893251 Ga0316584_0893251_113_370 84
148 3300037418 Ga0395900_0201928 Ga0395900_0201928_1714_1971 84
149 3300037471 Ga0395905_0001245 Ga0395905_0001245_9929_10186 84
150 3300041496 Ga0451839_1632871 Ga0451839_1632871_49_306 84
151 3300042876 Ga0451577_0031677 Ga0451577_0031677_3303_3560 84
152 3300042876 Ga0451577_0270634 Ga0451577_0270634_1266_1523 84
153 3300042876 Ga0451577_0380747 Ga0451577_0380747_848_1105 84
154 3300044712 Ga0453684_0029590 Ga0453684_0029590_5606_5863 84
155 3300044712 Ga0453684_0433350 Ga0453684_0433350_45_302 84
156 3300044712 Ga0453684_1276545 Ga0453684_1276545_36_293 84
157 3300045051 Ga0451576_0023205 Ga0451576_0023205_248_505 84
158 3300048925 Ga0496122_0386203 Ga0496122_0386203_223_480 84
159 3300048926 Ga0496123_0136278 Ga0496123_0136278_870_1127 84
160 3300048927 Ga0496124_0309277 Ga0496124_0309277_676_933 84
161 3300048928 Ga0496125_0006034 Ga0496125_0006034_12348_12605 84
162 3300048929 Ga0496126_0025269 Ga0496126_0025269_2213_2470 84
163 3300049127 Ga0501306_017923 Ga0501306_017923_309_566 84
164 3300049530 Ga0501314_041627 Ga0501314_041627_173_430 84
165 3300049574 Ga0501038_0021894 Ga0501038_0021894_2300_2557 84
166 3300050491 nmdc:mga00v17_23278_c1 nmdc:mga00v17_23278_c1_198_455 84
167 3300053117 Ga0500593_305065 Ga0500593_305065_93_353 84
168 3300059491 Ga0587070_192949 Ga0587070_192949_223_480 84
169 3300059645 Ga0587076_084777 Ga0587076_084777_42_299 84
170 3300004801 Ga0058860_12049493 Ga0058860_120494931 85
171 3300005289 Ga0065704_10311985 Ga0065704_103119851 85
172 3300005327 Ga0070658_10014007 Ga0070658_100140073 85
173 3300005329 Ga0070683_100001211 Ga0070683_1000012113 85
174 3300005331 Ga0070670_100021890 Ga0070670_1000218903 85
175 3300005334 Ga0068869_100001837 Ga0068869_1000018373 85
176 3300005334 Ga0068869_100642032 Ga0068869_1006420322 85
177 3300005335 Ga0070666_10198828 Ga0070666_101988282 85
178 3300005338 Ga0068868_100004900 Ga0068868_1000049005 85
179 3300005338 Ga0068868_100007490 Ga0068868_1000074906 85
180 3300005344 Ga0070661_100107053 Ga0070661_1001070532 85
181 3300005347 Ga0070668_100493276 Ga0070668_1004932761 85
182 3300005353 Ga0070669_100008790 Ga0070669_1000087904 85
183 3300005355 Ga0070671_100040612 Ga0070671_1000406124 85
184 3300005356 Ga0070674_100054340 Ga0070674_1000543402 85
185 3300005367 Ga0070667_100005595 Ga0070667_1000055957 85
186 3300005437 Ga0070710_10167496 Ga0070710_101674962 85
187 3300005440 Ga0070705_100864354 Ga0070705_1008643542 85
188 3300005441 Ga0070700_100506033 Ga0070700_1005060332 85
189 3300005445 Ga0070708_101097764 Ga0070708_1010977642 85
190 3300005458 Ga0070681_10251756 Ga0070681_102517561 85
191 3300005467 Ga0070706_100197905 Ga0070706_1001979052 85
192 3300005530 Ga0070679_101559392 Ga0070679_1015593921 85
193 3300005535 Ga0070684_100011471 Ga0070684_1000114712 85
194 3300005539 Ga0068853_100250593 Ga0068853_1002505932 85
195 3300005539 Ga0068853_100313409 Ga0068853_1003134093 85
196 3300005539 Ga0068853_101275828 Ga0068853_1012758282 85
197 3300005543 Ga0070672_101843893 Ga0070672_1018438932 85
198 3300005563 Ga0068855_101113995 Ga0068855_1011139952 85
199 3300005564 Ga0070664_101683220 Ga0070664_1016832202 85
200 3300005564 Ga0070664_101951841 Ga0070664_1019518412 85
201 3300005577 Ga0068857_100014330 Ga0068857_1000143303 85
202 3300005614 Ga0068856_100008202 Ga0068856_1000082027 85
203 3300005614 Ga0068856_100438372 Ga0068856_1004383722 85
204 3300005616 Ga0068852_100029234 Ga0068852_1000292343 85
205 3300005617 Ga0068859_100008964 Ga0068859_10000896410 85
206 3300005618 Ga0068864_100006989 Ga0068864_1000069896 85
207 3300005618 Ga0068864_102184838 Ga0068864_1021848381 85
208 3300005834 Ga0068851_10006556 Ga0068851_100065565 85
209 3300005834 Ga0068851_10975631 Ga0068851_109756311 85
210 3300005841 Ga0068863_100003161 Ga0068863_1000031614 85
211 3300005842 Ga0068858_100001902 Ga0068858_10000190220 85
212 3300005843 Ga0068860_100000809 Ga0068860_1000008093 85
213 3300005844 Ga0068862_100009301 Ga0068862_1000093014 85
214 3300005844 Ga0068862_100302218 Ga0068862_1003022182 85
215 3300005937 Ga0081455_10004869 Ga0081455_1000486914 85
216 3300005937 Ga0081455_10046010 Ga0081455_100460102 85
217 3300006163 Ga0070715_10226637 Ga0070715_102266372 85
218 3300006175 Ga0070712_100340940 Ga0070712_1003409404 85
219 3300006177 Ga0075362_10096835 Ga0075362_100968352 85
220 3300006177 Ga0075362_10295735 Ga0075362_102957352 85
221 3300006177 Ga0075362_10445905 Ga0075362_104459052 85
222 3300006195 Ga0075366_10001813 Ga0075366_100018135 85
223 3300006195 Ga0075366_10240061 Ga0075366_102400612 85
224 3300006195 Ga0075366_10460424 Ga0075366_104604242 85
225 3300006237 Ga0097621_100009947 Ga0097621_1000099476 85
226 3300006353 Ga0075370_10368488 Ga0075370_103684882 85
227 3300006358 Ga0068871_100139822 Ga0068871_1001398224 85
228 3300006358 Ga0068871_101755968 Ga0068871_1017559682 85
229 3300006844 Ga0075428_100880074 Ga0075428_1008800741 85
230 3300006844 Ga0075428_101135696 Ga0075428_1011356961 85
231 3300006844 Ga0075428_102175600 Ga0075428_1021756002 85
232 3300006847 Ga0075431_100061803 Ga0075431_1000618035 85
233 3300006847 Ga0075431_100487712 Ga0075431_1004877123 85
234 3300006847 Ga0075431_100647412 Ga0075431_1006474121 85
235 3300006847 Ga0075431_100884428 Ga0075431_1008844281 85
236 3300006847 Ga0075431_101335087 Ga0075431_1013350872 85
237 3300006852 Ga0075433_10164977 Ga0075433_101649772 85
238 3300006852 Ga0075433_10394147 Ga0075433_103941472 85
239 3300006871 Ga0075434_100907915 Ga0075434_1009079151 85
240 3300006880 Ga0075429_100596824 Ga0075429_1005968242 85
241 3300006881 Ga0068865_100470783 Ga0068865_1004707832 85
242 3300006931 Ga0097620_100008964 Ga0097620_1000089643 85
243 3300009093 Ga0105240_10003931 Ga0105240_100039314 85
244 3300009093 Ga0105240_10599373 Ga0105240_105993732 85
245 3300009093 Ga0105240_11620700 Ga0105240_116207002 85
246 3300009094 Ga0111539_10053174 Ga0111539_100531745 85
247 3300009094 Ga0111539_10643372 Ga0111539_106433722 85
248 3300009094 Ga0111539_10943369 Ga0111539_109433691 85
249 3300009098 Ga0105245_10010929 Ga0105245_100109295 85
250 3300009098 Ga0105245_10012850 Ga0105245_100128503 85
251 3300009101 Ga0105247_10024995 Ga0105247_100249955 85
252 3300009147 Ga0114129_10687122 Ga0114129_106871222 85
253 3300009147 Ga0114129_11574453 Ga0114129_115744532 85
254 3300009147 Ga0114129_13037071 Ga0114129_130370711 85
255 3300009147 Ga0114129_13071937 Ga0114129_130719371 85
256 3300009148 Ga0105243_11732571 Ga0105243_117325712 85
257 3300009174 Ga0105241_10004665 Ga0105241_100046658 85
258 3300009174 Ga0105241_11735213 Ga0105241_117352132 85
259 3300009177 Ga0105248_10093271 Ga0105248_100932714 85
260 3300009177 Ga0105248_11584326 Ga0105248_115843262 85
261 3300009545 Ga0105237_10007181 Ga0105237_100071815 85
262 3300009545 Ga0105237_10101571 Ga0105237_101015715 85
263 3300009545 Ga0105237_11177676 Ga0105237_111776762 85
264 3300009551 Ga0105238_10008228 Ga0105238_100082283 85
265 3300009551 Ga0105238_10021454 Ga0105238_100214545 85
266 3300009551 Ga0105238_10859662 Ga0105238_108596622 85
267 3300009553 Ga0105249_10238483 Ga0105249_102384833 85
268 3300010375 Ga0105239_10098590 Ga0105239_100985902 85
269 3300010375 Ga0105239_10099080 Ga0105239_100990803 85
270 3300011119 Ga0105246_10003503 Ga0105246_100035037 85
271 3300013105 Ga0157369_10015458 Ga0157369_100154588 85
272 3300013296 Ga0157374_10055775 Ga0157374_100557753 85
273 3300013296 Ga0157374_10093790 Ga0157374_100937905 85
274 3300013296 Ga0157374_10471857 Ga0157374_104718572 85
275 3300013297 Ga0157378_10025125 Ga0157378_100251252 85
276 3300013297 Ga0157378_10250805 Ga0157378_102508053 85
277 3300013306 Ga0163162_10179923 Ga0163162_101799232 85
278 3300013306 Ga0163162_10838192 Ga0163162_108381922 85
279 3300013307 Ga0157372_10101037 Ga0157372_101010372 85
280 3300013307 Ga0157372_10670785 Ga0157372_106707852 85
281 3300013308 Ga0157375_10005518 Ga0157375_100055182 85
282 3300013308 Ga0157375_10032187 Ga0157375_100321875 85
283 3300013308 Ga0157375_11964651 Ga0157375_119646512 85
284 3300014325 Ga0163163_10001103 Ga0163163_100011033 85
285 3300014326 Ga0157380_10103788 Ga0157380_101037884 85
286 3300014968 Ga0157379_10000092 Ga0157379_100000924 85
287 3300014968 Ga0157379_10295212 Ga0157379_102952122 85
288 3300014969 Ga0157376_10001138 Ga0157376_1000113813 85
289 3300014969 Ga0157376_11777445 Ga0157376_117774452 85
290 3300017792 Ga0163161_10877528 Ga0163161_108775282 85
291 3300025321 Ga0207656_10582918 Ga0207656_105829181 85
292 3300025899 Ga0207642_10313005 Ga0207642_103130052 85
293 3300025900 Ga0207710_10002483 Ga0207710_100024836 85
294 3300025903 Ga0207680_10690005 Ga0207680_106900052 85
295 3300025904 Ga0207647_10130798 Ga0207647_101307982 85
296 3300025909 Ga0207705_10066203 Ga0207705_100662033 85
297 3300025909 Ga0207705_11102940 Ga0207705_111029402 85
298 3300025910 Ga0207684_10347471 Ga0207684_103474713 85
299 3300025911 Ga0207654_10000682 Ga0207654_100006823 85
300 3300025911 Ga0207654_10733351 Ga0207654_107333512 85
301 3300025912 Ga0207707_10303295 Ga0207707_103032953 85
302 3300025912 Ga0207707_10785072 Ga0207707_107850721 85
303 3300025913 Ga0207695_10000314 Ga0207695_100003144 85
304 3300025913 Ga0207695_10174637 Ga0207695_101746373 85
305 3300025913 Ga0207695_11682570 Ga0207695_116825702 85
306 3300025914 Ga0207671_10002931 Ga0207671_100029314 85
307 3300025914 Ga0207671_10435488 Ga0207671_104354882 85
308 3300025914 Ga0207671_10862354 Ga0207671_108623542 85
309 3300025915 Ga0207693_11357758 Ga0207693_113577582 85
310 3300025916 Ga0207663_10533746 Ga0207663_105337462 85
311 3300025920 Ga0207649_10891506 Ga0207649_108915062 85
312 3300025923 Ga0207681_10081987 Ga0207681_100819874 85
313 3300025924 Ga0207694_10001968 Ga0207694_100019682 85
314 3300025924 Ga0207694_10250443 Ga0207694_102504432 85
315 3300025924 Ga0207694_10776372 Ga0207694_107763722 85
316 3300025925 Ga0207650_10011074 Ga0207650_100110747 85
317 3300025927 Ga0207687_10007042 Ga0207687_100070426 85
318 3300025927 Ga0207687_10168503 Ga0207687_101685031 85
319 3300025931 Ga0207644_10009369 Ga0207644_100093692 85
320 3300025935 Ga0207709_10699424 Ga0207709_106994241 85
321 3300025937 Ga0207669_10140090 Ga0207669_101400902 85
322 3300025938 Ga0207704_10242211 Ga0207704_102422112 85
323 3300025939 Ga0207665_10635632 Ga0207665_106356322 85
324 3300025941 Ga0207711_10103727 Ga0207711_101037272 85
325 3300025942 Ga0207689_10003813 Ga0207689_100038139 85
326 3300025944 Ga0207661_10030494 Ga0207661_100304943 85
327 3300025945 Ga0207679_10304259 Ga0207679_103042593 85
328 3300025945 Ga0207679_11038793 Ga0207679_110387932 85
329 3300025949 Ga0207667_12146998 Ga0207667_121469981 85
330 3300025961 Ga0207712_10145284 Ga0207712_101452843 85
331 3300025972 Ga0207668_11876898 Ga0207668_118768982 85
332 3300025986 Ga0207658_10004440 Ga0207658_100044404 85
333 3300026023 Ga0207677_10000104 Ga0207677_1000010463 85
334 3300026023 Ga0207677_10167947 Ga0207677_101679473 85
335 3300026035 Ga0207703_10001493 Ga0207703_1000149319 85
336 3300026041 Ga0207639_10001965 Ga0207639_100019659 85
337 3300026041 Ga0207639_10002214 Ga0207639_100022149 85
338 3300026041 Ga0207639_10933026 Ga0207639_109330262 85
339 3300026067 Ga0207678_10176897 Ga0207678_101768973 85
340 3300026075 Ga0207708_10586807 Ga0207708_105868071 85
341 3300026078 Ga0207702_10023448 Ga0207702_100234484 85
342 3300026088 Ga0207641_10000809 Ga0207641_1000080929 85
343 3300026089 Ga0207648_10221843 Ga0207648_102218433 85
344 3300026095 Ga0207676_10000862 Ga0207676_100008624 85
345 3300026116 Ga0207674_10003615 Ga0207674_100036153 85
346 3300026118 Ga0207675_100022885 Ga0207675_1000228857 85
347 3300026142 Ga0207698_10228774 Ga0207698_102287742 85
348 3300026142 Ga0207698_11387992 Ga0207698_113879921 85
349 3300027907 Ga0207428_10056948 Ga0207428_100569484 85
350 3300027907 Ga0207428_10425227 Ga0207428_104252272 85
351 3300028380 Ga0268265_10041752 Ga0268265_100417525 85
352 3300028381 Ga0268264_10001031 Ga0268264_100010314 85
353 3300028794 Ga0307515_10005786 Ga0307515_100057868 85
354 3300028794 Ga0307515_10045397 Ga0307515_100453977 85
355 3300031238 Ga0265332_10000028 Ga0265332_10000028111 85
356 3300031241 Ga0265325_10115242 Ga0265325_101152422 85
357 3300031247 Ga0265340_10029762 Ga0265340_100297622 85
358 3300031344 Ga0265316_10136783 Ga0265316_101367834 85
359 3300031344 Ga0265316_10468551 Ga0265316_104685512 85
360 3300031456 Ga0307513_10026448 Ga0307513_100264485 85
361 3300031456 Ga0307513_10248331 Ga0307513_102483312 85
362 3300031548 Ga0307408_100444376 Ga0307408_1004443761 85
363 3300031649 Ga0307514_10000920 Ga0307514_1000092025 85
364 3300031711 Ga0265314_10000054 Ga0265314_10000054111 85
365 3300031711 Ga0265314_10628997 Ga0265314_106289972 85
366 3300031731 Ga0307405_10319132 Ga0307405_103191322 85
367 3300031731 Ga0307405_11841687 Ga0307405_118416872 85
368 3300031824 Ga0307413_10034193 Ga0307413_100341932 85
369 3300031852 Ga0307410_10017964 Ga0307410_100179643 85
370 3300031901 Ga0307406_10036832 Ga0307406_100368323 85
371 3300031903 Ga0307407_10066639 Ga0307407_100666391 85
372 3300031911 Ga0307412_10337484 Ga0307412_103374842 85
373 3300031911 Ga0307412_10673558 Ga0307412_106735582 85
374 3300031995 Ga0307409_100437126 Ga0307409_1004371262 85
375 3300032002 Ga0307416_100067170 Ga0307416_1000671704 85
376 3300032004 Ga0307414_10090894 Ga0307414_100908942 85
377 3300032005 Ga0307411_10040085 Ga0307411_100400852 85
378 3300032126 Ga0307415_100123909 Ga0307415_1001239092 85
379 3300032126 Ga0307415_100128491 Ga0307415_1001284912 85
380 3300032133 Ga0316583_10004920 Ga0316583_100049204 85
381 3300032168 Ga0316593_10199397 Ga0316593_101993972 85
382 3300033180 Ga0307510_10659202 Ga0307510_106592021 85
383 3300033527 Ga0316586_1040824 Ga0316586_10408242 85
384 3300035083 Ga0373926_0413961 Ga0373926_0413961_128_385 85
385 3300035111 Ga0373923_0692527 Ga0373923_0692527_181_438 85
386 3300035114 Ga0373939_0118936 Ga0373939_0118936_29_289 85
387 3300035170 Ga0373943_0107900 Ga0373943_0107900_547_804 85
388 3300035171 Ga0373946_0414562 Ga0373946_0414562_148_405 85
389 3300035172 Ga0373955_0455528 Ga0373955_0455528_152_409 85
390 3300035398 Ga0316574_0746664 Ga0316574_0746664_275_535 85
391 3300035691 Ga0373931_0409292 Ga0373931_0409292_433_690 85
392 3300035692 Ga0373935_0755546 Ga0373935_0755546_89_346 85
393 3300035692 Ga0373935_0838132 Ga0373935_0838132_60_317 85
394 3300035695 Ga0373927_0182230 Ga0373927_0182230_502_759 85
395 3300035695 Ga0373927_0818875 Ga0373927_0818875_320_577 85
396 3300035724 Ga0373933_0297274 Ga0373933_0297274_75_335 85
397 3300035725 Ga0373947_0561376 Ga0373947_0561376_418_675 85
398 3300036401 Ga0373937_0090909 Ga0373937_0090909_1827_2084 85
399 3300037068 Ga0373925_0327193 Ga0373925_0327193_471_728 85
400 3300039447 Ga0436361_0470064 Ga0436361_0470064_193_450 85
401 3300041408 Ga0439453_0189804 Ga0439453_0189804_180_437 85
402 3300041494 Ga0451837_0156795 Ga0451837_0156795_329_589 85
403 3300042001 Ga0439441_042766 Ga0439441_042766_504_761 85
404 3300042436 Ga0439435_0029672 Ga0439435_0029672_1158_1415 85
405 3300042876 Ga0451577_0004474 Ga0451577_0004474_111_371 85
406 3300042876 Ga0451577_0012787 Ga0451577_0012787_4359_4619 85
407 3300044712 Ga0453684_0197742 Ga0453684_0197742_1699_1959 85
408 3300045051 Ga0451576_0000968 Ga0451576_0000968_37354_37614 85
409 3300045051 Ga0451576_0050377 Ga0451576_0050377_3882_4163 85
410 3300046460 Ga0495638_0573909 Ga0495638_0573909_91_348 85
411 3300046472 Ga0495580_0604330 Ga0495580_0604330_195_452 85
412 3300046529 Ga0495652_0482754 Ga0495652_0482754_148_408 85
413 3300046530 Ga0495654_0006530 Ga0495654_0006530_3614_3874 85
414 3300046558 Ga0495633_0000563 Ga0495633_0000563_16756_17016 85
415 3300046615 Ga0495656_0233678 Ga0495656_0233678_284_541 85
416 3300046616 Ga0495668_0613754 Ga0495668_0613754_159_419 85
417 3300046684 Ga0495669_0638658 Ga0495669_0638658_31_288 85
418 3300047323 Ga0495683_0240425 Ga0495683_0240425_520_780 85
419 3300047471 Ga0495684_0502201 Ga0495684_0502201_267_524 85
420 3300049161 Ga0501305_076619 Ga0501305_076619_51_308 85
421 3300049162 Ga0501307_040396 Ga0501307_040396_116_376 85
422 3300049529 Ga0501313_070236 Ga0501313_070236_227_487 85
423 3300049533 Ga0501317_033174 Ga0501317_033174_450_707 85
424 3300049533 Ga0501317_034341 Ga0501317_034341_421_681 85
425 3300049587 Ga0501071_0784925 Ga0501071_0784925_32_289 85
426 3300049591 Ga0501075_0836560 Ga0501075_0836560_356_613 85
427 3300049591 Ga0501075_0988697 Ga0501075_0988697_191_451 85
428 3300049592 Ga0501076_0128334 Ga0501076_0128334_1286_1543 85
429 3300049593 Ga0501077_0236396 Ga0501077_0236396_216_473 85
430 3300049686 Ga0501257_209474 Ga0501257_209474_12_269 85
431 3300049742 Ga0501080_0802919 Ga0501080_0802919_416_697 85
432 3300049743 Ga0501081_0628739 Ga0501081_0628739_96_356 85
433 3300049743 Ga0501081_1175557 Ga0501081_1175557_35_310 85
434 3300049824 Ga0501045_0065790 Ga0501045_0065790_1352_1612 85
435 3300050489 nmdc:mga03683_108372_c1 nmdc:mga03683_108372_c1_707_964 85
436 3300050493 nmdc:mga0k408_131008_c2 nmdc:mga0k408_131008_c2_505_762 85
437 3300050493 nmdc:mga0k408_5607_c1 nmdc:mga0k408_5607_c1_3108_3368 85
438 3300050496 nmdc:mga07m45_176203_c2 nmdc:mga07m45_176203_c2_407_667 85
439 3300050507 nmdc:mga05p37_331725_c1 nmdc:mga05p37_331725_c1_236_493 85
440 3300050507 nmdc:mga05p37_54904_c1 nmdc:mga05p37_54904_c1_3946_4206 85
441 3300050507 nmdc:mga05p37_64916_c1 nmdc:mga05p37_64916_c1_565_825 85
442 3300050508 nmdc:mga09592_1178515_c1 nmdc:mga09592_1178515_c1_37_294 85
443 3300050508 nmdc:mga09592_1442352_c1 nmdc:mga09592_1442352_c1_18_278 85
444 3300050508 nmdc:mga09592_564011_c1 nmdc:mga09592_564011_c1_139_399 85
445 3300050509 nmdc:mga0qj67_1102760_c1 nmdc:mga0qj67_1102760_c1_329_586 85
446 3300050510 nmdc:mga06r32_1339475_c1 nmdc:mga06r32_1339475_c1_135_395 85
447 3300050510 nmdc:mga06r32_390755_c1 nmdc:mga06r32_390755_c1_17_277 85
448 3300050510 nmdc:mga06r32_53958_c1 nmdc:mga06r32_53958_c1_2678_2938 85
449 3300050511 nmdc:mga08y16_14338_c1 nmdc:mga08y16_14338_c1_1653_1913 85
450 3300050511 nmdc:mga08y16_2037200_c1 nmdc:mga08y16_2037200_c1_43_300 85
451 3300050512 nmdc:mga0n895_546066_c1 nmdc:mga0n895_546066_c1_195_455 85
452 3300050512 nmdc:mga0n895_782032_c1 nmdc:mga0n895_782032_c1_629_889 85
453 3300050514 nmdc:mga08x19_1293612_c1 nmdc:mga08x19_1293612_c1_236_496 85
454 3300050514 nmdc:mga08x19_810544_c1 nmdc:mga08x19_810544_c1_127_384 85
455 3300050515 nmdc:mga0a205_263238_c1 nmdc:mga0a205_263238_c1_687_947 85
456 3300050515 nmdc:mga0a205_474934_c1 nmdc:mga0a205_474934_c1_404_664 85
457 3300053153 Ga0500616_0114013 Ga0500616_0114013_904_1164 85
458 3300053157 Ga0500624_042680 Ga0500624_042680_41_301 85
459 3300053161 Ga0500634_0097376 Ga0500634_0097376_304_564 85
460 3300054114 Ga0501084_0074473 Ga0501084_0074473_473_733 85
461 3300054114 Ga0501084_0365780 Ga0501084_0365780_277_534 85
462 3300059421 Ga0590071_147419 Ga0590071_147419_191_448 85
463 3300005327 Ga0070658_10061090 Ga0070658_100610904 86
464 3300005329 Ga0070683_100332912 Ga0070683_1003329123 86
465 3300005329 Ga0070683_102336919 Ga0070683_1023369191 86
466 3300005339 Ga0070660_100415098 Ga0070660_1004150983 86
467 3300005344 Ga0070661_100005387 Ga0070661_1000053877 86
468 3300005435 Ga0070714_100050959 Ga0070714_1000509593 86
469 3300005436 Ga0070713_101090290 Ga0070713_1010902901 86
470 3300005439 Ga0070711_101067854 Ga0070711_1010678541 86
471 3300005440 Ga0070705_100375867 Ga0070705_1003758672 86
472 3300005455 Ga0070663_102015109 Ga0070663_1020151091 86
473 3300005535 Ga0070684_100228194 Ga0070684_1002281942 86
474 3300005563 Ga0068855_100000872 Ga0068855_1000008728 86
475 3300005563 Ga0068855_100018642 Ga0068855_1000186426 86
476 3300005564 Ga0070664_100102401 Ga0070664_1001024015 86
477 3300005577 Ga0068857_100785092 Ga0068857_1007850922 86
478 3300005578 Ga0068854_100410490 Ga0068854_1004104902 86
479 3300005614 Ga0068856_101098719 Ga0068856_1010987191 86
480 3300005614 Ga0068856_101167549 Ga0068856_1011675492 86
481 3300005616 Ga0068852_100000015 Ga0068852_10000001569 86
482 3300005616 Ga0068852_101516901 Ga0068852_1015169012 86
483 3300005834 Ga0068851_10005020 Ga0068851_100050205 86
484 3300005937 Ga0081455_10982842 Ga0081455_109828422 86
485 3300009093 Ga0105240_10000181 Ga0105240_1000018160 86
486 3300009093 Ga0105240_10916213 Ga0105240_109162131 86
487 3300009093 Ga0105240_11717552 Ga0105240_117175521 86
488 3300009094 Ga0111539_12990888 Ga0111539_129908882 86
489 3300009101 Ga0105247_10112463 Ga0105247_101124632 86
490 3300009174 Ga0105241_10000076 Ga0105241_1000007658 86
491 3300009174 Ga0105241_10484211 Ga0105241_104842112 86
492 3300009174 Ga0105241_11473968 Ga0105241_114739682 86
493 3300009177 Ga0105248_11033458 Ga0105248_110334582 86
494 3300009545 Ga0105237_10583491 Ga0105237_105834912 86
495 3300009551 Ga0105238_10009668 Ga0105238_100096684 86
496 3300010375 Ga0105239_10204266 Ga0105239_102042663 86
497 3300010375 Ga0105239_11452286 Ga0105239_114522862 86
498 3300013100 Ga0157373_10066560 Ga0157373_100665603 86
499 3300013100 Ga0157373_10715598 Ga0157373_107155982 86
500 3300013102 Ga0157371_10046851 Ga0157371_100468513 86
501 3300013104 Ga0157370_10000196 Ga0157370_1000019658 86
502 3300013105 Ga0157369_10000241 Ga0157369_1000024166 86
503 3300013105 Ga0157369_10063405 Ga0157369_100634055 86
504 3300013105 Ga0157369_10143969 Ga0157369_101439694 86
505 3300013105 Ga0157369_10681824 Ga0157369_106818242 86
506 3300013296 Ga0157374_10011932 Ga0157374_100119323 86
507 3300013296 Ga0157374_10094415 Ga0157374_100944153 86
508 3300013296 Ga0157374_11653258 Ga0157374_116532581 86
509 3300013307 Ga0157372_10000197 Ga0157372_1000019759 86
510 3300013307 Ga0157372_10005898 Ga0157372_100058985 86
511 3300013308 Ga0157375_11737436 Ga0157375_117374361 86
512 3300014968 Ga0157379_10072593 Ga0157379_100725933 86
513 3300014969 Ga0157376_10010621 Ga0157376_100106215 86
514 3300014969 Ga0157376_12903748 Ga0157376_129037482 86
515 3300020069 Ga0197907_10371255 Ga0197907_103712552 86
516 3300020075 Ga0206349_1174937 Ga0206349_11749372 86
517 3300020076 Ga0206355_1316834 Ga0206355_13168342 86
518 3300020077 Ga0206351_10796194 Ga0206351_107961941 86
519 3300020078 Ga0206352_11254640 Ga0206352_112546403 86
520 3300020080 Ga0206350_11185957 Ga0206350_111859572 86
521 3300020081 Ga0206354_11484000 Ga0206354_114840002 86
522 3300022467 Ga0224712_10099893 Ga0224712_100998932 86
523 3300025321 Ga0207656_10019549 Ga0207656_100195493 86
524 3300025909 Ga0207705_10132720 Ga0207705_101327203 86
525 3300025911 Ga0207654_10000025 Ga0207654_1000002590 86
526 3300025911 Ga0207654_10000035 Ga0207654_1000003511 86
527 3300025911 Ga0207654_10636562 Ga0207654_106365622 86
528 3300025911 Ga0207654_11234484 Ga0207654_112344842 86
529 3300025913 Ga0207695_10000069 Ga0207695_10000069217 86
530 3300025915 Ga0207693_10638839 Ga0207693_106388391 86
531 3300025916 Ga0207663_11003777 Ga0207663_110037771 86
532 3300025920 Ga0207649_10323819 Ga0207649_103238193 86
533 3300025924 Ga0207694_10202911 Ga0207694_102029112 86
534 3300025929 Ga0207664_10287335 Ga0207664_102873353 86
535 3300025944 Ga0207661_11638208 Ga0207661_116382082 86
536 3300025945 Ga0207679_10292687 Ga0207679_102926871 86
537 3300025949 Ga0207667_10011113 Ga0207667_100111136 86
538 3300025949 Ga0207667_10238278 Ga0207667_102382783 86
539 3300025981 Ga0207640_10311147 Ga0207640_103111472 86
540 3300025981 Ga0207640_10737603 Ga0207640_107376032 86
541 3300026041 Ga0207639_10459529 Ga0207639_104595292 86
542 3300026067 Ga0207678_10927039 Ga0207678_109270392 86
543 3300026078 Ga0207702_10517983 Ga0207702_105179832 86
544 3300026116 Ga0207674_10150239 Ga0207674_101502393 86
545 3300026142 Ga0207698_10000006 Ga0207698_1000000659 86
546 3300026142 Ga0207698_10042739 Ga0207698_100427392 86
547 3300028800 Ga0265338_10003453 Ga0265338_100034535 86
548 3300028800 Ga0265338_10878674 Ga0265338_108786742 86
549 3300029957 Ga0265324_10200638 Ga0265324_102006382 86
550 3300031249 Ga0265339_10084308 Ga0265339_100843082 86
551 3300031249 Ga0265339_10450883 Ga0265339_104508832 86
552 3300031711 Ga0265314_10416167 Ga0265314_104161672 86
553 3300033541 Ga0316596_1055954 Ga0316596_10559542 86
554 3300035112 Ga0373932_0386017 Ga0373932_0386017_223_501 86
555 3300036401 Ga0373937_0905455 Ga0373937_0905455_388_651 86
556 3300036401 Ga0373937_1042337 Ga0373937_1042337_416_679 86
557 3300039450 Ga0436363_1402859 Ga0436363_1402859_340_603 86
558 3300044694 Ga0466963_0072801 Ga0466963_0072801_485_748 86
559 3300045976 Ga0466967_0000716 Ga0466967_0000716_8878_9141 86
560 3300046459 Ga0495629_0322261 Ga0495629_0322261_271_534 86
561 3300046462 Ga0495651_0808895 Ga0495651_0808895_162_425 86
562 3300046472 Ga0495580_0053212 Ga0495580_0053212_1491_1754 86
563 3300046472 Ga0495580_0741765 Ga0495580_0741765_284_547 86
564 3300046514 Ga0495618_0764145 Ga0495618_0764145_95_358 86
565 3300046531 Ga0495665_0498233 Ga0495665_0498233_209_472 86
566 3300046533 Ga0495640_0203276 Ga0495640_0203276_142_405 86
567 3300046642 Ga0495634_0339132 Ga0495634_0339132_441_704 86
568 3300046678 Ga0495599_0258323 Ga0495599_0258323_614_877 86
569 3300046689 Ga0495613_0013649 Ga0495613_0013649_75_338 86
570 3300046689 Ga0495613_0131731 Ga0495613_0131731_506_769 86
571 3300047317 Ga0495604_0232835 Ga0495604_0232835_468_731 86
572 3300047319 Ga0495674_0292484 Ga0495674_0292484_310_573 86
573 3300048088 Ga0495602_0157610 Ga0495602_0157610_589_852 86
574 3300048903 Ga0496100_0014533 Ga0496100_0014533_4155_4418 86
575 3300048904 Ga0496101_0005626 Ga0496101_0005626_2309_2572 86
576 3300048907 Ga0496104_0011960 Ga0496104_0011960_126_389 86
577 3300048907 Ga0496104_1292314 Ga0496104_1292314_62_325 86
578 3300048908 Ga0496105_0179639 Ga0496105_0179639_518_781 86
579 3300048910 Ga0496107_0078761 Ga0496107_0078761_65_328 86
580 3300048912 Ga0496109_0000023 Ga0496109_0000023_21905_22183 86
581 3300048913 Ga0496110_0051931 Ga0496110_0051931_101_364 86
582 3300048917 Ga0496114_0722210 Ga0496114_0722210_583_846 86
583 3300048918 Ga0496115_0053576 Ga0496115_0053576_392_655 86
584 3300021388 Ga0213875_10053554 Ga0213875_100535541 87
585 3300025949 Ga0207667_11441625 Ga0207667_114416252 87
586 3300028558 Ga0265326_10041653 Ga0265326_100416532 87
587 3300028558 Ga0265326_10239133 Ga0265326_102391331 87
588 3300028800 Ga0265338_10011065 Ga0265338_100110653 87
589 3300028800 Ga0265338_10042888 Ga0265338_100428886 87
590 3300028800 Ga0265338_10100984 Ga0265338_101009843 87
591 3300028800 Ga0265338_10366481 Ga0265338_103664812 87
592 3300031711 Ga0265314_10023669 Ga0265314_100236692 87
593 3300036401 Ga0373937_1158296 Ga0373937_1158296_318_584 87
594 3300037853 Ga0436364_0755656 Ga0436364_0755656_7915_8187 87
595 3300039437 Ga0436365_0142396 Ga0436365_0142396_857_1123 87
596 3300039437 Ga0436365_0257100 Ga0436365_0257100_180_446 87
597 3300039453 Ga0436362_1204042 Ga0436362_1204042_683_949 87
598 3300041505 Ga0451849_0242008 Ga0451849_0242008_219_482 87
599 3300041512 Ga0451853_1096528 Ga0451853_1096528_193_465 87
600 3300045049 Ga0466959_0913084 Ga0466959_0913084_89_361 87
601 3300048918 Ga0496115_0252433 Ga0496115_0252433_1071_1337 87
602 3300049581 Ga0501047_0732000 Ga0501047_0732000_69_341 87
603 3300053096 Ga0500641_0070968 Ga0500641_0070968_1134_1421 87
604 3300053103 Ga0500555_004963 Ga0500555_004963_2364_2651 87
605 3300053108 Ga0500562_019709 Ga0500562_019709_291_578 87
606 3300021377 Ga0213874_10109898 Ga0213874_101098982 88
607 3300028800 Ga0265338_10007366 Ga0265338_100073664 88
608 3300028800 Ga0265338_10701813 Ga0265338_107018132 88
609 3300031995 Ga0307409_100593712 Ga0307409_1005937121 88
610 3300032002 Ga0307416_100925299 Ga0307416_1009252992 88
611 3300033541 Ga0316596_1042366 Ga0316596_10423662 88
612 3300039437 Ga0436365_0429969 Ga0436365_0429969_262_531 88
613 3300039450 Ga0436363_0344193 Ga0436363_0344193_667_936 88
614 3300044684 Ga0466966_0872174 Ga0466966_0872174_207_518 88
615 3300044693 Ga0466961_0057455 Ga0466961_0057455_1954_2265 88
616 3300044735 Ga0466968_0010626 Ga0466968_0010626_1824_2135 88
617 3300045049 Ga0466959_0129678 Ga0466959_0129678_205_516 88
618 3300048919 Ga0496116_0321293 Ga0496116_0321293_360_671 88
619 3300048925 Ga0496122_0007634 Ga0496122_0007634_2306_2617 88
620 3300049570 Ga0501033_0128466 Ga0501033_0128466_1404_1673 88
621 3300049589 Ga0501073_0321404 Ga0501073_0321404_671_937 88
622 3300053153 Ga0500616_0238181 Ga0500616_0238181_61_327 88
623 3300059426 Ga0590077_161701 Ga0590077_161701_169_459 88
624 3300059640 Ga0587067_063942 Ga0587067_063942_402_716 88
625 3300060353 Ga0501082_0000993 Ga0501082_0000993_1813_2079 88
626 3300061719 Ga0466962_0051036 Ga0466962_0051036_798_1109 88
627 iso_pu_bacteria 2585428059 2587740447 88
628 iso_pu_bacteria 2643221676 2644426655 88
629 iso_pu_bacteria 2818991459 2819672880 88
630 iso_pu_bacteria 2857453340 2857456610 88
631 iso_pu_bacteria 2904755435 2904756243 88
632 iso_pu_bacteria 2919425241 2919432086 88
633 iso_pu_bacteria 2971410472 2971414083 88
634 iso_pu_bacteria 2980182181 2980185166 88
635 iso_pu_bacteria 8056533031 8056539162 88
636 3300003693 Ga0032354_1014035 Ga0032354_10140352 89
637 3300031731 Ga0307405_11680257 Ga0307405_116802571 89
638 3300049592 Ga0501076_0358010 Ga0501076_0358010_720_989 89
639 3300053102 Ga0500554_150671 Ga0500554_150671_382_675 89
640 3300053129 Ga0500628_000289 Ga0500628_000289_3117_3410 89
641 3300005445 Ga0070708_101007379 Ga0070708_1010073792 90
642 3300005468 Ga0070707_100157444 Ga0070707_1001574442 90
643 3300005544 Ga0070686_100223163 Ga0070686_1002231633 90
644 3300005546 Ga0070696_101822468 Ga0070696_1018224681 90
645 3300005549 Ga0070704_100122034 Ga0070704_1001220343 90
646 3300006852 Ga0075433_10983799 Ga0075433_109837992 90
647 3300007076 Ga0075435_100321182 Ga0075435_1003211823 90
648 3300013307 Ga0157372_10257589 Ga0157372_102575893 90
649 3300020081 Ga0206354_10521497 Ga0206354_105214971 90
650 3300021384 Ga0213876_10394154 Ga0213876_103941542 90
651 3300025885 Ga0207653_10261502 Ga0207653_102615021 90
652 3300025905 Ga0207685_10205860 Ga0207685_102058601 90
653 3300025922 Ga0207646_10108845 Ga0207646_101088452 90
654 3300028380 Ga0268265_11597889 Ga0268265_115978892 90
655 3300031548 Ga0307408_100291031 Ga0307408_1002910312 90
656 3300031665 Ga0316575_10089796 Ga0316575_100897962 90
657 3300031731 Ga0307405_10681859 Ga0307405_106818592 90
658 3300031824 Ga0307413_10722126 Ga0307413_107221262 90
659 3300031852 Ga0307410_10163591 Ga0307410_101635912 90
660 3300031903 Ga0307407_10335844 Ga0307407_103358442 90
661 3300032005 Ga0307411_11024632 Ga0307411_110246322 90
662 3300037853 Ga0436364_0661109 Ga0436364_0661109_108_380 90
663 3300039437 Ga0436365_0760636 Ga0436365_0760636_458_730 90
664 3300039437 Ga0436365_1153303 Ga0436365_1153303_1496_1768 90
665 3300039437 Ga0436365_1303455 Ga0436365_1303455_309_581 90
666 3300045051 Ga0451576_1074070 Ga0451576_1074070_122_397 90
667 3300049569 Ga0501032_1067427 Ga0501032_1067427_210_488 90
668 3300049570 Ga0501033_0230338 Ga0501033_0230338_351_629 90
669 3300049573 Ga0501037_0259210 Ga0501037_0259210_865_1143 90
670 3300049579 Ga0501043_0215283 Ga0501043_0215283_695_973 90
671 3300049581 Ga0501047_0135035 Ga0501047_0135035_1721_1999 90
672 3300049584 Ga0501068_0232786 Ga0501068_0232786_96_374 90
673 3300049586 Ga0501070_0449226 Ga0501070_0449226_346_624 90
674 3300049589 Ga0501073_0011356 Ga0501073_0011356_758_1036 90
675 3300049590 Ga0501074_0656757 Ga0501074_0656757_306_584 90
676 3300049742 Ga0501080_0050487 Ga0501080_0050487_1300_1578 90
677 3300049744 Ga0501083_0024181 Ga0501083_0024181_1355_1633 90
678 3300049823 Ga0501044_0056277 Ga0501044_0056277_1441_1719 90
679 3300049823 Ga0501044_1054123 Ga0501044_1054123_23_301 90
680 3300050513 nmdc:mga0rr50_643995_c1 nmdc:mga0rr50_643995_c1_339_614 90
681 3300054114 Ga0501084_0615504 Ga0501084_0615504_385_663 90
682 3300060353 Ga0501082_0507394 Ga0501082_0507394_572_850 90
683 3300005330 Ga0070690_100324858 Ga0070690_1003248582 91
684 3300006847 Ga0075431_100639006 Ga0075431_1006390062 91
685 3300013308 Ga0157375_12277894 Ga0157375_122778942 91
686 3300021377 Ga0213874_10384451 Ga0213874_103844512 91
687 3300031548 Ga0307408_100799984 Ga0307408_1007999842 91
688 3300031548 Ga0307408_101523386 Ga0307408_1015233862 91
689 3300031852 Ga0307410_11380741 Ga0307410_113807412 91
690 3300031911 Ga0307412_11889713 Ga0307412_118897132 91
691 3300031995 Ga0307409_102395469 Ga0307409_1023954692 91
692 3300032002 Ga0307416_101703994 Ga0307416_1017039942 91
693 3300032126 Ga0307415_101610594 Ga0307415_1016105942 91
694 3300033541 Ga0316596_1232317 Ga0316596_12323172 91
695 3300039450 Ga0436363_0995645 Ga0436363_0995645_209_508 91
696 3300042004 Ga0439445_0249593 Ga0439445_0249593_25_300 91
697 3300042435 Ga0439434_0304473 Ga0439434_0304473_97_372 91
698 3300044693 Ga0466961_0001485 Ga0466961_0001485_8000_8302 91
699 3300045051 Ga0451576_1020422 Ga0451576_1020422_274_558 91
700 3300046522 Ga0495643_0000286 Ga0495643_0000286_14924_15223 91
701 3300049568 Ga0501031_0233950 Ga0501031_0233950_893_1168 91
702 3300049569 Ga0501032_0001422 Ga0501032_0001422_4456_4731 91
703 3300049570 Ga0501033_0005041 Ga0501033_0005041_6000_6275 91
704 3300049571 Ga0501034_0057268 Ga0501034_0057268_1526_1801 91
705 3300049572 Ga0501036_0085234 Ga0501036_0085234_2117_2392 91
706 3300049573 Ga0501037_0008897 Ga0501037_0008897_4455_4730 91
707 3300049574 Ga0501038_0104377 Ga0501038_0104377_1857_2132 91
708 3300049575 Ga0501039_0004832 Ga0501039_0004832_146_421 91
709 3300049579 Ga0501043_0002349 Ga0501043_0002349_8783_9058 91
710 3300049580 Ga0501046_0001586 Ga0501046_0001586_1647_1922 91
711 3300049581 Ga0501047_0017656 Ga0501047_0017656_5864_6139 91
712 3300049582 Ga0501048_0119263 Ga0501048_0119263_308_583 91
713 3300049583 Ga0501067_0024472 Ga0501067_0024472_2198_2473 91
714 3300049585 Ga0501069_0000190 Ga0501069_0000190_7815_8090 91
715 3300049586 Ga0501070_0001037 Ga0501070_0001037_8516_8791 91
716 3300049588 Ga0501072_0392382 Ga0501072_0392382_10_285 91
717 3300049589 Ga0501073_0003174 Ga0501073_0003174_3647_3922 91
718 3300049590 Ga0501074_0037087 Ga0501074_0037087_274_549 91
719 3300049741 Ga0501079_0171794 Ga0501079_0171794_1354_1629 91
720 3300049742 Ga0501080_0001815 Ga0501080_0001815_13091_13366 91
721 3300049744 Ga0501083_0011803 Ga0501083_0011803_1593_1868 91
722 3300049822 Ga0501035_0021710 Ga0501035_0021710_1661_1936 91
723 3300049823 Ga0501044_0004911 Ga0501044_0004911_8352_8627 91
724 3300050510 nmdc:mga06r32_572598_c1 nmdc:mga06r32_572598_c1_660_935 91
725 3300054114 Ga0501084_0043078 Ga0501084_0043078_3329_3604 91
726 3300059424 Ga0590075_045809 Ga0590075_045809_248_523 91
727 3300060353 Ga0501082_0002008 Ga0501082_0002008_12618_12893 91
728 3300003215 JGI25153J46596_10001505 JGI25153J46596_1000150510 92
729 3300003794 Ga0055531_10021622 Ga0055531_100216222 92
730 3300005355 Ga0070671_100090147 Ga0070671_1000901473 92
731 3300005365 Ga0070688_101527846 Ga0070688_1015278462 92
732 3300005367 Ga0070667_101165405 Ga0070667_1011654051 92
733 3300005539 Ga0068853_102492998 Ga0068853_1024929981 92
734 3300005548 Ga0070665_100865750 Ga0070665_1008657502 92
735 3300005578 Ga0068854_100766745 Ga0068854_1007667452 92
736 3300005617 Ga0068859_100825558 Ga0068859_1008255581 92
737 3300005719 Ga0068861_100694630 Ga0068861_1006946301 92
738 3300005843 Ga0068860_102281767 Ga0068860_1022817671 92
739 3300005844 Ga0068862_100011360 Ga0068862_1000113602 92
740 3300005937 Ga0081455_10201084 Ga0081455_102010842 92
741 3300005983 Ga0081540_1212760 Ga0081540_12127602 92
742 3300005985 Ga0081539_10065440 Ga0081539_100654402 92
743 3300006931 Ga0097620_100825400 Ga0097620_1008254003 92
744 3300009011 Ga0105251_10440078 Ga0105251_104400782 92
745 3300009177 Ga0105248_11103110 Ga0105248_111031101 92
746 3300009551 Ga0105238_12120466 Ga0105238_121204662 92
747 3300010375 Ga0105239_12152431 Ga0105239_121524311 92
748 3300013100 Ga0157373_11256781 Ga0157373_112567811 92
749 3300025297 Ga0209758_1000060 Ga0209758_1000060262 92
750 3300025298 Ga0209050_1003616 Ga0209050_100361610 92
751 3300025303 Ga0209051_1068666 Ga0209051_10686662 92
752 3300025304 Ga0209257_1000589 Ga0209257_100058948 92
753 3300025931 Ga0207644_10028764 Ga0207644_100287643 92
754 3300025941 Ga0207711_10571149 Ga0207711_105711492 92
755 3300025986 Ga0207658_10939172 Ga0207658_109391722 92
756 3300026116 Ga0207674_10883178 Ga0207674_108831782 92
757 3300026118 Ga0207675_100685028 Ga0207675_1006850282 92
758 3300026142 Ga0207698_11230778 Ga0207698_112307781 92
759 3300028380 Ga0268265_10006082 Ga0268265_100060826 92
760 3300028381 Ga0268264_10851745 Ga0268264_108517451 92
761 3300028786 Ga0307517_10572697 Ga0307517_105726971 92
762 3300030522 Ga0307512_10087049 Ga0307512_100870494 92
763 3300031616 Ga0307508_10320450 Ga0307508_103204502 92
764 3300031730 Ga0307516_10078566 Ga0307516_100785662 92
765 3300031730 Ga0307516_10505428 Ga0307516_105054281 92
766 3300041461 Ga0451805_051563 Ga0451805_051563_427_705 92
767 3300042438 Ga0439459_0057414 Ga0439459_0057414_572_850 92
768 3300046507 Ga0495606_0589319 Ga0495606_0589319_214_492 92
769 3300046616 Ga0495668_0382538 Ga0495668_0382538_384_662 92
770 3300046660 Ga0495625_0252534 Ga0495625_0252534_562_840 92
771 3300046694 Ga0495649_0431163 Ga0495649_0431163_196_474 92
772 3300049460 Ga0495682_0337860 Ga0495682_0337860_82_360 92
773 3300049569 Ga0501032_0641078 Ga0501032_0641078_368_646 92
774 3300049570 Ga0501033_0148183 Ga0501033_0148183_627_905 92
775 3300049571 Ga0501034_0529974 Ga0501034_0529974_44_322 92
776 3300049572 Ga0501036_0622444 Ga0501036_0622444_431_709 92
777 3300049573 Ga0501037_0218500 Ga0501037_0218500_252_530 92
778 3300049574 Ga0501038_0314079 Ga0501038_0314079_37_315 92
779 3300049575 Ga0501039_0590998 Ga0501039_0590998_330_608 92
780 3300049580 Ga0501046_0195515 Ga0501046_0195515_557_835 92
781 3300049581 Ga0501047_0023291 Ga0501047_0023291_930_1208 92
782 3300049583 Ga0501067_0405423 Ga0501067_0405423_365_643 92
783 3300049584 Ga0501068_0026472 Ga0501068_0026472_2149_2427 92
784 3300049584 Ga0501068_0585048 Ga0501068_0585048_420_698 92
785 3300049585 Ga0501069_0057232 Ga0501069_0057232_1479_1757 92
786 3300049586 Ga0501070_0184654 Ga0501070_0184654_939_1217 92
787 3300049587 Ga0501071_0699848 Ga0501071_0699848_188_466 92
788 3300049588 Ga0501072_0368721 Ga0501072_0368721_341_619 92
789 3300049589 Ga0501073_0077405 Ga0501073_0077405_874_1152 92
790 3300049590 Ga0501074_0560633 Ga0501074_0560633_46_324 92
791 3300049741 Ga0501079_1174696 Ga0501079_1174696_177_455 92
792 3300049742 Ga0501080_0067793 Ga0501080_0067793_202_480 92
793 3300049742 Ga0501080_0095799 Ga0501080_0095799_2328_2606 92
794 3300049744 Ga0501083_0069065 Ga0501083_0069065_2008_2286 92
795 3300049822 Ga0501035_0538856 Ga0501035_0538856_591_869 92
796 3300049823 Ga0501044_0014858 Ga0501044_0014858_851_1129 92
797 3300049823 Ga0501044_0071661 Ga0501044_0071661_979_1257 92
798 3300053086 Ga0500578_0346513 Ga0500578_0346513_449_727 92
799 3300053088 Ga0500644_0026438 Ga0500644_0026438_1195_1473 92
800 3300053090 Ga0500646_0030665 Ga0500646_0030665_668_946 92
801 3300053098 Ga0500650_0026482 Ga0500650_0026482_159_437 92
802 3300053108 Ga0500562_137602 Ga0500562_137602_344_622 92
803 3300053109 Ga0500569_058510 Ga0500569_058510_164_442 92
804 3300053116 Ga0500592_006310 Ga0500592_006310_1474_1752 92
805 3300053118 Ga0500594_0028275 Ga0500594_0028275_346_624 92
806 3300053130 Ga0500642_0203549 Ga0500642_0203549_33_311 92
807 3300053130 Ga0500642_0226575 Ga0500642_0226575_492_770 92
808 3300053131 Ga0500652_109312 Ga0500652_109312_716_994 92
809 3300053134 Ga0500658_0508971 Ga0500658_0508971_245_523 92
810 3300053137 Ga0500561_0232084 Ga0500561_0232084_271_549 92
811 3300053146 Ga0500588_0039414 Ga0500588_0039414_1035_1313 92
812 3300053146 Ga0500588_0210417 Ga0500588_0210417_271_549 92
813 3300053160 Ga0500633_0254390 Ga0500633_0254390_168_446 92
814 3300053727 Ga0500611_227728 Ga0500611_227728_20_298 92
815 3300053731 Ga0500609_000322 Ga0500609_000322_703_981 92
816 3300053732 Ga0500656_050547 Ga0500656_050547_307_585 92
817 3300054114 Ga0501084_0596286 Ga0501084_0596286_23_301 92
818 3300059506 Ga0587085_053028 Ga0587085_053028_368_652 92
819 3300059507 Ga0587086_062123 Ga0587086_062123_38_316 92
820 3300059658 Ga0587119_039652 Ga0587119_039652_355_639 92
821 3300060346 Ga0587111_0232838 Ga0587111_0232838_112_390 92
822 3300060353 Ga0501082_0360254 Ga0501082_0360254_399_677 92
823 3300060353 Ga0501082_1311700 Ga0501082_1311700_67_345 92
824 2010549000 RicEn_FSXC49637_b1 RicEn_443990 93
825 3300009093 Ga0105240_11446537 Ga0105240_114465372 93
826 3300013100 Ga0157373_11075886 Ga0157373_110758862 93
827 3300013105 Ga0157369_10451149 Ga0157369_104511491 93
828 3300020070 Ga0206356_10144882 Ga0206356_101448821 93
829 3300025913 Ga0207695_11152662 Ga0207695_111526621 93
830 3300025914 Ga0207671_10123572 Ga0207671_101235723 93
831 3300026041 Ga0207639_11950938 Ga0207639_119509381 93
832 3300026095 Ga0207676_12203674 Ga0207676_122036741 93
833 3300031456 Ga0307513_10097010 Ga0307513_100970103 93
834 3300031456 Ga0307513_10169064 Ga0307513_101690642 93
835 3300031456 Ga0307513_10213773 Ga0307513_102137731 93
836 3300031456 Ga0307513_10871811 Ga0307513_108718112 93
837 3300031507 Ga0307509_10624940 Ga0307509_106249401 93
838 3300031616 Ga0307508_10476913 Ga0307508_104769132 93
839 3300033180 Ga0307510_10554259 Ga0307510_105542592 93
840 3300041452 Ga0451793_0596990 Ga0451793_0596990_376_660 93
841 3300041503 Ga0451847_0573443 Ga0451847_0573443_90_371 93
842 3300041512 Ga0451853_1978603 Ga0451853_1978603_176_460 93
843 3300045051 Ga0451576_1441934 Ga0451576_1441934_219_500 93
844 3300046452 Ga0495617_236732 Ga0495617_236732_137_418 93
845 3300046460 Ga0495638_0068933 Ga0495638_0068933_1058_1339 93
846 3300046460 Ga0495638_0281712 Ga0495638_0281712_170_451 93
847 3300046513 Ga0495616_0097836 Ga0495616_0097836_706_987 93
848 3300046648 Ga0495611_0218573 Ga0495611_0218573_169_453 93
849 3300046660 Ga0495625_0640658 Ga0495625_0640658_314_595 93
850 3300049584 Ga0501068_0015914 Ga0501068_0015914_3770_4051 93
851 3300049589 Ga0501073_0265944 Ga0501073_0265944_129_410 93
852 3300049742 Ga0501080_0212433 Ga0501080_0212433_925_1206 93
853 3300049823 Ga0501044_0590552 Ga0501044_0590552_570_851 93
854 3300053086 Ga0500578_0724073 Ga0500578_0724073_70_357 93
855 3300053090 Ga0500646_0084229 Ga0500646_0084229_571_852 93
856 3300053096 Ga0500641_0001835 Ga0500641_0001835_4519_4812 93
857 3300053103 Ga0500555_001003 Ga0500555_001003_239_523 93
858 3300053104 Ga0500556_0066361 Ga0500556_0066361_359_655 93
859 3300053105 Ga0500557_105121 Ga0500557_105121_136_420 93
860 3300053119 Ga0500595_000854 Ga0500595_000854_10736_11020 93
861 3300053123 Ga0500614_018705 Ga0500614_018705_447_728 93
862 3300053126 Ga0500621_235392 Ga0500621_235392_20_301 93
863 3300053130 Ga0500642_0134168 Ga0500642_0134168_819_1100 93
864 3300053134 Ga0500658_0010908 Ga0500658_0010908_2863_3144 93
865 3300053139 Ga0500568_0053865 Ga0500568_0053865_803_1084 93
866 3300053142 Ga0500577_0266024 Ga0500577_0266024_232_528 93
867 3300053146 Ga0500588_0012131 Ga0500588_0012131_1145_1441 93
868 3300053153 Ga0500616_0001666 Ga0500616_0001666_17018_17299 93
869 3300053156 Ga0500622_0272661 Ga0500622_0272661_20_316 93
870 3300053158 Ga0500627_0394321 Ga0500627_0394321_237_530 93
871 3300053731 Ga0500609_012306 Ga0500609_012306_858_1139 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9601 20 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9462 20 85
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9362 19 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9255 19 84
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9109 19 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9601 20 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9462 20 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9114 29 83 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8953 29 83 2.40.50.100
af_Q9VKJ4_10_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8844 31 81 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9713 20 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A660TPI7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9576 19 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.957 20 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A351YBM2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9531 21 87 GO:0003735
GO:0006412
GO:0022625
AF-A0A351YBM2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9395 21 87 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
80.9 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map