F497340

General Info

Members Datasets Scaffolds Average Seq Length
3560 1470 2737 388

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100002708|Ga0070704_1000027088
Length 425
Sequence MPPGYFSNLFYGLSKASLAVALGSAYIPCISHTGAFMTACIVGLAHTPFGKLDTESVESLIIRVTKEALADAGIEAADVDEIVLGHFNAGFSAQDFTAALVLQADPAFRFKPATRVENACATGSAAVHQGIKAIVSKSARIVLVVGVEQMTTTPSAEIGKNLLKASYLPEDGSIEGGFAGVFGKIAGLYFQRYGDQSDALAKIAAKNHKNGVGNPYAQMRKDFGYEFCRTESEKNPRVAGPLKRTDCSLVSDGAAAIVLTDVETAMKLDKPAIAFRGIAHAQDFLPMSKRDILKFEGCSEAWGRALKQAGIDLYDLSFVETHDCFTVAELIEYEAMGLAKPGQGARVIHDGIVEKTGKLPVNPSGGLKAKGHPIGATGVSMHALTTMQLRGEAGDMQIKDARLGGIFNMGGAAVANYVSILERLR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
4 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
5 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
6 2508501050 Microvirga lupini Lut6 Isolate Nodule
7 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
8 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
9 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
10 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
11 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
12 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
13 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
14 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
17 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
18 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
19 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
22 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
23 2512875024 Mesorhizobium loti R88b Isolate Nodule
24 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
25 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
26 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
27 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
28 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
29 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
30 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
31 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
32 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
33 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
34 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
35 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
36 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
37 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
38 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
39 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
40 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
41 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
42 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
43 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
44 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
45 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
47 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
48 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
49 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
50 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
51 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
52 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
53 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
54 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
55 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
56 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
57 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
58 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
59 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
60 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
61 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
62 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
63 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
64 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
65 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
66 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
67 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
68 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
69 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
70 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
71 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
72 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
73 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
74 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
75 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
76 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
77 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
78 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
79 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
80 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
81 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
82 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
83 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
84 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
85 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
86 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
87 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
88 2643221558 Rhizobium sp. Root149 Isolate Unclassified
89 2643221561 Nocardioides sp. Root151 Isolate Unclassified
90 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
91 2643221570 Acidovorax sp. Root568 Isolate Unclassified
92 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
93 2643221596 Acidovorax sp. Root70 Isolate Unclassified
94 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
95 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
96 2643221651 Afipia sp. Root123D2 Isolate Unclassified
97 2643221652 Acidovorax sp. Root402 Isolate Unclassified
98 2643221658 Variovorax sp. Root411 Isolate Unclassified
99 2643221693 Rhizobium sp. Root491 Isolate Unclassified
100 2643221696 Nocardioides sp. Root140 Isolate Unclassified
101 2643221733 Bosea sp. Root381 Isolate Unclassified
102 2643221734 Bosea sp. Root670 Isolate Unclassified
103 2643221736 Bosea sp. Root483D1 Isolate Unclassified
104 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
105 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
106 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
107 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
108 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
109 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
110 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
111 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
112 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
113 2738543024 Aminobacter sp. AP02 Isolate Unclassified
114 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
115 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
116 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
117 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
118 2773857925 Microvirga vignae BR3299 Isolate Unclassified
119 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
120 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
121 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
122 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
123 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
124 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
125 2791355199
126 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
127 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
128 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
129 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
130 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
131 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
132 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
133 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
134 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
135 2818991467 Bosea vestrisii 3192 Isolate Unclassified
136 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
137 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
138 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
139 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
140 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
141 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
142 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
143 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
144 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
145 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
146 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
147 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
148 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
149 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
150 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
151 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
152 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
153 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
154 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
155 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
156 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
157 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
158 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
159 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
160 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
161 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
162 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
163 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
164 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
165 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
166 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
167 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
168 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
169 2841760612 Bosea sp. Tri-49 Isolate Nodule
170 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
171 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
172 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
173 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
174 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
175 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
176 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
177 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
178 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
179 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
180 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
181 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
182 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
183 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
184 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
185 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
186 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
187 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
188 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
189 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
190 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
191 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
192 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
193 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
194 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
195 2844104063 Bosea sp. Tri-39 Isolate Nodule
196 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
197 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
198 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
199 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
200 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
201 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
202 2851182111 Bosea sp. Tri-44 Isolate Nodule
203 2851246043 Bosea sp. Tri-54 Isolate Nodule
204 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
205 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
206 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
207 2855730933 Achromobacter sp. HZ28 Isolate Nodule
208 2855767633 Achromobacter sp. HZ34 Isolate Nodule
209 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
210 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
211 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
212 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
213 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
214 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
215 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
216 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
217 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
218 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
219 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
220 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
221 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
222 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
223 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
224 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
225 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
226 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
227 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
228 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
229 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
230 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
231 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
232 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
233 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
234 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
235 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
236 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
237 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
238 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
239 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
240 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
241 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
242 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
243 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
244 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
245 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
246 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
247 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
248 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
249 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
250 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
251 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
252 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
253 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
254 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
255 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
256 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
257 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
258 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
259 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
260 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
261 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
262 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
263 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
264 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
265 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
266 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
267 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
268 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
269 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
270 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
271 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
272 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
273 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
274 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
275 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
276 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
277 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
278 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
279 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
280 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
281 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
282 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
283 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
284 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
285 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
286 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
287 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
288 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
289 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
290 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
291 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
292 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
293 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
294 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
295 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
296 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
297 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
298 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
299 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
300 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
301 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
302 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
303 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
304 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
305 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
306 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
307 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
308 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
309 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
310 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
311 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
312 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
313 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
314 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
315 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
316 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
317 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
318 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
319 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
320 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
321 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
322 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
323 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
324 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
325 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
326 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
327 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
328 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
329 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
330 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
331 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
332 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
333 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
334 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
335 2902330777 Methylobacterium sp. 2A Isolate Unclassified
336 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
337 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
338 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
339 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
340 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
341 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
342 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
343 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
344 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
345 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
346 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
347 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
348 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
349 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
350 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
351 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
352 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
353 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
354 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
355 2904699407
356 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
357 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
358 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
359 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
360 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
361 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
362 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
363 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
364 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
365 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
366 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
367 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
368 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
369 2906610324
370 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
371 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
372 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
373 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
374 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
375 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
376 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
377 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
378 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
379 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
380 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
381 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
382 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
383 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
384 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
385 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
386 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
387 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
388 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
389 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
390 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
391 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
392 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
393 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
394 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
395 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
396 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
397 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
398 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
399 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
400 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
401 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
402 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
403 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
404 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
405 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
406 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
407 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
408 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
409 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
410 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
411 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
412 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
413 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
414 2922368715
415 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
416 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
417 2922425934
418 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
419 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
420 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
421 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
422 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
423 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
424 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
425 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
426 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
427 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
428 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
429 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
430 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
431 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
432 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
433 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
434 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
435 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
436 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
437 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
438 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
439 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
440 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
441 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
442 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
443 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
444 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
445 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
446 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
447 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
448 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
449 2929520902 Variovorax beijingensis 502 Isolate Unclassified
450 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
451 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
452 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
453 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
454 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
455 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
456 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
457 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
458 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
459 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
460 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
461 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
462 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
463 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
464 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
465 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
466 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
467 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
468 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
469 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
470 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
471 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
472 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
473 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
474 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
475 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
476 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
477 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
478 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
479 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
480 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
481 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
482 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
483 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
484 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
485 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
486 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
487 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
488 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
489 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
490 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
491 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
492 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
493 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
494 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
495 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
496 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
497 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
498 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
499 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
500 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
501 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
502 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
503 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
504 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
505 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
506 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
507 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
508 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
509 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
510 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
511 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
512 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
513 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
514 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
515 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
516 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
517 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
518 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
519 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
520 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
521 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
522 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
523 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
524 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
525 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
526 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
527 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
528 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
529 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
530 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
531 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
532 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
533 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
534 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
535 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
536 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
537 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
538 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
539 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
540 2941479691
541 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
542 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
543 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
544 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
545 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
546 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
547 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
548 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
549 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
550 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
551 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
552 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
553 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
554 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
555 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
556 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
557 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
558 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
559 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
560 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
561 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
562 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
563 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
564 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
565 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
566 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
567 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
568 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
569 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
570 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
571 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
572 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
573 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
574 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
575 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
576 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
577 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
578 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
579 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
580 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
581 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
582 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
583 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
584 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
585 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
586 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
587 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
588 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
589 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
590 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
591 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
592 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
593 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
594 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
595 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
596 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
597 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
598 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
599 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
600 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
601 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
602 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
603 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
604 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
605 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
606 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
607 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
608 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
609 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
610 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
611 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
612 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
613 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
614 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
615 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
616 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
617 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
618 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
619 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
620 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
621 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
622 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
623 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
624 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
625 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
626 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
627 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
628 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
629 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
630 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
631 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
632 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
633 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
634 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
635 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
636 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
637 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
638 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
639 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
640 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
641 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
642 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
643 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
644 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
645 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
646 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
647 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
648 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
649 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
650 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
651 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
652 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
653 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
654 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
655 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
656 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
657 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
658 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
659 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
660 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
661 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
662 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
663 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
664 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
665 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
666 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
667 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
668 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
669 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
670 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
671 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
672 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
673 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
674 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
675 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
676 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
677 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
678 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
679 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
680 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
681 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
682 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
683 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
684 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
685 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
686 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
687 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
688 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
689 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
690 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
691 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
692 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
693 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
694 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
695 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
696 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
697 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
698 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
699 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
700 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
701 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
702 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
703 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
704 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
705 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
706 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
707 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
708 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
709 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
710 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
711 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
712 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
713 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
714 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
715 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
716 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
717 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
718 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
719 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
720 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
721 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
722 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
723 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
724 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
725 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
726 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
727 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
728 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
729 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
730 3004167301 Mesorhizobium loti 582 Isolate Unclassified
731 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
732 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
733 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
734 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
735 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
736 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
737 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
738 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
739 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
740 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
741 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
742 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
743 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
744 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
745 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
746 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
747 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
748 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
749 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
750 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
751 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
752 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
753 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
754 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
755 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
756 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
757 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
758 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
759 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
760 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
761 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
762 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
763 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
764 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
765 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
766 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
767 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
768 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
769 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
770 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
771 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
772 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
773 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
774 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
775 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
776 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
777 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
778 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
779 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
780 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
781 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
782 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
783 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
784 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
785 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
786 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
787 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
788 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
789 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
790 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
791 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
792 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
793 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
794 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
795 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
796 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
797 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
798 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
799 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
800 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
801 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
802 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
803 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
804 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
805 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
806 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
807 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
808 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
809 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
810 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
811 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
812 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
813 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
814 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
815 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
816 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
817 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
818 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
819 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
820 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
821 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
822 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
823 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
824 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
825 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
826 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
827 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
828 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
829 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
830 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
831 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
832 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
833 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
834 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
835 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
836 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
837 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
838 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
839 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
840 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
841 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
842 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
843 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
844 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
845 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
846 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
847 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
848 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
849 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
850 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
851 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
852 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
853 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
854 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
855 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
856 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
857 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
858 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
859 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
860 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
861 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
862 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
863 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
864 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
865 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
866 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
867 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
868 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
869 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
870 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
871 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
872 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
873 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
874 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
875 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
876 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
877 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
878 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
879 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
880 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
881 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
882 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
883 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
884 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
885 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
886 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
887 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
888 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
889 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
890 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
891 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
892 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
893 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
894 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
895 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
896 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
897 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
898 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
899 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
900 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
901 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
902 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
903 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
904 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
905 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
906 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
907 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
908 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
909 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
910 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
911 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
912 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
913 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
914 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
915 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
916 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
917 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
918 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
919 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
920 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
921 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
922 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
923 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
924 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
925 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
926 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
927 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
928 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
929 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
930 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
931 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
932 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
933 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
934 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
935 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
936 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
937 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
938 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
939 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
940 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
941 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
942 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
943 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
944 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
945 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
946 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
947 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
948 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
949 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
950 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
951 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
952 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
953 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
954 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
955 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
956 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
957 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
958 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
959 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
960 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
961 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
962 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
963 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
964 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
965 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
966 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
967 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
968 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
969 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
970 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
971 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
972 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
973 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
974 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
975 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
976 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
977 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
978 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
979 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
980 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
981 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
982 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
983 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
984 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
985 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
986 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
987 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
988 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
989 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
990 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
991 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
992 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
993 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
994 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
995 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
996 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
997 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
998 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
999 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1000 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1001 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1002 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1003 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1004 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1005 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1007 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1008 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1009 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1010 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1011 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1012 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1013 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1014 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1015 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1016 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1017 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1018 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1019 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1020 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1021 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1022 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1023 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1024 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1025 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1026 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1027 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1028 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1029 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1030 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1031 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1032 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1033 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1034 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1035 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1036 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1037 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1038 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1039 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1040 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1041 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1042 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1043 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1044 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1045 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1046 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1047 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1048 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1049 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1050 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1051 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1052 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1053 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1054 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1055 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1056 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1057 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
1058 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1059 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1060 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
1061 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1062 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1063 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1064 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
1065 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1066 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1067 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1068 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1069 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1070 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1071 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1072 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
1073 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
1074 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1075 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1076 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1077 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
1078 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1079 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1080 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1081 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1082 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1083 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1084 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1085 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1086 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1087 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1088 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1089 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1090 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1091 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1092 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1093 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1094 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1095 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1096 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1097 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1098 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1099 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1107 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
1112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1113 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1114 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
1115 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1118 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
1124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
1127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1163 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
1170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
1173 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
1174 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
1175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
1177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1178 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
1179 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
1180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
1226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1234 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1359 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1360 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1362 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1364 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
1365 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1366 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1367 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
1368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1369 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1370 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1371 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1372 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1373 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1374 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1375 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1377 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
1378 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1384 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1386 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1389 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1391 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1393 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
1394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1395 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1396 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1397 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1398 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1399 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1401 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1403 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1405 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1407 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1408 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1409 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1410 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1411 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1412 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1413 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1414 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
1415 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1416 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1417 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1418 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1419 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1420 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1421 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1422 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1423 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1424 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1425 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1426 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1427 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1428 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1429 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1430 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1431 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1432 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1433 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1434 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1435 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1436 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1437 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1438 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1439 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1440 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1441 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1442 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1443 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1444 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1445 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1446 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1447 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1448 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1449 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1450 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1451 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1452 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1453 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1454 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1455 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1456 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1457 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1458 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1459 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1460 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1461 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
1462 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1463 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1464 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
1465 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1466 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1467 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1468 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1469 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1470 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.85
Metatranscriptomes 0.17
Isolates 22.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 6.35
Nodule 17.56
Rhizoplane 5.48
Rhizosphere 61.18
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544919 2209111006 Bacteria 20284
2 ARcpr5oldR_c000002 3300000041 Bacteria 79314
3 ARSoilYngRDRAFT_c00003 3300000042 Bacteria 43678
4 ARcpr5yngRDRAFT_c000036 3300000043 Bacteria 21264
5 ARSoilOldRDRAFT_c000002 3300000044 Bacteria 66650
6 ARCol0oldRDRAFT_c00314 3300000045 Bacteria 4672
7 ARCol0yngRDRAFT_1000005 3300000652 Bacteria 47205
8 JGI24032J14994_100147 3300001430 Bacteria 3367
9 JGI24746J21847_1000131 3300001977 Bacteria 9137
10 JGI24739J22299_10007211 3300001989 Bacteria 4180
11 JGI24739J22299_10026188 3300001989 Bacteria 2048
12 JGI24737J22298_10003920 3300001990 Bacteria 5214
13 JGI24737J22298_10011733 3300001990 Bacteria 2866
14 JGI24750J21931_1000047 3300002070 Bacteria 16414
15 JGI24748J21848_1000620 3300002074 Bacteria 3809
16 JGI24748J21848_1004239 3300002074 Bacteria 1644
17 JGI24738J21930_10000265 3300002075 Bacteria 14234
18 JGI24749J21850_1002322 3300002076 Bacteria 2675
19 JGI24035J26624_1000154 3300002126 Bacteria 6182
20 JGI24034J26672_10000826 3300002239 Bacteria 4018
21 JGI24742J22300_10000044 3300002244 Bacteria 18297
22 JGI24742J22300_10001628 3300002244 Bacteria 3568
23 JGI24751J29686_10011524 3300002459 Bacteria 1823
24 JGI25156J39149_1002014 3300002705 Bacteria 7769
25 JGI25156J39149_1004416 3300002705 Bacteria 4285
26 JGI25157J39369_1001113 3300002741 Bacteria 11952
27 JGI25157J39369_1002073 3300002741 Bacteria 5718
28 JGI25159J45721_1003796 3300002987 Bacteria 5205
29 JGI25151J46595_10000036 3300003187 Bacteria 188770
30 JGI25151J46595_10000209 3300003187 Bacteria 71715
31 JGI25151J46595_10000244 3300003187 Bacteria 63724
32 JGI25151J46595_10004420 3300003187 Bacteria 7443
33 JGI25406J46586_10000093 3300003203 Bacteria 41100
34 JGI25406J46586_10000412 3300003203 Bacteria 19629
35 JGI25406J46586_10000504 3300003203 Bacteria 18270
36 JGI25406J46586_10000565 3300003203 Bacteria 17468
37 JGI25406J46586_10002895 3300003203 Bacteria 8093
38 JGI25165J46597_1000016 3300003214 Bacteria 377866
39 JGI25153J46596_10000462 3300003215 Bacteria 25965
40 JGI25153J46596_10000860 3300003215 Bacteria 18503
41 JGI25153J46596_10002078 3300003215 Bacteria 11772
42 JGI25153J46596_10005256 3300003215 Bacteria 6807
43 JGI25160J50197_1001585 3300003354 Bacteria 11209
44 JGI25160J50197_1005731 3300003354 Bacteria 5126
45 Ga0006562J51391_1082408 3300003578 Bacteria 2384
46 Ga0006562J51391_1082410 3300003578 Bacteria 1520
47 JGI25404J52841_10001115 3300003659 Bacteria 4531
48 JGI25404J52841_10005561 3300003659 Bacteria 2604
49 Ga0055539_1000125 3300003752 Bacteria 81835
50 Ga0055533_1000132 3300003756 Bacteria 81835
51 Ga0055532_1001641 3300003758 Bacteria 5866
52 Ga0055525_1000171 3300003759 Bacteria 81835
53 Ga0055529_1002195 3300003763 Bacteria 4034
54 Ga0055526_1000017 3300003771 Bacteria 210613
55 Ga0055526_1000391 3300003771 Bacteria 35449
56 Ga0055524_1000014 3300003775 Bacteria 259417
57 Ga0055524_1001064 3300003775 Bacteria 16909
58 Ga0055524_1028695 3300003775 Bacteria 1661
59 Ga0055536_1015634 3300003781 Bacteria 2583
60 Ga0055530_10000614 3300003791 Bacteria 30953
61 Ga0055530_10024263 3300003791 Bacteria 1724
62 Ga0055540_1000014 3300003792 Bacteria 234171
63 Ga0055540_1008590 3300003792 Bacteria 3661
64 Ga0055531_10007927 3300003794 Bacteria 5696
65 Ga0055531_10011219 3300003794 Bacteria 4352
66 Ga0055541_1000083 3300003841 Bacteria 81835
67 Ga0058692_1001859 3300003856 Bacteria 7413
68 JGI25405J52794_10001403 3300003911 Bacteria 3950
69 Ga0065165_1000048 3300005262 Bacteria 196539
70 Ga0065165_1000231 3300005262 Bacteria 97237
71 Ga0065165_1010260 3300005262 Bacteria 4074
72 Ga0065165_1014736 3300005262 Bacteria 3020
73 Ga0065165_1026652 3300005262 Bacteria 1898
74 Ga0065717_1002078 3300005276 Bacteria 3085
75 Ga0065704_10074116 3300005289 Bacteria 6514
76 Ga0065704_10101877 3300005289 Bacteria 2223
77 Ga0065712_10037077 3300005290 Bacteria 1279
78 Ga0065712_10081299 3300005290 Bacteria 3019
79 Ga0065712_10105846 3300005290 Bacteria 1930
80 Ga0065715_10000449 3300005293 Bacteria 15495
81 Ga0065715_10164600 3300005293 Bacteria 1598
82 Ga0070658_10033732 3300005327 Bacteria 4119
83 Ga0070676_10000308 3300005328 Bacteria 22069
84 Ga0070683_100004737 3300005329 Bacteria 11254
85 Ga0070683_100031574 3300005329 Bacteria 4818
86 Ga0070683_100054561 3300005329 Bacteria 3705
87 Ga0070683_100160548 3300005329 Bacteria 2133
88 Ga0070683_100166639 3300005329 Bacteria 2091
89 Ga0070683_100222817 3300005329 Bacteria 1792
90 Ga0070690_100002356 3300005330 Bacteria 10159
91 Ga0070690_100009282 3300005330 Bacteria 5693
92 Ga0070690_100134039 3300005330 Bacteria 1675
93 Ga0070670_100003132 3300005331 Bacteria 13685
94 Ga0070670_100003645 3300005331 Bacteria 12827
95 Ga0070670_100013025 3300005331 Bacteria 7124
96 Ga0070670_100054159 3300005331 Bacteria 3443
97 Ga0070670_100350918 3300005331 Bacteria 1296
98 Ga0070677_10000203 3300005333 Bacteria 20576
99 Ga0070677_10093224 3300005333 Bacteria 1314
100 Ga0068869_100000290 3300005334 Bacteria 26728
101 Ga0068869_100118106 3300005334 Bacteria 2025
102 Ga0068869_100178225 3300005334 Bacteria 1665
103 Ga0068869_100239011 3300005334 Bacteria 1446
104 Ga0070666_10033208 3300005335 Bacteria 3413
105 Ga0070666_10068460 3300005335 Bacteria 2412
106 Ga0070680_100006358 3300005336 Bacteria 8972
107 Ga0070680_100006548 3300005336 Bacteria 8859
108 Ga0070680_100007952 3300005336 Bacteria 8093
109 Ga0070680_100040562 3300005336 Bacteria 3770
110 Ga0070680_100096638 3300005336 Bacteria 2449
111 Ga0070680_100107144 3300005336 Bacteria 2324
112 Ga0070680_100135402 3300005336 Bacteria 2063
113 Ga0070680_100170904 3300005336 Bacteria 1829
114 Ga0070682_100000982 3300005337 Bacteria 16537
115 Ga0070682_100001061 3300005337 Bacteria 15845
116 Ga0070682_100038624 3300005337 Bacteria 2929
117 Ga0070682_100066366 3300005337 Bacteria 2295
118 Ga0068868_100000505 3300005338 Bacteria 26049
119 Ga0070660_100000419 3300005339 Bacteria 28331
120 Ga0070660_100002532 3300005339 Bacteria 12526
121 Ga0070660_100016441 3300005339 Bacteria 5369
122 Ga0070660_100039991 3300005339 Bacteria 3566
123 Ga0070660_100042109 3300005339 Bacteria 3484
124 Ga0070660_100216086 3300005339 Bacteria 1557
125 Ga0070689_100000567 3300005340 Bacteria 22207
126 Ga0070689_100000784 3300005340 Bacteria 19512
127 Ga0070689_100006577 3300005340 Bacteria 8062
128 Ga0070689_100010941 3300005340 Bacteria 6484
129 Ga0070689_100017607 3300005340 Bacteria 5251
130 Ga0070689_100019683 3300005340 Bacteria 4993
131 Ga0070689_100024286 3300005340 Bacteria 4545
132 Ga0070691_10001059 3300005341 Bacteria 11357
133 Ga0070691_10016994 3300005341 Bacteria 3346
134 Ga0070691_10080215 3300005341 Bacteria 1597
135 Ga0070687_100000145 3300005343 Bacteria 24820
136 Ga0070687_100001424 3300005343 Bacteria 8402
137 Ga0070661_100004369 3300005344 Bacteria 9747
138 Ga0070661_100015609 3300005344 Bacteria 5362
139 Ga0070661_100063942 3300005344 Bacteria 2703
140 Ga0070661_100067273 3300005344 Bacteria 2633
141 Ga0070661_100102307 3300005344 Bacteria 2132
142 Ga0070661_100151584 3300005344 Bacteria 1752
143 Ga0070692_10000927 3300005345 Bacteria 9932
144 Ga0070668_100003304 3300005347 Bacteria 11899
145 Ga0070668_100044604 3300005347 Bacteria 3401
146 Ga0070668_100049906 3300005347 Bacteria 3220
147 Ga0070668_100071617 3300005347 Bacteria 2701
148 Ga0070668_100090516 3300005347 Bacteria 2411
149 Ga0070668_100353361 3300005347 Bacteria 1244
150 Ga0070669_100003579 3300005353 Bacteria 11213
151 Ga0070669_100026298 3300005353 Bacteria 4186
152 Ga0070669_100118893 3300005353 Bacteria 2013
153 Ga0070669_100170420 3300005353 Bacteria 1697
154 Ga0070675_100000977 3300005354 Bacteria 20445
155 Ga0070675_100006235 3300005354 Bacteria 9148
156 Ga0070675_100047289 3300005354 Bacteria 3526
157 Ga0070675_100053971 3300005354 Bacteria 3306
158 Ga0070671_100000457 3300005355 Bacteria 28429
159 Ga0070671_100005484 3300005355 Bacteria 10122
160 Ga0070671_100013863 3300005355 Bacteria 6503
161 Ga0070671_100024576 3300005355 Bacteria 4934
162 Ga0070671_100056174 3300005355 Bacteria 3275
163 Ga0070671_100102405 3300005355 Bacteria 2403
164 Ga0070671_100162562 3300005355 Bacteria 1887
165 Ga0070674_100003924 3300005356 Bacteria 8424
166 Ga0070674_100005104 3300005356 Bacteria 7550
167 Ga0070674_100010581 3300005356 Bacteria 5583
168 Ga0070674_100023685 3300005356 Bacteria 3977
169 Ga0070673_100002173 3300005364 Bacteria 11883
170 Ga0070673_100002183 3300005364 Bacteria 11836
171 Ga0070673_100091785 3300005364 Bacteria 2483
172 Ga0070673_100095685 3300005364 Bacteria 2436
173 Ga0070688_100000956 3300005365 Bacteria 14425
174 Ga0070688_100008606 3300005365 Bacteria 5551
175 Ga0070688_100036208 3300005365 Bacteria 3000
176 Ga0070688_100061090 3300005365 Bacteria 2381
177 Ga0070688_100071389 3300005365 Bacteria 2223
178 Ga0070659_100001451 3300005366 Bacteria 17085
179 Ga0070659_100016138 3300005366 Bacteria 5604
180 Ga0070659_100049630 3300005366 Bacteria 3300
181 Ga0070659_100059384 3300005366 Bacteria 3020
182 Ga0070659_100233404 3300005366 Bacteria 1520
183 Ga0070667_100156522 3300005367 Bacteria 2004
184 Ga0070703_10011030 3300005406 Bacteria 2551
185 Ga0070709_10004491 3300005434 Bacteria 7528
186 Ga0070709_10011326 3300005434 Bacteria 4967
187 Ga0070709_10022469 3300005434 Bacteria 3690
188 Ga0070709_10030529 3300005434 Bacteria 3235
189 Ga0070714_100005442 3300005435 Bacteria 9720
190 Ga0070714_100011031 3300005435 Bacteria 7157
191 Ga0070714_100016605 3300005435 Bacteria 5948
192 Ga0070714_100016855 3300005435 Bacteria 5909
193 Ga0070714_100019021 3300005435 Bacteria 5589
194 Ga0070714_100036484 3300005435 Bacteria 4123
195 Ga0070714_100042403 3300005435 Bacteria 3844
196 Ga0070714_100083816 3300005435 Bacteria 2781
197 Ga0070714_100194327 3300005435 Bacteria 1853
198 Ga0070714_100196379 3300005435 Bacteria 1844
199 Ga0070713_100000834 3300005436 Bacteria 19697
200 Ga0070713_100008105 3300005436 Bacteria 7430
201 Ga0070713_100015475 3300005436 Bacteria 5707
202 Ga0070713_100051872 3300005436 Bacteria 3395
203 Ga0070713_100092085 3300005436 Bacteria 2609
204 Ga0070713_100095586 3300005436 Bacteria 2563
205 Ga0070710_10000567 3300005437 Bacteria 17537
206 Ga0070710_10009242 3300005437 Bacteria 4817
207 Ga0070710_10019974 3300005437 Bacteria 3470
208 Ga0070710_10027323 3300005437 Bacteria 3042
209 Ga0070701_10000773 3300005438 Bacteria 11424
210 Ga0070701_10052031 3300005438 Bacteria 2126
211 Ga0070711_100000801 3300005439 Bacteria 16448
212 Ga0070711_100006558 3300005439 Bacteria 7021
213 Ga0070711_100019620 3300005439 Bacteria 4340
214 Ga0070711_100067921 3300005439 Bacteria 2503
215 Ga0070711_100073752 3300005439 Bacteria 2412
216 Ga0070711_100146969 3300005439 Bacteria 1774
217 Ga0070705_100012088 3300005440 Bacteria 4377
218 Ga0070705_100114972 3300005440 Bacteria 1727
219 Ga0070700_100002595 3300005441 Bacteria 9237
220 Ga0070700_100005406 3300005441 Bacteria 6762
221 Ga0070700_100015662 3300005441 Bacteria 4304
222 Ga0070694_100005038 3300005444 Bacteria 7972
223 Ga0070694_100019262 3300005444 Bacteria 4339
224 Ga0070708_100016537 3300005445 Bacteria 6125
225 Ga0070663_100007329 3300005455 Bacteria 6707
226 Ga0070663_100013311 3300005455 Bacteria 5240
227 Ga0070663_100016126 3300005455 Bacteria 4841
228 Ga0070663_100018939 3300005455 Bacteria 4525
229 Ga0070663_100020358 3300005455 Bacteria 4392
230 Ga0070663_100080041 3300005455 Bacteria 2399
231 Ga0070663_100081341 3300005455 Bacteria 2381
232 Ga0070663_100236714 3300005455 Bacteria 1440
233 Ga0070678_100000204 3300005456 Bacteria 26272
234 Ga0070678_100006849 3300005456 Bacteria 6717
235 Ga0070678_100016075 3300005456 Bacteria 4774
236 Ga0070678_100019584 3300005456 Bacteria 4418
237 Ga0070678_100026143 3300005456 Bacteria 3941
238 Ga0070678_100062074 3300005456 Bacteria 2757
239 Ga0070678_100064897 3300005456 Bacteria 2708
240 Ga0070678_100069888 3300005456 Bacteria 2623
241 Ga0070678_100071249 3300005456 Bacteria 2602
242 Ga0070662_100051612 3300005457 Bacteria 2970
243 Ga0070662_100077295 3300005457 Bacteria 2470
244 Ga0070662_100124476 3300005457 Bacteria 1979
245 Ga0070681_10001622 3300005458 Bacteria 20041
246 Ga0070681_10004974 3300005458 Bacteria 12787
247 Ga0070681_10016579 3300005458 Bacteria 7356
248 Ga0070681_10018673 3300005458 Bacteria 6935
249 Ga0070681_10034683 3300005458 Bacteria 5067
250 Ga0070681_10062985 3300005458 Bacteria 3681
251 Ga0070681_10064861 3300005458 Bacteria 3622
252 Ga0070681_10106074 3300005458 Bacteria 2751
253 Ga0070681_10301768 3300005458 Bacteria 1511
254 Ga0068867_100016017 3300005459 Bacteria 5322
255 Ga0068867_100021279 3300005459 Bacteria 4628
256 Ga0068867_100024746 3300005459 Bacteria 4303
257 Ga0068867_100068926 3300005459 Bacteria 2641
258 Ga0068867_100095594 3300005459 Bacteria 2261
259 Ga0068867_100183297 3300005459 Bacteria 1666
260 Ga0070685_10017792 3300005466 Bacteria 3811
261 Ga0070685_10023595 3300005466 Bacteria 3370
262 Ga0070685_10057794 3300005466 Bacteria 2258
263 Ga0070706_100096722 3300005467 Bacteria 2741
264 Ga0070707_100064794 3300005468 Bacteria 3509
265 Ga0070707_100108628 3300005468 Bacteria 2691
266 Ga0070707_100190933 3300005468 Bacteria 1997
267 Ga0070699_100004210 3300005518 Bacteria 12728
268 Ga0070679_100003230 3300005530 Bacteria 14890
269 Ga0070679_100004369 3300005530 Bacteria 13060
270 Ga0070679_100006042 3300005530 Bacteria 11261
271 Ga0070679_100020708 3300005530 Bacteria 6417
272 Ga0070679_100066542 3300005530 Bacteria 3591
273 Ga0070679_100296983 3300005530 Bacteria 1566
274 Ga0070679_100437708 3300005530 Bacteria 1252
275 Ga0070684_100006387 3300005535 Bacteria 9116
276 Ga0070684_100017723 3300005535 Bacteria 5852
277 Ga0070684_100069493 3300005535 Bacteria 3097
278 Ga0070684_100138162 3300005535 Bacteria 2202
279 Ga0070684_100221590 3300005535 Bacteria 1726
280 Ga0070697_100003792 3300005536 Bacteria 11607
281 Ga0070697_100219633 3300005536 Bacteria 1620
282 Ga0068853_100000504 3300005539 Bacteria 26665
283 Ga0068853_100006640 3300005539 Bacteria 9216
284 Ga0068853_100014714 3300005539 Bacteria 6418
285 Ga0068853_100018347 3300005539 Bacteria 5790
286 Ga0068853_100028677 3300005539 Bacteria 4684
287 Ga0068853_100112169 3300005539 Bacteria 2423
288 Ga0070672_100000343 3300005543 Bacteria 26805
289 Ga0070672_100014311 3300005543 Bacteria 5622
290 Ga0070672_100014711 3300005543 Bacteria 5551
291 Ga0070686_100000862 3300005544 Bacteria 17619
292 Ga0070686_100003330 3300005544 Bacteria 8806
293 Ga0070686_100015191 3300005544 Bacteria 4452
294 Ga0070695_100000693 3300005545 Bacteria 18006
295 Ga0070695_100003899 3300005545 Bacteria 8707
296 Ga0070695_100017273 3300005545 Bacteria 4374
297 Ga0070695_100036710 3300005545 Bacteria 3085
298 Ga0070696_100008114 3300005546 Bacteria 7020
299 Ga0070696_100116741 3300005546 Bacteria 1928
300 Ga0070693_100008248 3300005547 Bacteria 5123
301 Ga0070693_100008941 3300005547 Bacteria 4968
302 Ga0070693_100124478 3300005547 Bacteria 1603
303 Ga0070665_100021753 3300005548 Bacteria 6448
304 Ga0070665_100032166 3300005548 Bacteria 5279
305 Ga0070665_100087707 3300005548 Bacteria 3117
306 Ga0070665_100095749 3300005548 Bacteria 2974
307 Ga0070665_100193878 3300005548 Bacteria 2032
308 Ga0070665_100292379 3300005548 Bacteria 1631
309 Ga0070704_100000799 3300005549 Bacteria 15589
310 Ga0070704_100002708 3300005549 Bacteria 10020
311 Ga0070704_100002929 3300005549 Bacteria 9697
312 Ga0070704_100024943 3300005549 Bacteria 3930
313 Ga0068855_100012892 3300005563 Bacteria 10087
314 Ga0068855_100016222 3300005563 Bacteria 8958
315 Ga0068855_100019843 3300005563 Bacteria 8075
316 Ga0068855_100040429 3300005563 Bacteria 5534
317 Ga0068855_100040447 3300005563 Bacteria 5533
318 Ga0068855_100096594 3300005563 Bacteria 3403
319 Ga0068855_100146506 3300005563 Bacteria 2687
320 Ga0068855_100155994 3300005563 Bacteria 2594
321 Ga0068855_100326594 3300005563 Bacteria 1694
322 Ga0068855_100363645 3300005563 Bacteria 1592
323 Ga0070664_100022786 3300005564 Bacteria 5166
324 Ga0070664_100094573 3300005564 Bacteria 2591
325 Ga0068857_100000979 3300005577 Bacteria 21865
326 Ga0068857_100100623 3300005577 Bacteria 2593
327 Ga0068857_100139657 3300005577 Bacteria 2189
328 Ga0068857_100341286 3300005577 Bacteria 1386
329 Ga0068854_100000702 3300005578 Bacteria 19795
330 Ga0068854_100056438 3300005578 Bacteria 2830
331 Ga0068856_100000020 3300005614 Bacteria 146775
332 Ga0068856_100010469 3300005614 Bacteria 9003
333 Ga0068856_100021168 3300005614 Bacteria 6317
334 Ga0068856_100039666 3300005614 Bacteria 4623
335 Ga0068856_100276730 3300005614 Bacteria 1695
336 Ga0068856_100291136 3300005614 Bacteria 1650
337 Ga0070702_100001050 3300005615 Bacteria 11000
338 Ga0068852_100001019 3300005616 Bacteria 18512
339 Ga0068852_100002168 3300005616 Bacteria 13456
340 Ga0068852_100002288 3300005616 Bacteria 13173
341 Ga0068852_100038925 3300005616 Bacteria 4000
342 Ga0068852_100046632 3300005616 Bacteria 3693
343 Ga0068852_100052790 3300005616 Bacteria 3495
344 Ga0068852_100059057 3300005616 Bacteria 3325
345 Ga0068852_100093147 3300005616 Bacteria 2700
346 Ga0068852_100383865 3300005616 Bacteria 1378
347 Ga0068859_100045113 3300005617 Bacteria 4429
348 Ga0068859_100067415 3300005617 Bacteria 3613
349 Ga0068859_100231421 3300005617 Bacteria 1936
350 Ga0068864_100004079 3300005618 Bacteria 11994
351 Ga0068864_100241508 3300005618 Bacteria 1674
352 Ga0068866_10002039 3300005718 Bacteria 8408
353 Ga0068861_100005424 3300005719 Bacteria 8634
354 Ga0068861_100011655 3300005719 Bacteria 6117
355 Ga0068861_100124311 3300005719 Bacteria 2085
356 Ga0068861_100303730 3300005719 Bacteria 1383
357 Ga0068851_10001344 3300005834 Bacteria 10741
358 Ga0068851_10007440 3300005834 Bacteria 5028
359 Ga0068851_10071673 3300005834 Bacteria 1794
360 Ga0068870_10000442 3300005840 Bacteria 15715
361 Ga0068863_100022454 3300005841 Bacteria 6026
362 Ga0068858_100000657 3300005842 Bacteria 36147
363 Ga0068858_100024985 3300005842 Bacteria 5560
364 Ga0068858_100025080 3300005842 Bacteria 5549
365 Ga0068858_100051225 3300005842 Bacteria 3820
366 Ga0068858_100152855 3300005842 Bacteria 2170
367 Ga0068858_100258627 3300005842 Bacteria 1654
368 Ga0068860_100000633 3300005843 Bacteria 41450
369 Ga0068860_100012235 3300005843 Bacteria 8456
370 Ga0068860_100029184 3300005843 Bacteria 5306
371 Ga0068860_100140686 3300005843 Bacteria 2319
372 Ga0068862_100002115 3300005844 Bacteria 17901
373 Ga0068862_100084095 3300005844 Bacteria 2764
374 Ga0068862_100123886 3300005844 Bacteria 2281
375 Ga0068862_100154356 3300005844 Bacteria 2045
376 Ga0081455_10000012 3300005937 Bacteria 201668
377 Ga0081455_10000678 3300005937 Bacteria 44138
378 Ga0081455_10001814 3300005937 Bacteria 25739
379 Ga0081455_10005602 3300005937 Bacteria 13727
380 Ga0081455_10008012 3300005937 Bacteria 11039
381 Ga0081455_10011296 3300005937 Bacteria 8984
382 Ga0081455_10044146 3300005937 Bacteria 3892
383 Ga0081455_10056922 3300005937 Bacteria 3317
384 Ga0081455_10067121 3300005937 Bacteria 2991
385 Ga0081455_10071109 3300005937 Bacteria 2885
386 Ga0081455_10240205 3300005937 Bacteria 1332
387 Ga0081538_10005596 3300005981 Bacteria 11277
388 Ga0081538_10011536 3300005981 Bacteria 7152
389 Ga0081538_10053242 3300005981 Bacteria 2408
390 Ga0081538_10059528 3300005981 Bacteria 2205
391 Ga0081540_1000019 3300005983 Bacteria 163281
392 Ga0081540_1000933 3300005983 Bacteria 26285
393 Ga0081540_1001603 3300005983 Bacteria 19287
394 Ga0081540_1001730 3300005983 Bacteria 18408
395 Ga0081540_1002812 3300005983 Bacteria 14092
396 Ga0081540_1004950 3300005983 Bacteria 10015
397 Ga0081540_1011886 3300005983 Bacteria 5779
398 Ga0081540_1024213 3300005983 Bacteria 3528
399 Ga0081540_1027590 3300005983 Bacteria 3212
400 Ga0081540_1047883 3300005983 Bacteria 2146
401 Ga0081539_10000059 3300005985 Bacteria 254888
402 Ga0081539_10000140 3300005985 Bacteria 166746
403 Ga0081539_10000862 3300005985 Bacteria 58119
404 Ga0081539_10002946 3300005985 Bacteria 22393
405 Ga0081539_10003950 3300005985 Bacteria 17174
406 Ga0081539_10008084 3300005985 Bacteria 9306
407 Ga0081539_10041228 3300005985 Bacteria 2700
408 Ga0081539_10044663 3300005985 Bacteria 2556
409 Ga0070717_10000720 3300006028 Bacteria 21477
410 Ga0070717_10002391 3300006028 Bacteria 13228
411 Ga0070717_10004566 3300006028 Bacteria 10020
412 Ga0070717_10012075 3300006028 Bacteria 6581
413 Ga0070717_10101140 3300006028 Bacteria 2448
414 Ga0070717_10121488 3300006028 Bacteria 2238
415 Ga0070717_10124748 3300006028 Bacteria 2210
416 Ga0070717_10126620 3300006028 Bacteria 2193
417 Ga0070717_10175268 3300006028 Bacteria 1867
418 Ga0075365_10019560 3300006038 Bacteria 4182
419 Ga0075365_10093037 3300006038 Bacteria 2056
420 Ga0075368_10014679 3300006042 Bacteria 2898
421 Ga0075368_10024855 3300006042 Bacteria 2296
422 Ga0075368_10037252 3300006042 Bacteria 1902
423 Ga0075363_100025038 3300006048 Bacteria 3039
424 Ga0075363_100087500 3300006048 Bacteria 1711
425 Ga0075364_10004310 3300006051 Bacteria 8166
426 Ga0075364_10066064 3300006051 Bacteria 2375
427 Ga0075432_10002045 3300006058 Bacteria 6716
428 Ga0075432_10011462 3300006058 Bacteria 3011
429 Ga0070715_10002602 3300006163 Bacteria 5578
430 Ga0070715_10012885 3300006163 Bacteria 3057
431 Ga0070716_100003115 3300006173 Bacteria 7747
432 Ga0070716_100004945 3300006173 Bacteria 6414
433 Ga0070712_100000405 3300006175 Bacteria 24580
434 Ga0070712_100006221 3300006175 Bacteria 7388
435 Ga0070712_100084821 3300006175 Bacteria 2304
436 Ga0070712_100096644 3300006175 Bacteria 2175
437 Ga0075362_10010694 3300006177 Bacteria 3591
438 Ga0075362_10026595 3300006177 Bacteria 2473
439 Ga0075362_10065967 3300006177 Bacteria 1644
440 Ga0075367_10000606 3300006178 Bacteria 13778
441 Ga0075367_10027570 3300006178 Bacteria 3233
442 Ga0075367_10031335 3300006178 Bacteria 3053
443 Ga0075369_10005848 3300006186 Bacteria 4623
444 Ga0075427_10000374 3300006194 Bacteria 4961
445 Ga0075366_10052684 3300006195 Bacteria 2417
446 Ga0075366_10064748 3300006195 Bacteria 2174
447 Ga0097621_100000568 3300006237 Bacteria 25929
448 Ga0097621_100031502 3300006237 Bacteria 4209
449 Ga0097621_100122529 3300006237 Bacteria 2207
450 Ga0097621_100159633 3300006237 Bacteria 1937
451 Ga0097621_100252451 3300006237 Bacteria 1545
452 Ga0075370_10015666 3300006353 Bacteria 4064
453 Ga0075370_10022235 3300006353 Bacteria 3480
454 Ga0068871_100000203 3300006358 Bacteria 41063
455 Ga0068871_100034225 3300006358 Bacteria 4030
456 Ga0075428_100001488 3300006844 Bacteria 25069
457 Ga0075428_100001638 3300006844 Bacteria 23879
458 Ga0075428_100001971 3300006844 Bacteria 22113
459 Ga0075428_100007729 3300006844 Bacteria 11915
460 Ga0075428_100045691 3300006844 Bacteria 4812
461 Ga0075430_100000132 3300006846 Bacteria 47593
462 Ga0075430_100000251 3300006846 Bacteria 37229
463 Ga0075430_100024107 3300006846 Bacteria 5180
464 Ga0075430_100072799 3300006846 Bacteria 2881
465 Ga0075430_100102368 3300006846 Bacteria 2391
466 Ga0075431_100000504 3300006847 Bacteria 32639
467 Ga0075431_100001119 3300006847 Bacteria 24014
468 Ga0075431_100006760 3300006847 Bacteria 11391
469 Ga0075431_100017432 3300006847 Bacteria 7297
470 Ga0075431_100050893 3300006847 Bacteria 4271
471 Ga0075431_100099529 3300006847 Bacteria 3000
472 Ga0075431_100115251 3300006847 Bacteria 2774
473 Ga0075431_100236707 3300006847 Bacteria 1858
474 Ga0075431_100269808 3300006847 Bacteria 1725
475 Ga0075433_10000152 3300006852 Bacteria 37183
476 Ga0075433_10038769 3300006852 Bacteria 4116
477 Ga0075433_10053555 3300006852 Bacteria 3519
478 Ga0075434_100003370 3300006871 Bacteria 14305
479 Ga0075434_100022796 3300006871 Bacteria 6097
480 Ga0075434_100025594 3300006871 Bacteria 5773
481 Ga0075434_100036086 3300006871 Bacteria 4889
482 Ga0075434_100044526 3300006871 Bacteria 4402
483 Ga0075434_100133060 3300006871 Bacteria 2506
484 Ga0075434_100176158 3300006871 Bacteria 2159
485 Ga0075434_100270499 3300006871 Bacteria 1719
486 Ga0075429_100000459 3300006880 Bacteria 30370
487 Ga0075429_100000855 3300006880 Bacteria 23955
488 Ga0075429_100002649 3300006880 Bacteria 15053
489 Ga0075429_100029010 3300006880 Bacteria 4804
490 Ga0075429_100105058 3300006880 Bacteria 2467
491 Ga0075429_100292969 3300006880 Bacteria 1425
492 Ga0068865_100000155 3300006881 Bacteria 37357
493 Ga0068865_100024484 3300006881 Bacteria 3961
494 Ga0068865_100103481 3300006881 Bacteria 2088
495 Ga0068865_100130394 3300006881 Bacteria 1883
496 Ga0075436_100003747 3300006914 Bacteria 10419
497 Ga0075436_100013840 3300006914 Bacteria 5525
498 Ga0097620_100045113 3300006931 Bacteria 4429
499 Ga0097620_100067407 3300006931 Bacteria 3613
500 Ga0097620_100068299 3300006931 Bacteria 3589
501 Ga0097620_100231398 3300006931 Bacteria 1936
502 Ga0099825_1023236 3300006941 Bacteria 3840
503 Ga0099824_1011525 3300006942 Bacteria 9966
504 Ga0099824_1016950 3300006942 Bacteria 6464
505 Ga0099822_1002297 3300006943 Bacteria 23658
506 Ga0079104_1000013 3300006946 Bacteria 349477
507 Ga0079104_1004572 3300006946 Bacteria 5849
508 Ga0079104_1015986 3300006946 Bacteria 2207
509 Ga0075435_100008956 3300007076 Bacteria 7216
510 Ga0075435_100008983 3300007076 Bacteria 7207
511 Ga0075435_100020212 3300007076 Bacteria 5097
512 Ga0075435_100089012 3300007076 Bacteria 2545
513 Ga0075435_100128461 3300007076 Bacteria 2120
514 Ga0105251_10013625 3300009011 Bacteria 4541
515 Ga0105244_10022126 3300009036 Bacteria 3502
516 Ga0105240_10009843 3300009093 Bacteria 13490
517 Ga0105240_10011032 3300009093 Bacteria 12637
518 Ga0105240_10038752 3300009093 Bacteria 6110
519 Ga0105240_10070355 3300009093 Bacteria 4328
520 Ga0105240_10117923 3300009093 Bacteria 3199
521 Ga0105240_10132741 3300009093 Bacteria 2985
522 Ga0105240_10335532 3300009093 Bacteria 1719
523 Ga0111539_10000114 3300009094 Bacteria 88757
524 Ga0111539_10000367 3300009094 Bacteria 55719
525 Ga0111539_10000673 3300009094 Bacteria 44168
526 Ga0111539_10002196 3300009094 Bacteria 26061
527 Ga0111539_10005040 3300009094 Bacteria 17161
528 Ga0111539_10010049 3300009094 Bacteria 11929
529 Ga0111539_10025425 3300009094 Bacteria 7259
530 Ga0111539_10036276 3300009094 Bacteria 5964
531 Ga0111539_10058399 3300009094 Bacteria 4577
532 Ga0111539_10097831 3300009094 Bacteria 3447
533 Ga0111539_10108668 3300009094 Bacteria 3255
534 Ga0111539_10122343 3300009094 Bacteria 3050
535 Ga0111539_10172350 3300009094 Bacteria 2528
536 Ga0105245_10001558 3300009098 Bacteria 20810
537 Ga0105245_10043604 3300009098 Bacteria 4001
538 Ga0105245_10124344 3300009098 Bacteria 2413
539 Ga0105245_10316628 3300009098 Bacteria 1536
540 Ga0105247_10012387 3300009101 Bacteria 5120
541 Ga0105247_10152833 3300009101 Bacteria 1522
542 Ga0114129_10000593 3300009147 Bacteria 44778
543 Ga0114129_10007730 3300009147 Bacteria 15296
544 Ga0114129_10012376 3300009147 Bacteria 12146
545 Ga0114129_10016320 3300009147 Bacteria 10571
546 Ga0114129_10022324 3300009147 Bacteria 8983
547 Ga0114129_10037856 3300009147 Bacteria 6808
548 Ga0114129_10081687 3300009147 Bacteria 4492
549 Ga0114129_10126328 3300009147 Bacteria 3516
550 Ga0114129_10379780 3300009147 Bacteria 1866
551 Ga0114129_10530940 3300009147 Bacteria 1533
552 Ga0105243_10000960 3300009148 Bacteria 26967
553 Ga0105243_10016776 3300009148 Bacteria 5536
554 Ga0105243_10019267 3300009148 Bacteria 5173
555 Ga0105241_10001324 3300009174 Bacteria 18806
556 Ga0105241_10002167 3300009174 Bacteria 14788
557 Ga0105241_10002458 3300009174 Bacteria 13919
558 Ga0105241_10034550 3300009174 Bacteria 3799
559 Ga0105241_10108268 3300009174 Bacteria 2221
560 Ga0105241_10237971 3300009174 Bacteria 1538
561 Ga0105242_10001412 3300009176 Bacteria 18927
562 Ga0105242_10134459 3300009176 Bacteria 2138
563 Ga0105242_10329696 3300009176 Bacteria 1403
564 Ga0105248_10001378 3300009177 Bacteria 27081
565 Ga0105248_10004213 3300009177 Bacteria 15908
566 Ga0105248_10009339 3300009177 Bacteria 10798
567 Ga0105248_10038312 3300009177 Bacteria 5364
568 Ga0105248_10048628 3300009177 Bacteria 4758
569 Ga0105248_10124692 3300009177 Bacteria 2906
570 Ga0105248_10130378 3300009177 Bacteria 2836
571 Ga0105248_10326079 3300009177 Bacteria 1730
572 Ga0105248_10631395 3300009177 Bacteria 1208
573 Ga0105237_10007091 3300009545 Bacteria 12319
574 Ga0105237_10010293 3300009545 Bacteria 9963
575 Ga0105237_10034611 3300009545 Bacteria 5114
576 Ga0105237_10043126 3300009545 Bacteria 4546
577 Ga0105237_10052821 3300009545 Bacteria 4078
578 Ga0105237_10053424 3300009545 Bacteria 4052
579 Ga0105237_10080663 3300009545 Bacteria 3244
580 Ga0105237_10085649 3300009545 Bacteria 3141
581 Ga0105237_10368426 3300009545 Bacteria 1441
582 Ga0105238_10000006 3300009551 Bacteria 346249
583 Ga0105238_10025766 3300009551 Bacteria 5997
584 Ga0105238_10038823 3300009551 Bacteria 4835
585 Ga0105238_10075539 3300009551 Bacteria 3361
586 Ga0105238_10092943 3300009551 Bacteria 3004
587 Ga0105249_10000925 3300009553 Bacteria 25945
588 Ga0105249_10000930 3300009553 Bacteria 25901
589 Ga0105249_10008708 3300009553 Bacteria 8847
590 Ga0105249_10212680 3300009553 Bacteria 1898
591 Ga0099796_10009432 3300010159 Bacteria 2642
592 Ga0105239_10003131 3300010375 Bacteria 20532
593 Ga0105239_10009354 3300010375 Bacteria 11062
594 Ga0105239_10010180 3300010375 Bacteria 10534
595 Ga0105239_10033065 3300010375 Bacteria 5681
596 Ga0105239_10033364 3300010375 Bacteria 5654
597 Ga0105239_10053228 3300010375 Bacteria 4440
598 Ga0105239_10089057 3300010375 Bacteria 3403
599 Ga0105239_10097520 3300010375 Bacteria 3249
600 Ga0105239_10118722 3300010375 Bacteria 2935
601 Ga0105239_10122398 3300010375 Bacteria 2890
602 Ga0105239_10123931 3300010375 Bacteria 2871
603 Ga0105239_10163330 3300010375 Bacteria 2489
604 Ga0105239_10178685 3300010375 Bacteria 2374
605 Ga0105239_10281271 3300010375 Bacteria 1873
606 Ga0105239_10447064 3300010375 Bacteria 1466
607 Ga0105246_10029413 3300011119 Bacteria 3618
608 Ga0105246_10036496 3300011119 Bacteria 3293
609 Ga0105246_10049577 3300011119 Bacteria 2876
610 Ga0105246_10077053 3300011119 Bacteria 2364
611 Ga0105246_10179703 3300011119 Bacteria 1628
612 Ga0157342_1000469 3300012507 Bacteria 2468
613 Ga0157326_1003442 3300012513 Bacteria 1665
614 Ga0157373_10011335 3300013100 Bacteria 6555
615 Ga0157373_10011392 3300013100 Bacteria 6539
616 Ga0157373_10020149 3300013100 Bacteria 4851
617 Ga0157373_10058571 3300013100 Bacteria 2731
618 Ga0157373_10139478 3300013100 Bacteria 1705
619 Ga0157371_10000268 3300013102 Bacteria 70868
620 Ga0157371_10002137 3300013102 Bacteria 19248
621 Ga0157371_10004410 3300013102 Bacteria 12300
622 Ga0157370_10006303 3300013104 Bacteria 13111
623 Ga0157370_10009085 3300013104 Bacteria 10660
624 Ga0157370_10013966 3300013104 Bacteria 8247
625 Ga0157370_10031648 3300013104 Bacteria 5173
626 Ga0157370_10056849 3300013104 Bacteria 3723
627 Ga0157370_10159190 3300013104 Bacteria 2101
628 Ga0157369_10018324 3300013105 Bacteria 7851
629 Ga0157369_10058415 3300013105 Bacteria 4161
630 Ga0157369_10082850 3300013105 Bacteria 3432
631 Ga0157369_10391079 3300013105 Bacteria 1443
632 Ga0171462_1007 3300013250 Bacteria 417698
633 Ga0157374_10006983 3300013296 Bacteria 9610
634 Ga0157374_10081595 3300013296 Bacteria 3069
635 Ga0157374_10185883 3300013296 Bacteria 2031
636 Ga0157378_10006990 3300013297 Bacteria 9847
637 Ga0157378_10013694 3300013297 Bacteria 7094
638 Ga0157378_10056690 3300013297 Bacteria 3492
639 Ga0163162_10002587 3300013306 Bacteria 17132
640 Ga0163162_10007934 3300013306 Bacteria 10351
641 Ga0163162_10062058 3300013306 Bacteria 3777
642 Ga0163162_10068389 3300013306 Bacteria 3603
643 Ga0163162_10171987 3300013306 Bacteria 2291
644 Ga0157372_10038427 3300013307 Bacteria 5282
645 Ga0157372_10053251 3300013307 Bacteria 4509
646 Ga0157372_10068346 3300013307 Bacteria 3994
647 Ga0157372_10236564 3300013307 Bacteria 2118
648 Ga0157372_10274136 3300013307 Bacteria 1961
649 Ga0157372_10309064 3300013307 Bacteria 1840
650 Ga0157375_10000697 3300013308 Bacteria 29707
651 Ga0157375_10006290 3300013308 Bacteria 10341
652 Ga0157375_10019881 3300013308 Bacteria 6122
653 Ga0157375_10042254 3300013308 Bacteria 4411
654 Ga0157375_10153889 3300013308 Bacteria 2437
655 Ga0157375_10157330 3300013308 Bacteria 2412
656 Ga0163163_10002553 3300014325 Bacteria 15424
657 Ga0163163_10020492 3300014325 Bacteria 6227
658 Ga0163163_10022591 3300014325 Bacteria 5961
659 Ga0163163_10036664 3300014325 Bacteria 4765
660 Ga0163163_10073045 3300014325 Bacteria 3420
661 Ga0157380_10002235 3300014326 Bacteria 13019
662 Ga0157380_10022132 3300014326 Bacteria 4779
663 Ga0182008_10022719 3300014497 Bacteria 3211
664 Ga0157377_10000454 3300014745 Bacteria 17664
665 Ga0157377_10018242 3300014745 Bacteria 3645
666 Ga0157379_10000539 3300014968 Bacteria 30568
667 Ga0157379_10087747 3300014968 Bacteria 2789
668 Ga0157379_10221421 3300014968 Bacteria 1715
669 Ga0157376_10001949 3300014969 Bacteria 13795
670 Ga0157376_10023925 3300014969 Bacteria 4790
671 Ga0157376_10048612 3300014969 Bacteria 3509
672 Ga0157376_10114658 3300014969 Bacteria 2378
673 Ga0182006_1023156 3300015261 Bacteria 2574
674 Ga0182006_1026458 3300015261 Bacteria 2375
675 Ga0182006_1039122 3300015261 Bacteria 1873
676 Ga0163161_10001235 3300017792 Bacteria 19165
677 Ga0163161_10027620 3300017792 Bacteria 4027
678 Ga0163161_10080174 3300017792 Bacteria 2402
679 Ga0163161_10194839 3300017792 Bacteria 1559
680 Ga0206356_11768000 3300020070 Bacteria 4419
681 Ga0214544_1000002 3300021320 Bacteria 753857
682 Ga0214542_1000001 3300021321 Bacteria 1018696
683 Ga0214545_1000001 3300021324 Bacteria 1092817
684 Ga0214543_1000001 3300021327 Bacteria 776921
685 Ga0213872_10003952 3300021361 Bacteria 8008
686 Ga0213872_10055816 3300021361 Bacteria 1790
687 Ga0213874_10008081 3300021377 Bacteria 2551
688 Ga0213876_10001306 3300021384 Bacteria 15675
689 Ga0213876_10002183 3300021384 Bacteria 11561
690 Ga0213876_10010793 3300021384 Bacteria 4894
691 Ga0213876_10073389 3300021384 Bacteria 1807
692 Ga0213875_10000036 3300021388 Bacteria 166707
693 Ga0213875_10002463 3300021388 Bacteria 11047
694 Ga0213875_10003211 3300021388 Bacteria 9390
695 Ga0213875_10021442 3300021388 Bacteria 3095
696 Ga0213875_10021972 3300021388 Bacteria 3054
697 Ga0213871_10001174 3300021441 Bacteria 4205
698 Ga0213871_10009084 3300021441 Bacteria 2214
699 Ga0224712_10040306 3300022467 Bacteria 1757
700 Ga0224712_10065997 3300022467 Bacteria 1456
701 Ga0228711_1000007 3300022739 Bacteria 202413
702 Ga0228710_1000007 3300022740 Bacteria 189104
703 Ga0224572_1000531 3300024225 Bacteria 4621
704 Ga0228598_1000795 3300024227 Bacteria 6784
705 Ga0209435_100018 3300025206 Bacteria 274625
706 Ga0209435_100240 3300025206 Bacteria 14674
707 Ga0209784_100009 3300025224 Bacteria 688031
708 Ga0209566_100007 3300025225 Bacteria 688031
709 Ga0209674_100018 3300025226 Bacteria 688031
710 Ga0209672_101842 3300025228 Bacteria 6376
711 Ga0209147_100051 3300025229 Bacteria 274605
712 Ga0209563_100020 3300025230 Bacteria 688031
713 Ga0209437_101200 3300025233 Bacteria 7546
714 Ga0209258_101977 3300025242 Bacteria 5949
715 Ga0209646_1000172 3300025246 Bacteria 84840
716 Ga0209646_1000186 3300025246 Bacteria 77615
717 Ga0209026_1000005 3300025250 Bacteria 731387
718 Ga0209026_1000042 3300025250 Bacteria 273111
719 Ga0209677_100010 3300025253 Bacteria 688031
720 Ga0209677_101018 3300025253 Bacteria 13392
721 Ga0209148_1000056 3300025254 Bacteria 363380
722 Ga0209148_1000475 3300025254 Bacteria 42476
723 Ga0209148_1006213 3300025254 Bacteria 2615
724 Ga0209759_1000538 3300025256 Bacteria 39836
725 Ga0209759_1000547 3300025256 Bacteria 38694
726 Ga0209759_1000933 3300025256 Bacteria 21089
727 Ga0209233_1000068 3300025261 Bacteria 377969
728 Ga0209233_1002185 3300025261 Bacteria 7325
729 Ga0209233_1003457 3300025261 Bacteria 5564
730 Ga0209233_1004993 3300025261 Bacteria 4458
731 Ga0209233_1025477 3300025261 Bacteria 1462
732 Ga0207666_1000037 3300025271 Bacteria 27148
733 Ga0207666_1000419 3300025271 Bacteria 5538
734 Ga0209455_1000238 3300025272 Bacteria 68798
735 Ga0209455_1001687 3300025272 Bacteria 9461
736 Ga0209455_1002135 3300025272 Bacteria 7850
737 Ga0209455_1009858 3300025272 Bacteria 2472
738 Ga0209130_1001022 3300025284 Bacteria 21581
739 Ga0207673_1000102 3300025290 Bacteria 7698
740 Ga0209675_1000633 3300025291 Bacteria 25016
741 Ga0209676_1003848 3300025292 Bacteria 8798
742 Ga0209025_1000017 3300025294 Bacteria 768983
743 Ga0209025_1000227 3300025294 Bacteria 132244
744 Ga0209025_1000291 3300025294 Bacteria 112755
745 Ga0209025_1015469 3300025294 Bacteria 4598
746 Ga0209025_1015993 3300025294 Bacteria 4469
747 Ga0209564_1000031 3300025295 Bacteria 494703
748 Ga0209564_1000082 3300025295 Bacteria 261494
749 Ga0209564_1001979 3300025295 Bacteria 17989
750 Ga0209564_1016460 3300025295 Bacteria 2941
751 Ga0209758_1000140 3300025297 Bacteria 174267
752 Ga0209758_1001460 3300025297 Bacteria 27753
753 Ga0209758_1002072 3300025297 Bacteria 21375
754 Ga0209758_1003468 3300025297 Bacteria 14294
755 Ga0209758_1006144 3300025297 Bacteria 8800
756 Ga0209758_1011521 3300025297 Bacteria 5106
757 Ga0209050_1000142 3300025298 Bacteria 172356
758 Ga0209050_1000671 3300025298 Bacteria 51908
759 Ga0209256_1000033 3300025299 Bacteria 393924
760 Ga0209256_1000130 3300025299 Bacteria 163227
761 Ga0209256_1001059 3300025299 Bacteria 31924
762 Ga0209256_1004348 3300025299 Bacteria 8979
763 Ga0209256_1031562 3300025299 Bacteria 1447
764 Ga0207426_1000434 3300025302 Bacteria 68127
765 Ga0207426_1000855 3300025302 Bacteria 32019
766 Ga0207426_1018849 3300025302 Bacteria 2423
767 Ga0207426_1025686 3300025302 Bacteria 1981
768 Ga0209051_1000035 3300025303 Bacteria 346999
769 Ga0209051_1000544 3300025303 Bacteria 46205
770 Ga0209257_1000494 3300025304 Bacteria 70693
771 Ga0209257_1001932 3300025304 Bacteria 22369
772 Ga0207697_10000293 3300025315 Bacteria 27911
773 Ga0207656_10005412 3300025321 Bacteria 4510
774 Ga0207656_10009022 3300025321 Bacteria 3696
775 Ga0207656_10026610 3300025321 Bacteria 2360
776 Ga0207713_1029023 3300025735 Bacteria 2485
777 Ga0207653_10016484 3300025885 Bacteria 2321
778 Ga0207682_10000081 3300025893 Bacteria 42361
779 Ga0207682_10001282 3300025893 Bacteria 11542
780 Ga0207692_10000504 3300025898 Bacteria 13779
781 Ga0207692_10013638 3300025898 Bacteria 3531
782 Ga0207692_10014597 3300025898 Bacteria 3435
783 Ga0207692_10030702 3300025898 Bacteria 2566
784 Ga0207692_10038782 3300025898 Bacteria 2339
785 Ga0207692_10040515 3300025898 Bacteria 2299
786 Ga0207692_10119510 3300025898 Bacteria 1473
787 Ga0207642_10004660 3300025899 Bacteria 4428
788 Ga0207642_10005716 3300025899 Bacteria 4080
789 Ga0207642_10063847 3300025899 Bacteria 1724
790 Ga0207710_10006913 3300025900 Bacteria 4828
791 Ga0207710_10048821 3300025900 Bacteria 1895
792 Ga0207710_10083539 3300025900 Bacteria 1485
793 Ga0207688_10000487 3300025901 Bacteria 19060
794 Ga0207688_10002068 3300025901 Bacteria 10784
795 Ga0207680_10119664 3300025903 Bacteria 1720
796 Ga0207680_10129668 3300025903 Bacteria 1660
797 Ga0207647_10001362 3300025904 Bacteria 18775
798 Ga0207647_10004059 3300025904 Bacteria 10903
799 Ga0207647_10007664 3300025904 Bacteria 7779
800 Ga0207647_10010142 3300025904 Bacteria 6663
801 Ga0207647_10013913 3300025904 Bacteria 5569
802 Ga0207647_10024727 3300025904 Bacteria 3958
803 Ga0207647_10125778 3300025904 Bacteria 1509
804 Ga0207685_10061965 3300025905 Bacteria 1485
805 Ga0207685_10078370 3300025905 Bacteria 1360
806 Ga0207699_10000508 3300025906 Bacteria 19334
807 Ga0207699_10010294 3300025906 Bacteria 4687
808 Ga0207699_10014968 3300025906 Bacteria 4017
809 Ga0207645_10000792 3300025907 Bacteria 26448
810 Ga0207645_10007259 3300025907 Bacteria 7842
811 Ga0207645_10017134 3300025907 Bacteria 4785
812 Ga0207645_10029304 3300025907 Bacteria 3550
813 Ga0207643_10000392 3300025908 Bacteria 29123
814 Ga0207643_10000657 3300025908 Bacteria 21585
815 Ga0207705_10011559 3300025909 Bacteria 6383
816 Ga0207705_10035072 3300025909 Bacteria 3589
817 Ga0207705_10075031 3300025909 Bacteria 2455
818 Ga0207684_10036233 3300025910 Bacteria 4188
819 Ga0207654_10002172 3300025911 Bacteria 10047
820 Ga0207654_10023733 3300025911 Bacteria 3290
821 Ga0207654_10049566 3300025911 Bacteria 2409
822 Ga0207654_10064204 3300025911 Bacteria 2158
823 Ga0207707_10002890 3300025912 Bacteria 15331
824 Ga0207707_10005173 3300025912 Bacteria 11433
825 Ga0207707_10011878 3300025912 Bacteria 7576
826 Ga0207707_10011983 3300025912 Bacteria 7538
827 Ga0207707_10018389 3300025912 Bacteria 6092
828 Ga0207707_10021037 3300025912 Bacteria 5698
829 Ga0207707_10028853 3300025912 Bacteria 4849
830 Ga0207707_10043434 3300025912 Bacteria 3921
831 Ga0207707_10089849 3300025912 Bacteria 2684
832 Ga0207707_10116613 3300025912 Bacteria 2333
833 Ga0207707_10123314 3300025912 Bacteria 2266
834 Ga0207707_10164977 3300025912 Bacteria 1936
835 Ga0207707_10215466 3300025912 Bacteria 1672
836 Ga0207707_10219240 3300025912 Bacteria 1656
837 Ga0207707_10301618 3300025912 Bacteria 1385
838 Ga0207695_10000008 3300025913 Bacteria 1058268
839 Ga0207695_10005095 3300025913 Bacteria 17608
840 Ga0207695_10012818 3300025913 Bacteria 10040
841 Ga0207695_10030124 3300025913 Bacteria 5979
842 Ga0207695_10034276 3300025913 Bacteria 5524
843 Ga0207695_10079160 3300025913 Bacteria 3332
844 Ga0207695_10140481 3300025913 Bacteria 2364
845 Ga0207695_10198453 3300025913 Bacteria 1922
846 Ga0207671_10003541 3300025914 Bacteria 15487
847 Ga0207671_10018613 3300025914 Bacteria 5322
848 Ga0207671_10040346 3300025914 Bacteria 3456
849 Ga0207671_10043529 3300025914 Bacteria 3320
850 Ga0207693_10000581 3300025915 Bacteria 32715
851 Ga0207693_10002467 3300025915 Bacteria 16076
852 Ga0207693_10002907 3300025915 Bacteria 14826
853 Ga0207693_10004238 3300025915 Bacteria 12158
854 Ga0207693_10004411 3300025915 Bacteria 11896
855 Ga0207693_10008804 3300025915 Bacteria 8248
856 Ga0207693_10011407 3300025915 Bacteria 7195
857 Ga0207693_10027698 3300025915 Bacteria 4479
858 Ga0207693_10051877 3300025915 Bacteria 3217
859 Ga0207693_10070059 3300025915 Bacteria 2744
860 Ga0207693_10081644 3300025915 Bacteria 2531
861 Ga0207693_10118274 3300025915 Bacteria 2081
862 Ga0207663_10000084 3300025916 Bacteria 44454
863 Ga0207663_10000732 3300025916 Bacteria 14686
864 Ga0207663_10020836 3300025916 Bacteria 3721
865 Ga0207660_10007083 3300025917 Bacteria 7262
866 Ga0207660_10015824 3300025917 Bacteria 4985
867 Ga0207660_10026809 3300025917 Bacteria 3927
868 Ga0207660_10036904 3300025917 Bacteria 3400
869 Ga0207660_10080994 3300025917 Bacteria 2385
870 Ga0207660_10167024 3300025917 Bacteria 1701
871 Ga0207660_10185145 3300025917 Bacteria 1619
872 Ga0207662_10003086 3300025918 Bacteria 8502
873 Ga0207662_10013452 3300025918 Bacteria 4578
874 Ga0207662_10038307 3300025918 Bacteria 2809
875 Ga0207657_10001069 3300025919 Bacteria 29010
876 Ga0207657_10004955 3300025919 Bacteria 14013
877 Ga0207657_10047517 3300025919 Bacteria 3752
878 Ga0207657_10061319 3300025919 Bacteria 3225
879 Ga0207657_10070879 3300025919 Bacteria 2953
880 Ga0207657_10141441 3300025919 Bacteria 1966
881 Ga0207649_10001901 3300025920 Bacteria 11923
882 Ga0207649_10032314 3300025920 Bacteria 3119
883 Ga0207652_10006216 3300025921 Bacteria 9644
884 Ga0207652_10011506 3300025921 Bacteria 7134
885 Ga0207652_10019271 3300025921 Bacteria 5609
886 Ga0207652_10024457 3300025921 Bacteria 5011
887 Ga0207652_10024840 3300025921 Bacteria 4973
888 Ga0207652_10149044 3300025921 Bacteria 2094
889 Ga0207646_10005334 3300025922 Bacteria 13548
890 Ga0207646_10083857 3300025922 Bacteria 2850
891 Ga0207681_10000738 3300025923 Bacteria 21439
892 Ga0207681_10204761 3300025923 Bacteria 1517
893 Ga0207681_10264669 3300025923 Bacteria 1347
894 Ga0207694_10000050 3300025924 Bacteria 159920
895 Ga0207694_10000110 3300025924 Bacteria 85854
896 Ga0207694_10011528 3300025924 Bacteria 6671
897 Ga0207694_10035357 3300025924 Bacteria 3832
898 Ga0207694_10065780 3300025924 Bacteria 2827
899 Ga0207694_10135037 3300025924 Bacteria 1980
900 Ga0207694_10258981 3300025924 Bacteria 1425
901 Ga0207650_10002215 3300025925 Bacteria 13575
902 Ga0207650_10005378 3300025925 Bacteria 8733
903 Ga0207650_10010692 3300025925 Bacteria 6304
904 Ga0207650_10159713 3300025925 Bacteria 1785
905 Ga0207650_10178404 3300025925 Bacteria 1692
906 Ga0207659_10000288 3300025926 Bacteria 30505
907 Ga0207659_10034549 3300025926 Bacteria 3487
908 Ga0207659_10039801 3300025926 Bacteria 3282
909 Ga0207659_10044513 3300025926 Bacteria 3123
910 Ga0207659_10169141 3300025926 Bacteria 1723
911 Ga0207687_10000520 3300025927 Bacteria 25824
912 Ga0207687_10007944 3300025927 Bacteria 6947
913 Ga0207687_10047813 3300025927 Bacteria 2967
914 Ga0207687_10185784 3300025927 Bacteria 1614
915 Ga0207687_10208913 3300025927 Bacteria 1530
916 Ga0207700_10003137 3300025928 Bacteria 9542
917 Ga0207700_10008693 3300025928 Bacteria 6308
918 Ga0207700_10015401 3300025928 Bacteria 5044
919 Ga0207700_10018117 3300025928 Bacteria 4723
920 Ga0207700_10020581 3300025928 Bacteria 4485
921 Ga0207700_10073707 3300025928 Bacteria 2637
922 Ga0207700_10084327 3300025928 Bacteria 2490
923 Ga0207700_10101369 3300025928 Bacteria 2297
924 Ga0207700_10120743 3300025928 Bacteria 2124
925 Ga0207664_10016357 3300025929 Bacteria 5410
926 Ga0207664_10018977 3300025929 Bacteria 5074
927 Ga0207664_10029248 3300025929 Bacteria 4195
928 Ga0207664_10039092 3300025929 Bacteria 3682
929 Ga0207664_10054997 3300025929 Bacteria 3156
930 Ga0207664_10083524 3300025929 Bacteria 2604
931 Ga0207664_10160779 3300025929 Bacteria 1915
932 Ga0207644_10006166 3300025931 Bacteria 7816
933 Ga0207644_10009382 3300025931 Bacteria 6427
934 Ga0207644_10010162 3300025931 Bacteria 6200
935 Ga0207644_10020651 3300025931 Bacteria 4482
936 Ga0207644_10066682 3300025931 Bacteria 2621
937 Ga0207690_10000953 3300025932 Bacteria 18524
938 Ga0207690_10020076 3300025932 Bacteria 4123
939 Ga0207690_10051950 3300025932 Bacteria 2743
940 Ga0207690_10105442 3300025932 Bacteria 2021
941 Ga0207706_10009006 3300025933 Bacteria 9185
942 Ga0207706_10020589 3300025933 Bacteria 5928
943 Ga0207706_10022836 3300025933 Bacteria 5613
944 Ga0207706_10025278 3300025933 Bacteria 5322
945 Ga0207706_10026762 3300025933 Bacteria 5163
946 Ga0207706_10034150 3300025933 Bacteria 4525
947 Ga0207686_10004859 3300025934 Bacteria 7224
948 Ga0207709_10004590 3300025935 Bacteria 7946
949 Ga0207709_10009427 3300025935 Bacteria 5372
950 Ga0207709_10092041 3300025935 Bacteria 1984
951 Ga0207670_10000731 3300025936 Bacteria 17259
952 Ga0207670_10002332 3300025936 Bacteria 9942
953 Ga0207670_10016264 3300025936 Bacteria 4466
954 Ga0207670_10085361 3300025936 Bacteria 2218
955 Ga0207670_10096410 3300025936 Bacteria 2103
956 Ga0207669_10000538 3300025937 Bacteria 16538
957 Ga0207669_10007894 3300025937 Bacteria 4960
958 Ga0207669_10014485 3300025937 Bacteria 3953
959 Ga0207669_10020048 3300025937 Bacteria 3496
960 Ga0207704_10001761 3300025938 Bacteria 9683
961 Ga0207704_10008415 3300025938 Bacteria 4932
962 Ga0207704_10118292 3300025938 Bacteria 1807
963 Ga0207704_10131047 3300025938 Bacteria 1736
964 Ga0207704_10185300 3300025938 Bacteria 1508
965 Ga0207665_10001296 3300025939 Bacteria 16883
966 Ga0207665_10001463 3300025939 Bacteria 15900
967 Ga0207665_10002892 3300025939 Bacteria 11522
968 Ga0207665_10003511 3300025939 Bacteria 10469
969 Ga0207665_10017491 3300025939 Bacteria 4712
970 Ga0207665_10024541 3300025939 Bacteria 3976
971 Ga0207665_10125079 3300025939 Bacteria 1820
972 Ga0207665_10180038 3300025939 Bacteria 1530
973 Ga0207691_10001399 3300025940 Bacteria 24140
974 Ga0207691_10001984 3300025940 Bacteria 20012
975 Ga0207691_10018717 3300025940 Bacteria 6561
976 Ga0207691_10048406 3300025940 Bacteria 3898
977 Ga0207711_10002344 3300025941 Bacteria 16966
978 Ga0207711_10010081 3300025941 Bacteria 7855
979 Ga0207711_10022179 3300025941 Bacteria 5309
980 Ga0207711_10024759 3300025941 Bacteria 5034
981 Ga0207711_10034149 3300025941 Bacteria 4308
982 Ga0207689_10000503 3300025942 Bacteria 36892
983 Ga0207689_10003495 3300025942 Bacteria 14359
984 Ga0207689_10010214 3300025942 Bacteria 8089
985 Ga0207661_10001274 3300025944 Bacteria 16851
986 Ga0207661_10036312 3300025944 Bacteria 3845
987 Ga0207661_10044111 3300025944 Bacteria 3522
988 Ga0207679_10007046 3300025945 Bacteria 7128
989 Ga0207679_10093556 3300025945 Bacteria 2332
990 Ga0207679_10159422 3300025945 Bacteria 1846
991 Ga0207667_10002525 3300025949 Bacteria 22786
992 Ga0207667_10005244 3300025949 Bacteria 15813
993 Ga0207667_10006325 3300025949 Bacteria 14350
994 Ga0207667_10012846 3300025949 Bacteria 9622
995 Ga0207667_10021610 3300025949 Bacteria 7129
996 Ga0207667_10046023 3300025949 Bacteria 4619
997 Ga0207667_10054142 3300025949 Bacteria 4220
998 Ga0207667_10115861 3300025949 Bacteria 2762
999 Ga0207651_10012345 3300025960 Bacteria 4830
1000 Ga0207651_10012534 3300025960 Bacteria 4803
1001 Ga0207651_10014181 3300025960 Bacteria 4593
1002 Ga0207651_10040996 3300025960 Bacteria 3069
1003 Ga0207651_10104472 3300025960 Bacteria 2111
1004 Ga0207712_10001942 3300025961 Bacteria 13572
1005 Ga0207712_10005326 3300025961 Bacteria 8123
1006 Ga0207712_10028620 3300025961 Bacteria 3729
1007 Ga0207712_10239083 3300025961 Bacteria 1462
1008 Ga0207668_10003473 3300025972 Bacteria 9247
1009 Ga0207668_10025269 3300025972 Bacteria 3842
1010 Ga0207668_10028713 3300025972 Bacteria 3640
1011 Ga0207668_10045029 3300025972 Bacteria 3006
1012 Ga0207668_10057581 3300025972 Bacteria 2712
1013 Ga0207640_10007626 3300025981 Bacteria 5974
1014 Ga0207640_10046659 3300025981 Bacteria 2790
1015 Ga0207640_10050100 3300025981 Bacteria 2707
1016 Ga0207658_10012739 3300025986 Bacteria 5744
1017 Ga0207658_10349489 3300025986 Bacteria 1287
1018 Ga0207677_10002538 3300026023 Bacteria 9574
1019 Ga0207677_10047395 3300026023 Bacteria 2885
1020 Ga0207677_10096948 3300026023 Bacteria 2159
1021 Ga0207703_10001883 3300026035 Bacteria 18645
1022 Ga0207703_10013028 3300026035 Bacteria 6480
1023 Ga0207703_10064594 3300026035 Bacteria 3005
1024 Ga0207703_10113385 3300026035 Bacteria 2317
1025 Ga0207639_10002783 3300026041 Bacteria 11742
1026 Ga0207639_10008102 3300026041 Bacteria 7185
1027 Ga0207639_10009386 3300026041 Bacteria 6747
1028 Ga0207639_10010395 3300026041 Bacteria 6445
1029 Ga0207639_10150609 3300026041 Bacteria 1948
1030 Ga0207639_10216561 3300026041 Bacteria 1651
1031 Ga0207678_10001725 3300026067 Bacteria 20014
1032 Ga0207678_10004088 3300026067 Bacteria 13123
1033 Ga0207678_10009392 3300026067 Bacteria 8605
1034 Ga0207678_10027585 3300026067 Bacteria 4955
1035 Ga0207678_10048870 3300026067 Bacteria 3655
1036 Ga0207678_10069767 3300026067 Bacteria 3013
1037 Ga0207678_10104634 3300026067 Bacteria 2415
1038 Ga0207678_10147494 3300026067 Bacteria 2008
1039 Ga0207708_10000547 3300026075 Bacteria 28999
1040 Ga0207708_10004170 3300026075 Bacteria 10623
1041 Ga0207708_10007309 3300026075 Bacteria 8167
1042 Ga0207702_10000002 3300026078 Bacteria 491507
1043 Ga0207702_10000126 3300026078 Bacteria 90550
1044 Ga0207702_10004224 3300026078 Bacteria 12831
1045 Ga0207702_10023264 3300026078 Bacteria 5138
1046 Ga0207702_10032072 3300026078 Bacteria 4383
1047 Ga0207702_10061307 3300026078 Bacteria 3208
1048 Ga0207702_10236649 3300026078 Bacteria 1709
1049 Ga0207702_10326981 3300026078 Bacteria 1461
1050 Ga0207641_10003985 3300026088 Bacteria 12890
1051 Ga0207648_10001178 3300026089 Bacteria 29263
1052 Ga0207648_10001416 3300026089 Bacteria 26440
1053 Ga0207648_10038200 3300026089 Bacteria 4225
1054 Ga0207648_10045343 3300026089 Bacteria 3857
1055 Ga0207648_10098110 3300026089 Bacteria 2565
1056 Ga0207648_10125780 3300026089 Bacteria 2255
1057 Ga0207648_10126834 3300026089 Bacteria 2245
1058 Ga0207676_10001299 3300026095 Bacteria 18580
1059 Ga0207676_10002095 3300026095 Bacteria 14448
1060 Ga0207676_10054111 3300026095 Bacteria 3144
1061 Ga0207676_10071537 3300026095 Bacteria 2785
1062 Ga0207676_10100799 3300026095 Bacteria 2393
1063 Ga0207676_10167048 3300026095 Bacteria 1913
1064 Ga0207676_10417416 3300026095 Bacteria 1258
1065 Ga0207674_10007592 3300026116 Bacteria 12635
1066 Ga0207674_10042017 3300026116 Bacteria 4725
1067 Ga0207674_10046689 3300026116 Bacteria 4445
1068 Ga0207674_10079786 3300026116 Bacteria 3276
1069 Ga0207674_10086147 3300026116 Bacteria 3136
1070 Ga0207674_10204712 3300026116 Bacteria 1923
1071 Ga0207674_10355247 3300026116 Bacteria 1417
1072 Ga0207675_100000190 3300026118 Bacteria 55772
1073 Ga0207675_100002065 3300026118 Bacteria 20012
1074 Ga0207675_100016489 3300026118 Bacteria 6899
1075 Ga0207675_100023453 3300026118 Bacteria 5740
1076 Ga0207683_10000069 3300026121 Bacteria 78741
1077 Ga0207683_10002867 3300026121 Bacteria 15038
1078 Ga0207683_10014712 3300026121 Bacteria 6664
1079 Ga0207683_10020473 3300026121 Bacteria 5658
1080 Ga0207683_10042619 3300026121 Bacteria 3964
1081 Ga0207683_10073526 3300026121 Bacteria 3024
1082 Ga0207683_10078716 3300026121 Bacteria 2921
1083 Ga0207683_10088268 3300026121 Bacteria 2759
1084 Ga0207683_10092545 3300026121 Bacteria 2694
1085 Ga0207683_10113164 3300026121 Bacteria 2431
1086 Ga0207698_10006596 3300026142 Bacteria 7257
1087 Ga0207698_10027648 3300026142 Bacteria 4030
1088 Ga0207698_10029389 3300026142 Bacteria 3936
1089 Ga0207698_10073697 3300026142 Bacteria 2720
1090 Ga0207698_10110754 3300026142 Bacteria 2300
1091 Ga0209281_1000076 3300027111 Bacteria 263350
1092 Ga0209281_1000128 3300027111 Bacteria 199265
1093 Ga0209281_1000496 3300027111 Bacteria 53494
1094 Ga0209281_1007629 3300027111 Bacteria 2701
1095 Ga0209389_1000040 3300027296 Bacteria 124256
1096 Ga0209389_1000123 3300027296 Bacteria 70041
1097 Ga0209371_1000022 3300027312 Bacteria 536342
1098 Ga0209371_1002845 3300027312 Bacteria 9157
1099 Ga0209589_1000001 3300027357 Bacteria 794224
1100 Ga0209589_1000036 3300027357 Bacteria 131278
1101 Ga0209969_1002406 3300027360 Bacteria 2586
1102 Ga0209489_100001 3300027361 Bacteria 794224
1103 Ga0209489_100006 3300027361 Bacteria 475698
1104 Ga0209700_100001 3300027363 Bacteria 794224
1105 Ga0209700_100005 3300027363 Bacteria 573969
1106 Ga0209999_1003561 3300027543 Bacteria 2790
1107 Ga0210002_1001002 3300027617 Bacteria 3909
1108 Ga0209282_1000039 3300027666 Bacteria 128517
1109 Ga0209282_1000100 3300027666 Bacteria 59184
1110 Ga0209971_1004787 3300027682 Bacteria 3215
1111 Ga0209966_1000576 3300027695 Bacteria 8921
1112 Ga0209998_10000606 3300027717 Bacteria 9633
1113 Ga0209998_10002913 3300027717 Bacteria 3832
1114 Ga0209813_10013666 3300027866 Bacteria 2172
1115 Ga0209974_10046815 3300027876 Bacteria 1447
1116 Ga0207428_10000198 3300027907 Bacteria 84187
1117 Ga0207428_10000312 3300027907 Bacteria 64494
1118 Ga0207428_10000578 3300027907 Bacteria 43283
1119 Ga0207428_10000908 3300027907 Bacteria 33083
1120 Ga0207428_10008834 3300027907 Bacteria 9084
1121 Ga0207428_10051612 3300027907 Bacteria 3287
1122 Ga0268266_10059811 3300028379 Bacteria 3282
1123 Ga0268266_10103610 3300028379 Bacteria 2511
1124 Ga0268266_10173694 3300028379 Bacteria 1957
1125 Ga0268265_10065606 3300028380 Bacteria 2802
1126 Ga0268264_10000065 3300028381 Bacteria 298403
1127 Ga0268264_10004307 3300028381 Bacteria 12144
1128 Ga0268264_10051309 3300028381 Bacteria 3437
1129 Ga0265337_1002249 3300028556 Bacteria 8967
1130 Ga0265337_1002492 3300028556 Bacteria 8393
1131 Ga0265326_10011167 3300028558 Bacteria 2651
1132 Ga0265334_10001756 3300028573 Bacteria 10354
1133 Ga0265334_10032169 3300028573 Bacteria 2093
1134 Ga0265318_10004183 3300028577 Bacteria 7049
1135 Ga0265323_10001892 3300028653 Bacteria 9875
1136 Ga0265322_10019041 3300028654 Bacteria 1971
1137 Ga0265336_10001788 3300028666 Bacteria 9401
1138 Ga0307517_10000008 3300028786 Bacteria 243202
1139 Ga0265338_10000321 3300028800 Bacteria 87046
1140 Ga0265338_10022608 3300028800 Bacteria 6501
1141 Ga0265338_10033094 3300028800 Bacteria 5025
1142 Ga0265338_10143091 3300028800 Bacteria 1870
1143 Ga0265324_10002078 3300029957 Bacteria 10605
1144 Ga0268256_1000019 3300030500 Bacteria 587949
1145 Ga0268256_1004441 3300030500 Bacteria 5813
1146 Ga0307511_10075112 3300030521 Bacteria 2429
1147 Ga0316181_1006667 3300030744 Bacteria 2660
1148 Ga0265760_10014211 3300031090 Bacteria 2279
1149 Ga0265332_10004954 3300031238 Bacteria 6189
1150 Ga0265320_10042368 3300031240 Bacteria 2258
1151 Ga0265325_10000004 3300031241 Bacteria 347347
1152 Ga0265325_10000172 3300031241 Bacteria 45954
1153 Ga0265325_10003859 3300031241 Bacteria 9628
1154 Ga0265325_10005573 3300031241 Bacteria 7766
1155 Ga0265325_10008790 3300031241 Bacteria 5936
1156 Ga0265325_10023370 3300031241 Bacteria 3376
1157 Ga0265325_10082433 3300031241 Bacteria 1596
1158 Ga0265325_10122730 3300031241 Bacteria 1250
1159 Ga0265340_10000674 3300031247 Bacteria 19133
1160 Ga0265340_10013956 3300031247 Bacteria 4209
1161 Ga0265340_10017773 3300031247 Bacteria 3678
1162 Ga0265340_10034740 3300031247 Bacteria 2507
1163 Ga0265340_10038971 3300031247 Bacteria 2348
1164 Ga0265340_10047672 3300031247 Bacteria 2085
1165 Ga0265339_10000330 3300031249 Bacteria 38106
1166 Ga0265339_10003099 3300031249 Bacteria 11697
1167 Ga0265339_10004140 3300031249 Bacteria 9989
1168 Ga0265339_10009592 3300031249 Bacteria 6066
1169 Ga0265339_10019287 3300031249 Bacteria 4008
1170 Ga0265339_10046228 3300031249 Bacteria 2394
1171 Ga0265331_10009183 3300031250 Bacteria 5575
1172 Ga0265331_10022871 3300031250 Bacteria 3184
1173 Ga0265316_10057734 3300031344 Bacteria 3025
1174 Ga0265316_10114951 3300031344 Bacteria 2035
1175 Ga0265316_10245546 3300031344 Bacteria 1316
1176 Ga0307513_10002722 3300031456 Bacteria 24331
1177 Ga0307513_10035190 3300031456 Bacteria 5607
1178 Ga0307513_10062899 3300031456 Bacteria 3920
1179 Ga0307513_10102323 3300031456 Bacteria 2884
1180 Ga0307513_10322657 3300031456 Bacteria 1302
1181 Ga0307509_10089892 3300031507 Bacteria 3147
1182 Ga0307509_10244860 3300031507 Bacteria 1582
1183 Ga0307408_100090426 3300031548 Unclassified 2310
1184 Ga0265313_10000176 3300031595 Bacteria 68037
1185 Ga0265313_10000572 3300031595 Bacteria 38438
1186 Ga0265313_10002253 3300031595 Bacteria 16951
1187 Ga0265313_10008621 3300031595 Bacteria 6745
1188 Ga0265313_10016010 3300031595 Bacteria 4334
1189 Ga0265313_10016397 3300031595 Bacteria 4260
1190 Ga0265313_10042830 3300031595 Bacteria 2220
1191 Ga0265313_10087204 3300031595 Bacteria 1407
1192 Ga0307508_10000018 3300031616 Bacteria 202701
1193 Ga0307508_10080781 3300031616 Bacteria 2833
1194 Ga0307508_10158279 3300031616 Bacteria 1868
1195 Ga0316575_10041734 3300031665 Bacteria 1815
1196 Ga0265314_10001133 3300031711 Bacteria 30864
1197 Ga0265314_10002100 3300031711 Bacteria 20973
1198 Ga0265314_10009137 3300031711 Bacteria 8412
1199 Ga0265314_10014338 3300031711 Bacteria 6350
1200 Ga0265314_10024621 3300031711 Bacteria 4561
1201 Ga0265314_10088673 3300031711 Bacteria 2019
1202 Ga0265314_10104967 3300031711 Bacteria 1808
1203 Ga0265342_10000148 3300031712 Bacteria 79748
1204 Ga0265342_10000196 3300031712 Bacteria 67364
1205 Ga0265342_10005459 3300031712 Bacteria 9682
1206 Ga0265342_10015115 3300031712 Bacteria 5091
1207 Ga0307516_10014561 3300031730 Bacteria 8313
1208 Ga0307516_10066954 3300031730 Bacteria 3462
1209 Ga0307516_10071784 3300031730 Bacteria 3323
1210 Ga0307413_10005951 3300031824 Bacteria 5514
1211 Ga0307410_10006626 3300031852 Bacteria 6268
1212 Ga0307410_10151734 3300031852 Bacteria 1726
1213 Ga0307406_10062745 3300031901 Bacteria 2405
1214 Ga0307407_10105260 3300031903 Bacteria 1760
1215 Ga0307407_10143414 3300031903 Bacteria 1544
1216 Ga0307412_10001651 3300031911 Bacteria 12316
1217 Ga0307412_10165201 3300031911 Bacteria 1650
1218 Ga0315914_1000010 3300031967 Bacteria 171642
1219 Ga0307409_100107636 3300031995 Bacteria 2329
1220 Ga0307409_100157231 3300031995 Bacteria 1983
1221 Ga0307409_100276336 3300031995 Bacteria 1550
1222 Ga0307414_10031373 3300032004 Unclassified 3485
1223 Ga0307414_10070407 3300032004 Bacteria 2519
1224 Ga0307411_10041309 3300032005 Bacteria 2933
1225 Ga0307411_10229286 3300032005 Bacteria 1446
1226 Ga0307507_10024914 3300033179 Bacteria 6503
1227 Ga0307510_10002813 3300033180 Bacteria 19952
1228 Ga0307510_10020196 3300033180 Bacteria 7791
1229 Ga0307510_10061161 3300033180 Bacteria 3865
1230 Ga0307510_10067745 3300033180 Bacteria 3590
1231 Ga0315913_1000005 3300033430 Bacteria 171651
1232 Ga0315911_1000006 3300033442 Bacteria 414563
1233 Ga0315915_1000012 3300033464 Bacteria 199284
1234 Ga0373930_0000062 3300034816 Bacteria 10314
1235 Ga0373948_0000051 3300034817 Bacteria 12492
1236 Ga0373950_0000418 3300034818 Bacteria 5189
1237 Ga0373950_0001085 3300034818 Bacteria 3475
1238 Ga0373950_0002232 3300034818 Bacteria 2644
1239 Ga0373958_0000123 3300034819 Bacteria 8540
1240 Ga0373959_0000191 3300034820 Bacteria 13735
1241 Ga0373938_0000141 3300034957 Bacteria 10420
1242 Ga0373938_0000287 3300034957 Bacteria 8101
1243 Ga0373926_0014543 3300035083 Bacteria 2676
1244 Ga0373926_0023841 3300035083 Bacteria 2127
1245 Ga0373928_0003217 3300035084 Bacteria 3126
1246 Ga0373929_0001387 3300035085 Bacteria 4642
1247 Ga0373929_0012687 3300035085 Bacteria 1605
1248 Ga0373934_0004739 3300035086 Bacteria 5029
1249 Ga0373934_0011693 3300035086 Bacteria 3305
1250 Ga0373934_0070997 3300035086 Bacteria 1393
1251 Ga0373940_0000365 3300035088 Bacteria 6788
1252 Ga0373940_0008793 3300035088 Bacteria 2328
1253 Ga0373944_0003497 3300035089 Bacteria 4059
1254 Ga0373944_0008808 3300035089 Bacteria 2727
1255 Ga0373944_0009077 3300035089 Bacteria 2690
1256 Ga0373944_0023567 3300035089 Bacteria 1797
1257 Ga0373944_0037297 3300035089 Bacteria 1488
1258 Ga0373949_0004024 3300035090 Bacteria 3408
1259 Ga0373949_0007442 3300035090 Bacteria 2397
1260 Ga0373951_0001019 3300035091 Bacteria 7538
1261 Ga0373952_0000465 3300035092 Bacteria 7082
1262 Ga0373952_0002504 3300035092 Bacteria 3309
1263 Ga0373952_0010270 3300035092 Bacteria 1807
1264 Ga0373923_0003017 3300035111 Bacteria 5319
1265 Ga0373923_0003695 3300035111 Bacteria 4953
1266 Ga0373923_0006013 3300035111 Bacteria 4162
1267 Ga0373923_0012345 3300035111 Bacteria 3156
1268 Ga0373923_0013075 3300035111 Bacteria 3086
1269 Ga0373923_0017037 3300035111 Bacteria 2773
1270 Ga0373932_0000305 3300035112 Bacteria 14847
1271 Ga0373932_0001852 3300035112 Bacteria 5670
1272 Ga0373932_0026993 3300035112 Bacteria 1567
1273 Ga0373936_0000082 3300035113 Bacteria 35991
1274 Ga0373936_0000290 3300035113 Bacteria 16812
1275 Ga0373936_0000946 3300035113 Bacteria 10370
1276 Ga0373936_0007442 3300035113 Bacteria 4117
1277 Ga0373936_0012489 3300035113 Bacteria 3232
1278 Ga0373936_0013610 3300035113 Bacteria 3105
1279 Ga0373936_0014254 3300035113 Bacteria 3038
1280 Ga0373936_0057060 3300035113 Bacteria 1588
1281 Ga0373939_0000355 3300035114 Bacteria 11602
1282 Ga0373939_0003430 3300035114 Bacteria 3718
1283 Ga0373939_0005402 3300035114 Bacteria 3043
1284 Ga0373941_0001908 3300035115 Bacteria 4515
1285 Ga0373941_0002882 3300035115 Bacteria 3835
1286 Ga0373945_0005133 3300035116 Bacteria 4179
1287 Ga0373945_0034466 3300035116 Bacteria 1804
1288 Ga0373945_0059657 3300035116 Bacteria 1421
1289 Ga0373953_0006758 3300035117 Bacteria 3799
1290 Ga0373953_0010746 3300035117 Bacteria 3196
1291 Ga0373953_0026996 3300035117 Bacteria 2203
1292 Ga0373953_0035276 3300035117 Bacteria 1965
1293 Ga0373953_0052471 3300035117 Bacteria 1650
1294 Ga0373954_0003768 3300035118 Bacteria 6466
1295 Ga0373954_0006443 3300035118 Bacteria 5119
1296 Ga0373954_0009287 3300035118 Bacteria 4327
1297 Ga0373954_0009326 3300035118 Bacteria 4317
1298 Ga0373954_0012508 3300035118 Bacteria 3774
1299 Ga0373954_0012944 3300035118 Bacteria 3715
1300 Ga0373954_0035182 3300035118 Bacteria 2322
1301 Ga0373954_0085459 3300035118 Bacteria 1511
1302 Ga0373956_0005842 3300035119 Bacteria 4922
1303 Ga0373956_0027831 3300035119 Bacteria 2457
1304 Ga0373956_0037968 3300035119 Bacteria 2130
1305 Ga0373957_0003174 3300035120 Bacteria 4815
1306 Ga0373957_0003945 3300035120 Bacteria 4455
1307 Ga0373957_0029892 3300035120 Bacteria 1993
1308 Ga0373957_0046275 3300035120 Bacteria 1651
1309 Ga0373960_0000049 3300035121 Bacteria 16154
1310 Ga0373960_0000939 3300035121 Bacteria 6241
1311 Ga0373960_0006872 3300035121 Bacteria 2680
1312 Ga0373960_0012406 3300035121 Bacteria 2117
1313 Ga0373960_0015179 3300035121 Bacteria 1961
1314 Ga0373943_0000731 3300035170 Bacteria 14311
1315 Ga0373943_0001740 3300035170 Bacteria 9873
1316 Ga0373943_0009675 3300035170 Bacteria 4318
1317 Ga0373943_0032340 3300035170 Bacteria 2486
1318 Ga0373943_0066731 3300035170 Bacteria 1813
1319 Ga0373946_0001140 3300035171 Bacteria 9196
1320 Ga0373946_0004807 3300035171 Bacteria 4862
1321 Ga0373946_0012296 3300035171 Bacteria 3202
1322 Ga0373946_0014320 3300035171 Bacteria 2989
1323 Ga0373946_0042153 3300035171 Bacteria 1875
1324 Ga0373955_0000306 3300035172 Bacteria 20291
1325 Ga0373955_0004397 3300035172 Bacteria 6236
1326 Ga0373955_0020245 3300035172 Bacteria 3341
1327 Ga0373955_0027638 3300035172 Bacteria 2935
1328 Ga0373942_0000263 3300035207 Bacteria 14039
1329 Ga0373942_0002162 3300035207 Bacteria 4848
1330 Ga0373961_0000821 3300035241 Bacteria 10558
1331 Ga0373962_0000166 3300035242 Bacteria 14061
1332 Ga0373962_0001762 3300035242 Bacteria 5150
1333 Ga0373962_0004665 3300035242 Bacteria 3307
1334 Ga0373962_0006951 3300035242 Bacteria 2758
1335 Ga0316574_0004257 3300035398 Bacteria 7477
1336 Ga0373924_0000437 3300035410 Bacteria 12805
1337 Ga0373924_0005336 3300035410 Bacteria 4544
1338 Ga0373924_0008896 3300035410 Bacteria 3665
1339 Ga0373924_0025681 3300035410 Bacteria 2329
1340 Ga0373924_0033174 3300035410 Bacteria 2083
1341 Ga0373924_0054754 3300035410 Bacteria 1659
1342 Ga0373931_0000251 3300035691 Bacteria 22877
1343 Ga0373931_0002892 3300035691 Bacteria 7657
1344 Ga0373931_0003067 3300035691 Bacteria 7469
1345 Ga0373931_0003885 3300035691 Bacteria 6758
1346 Ga0373931_0006942 3300035691 Bacteria 5328
1347 Ga0373931_0007466 3300035691 Bacteria 5151
1348 Ga0373931_0014118 3300035691 Bacteria 3900
1349 Ga0373931_0058607 3300035691 Bacteria 2068
1350 Ga0373935_0000287 3300035692 Bacteria 24929
1351 Ga0373935_0000382 3300035692 Bacteria 22745
1352 Ga0373935_0004967 3300035692 Bacteria 7823
1353 Ga0373935_0012579 3300035692 Bacteria 5093
1354 Ga0373935_0019053 3300035692 Bacteria 4185
1355 Ga0373935_0025698 3300035692 Bacteria 3629
1356 Ga0373935_0032906 3300035692 Bacteria 3224
1357 Ga0373935_0103576 3300035692 Bacteria 1880
1358 Ga0373935_0107899 3300035692 Bacteria 1844
1359 Ga0373927_0001986 3300035695 Bacteria 15072
1360 Ga0373927_0002885 3300035695 Bacteria 12521
1361 Ga0373927_0003772 3300035695 Bacteria 10756
1362 Ga0373927_0006211 3300035695 Bacteria 8159
1363 Ga0373927_0006833 3300035695 Bacteria 7765
1364 Ga0373927_0024472 3300035695 Bacteria 3949
1365 Ga0373927_0027258 3300035695 Bacteria 3731
1366 Ga0373927_0034185 3300035695 Bacteria 3307
1367 Ga0373927_0035489 3300035695 Bacteria 3242
1368 Ga0373927_0048028 3300035695 Bacteria 2760
1369 Ga0373927_0049440 3300035695 Bacteria 2718
1370 Ga0373927_0057068 3300035695 Bacteria 2525
1371 Ga0373927_0120841 3300035695 Bacteria 1709
1372 Ga0373933_0000110 3300035724 Bacteria 52519
1373 Ga0373933_0002816 3300035724 Bacteria 9717
1374 Ga0373933_0004137 3300035724 Bacteria 7991
1375 Ga0373933_0005829 3300035724 Bacteria 6699
1376 Ga0373933_0006160 3300035724 Bacteria 6530
1377 Ga0373933_0008646 3300035724 Bacteria 5554
1378 Ga0373933_0020415 3300035724 Bacteria 3754
1379 Ga0373947_0000156 3300035725 Bacteria 36048
1380 Ga0373947_0001850 3300035725 Bacteria 12909
1381 Ga0373947_0002644 3300035725 Bacteria 10766
1382 Ga0373947_0004465 3300035725 Bacteria 8211
1383 Ga0373947_0004860 3300035725 Bacteria 7855
1384 Ga0373947_0005528 3300035725 Bacteria 7375
1385 Ga0373947_0008142 3300035725 Bacteria 6044
1386 Ga0373947_0011440 3300035725 Bacteria 5092
1387 Ga0373947_0012827 3300035725 Bacteria 4803
1388 Ga0373947_0022837 3300035725 Bacteria 3631
1389 Ga0373947_0042745 3300035725 Bacteria 2705
1390 Ga0373947_0088100 3300035725 Bacteria 1931
1391 Ga0373947_0101709 3300035725 Bacteria 1807
1392 Ga0373937_0000269 3300036401 Bacteria 50111
1393 Ga0373937_0003306 3300036401 Bacteria 13538
1394 Ga0373937_0007162 3300036401 Bacteria 9645
1395 Ga0373937_0007207 3300036401 Bacteria 9622
1396 Ga0373937_0008870 3300036401 Bacteria 8730
1397 Ga0373937_0012150 3300036401 Bacteria 7558
1398 Ga0373937_0022596 3300036401 Bacteria 5657
1399 Ga0373937_0023869 3300036401 Bacteria 5514
1400 Ga0373937_0039555 3300036401 Bacteria 4297
1401 Ga0373937_0046402 3300036401 Bacteria 3973
1402 Ga0373937_0048939 3300036401 Bacteria 3870
1403 Ga0373937_0052305 3300036401 Bacteria 3744
1404 Ga0373937_0122394 3300036401 Bacteria 2425
1405 Ga0373937_0191120 3300036401 Bacteria 1924
1406 Ga0373937_0203326 3300036401 Bacteria 1862
1407 Ga0373937_0205428 3300036401 Bacteria 1852
1408 Ga0373937_0393298 3300036401 Bacteria 1315
1409 Ga0373925_0000075 3300037068 Bacteria 105395
1410 Ga0373925_0002634 3300037068 Bacteria 14243
1411 Ga0373925_0002995 3300037068 Bacteria 13303
1412 Ga0373925_0025219 3300037068 Bacteria 4341
1413 Ga0373925_0030557 3300037068 Bacteria 3954
1414 Ga0373925_0050209 3300037068 Bacteria 3111
1415 Ga0373925_0058607 3300037068 Bacteria 2887
1416 Ga0373925_0076823 3300037068 Bacteria 2534
1417 Ga0373925_0122814 3300037068 Bacteria 2017
1418 Ga0373925_0161133 3300037068 Bacteria 1767
1419 Ga0373925_0161974 3300037068 Bacteria 1762
1420 Ga0373925_0209548 3300037068 Bacteria 1552
1421 Ga0395899_0000090 3300037312 Bacteria 156587
1422 Ga0395899_0021302 3300037312 Bacteria 4917
1423 Ga0395899_0031696 3300037312 Bacteria 3972
1424 Ga0395899_0141965 3300037312 Bacteria 1708
1425 Ga0395900_0000017 3300037418 Bacteria 369602
1426 Ga0395900_0000940 3300037418 Bacteria 38072
1427 Ga0395900_0034081 3300037418 Bacteria 5241
1428 Ga0395900_0147352 3300037418 Bacteria 2407
1429 Ga0395900_0206362 3300037418 Bacteria 1986
1430 Ga0395898_0000030 3300037466 Bacteria 369577
1431 Ga0395898_0029285 3300037466 Bacteria 5517
1432 Ga0395898_0029616 3300037466 Bacteria 5480
1433 Ga0395898_0032592 3300037466 Bacteria 5202
1434 Ga0395898_0061821 3300037466 Bacteria 3638
1435 Ga0395898_0079128 3300037466 Bacteria 3171
1436 Ga0395898_0118976 3300037466 Bacteria 2531
1437 Ga0395898_0140265 3300037466 Bacteria 2314
1438 Ga0395905_0000081 3300037471 Bacteria 160409
1439 Ga0395905_0004739 3300037471 Bacteria 14053
1440 Ga0395905_0005715 3300037471 Bacteria 12643
1441 Ga0395905_0030761 3300037471 Bacteria 5056
1442 Ga0395905_0079814 3300037471 Bacteria 3067
1443 Ga0395905_0180690 3300037471 Bacteria 1981
1444 Ga0436364_0010736 3300037853 Bacteria 24036
1445 Ga0436364_0281278 3300037853 Bacteria 34090
1446 Ga0436364_0400687 3300037853 Bacteria 4078
1447 Ga0436364_0409058 3300037853 Bacteria 2189
1448 Ga0436364_0529683 3300037853 Bacteria 5388
1449 Ga0436364_0612608 3300037853 Bacteria 3125
1450 Ga0436364_0711898 3300037853 Bacteria 3155
1451 Ga0436364_0777339 3300037853 Bacteria 3070
1452 Ga0436364_0817653 3300037853 Bacteria 49922
1453 Ga0436364_1320386 3300037853 Bacteria 1512
1454 Ga0436364_1385698 3300037853 Bacteria 2965
1455 Ga0395901_0000015 3300038443 Bacteria 373388
1456 Ga0395901_0000055 3300038443 Bacteria 157964
1457 Ga0395901_0024150 3300038443 Bacteria 6236
1458 Ga0395901_0050570 3300038443 Bacteria 4317
1459 Ga0395901_0051490 3300038443 Bacteria 4281
1460 Ga0395901_0072724 3300038443 Bacteria 3585
1461 Ga0395901_0083716 3300038443 Bacteria 3334
1462 Ga0395901_0132765 3300038443 Bacteria 2616
1463 Ga0395901_0338810 3300038443 Bacteria 1554
1464 Ga0395901_0353499 3300038443 Bacteria 1516
1465 Ga0400483_222177 3300039062 Bacteria 2165
1466 Ga0400483_222778 3300039062 Bacteria 11316
1467 Ga0400483_239471 3300039062 Bacteria 7323
1468 Ga0436365_0134733 3300039437 Bacteria 5028
1469 Ga0436365_0154683 3300039437 Bacteria 12355
1470 Ga0436365_1332159 3300039437 Bacteria 25414
1471 Ga0436365_1463106 3300039437 Bacteria 11734
1472 Ga0436365_1713855 3300039437 Bacteria 2438
1473 Ga0436365_1748556 3300039437 Bacteria 2728
1474 Ga0436365_1892050 3300039437 Bacteria 2719
1475 Ga0436360_0049575 3300039438 Bacteria 3015
1476 Ga0436360_0205335 3300039438 Bacteria 6585
1477 Ga0436360_0370851 3300039438 Bacteria 1646
1478 Ga0436360_0822831 3300039438 Bacteria 1631
1479 Ga0436360_1106222 3300039438 Bacteria 6379
1480 Ga0436361_0052401 3300039447 Bacteria 12376
1481 Ga0436361_0365828 3300039447 Bacteria 13089
1482 Ga0436361_1108010 3300039447 Bacteria 1528
1483 Ga0436363_0267009 3300039450 Bacteria 1257
1484 Ga0436363_0410105 3300039450 Bacteria 2479
1485 Ga0436363_0660862 3300039450 Bacteria 3711
1486 Ga0436363_0878076 3300039450 Bacteria 2174
1487 Ga0436363_1159398 3300039450 Bacteria 2747
1488 Ga0436363_1595676 3300039450 Bacteria 2940
1489 Ga0436362_0057416 3300039453 Bacteria 2387
1490 Ga0436362_1133249 3300039453 Bacteria 2638
1491 Ga0439453_0000022 3300041408 Bacteria 9833
1492 Ga0439465_0022466 3300041413 Bacteria 1982
1493 Ga0439449_0007041 3300042007 Bacteria 4283
1494 Ga0439462_0024753 3300042015 Bacteria 1579
1495 Ga0450894_014274 3300042131 Bacteria 1046
1496 Ga0450902_000021 3300042137 Bacteria 14340
1497 Ga0451577_0214895 3300042876 Bacteria 1738
1498 Ga0439440_0029940 3300042993 Bacteria 1280
1499 Ga0466972_0000160 3300044658 Bacteria 54154
1500 Ga0466972_0001455 3300044658 Bacteria 11506
1501 Ga0466972_0023293 3300044658 Bacteria 3080
1502 Ga0466972_0031030 3300044658 Bacteria 2630
1503 Ga0466973_0019539 3300044659 Bacteria 6459
1504 Ga0466977_0000186 3300044666 Bacteria 16059
1505 Ga0466965_0027283 3300044683 Bacteria 2771
1506 Ga0466966_0006283 3300044684 Bacteria 7861
1507 Ga0466966_0047612 3300044684 Bacteria 2733
1508 Ga0466961_0000154 3300044693 Bacteria 46518
1509 Ga0466961_0040920 3300044693 Bacteria 2971
1510 Ga0466961_0055444 3300044693 Bacteria 2527
1511 Ga0466961_0062880 3300044693 Bacteria 2358
1512 Ga0466961_0069702 3300044693 Bacteria 2232
1513 Ga0466961_0144001 3300044693 Bacteria 1491
1514 Ga0466963_0004891 3300044694 Bacteria 7811
1515 Ga0466963_0011092 3300044694 Bacteria 5480
1516 Ga0466963_0024315 3300044694 Bacteria 3856
1517 Ga0466963_0115850 3300044694 Bacteria 1842
1518 Ga0466963_0250084 3300044694 Bacteria 1244
1519 Ga0453684_0125689 3300044712 Bacteria 3087
1520 Ga0453684_0156952 3300044712 Bacteria 2696
1521 Ga0466968_0027966 3300044735 Bacteria 2322
1522 Ga0466968_0032688 3300044735 Bacteria 2165
1523 Ga0466957_0000233 3300044842 Bacteria 26263
1524 Ga0466957_0019829 3300044842 Bacteria 3958
1525 Ga0466957_0044390 3300044842 Bacteria 2693
1526 Ga0466957_0086419 3300044842 Bacteria 1960
1527 Ga0466960_0129397 3300044901 Bacteria 1331
1528 Ga0466959_0012963 3300045049 Bacteria 6035
1529 Ga0466959_0016488 3300045049 Bacteria 5399
1530 Ga0466959_0022731 3300045049 Bacteria 4635
1531 Ga0466959_0202610 3300045049 Bacteria 1381
1532 Ga0451576_0011255 3300045051 Bacteria 10184
1533 Ga0451576_0027106 3300045051 Bacteria 6158
1534 Ga0466958_0010635 3300045836 Bacteria 5160
1535 Ga0466958_0074628 3300045836 Bacteria 2079
1536 Ga0466958_0108940 3300045836 Bacteria 1728
1537 Ga0466967_0003827 3300045976 Bacteria 9960
1538 Ga0466967_0022912 3300045976 Bacteria 5107
1539 Ga0466967_0137698 3300045976 Bacteria 2271
1540 Ga0466967_0431118 3300045976 Bacteria 1286
1541 Ga0495627_001678 3300046453 Bacteria 12186
1542 Ga0495592_0000060 3300046454 Bacteria 100113
1543 Ga0495592_0001659 3300046454 Bacteria 15603
1544 Ga0495592_0002937 3300046454 Bacteria 12135
1545 Ga0495592_0016948 3300046454 Bacteria 5532
1546 Ga0495592_0039427 3300046454 Bacteria 3548
1547 Ga0495592_0053403 3300046454 Bacteria 2997
1548 Ga0495592_0082148 3300046454 Bacteria 2329
1549 Ga0495592_0107397 3300046454 Bacteria 1980
1550 Ga0495603_0006274 3300046455 Bacteria 7111
1551 Ga0495603_0008489 3300046455 Bacteria 6205
1552 Ga0495603_0009274 3300046455 Bacteria 5952
1553 Ga0495603_0030358 3300046455 Bacteria 3255
1554 Ga0495603_0168148 3300046455 Bacteria 1270
1555 Ga0495629_0000820 3300046459 Bacteria 25209
1556 Ga0495629_0001281 3300046459 Bacteria 19758
1557 Ga0495629_0004130 3300046459 Bacteria 10893
1558 Ga0495629_0005499 3300046459 Bacteria 9461
1559 Ga0495629_0021353 3300046459 Bacteria 4620
1560 Ga0495629_0041636 3300046459 Bacteria 3232
1561 Ga0495629_0070245 3300046459 Bacteria 2443
1562 Ga0495629_0138616 3300046459 Bacteria 1693
1563 Ga0495629_0156648 3300046459 Bacteria 1582
1564 Ga0495638_0034133 3300046460 Bacteria 3249
1565 Ga0495638_0047300 3300046460 Bacteria 2697
1566 Ga0495638_0112582 3300046460 Bacteria 1615
1567 Ga0495641_0013534 3300046461 Bacteria 4473
1568 Ga0495641_0020456 3300046461 Bacteria 3355
1569 Ga0495641_0033444 3300046461 Bacteria 2439
1570 Ga0495651_0000762 3300046462 Bacteria 24938
1571 Ga0495651_0000821 3300046462 Bacteria 24117
1572 Ga0495651_0004144 3300046462 Bacteria 11105
1573 Ga0495651_0008754 3300046462 Bacteria 7763
1574 Ga0495651_0029252 3300046462 Bacteria 4296
1575 Ga0495651_0048772 3300046462 Bacteria 3270
1576 Ga0495651_0175092 3300046462 Bacteria 1524
1577 Ga0495653_0000129 3300046463 Bacteria 62515
1578 Ga0495653_0002057 3300046463 Bacteria 15818
1579 Ga0495653_0002307 3300046463 Bacteria 15112
1580 Ga0495653_0010963 3300046463 Bacteria 7419
1581 Ga0495653_0063797 3300046463 Bacteria 2778
1582 Ga0495653_0211822 3300046463 Bacteria 1308
1583 Ga0495650_0026363 3300046471 Bacteria 2705
1584 Ga0495580_0006533 3300046472 Bacteria 9486
1585 Ga0495580_0010022 3300046472 Bacteria 7410
1586 Ga0495582_0002118 3300046473 Bacteria 11108
1587 Ga0495582_0002522 3300046473 Bacteria 10188
1588 Ga0495582_0037881 3300046473 Bacteria 2652
1589 Ga0495582_0051934 3300046473 Bacteria 2261
1590 Ga0495582_0098419 3300046473 Bacteria 1636
1591 Ga0495605_0101675 3300046474 Bacteria 1320
1592 Ga0495639_0000077 3300046475 Bacteria 46394
1593 Ga0495639_0039061 3300046475 Bacteria 2133
1594 Ga0495639_0067982 3300046475 Bacteria 1642
1595 Ga0495662_0000558 3300046476 Bacteria 17109
1596 Ga0495662_0001138 3300046476 Bacteria 13118
1597 Ga0495662_0003102 3300046476 Bacteria 8379
1598 Ga0495662_0005023 3300046476 Bacteria 6628
1599 Ga0495662_0024743 3300046476 Bacteria 2897
1600 Ga0495662_0070723 3300046476 Bacteria 1691
1601 Ga0495664_0000003 3300046477 Bacteria 551602
1602 Ga0495664_0000393 3300046477 Bacteria 21384
1603 Ga0495664_0008391 3300046477 Bacteria 5763
1604 Ga0495664_0015614 3300046477 Bacteria 4319
1605 Ga0495664_0037381 3300046477 Bacteria 2865
1606 Ga0495664_0057799 3300046477 Bacteria 2307
1607 Ga0495664_0082115 3300046477 Bacteria 1932
1608 Ga0495584_0033835 3300046491 Bacteria 2586
1609 Ga0495584_0052272 3300046491 Bacteria 2056
1610 Ga0495584_0060796 3300046491 Bacteria 1899
1611 Ga0495584_0090714 3300046491 Bacteria 1541
1612 Ga0495585_0001819 3300046492 Bacteria 16149
1613 Ga0495585_0015259 3300046492 Bacteria 4464
1614 Ga0495585_0148941 3300046492 Bacteria 1221
1615 Ga0495594_0004654 3300046499 Bacteria 7070
1616 Ga0495594_0008785 3300046499 Bacteria 5209
1617 Ga0495594_0035529 3300046499 Bacteria 2715
1618 Ga0495594_0036792 3300046499 Bacteria 2670
1619 Ga0495607_0000071 3300046501 Bacteria 100353
1620 Ga0495607_0000280 3300046501 Bacteria 54943
1621 Ga0495607_0015399 3300046501 Bacteria 4957
1622 Ga0495606_0001988 3300046507 Bacteria 25210
1623 Ga0495608_0000005 3300046511 Bacteria 350726
1624 Ga0495608_0000180 3300046511 Bacteria 45181
1625 Ga0495608_0000456 3300046511 Bacteria 28492
1626 Ga0495608_0022036 3300046511 Bacteria 4368
1627 Ga0495608_0035091 3300046511 Bacteria 3384
1628 Ga0495608_0060608 3300046511 Bacteria 2489
1629 Ga0495608_0111535 3300046511 Bacteria 1758
1630 Ga0495608_0131640 3300046511 Bacteria 1600
1631 Ga0495608_0170517 3300046511 Bacteria 1380
1632 Ga0495610_0035245 3300046512 Bacteria 2571
1633 Ga0495610_0063639 3300046512 Bacteria 1746
1634 Ga0495616_0010819 3300046513 Bacteria 5259
1635 Ga0495618_0000044 3300046514 Bacteria 95526
1636 Ga0495618_0004121 3300046514 Bacteria 8969
1637 Ga0495618_0004321 3300046514 Bacteria 8746
1638 Ga0495618_0008722 3300046514 Bacteria 6126
1639 Ga0495618_0088268 3300046514 Bacteria 1983
1640 Ga0495620_0033982 3300046515 Bacteria 2309
1641 Ga0495628_0000001 3300046516 Bacteria 917742
1642 Ga0495628_0001503 3300046516 Bacteria 21373
1643 Ga0495628_0022057 3300046516 Bacteria 5233
1644 Ga0495628_0047631 3300046516 Bacteria 3400
1645 Ga0495628_0055004 3300046516 Bacteria 3135
1646 Ga0495628_0069229 3300046516 Bacteria 2752
1647 Ga0495628_0069396 3300046516 Bacteria 2749
1648 Ga0495628_0117253 3300046516 Bacteria 2044
1649 Ga0495630_0000530 3300046517 Bacteria 28063
1650 Ga0495630_0001279 3300046517 Bacteria 17334
1651 Ga0495630_0011535 3300046517 Bacteria 6399
1652 Ga0495630_0029799 3300046517 Bacteria 4057
1653 Ga0495630_0035236 3300046517 Bacteria 3740
1654 Ga0495630_0080145 3300046517 Bacteria 2463
1655 Ga0495630_0085140 3300046517 Bacteria 2386
1656 Ga0495630_0173753 3300046517 Bacteria 1642
1657 Ga0495637_0034213 3300046520 Bacteria 2227
1658 Ga0495637_0034650 3300046520 Bacteria 2209
1659 Ga0495643_0021142 3300046522 Bacteria 3739
1660 Ga0495644_0000332 3300046523 Bacteria 21605
1661 Ga0495644_0009287 3300046523 Bacteria 3790
1662 Ga0495648_0004264 3300046524 Bacteria 12265
1663 Ga0495648_0006745 3300046524 Bacteria 9285
1664 Ga0495663_0009551 3300046525 Bacteria 2691
1665 Ga0495666_0006830 3300046526 Bacteria 5730
1666 Ga0495666_0015122 3300046526 Bacteria 3842
1667 Ga0495642_0014122 3300046528 Bacteria 3094
1668 Ga0495652_0000002 3300046529 Bacteria 946606
1669 Ga0495652_0002402 3300046529 Bacteria 19345
1670 Ga0495652_0003331 3300046529 Bacteria 15948
1671 Ga0495652_0005063 3300046529 Bacteria 12476
1672 Ga0495652_0010705 3300046529 Bacteria 8311
1673 Ga0495652_0051726 3300046529 Bacteria 3506
1674 Ga0495652_0057979 3300046529 Bacteria 3282
1675 Ga0495652_0155033 3300046529 Bacteria 1784
1676 Ga0495652_0174810 3300046529 Bacteria 1654
1677 Ga0495652_0208727 3300046529 Bacteria 1476
1678 Ga0495652_0305259 3300046529 Bacteria 1155
1679 Ga0495654_0044044 3300046530 Bacteria 2209
1680 Ga0495665_0005354 3300046531 Bacteria 6918
1681 Ga0495665_0007168 3300046531 Bacteria 6018
1682 Ga0495665_0052102 3300046531 Bacteria 2167
1683 Ga0495665_0085239 3300046531 Bacteria 1660
1684 Ga0495640_0000001 3300046533 Bacteria 853827
1685 Ga0495640_0001485 3300046533 Bacteria 18461
1686 Ga0495640_0004699 3300046533 Bacteria 10884
1687 Ga0495640_0009310 3300046533 Bacteria 7652
1688 Ga0495640_0010468 3300046533 Bacteria 7164
1689 Ga0495640_0018557 3300046533 Bacteria 5153
1690 Ga0495640_0030218 3300046533 Bacteria 3881
1691 Ga0495640_0036301 3300046533 Bacteria 3482
1692 Ga0495640_0080681 3300046533 Bacteria 2163
1693 Ga0495640_0127557 3300046533 Bacteria 1649
1694 Ga0495640_0149600 3300046533 Bacteria 1501
1695 Ga0495586_0025121 3300046535 Bacteria 3187
1696 Ga0495586_0034731 3300046535 Bacteria 2709
1697 Ga0495587_0000001 3300046536 Bacteria 724132
1698 Ga0495587_0006392 3300046536 Bacteria 7685
1699 Ga0495587_0006778 3300046536 Bacteria 7455
1700 Ga0495587_0009149 3300046536 Bacteria 6354
1701 Ga0495587_0016455 3300046536 Bacteria 4599
1702 Ga0495587_0055111 3300046536 Bacteria 2342
1703 Ga0495598_0004524 3300046537 Bacteria 3018
1704 Ga0495621_0039499 3300046539 Bacteria 1650
1705 Ga0495597_0044482 3300046542 Bacteria 1974
1706 Ga0495645_0000002 3300046543 Bacteria 651644
1707 Ga0495645_0000399 3300046543 Bacteria 30028
1708 Ga0495645_0000911 3300046543 Bacteria 20141
1709 Ga0495645_0016639 3300046543 Bacteria 5256
1710 Ga0495645_0021556 3300046543 Bacteria 4656
1711 Ga0495645_0054262 3300046543 Bacteria 2912
1712 Ga0495645_0064957 3300046543 Bacteria 2640
1713 Ga0495622_0001874 3300046557 Bacteria 10356
1714 Ga0495622_0011900 3300046557 Bacteria 4024
1715 Ga0495622_0015051 3300046557 Bacteria 3596
1716 Ga0495622_0021777 3300046557 Bacteria 2985
1717 Ga0495622_0094905 3300046557 Bacteria 1369
1718 Ga0495633_0002835 3300046558 Bacteria 11935
1719 Ga0495633_0018437 3300046558 Bacteria 3546
1720 Ga0495633_0039921 3300046558 Bacteria 2238
1721 Ga0495667_0000039 3300046559 Bacteria 131308
1722 Ga0495667_0000832 3300046559 Bacteria 19943
1723 Ga0495667_0003030 3300046559 Bacteria 11262
1724 Ga0495667_0033501 3300046559 Bacteria 3438
1725 Ga0495667_0039300 3300046559 Bacteria 3146
1726 Ga0495667_0040203 3300046559 Bacteria 3106
1727 Ga0495667_0053211 3300046559 Bacteria 2667
1728 Ga0495667_0056873 3300046559 Bacteria 2571
1729 Ga0495656_0000480 3300046615 Bacteria 12974
1730 Ga0495656_0005889 3300046615 Bacteria 4264
1731 Ga0495656_0009875 3300046615 Bacteria 3448
1732 Ga0495656_0010749 3300046615 Bacteria 3337
1733 Ga0495656_0025146 3300046615 Bacteria 2358
1734 Ga0495656_0034711 3300046615 Bacteria 2067
1735 Ga0495668_0066126 3300046616 Bacteria 1990
1736 Ga0495634_0000010 3300046642 Bacteria 143792
1737 Ga0495634_0001976 3300046642 Bacteria 17475
1738 Ga0495634_0007301 3300046642 Bacteria 8315
1739 Ga0495634_0011570 3300046642 Bacteria 6420
1740 Ga0495634_0022903 3300046642 Bacteria 4398
1741 Ga0495634_0069268 3300046642 Bacteria 2328
1742 Ga0495634_0078394 3300046642 Bacteria 2164
1743 Ga0495634_0126035 3300046642 Bacteria 1636
1744 Ga0495625_0001042 3300046660 Bacteria 36418
1745 Ga0495625_0060789 3300046660 Bacteria 2676
1746 Ga0495625_0159260 3300046660 Bacteria 1513
1747 Ga0495635_0000001 3300046663 Bacteria 704901
1748 Ga0495635_0002471 3300046663 Bacteria 12619
1749 Ga0495635_0014085 3300046663 Bacteria 5596
1750 Ga0495635_0014978 3300046663 Bacteria 5424
1751 Ga0495635_0017755 3300046663 Bacteria 4969
1752 Ga0495635_0027461 3300046663 Bacteria 3958
1753 Ga0495635_0027843 3300046663 Bacteria 3930
1754 Ga0495635_0034447 3300046663 Bacteria 3511
1755 Ga0495635_0100736 3300046663 Bacteria 1974
1756 Ga0495659_0014731 3300046664 Bacteria 2564
1757 Ga0495661_0003988 3300046665 Bacteria 10766
1758 Ga0495661_0022266 3300046665 Bacteria 4123
1759 Ga0495661_0110362 3300046665 Bacteria 1534
1760 Ga0495661_0144400 3300046665 Bacteria 1291
1761 Ga0495588_0001123 3300046674 Bacteria 11533
1762 Ga0495588_0001283 3300046674 Bacteria 10760
1763 Ga0495588_0046212 3300046674 Bacteria 2233
1764 Ga0495588_0050113 3300046674 Bacteria 2148
1765 Ga0495588_0097587 3300046674 Bacteria 1542
1766 Ga0495657_0000042 3300046675 Bacteria 114669
1767 Ga0495657_0008710 3300046675 Bacteria 7742
1768 Ga0495657_0015882 3300046675 Bacteria 5497
1769 Ga0495657_0016840 3300046675 Bacteria 5315
1770 Ga0495657_0059158 3300046675 Bacteria 2542
1771 Ga0495599_0000013 3300046678 Bacteria 179828
1772 Ga0495599_0003635 3300046678 Bacteria 9042
1773 Ga0495599_0005435 3300046678 Bacteria 7616
1774 Ga0495599_0010526 3300046678 Bacteria 5659
1775 Ga0495599_0060421 3300046678 Bacteria 2369
1776 Ga0495599_0094460 3300046678 Bacteria 1865
1777 Ga0495599_0139257 3300046678 Bacteria 1505
1778 Ga0495623_0000050 3300046679 Bacteria 72959
1779 Ga0495623_0000372 3300046679 Bacteria 29382
1780 Ga0495623_0009213 3300046679 Bacteria 6405
1781 Ga0495623_0009394 3300046679 Bacteria 6349
1782 Ga0495623_0010249 3300046679 Bacteria 6064
1783 Ga0495623_0017926 3300046679 Bacteria 4574
1784 Ga0495623_0026859 3300046679 Bacteria 3704
1785 Ga0495623_0147730 3300046679 Bacteria 1392
1786 Ga0495646_0000009 3300046680 Bacteria 200698
1787 Ga0495646_0001728 3300046680 Bacteria 13099
1788 Ga0495646_0013938 3300046680 Bacteria 5108
1789 Ga0495646_0015084 3300046680 Bacteria 4908
1790 Ga0495646_0021040 3300046680 Bacteria 4123
1791 Ga0495646_0024603 3300046680 Bacteria 3791
1792 Ga0495646_0025467 3300046680 Bacteria 3721
1793 Ga0495646_0028255 3300046680 Bacteria 3513
1794 Ga0495646_0071640 3300046680 Bacteria 2039
1795 Ga0495646_0074176 3300046680 Bacteria 1997
1796 Ga0495647_0000134 3300046681 Bacteria 18591
1797 Ga0495647_0012083 3300046681 Bacteria 2968
1798 Ga0495658_0000479 3300046683 Bacteria 22023
1799 Ga0495658_0001615 3300046683 Bacteria 11744
1800 Ga0495658_0013570 3300046683 Bacteria 4149
1801 Ga0495658_0018146 3300046683 Bacteria 3651
1802 Ga0495658_0018389 3300046683 Bacteria 3633
1803 Ga0495658_0024645 3300046683 Bacteria 3206
1804 Ga0495658_0031178 3300046683 Bacteria 2901
1805 Ga0495658_0045601 3300046683 Bacteria 2461
1806 Ga0495658_0055136 3300046683 Bacteria 2263
1807 Ga0495658_0101589 3300046683 Bacteria 1717
1808 Ga0495669_0026867 3300046684 Bacteria 2516
1809 Ga0495669_0043054 3300046684 Bacteria 2009
1810 Ga0495669_0108558 3300046684 Bacteria 1294
1811 Ga0495613_0004515 3300046689 Bacteria 10436
1812 Ga0495613_0013924 3300046689 Bacteria 5968
1813 Ga0495613_0017495 3300046689 Bacteria 5337
1814 Ga0495613_0033948 3300046689 Bacteria 3790
1815 Ga0495613_0054098 3300046689 Bacteria 2952
1816 Ga0495613_0122846 3300046689 Bacteria 1863
1817 Ga0495613_0145084 3300046689 Bacteria 1694
1818 Ga0495624_0002021 3300046690 Bacteria 15445
1819 Ga0495624_0003130 3300046690 Bacteria 12351
1820 Ga0495624_0005517 3300046690 Bacteria 9105
1821 Ga0495624_0018581 3300046690 Bacteria 4648
1822 Ga0495624_0021002 3300046690 Bacteria 4335
1823 Ga0495624_0061013 3300046690 Bacteria 2363
1824 Ga0495624_0064486 3300046690 Bacteria 2289
1825 Ga0495670_0008138 3300046691 Bacteria 5154
1826 Ga0495670_0014312 3300046691 Bacteria 3901
1827 Ga0495670_0118683 3300046691 Bacteria 1373
1828 Ga0495671_0000618 3300046692 Bacteria 26020
1829 Ga0495671_0015600 3300046692 Bacteria 4067
1830 Ga0495671_0056245 3300046692 Bacteria 1948
1831 Ga0495671_0068501 3300046692 Bacteria 1745
1832 Ga0495671_0084324 3300046692 Bacteria 1557
1833 Ga0495589_0029050 3300046794 Bacteria 2788
1834 Ga0495589_0102532 3300046794 Bacteria 1384
1835 Ga0495600_0000035 3300046809 Bacteria 80552
1836 Ga0495600_0011402 3300046809 Bacteria 5536
1837 Ga0495600_0012452 3300046809 Bacteria 5320
1838 Ga0495600_0022024 3300046809 Bacteria 4088
1839 Ga0495600_0049651 3300046809 Bacteria 2737
1840 Ga0495600_0129028 3300046809 Bacteria 1644
1841 Ga0495581_0000503 3300047315 Bacteria 19983
1842 Ga0495581_0014816 3300047315 Bacteria 4523
1843 Ga0495581_0015374 3300047315 Bacteria 4444
1844 Ga0495581_0103190 3300047315 Bacteria 1657
1845 Ga0495581_0152153 3300047315 Bacteria 1351
1846 Ga0495604_0000069 3300047317 Bacteria 89935
1847 Ga0495604_0000241 3300047317 Bacteria 48922
1848 Ga0495604_0000702 3300047317 Bacteria 28428
1849 Ga0495604_0003178 3300047317 Bacteria 13125
1850 Ga0495604_0006376 3300047317 Bacteria 9353
1851 Ga0495604_0023347 3300047317 Bacteria 4933
1852 Ga0495604_0049389 3300047317 Bacteria 3269
1853 Ga0495604_0085915 3300047317 Bacteria 2347
1854 Ga0495604_0157590 3300047317 Bacteria 1607
1855 Ga0495604_0163032 3300047317 Bacteria 1574
1856 Ga0495636_0060692 3300047318 Bacteria 1598
1857 Ga0495674_0000002 3300047319 Bacteria 642785
1858 Ga0495674_0001363 3300047319 Bacteria 23830
1859 Ga0495674_0009848 3300047319 Bacteria 9072
1860 Ga0495674_0010172 3300047319 Bacteria 8912
1861 Ga0495674_0010576 3300047319 Bacteria 8733
1862 Ga0495674_0017131 3300047319 Bacteria 6748
1863 Ga0495674_0035825 3300047319 Bacteria 4473
1864 Ga0495674_0081957 3300047319 Bacteria 2767
1865 Ga0495674_0093453 3300047319 Bacteria 2566
1866 Ga0495674_0096869 3300047319 Bacteria 2513
1867 Ga0495674_0142364 3300047319 Bacteria 2015
1868 Ga0495674_0295740 3300047319 Bacteria 1323
1869 Ga0495674_0345522 3300047319 Bacteria 1208
1870 Ga0495672_0020588 3300047320 Bacteria 4317
1871 Ga0495672_0024913 3300047320 Bacteria 3843
1872 Ga0495672_0037370 3300047320 Bacteria 2972
1873 Ga0495672_0078278 3300047320 Bacteria 1850
1874 Ga0495676_0009761 3300047321 Bacteria 8722
1875 Ga0495676_0024072 3300047321 Bacteria 5276
1876 Ga0495676_0035814 3300047321 Bacteria 4149
1877 Ga0495676_0105518 3300047321 Bacteria 2077
1878 Ga0495680_0000497 3300047322 Bacteria 44425
1879 Ga0495680_0000994 3300047322 Bacteria 31554
1880 Ga0495680_0002292 3300047322 Bacteria 19664
1881 Ga0495680_0002523 3300047322 Bacteria 18717
1882 Ga0495680_0006821 3300047322 Bacteria 10546
1883 Ga0495680_0007750 3300047322 Bacteria 9806
1884 Ga0495680_0019186 3300047322 Bacteria 5784
1885 Ga0495680_0050134 3300047322 Bacteria 3265
1886 Ga0495680_0117700 3300047322 Bacteria 1964
1887 Ga0495683_0066187 3300047323 Bacteria 1781
1888 Ga0495687_000091 3300047443 Bacteria 140319
1889 Ga0495687_010818 3300047443 Bacteria 4963
1890 Ga0495675_0000164 3300047444 Bacteria 47361
1891 Ga0495675_0003053 3300047444 Bacteria 10065
1892 Ga0495675_0011479 3300047444 Bacteria 5561
1893 Ga0495675_0021384 3300047444 Bacteria 4119
1894 Ga0495675_0028161 3300047444 Bacteria 3582
1895 Ga0495675_0114789 3300047444 Bacteria 1679
1896 Ga0495681_0011395 3300047470 Bacteria 5294
1897 Ga0495684_0000016 3300047471 Bacteria 169338
1898 Ga0495684_0002016 3300047471 Bacteria 16338
1899 Ga0495684_0006620 3300047471 Bacteria 8988
1900 Ga0495684_0009241 3300047471 Bacteria 7612
1901 Ga0495684_0010790 3300047471 Bacteria 7062
1902 Ga0495684_0013942 3300047471 Bacteria 6184
1903 Ga0495684_0016455 3300047471 Bacteria 5695
1904 Ga0495684_0017301 3300047471 Bacteria 5549
1905 Ga0495684_0055741 3300047471 Bacteria 3014
1906 Ga0495684_0067103 3300047471 Bacteria 2728
1907 Ga0495684_0160931 3300047471 Bacteria 1674
1908 Ga0495684_0174443 3300047471 Bacteria 1597
1909 Ga0495686_0003430 3300047472 Bacteria 13748
1910 Ga0495686_0014825 3300047472 Bacteria 5354
1911 Ga0495686_0097311 3300047472 Bacteria 1779
1912 Ga0495593_0000500 3300047673 Bacteria 22173
1913 Ga0495593_0001200 3300047673 Bacteria 15172
1914 Ga0495593_0008925 3300047673 Bacteria 5819
1915 Ga0495593_0011269 3300047673 Bacteria 5138
1916 Ga0495593_0047105 3300047673 Bacteria 2294
1917 Ga0495602_0000240 3300048088 Bacteria 51242
1918 Ga0495602_0001314 3300048088 Bacteria 24503
1919 Ga0495602_0002214 3300048088 Bacteria 19624
1920 Ga0495602_0002373 3300048088 Bacteria 19095
1921 Ga0495602_0015855 3300048088 Bacteria 7590
1922 Ga0495602_0073081 3300048088 Bacteria 2921
1923 Ga0495614_0007099 3300048089 Bacteria 4995
1924 Ga0495614_0042403 3300048089 Bacteria 1951
1925 Ga0495615_0016460 3300048090 Bacteria 1595
1926 Ga0496100_0000894 3300048903 Bacteria 14217
1927 Ga0496100_0001914 3300048903 Bacteria 10423
1928 Ga0496100_0017089 3300048903 Bacteria 4275
1929 Ga0496100_0029132 3300048903 Bacteria 3413
1930 Ga0496100_0149792 3300048903 Bacteria 1662
1931 Ga0496100_0202533 3300048903 Bacteria 1447
1932 Ga0496101_0002235 3300048904 Bacteria 11838
1933 Ga0496101_0006818 3300048904 Bacteria 7369
1934 Ga0496101_0010083 3300048904 Bacteria 6227
1935 Ga0496101_0017259 3300048904 Bacteria 4893
1936 Ga0496101_0017359 3300048904 Bacteria 4883
1937 Ga0496101_0018376 3300048904 Bacteria 4753
1938 Ga0496101_0034478 3300048904 Bacteria 3574
1939 Ga0496101_0038342 3300048904 Bacteria 3403
1940 Ga0496101_0050303 3300048904 Bacteria 2999
1941 Ga0496101_0086232 3300048904 Bacteria 2328
1942 Ga0496101_0100572 3300048904 Bacteria 2163
1943 Ga0496101_0144441 3300048904 Bacteria 1816
1944 Ga0496101_0168803 3300048904 Bacteria 1681
1945 Ga0496102_0002866 3300048905 Bacteria 14649
1946 Ga0496102_0005027 3300048905 Bacteria 11199
1947 Ga0496102_0007763 3300048905 Bacteria 9170
1948 Ga0496102_0012150 3300048905 Bacteria 7443
1949 Ga0496102_0017100 3300048905 Bacteria 6349
1950 Ga0496102_0020900 3300048905 Bacteria 5786
1951 Ga0496102_0083804 3300048905 Bacteria 2941
1952 Ga0496102_0084929 3300048905 Bacteria 2922
1953 Ga0496102_0094089 3300048905 Bacteria 2776
1954 Ga0496102_0124750 3300048905 Bacteria 2406
1955 Ga0496102_0152258 3300048905 Bacteria 2174
1956 Ga0496102_0171071 3300048905 Bacteria 2045
1957 Ga0496102_0388576 3300048905 Bacteria 1313
1958 Ga0496103_0002892 3300048906 Bacteria 10656
1959 Ga0496103_0003599 3300048906 Bacteria 9454
1960 Ga0496103_0006142 3300048906 Bacteria 7178
1961 Ga0496103_0052397 3300048906 Bacteria 2527
1962 Ga0496103_0053875 3300048906 Bacteria 2493
1963 Ga0496103_0074492 3300048906 Bacteria 2128
1964 Ga0496103_0084224 3300048906 Bacteria 2002
1965 Ga0496103_0103945 3300048906 Bacteria 1800
1966 Ga0496104_0000061 3300048907 Bacteria 117394
1967 Ga0496104_0000194 3300048907 Bacteria 54525
1968 Ga0496104_0000577 3300048907 Bacteria 31297
1969 Ga0496104_0000591 3300048907 Bacteria 30958
1970 Ga0496104_0001608 3300048907 Bacteria 19461
1971 Ga0496104_0005904 3300048907 Bacteria 10722
1972 Ga0496104_0009816 3300048907 Bacteria 8534
1973 Ga0496104_0010521 3300048907 Bacteria 8265
1974 Ga0496104_0011884 3300048907 Bacteria 7814
1975 Ga0496104_0016737 3300048907 Bacteria 6666
1976 Ga0496104_0020587 3300048907 Bacteria 6048
1977 Ga0496104_0044813 3300048907 Bacteria 4157
1978 Ga0496104_0072979 3300048907 Bacteria 3264
1979 Ga0496104_0189988 3300048907 Bacteria 1965
1980 Ga0496105_0000365 3300048908 Bacteria 30018
1981 Ga0496105_0002920 3300048908 Bacteria 12546
1982 Ga0496105_0003112 3300048908 Bacteria 12204
1983 Ga0496105_0004541 3300048908 Bacteria 10460
1984 Ga0496105_0005828 3300048908 Bacteria 9397
1985 Ga0496105_0006281 3300048908 Bacteria 9125
1986 Ga0496105_0014088 3300048908 Bacteria 6362
1987 Ga0496105_0014128 3300048908 Bacteria 6353
1988 Ga0496105_0024367 3300048908 Bacteria 4916
1989 Ga0496105_0027670 3300048908 Bacteria 4634
1990 Ga0496105_0083381 3300048908 Bacteria 2640
1991 Ga0496106_0000990 3300048909 Bacteria 20724
1992 Ga0496106_0001140 3300048909 Bacteria 19677
1993 Ga0496106_0002884 3300048909 Bacteria 12771
1994 Ga0496106_0007418 3300048909 Bacteria 8104
1995 Ga0496106_0020125 3300048909 Bacteria 4950
1996 Ga0496106_0024426 3300048909 Bacteria 4493
1997 Ga0496106_0043386 3300048909 Bacteria 3374
1998 Ga0496106_0063690 3300048909 Bacteria 2803
1999 Ga0496106_0070094 3300048909 Bacteria 2677
2000 Ga0496106_0123320 3300048909 Bacteria 2027
2001 Ga0496106_0210197 3300048909 Bacteria 1550
2002 Ga0496107_0005244 3300048910 Bacteria 8847
2003 Ga0496107_0005579 3300048910 Bacteria 8619
2004 Ga0496107_0016685 3300048910 Bacteria 5161
2005 Ga0496107_0020521 3300048910 Bacteria 4667
2006 Ga0496107_0022051 3300048910 Bacteria 4499
2007 Ga0496107_0031230 3300048910 Bacteria 3799
2008 Ga0496107_0046671 3300048910 Bacteria 3118
2009 Ga0496107_0059511 3300048910 Bacteria 2764
2010 Ga0496107_0060830 3300048910 Bacteria 2733
2011 Ga0496107_0070560 3300048910 Bacteria 2537
2012 Ga0496107_0090658 3300048910 Bacteria 2233
2013 Ga0496108_0000322 3300048911 Bacteria 40621
2014 Ga0496108_0000515 3300048911 Bacteria 30277
2015 Ga0496108_0001664 3300048911 Bacteria 17632
2016 Ga0496108_0002753 3300048911 Bacteria 14079
2017 Ga0496108_0009720 3300048911 Bacteria 7796
2018 Ga0496108_0015807 3300048911 Bacteria 6153
2019 Ga0496108_0029173 3300048911 Bacteria 4568
2020 Ga0496108_0039592 3300048911 Bacteria 3928
2021 Ga0496108_0048324 3300048911 Bacteria 3557
2022 Ga0496108_0055977 3300048911 Bacteria 3312
2023 Ga0496108_0069354 3300048911 Bacteria 2975
2024 Ga0496108_0203032 3300048911 Bacteria 1720
2025 Ga0496108_0300997 3300048911 Bacteria 1397
2026 Ga0496108_0346332 3300048911 Bacteria 1296
2027 Ga0496109_0000394 3300048912 Bacteria 39667
2028 Ga0496109_0001619 3300048912 Bacteria 18811
2029 Ga0496109_0002891 3300048912 Bacteria 14365
2030 Ga0496109_0003998 3300048912 Bacteria 12318
2031 Ga0496109_0004579 3300048912 Bacteria 11541
2032 Ga0496109_0005428 3300048912 Bacteria 10662
2033 Ga0496109_0016198 3300048912 Bacteria 6514
2034 Ga0496109_0025734 3300048912 Bacteria 5244
2035 Ga0496109_0035560 3300048912 Bacteria 4495
2036 Ga0496109_0090349 3300048912 Bacteria 2832
2037 Ga0496109_0131368 3300048912 Bacteria 2337
2038 Ga0496110_0001173 3300048913 Bacteria 18616
2039 Ga0496110_0005945 3300048913 Bacteria 9603
2040 Ga0496110_0009681 3300048913 Bacteria 7804
2041 Ga0496110_0017791 3300048913 Bacteria 5948
2042 Ga0496110_0024430 3300048913 Bacteria 5150
2043 Ga0496110_0031329 3300048913 Bacteria 4588
2044 Ga0496110_0037159 3300048913 Bacteria 4232
2045 Ga0496110_0076056 3300048913 Bacteria 2984
2046 Ga0496110_0096299 3300048913 Bacteria 2652
2047 Ga0496110_0141887 3300048913 Bacteria 2172
2048 Ga0496110_0220308 3300048913 Bacteria 1725
2049 Ga0496110_0229379 3300048913 Bacteria 1688
2050 Ga0496110_0229641 3300048913 Bacteria 1687
2051 Ga0496111_0006536 3300048914 Bacteria 7580
2052 Ga0496111_0007757 3300048914 Bacteria 7064
2053 Ga0496111_0010326 3300048914 Bacteria 6260
2054 Ga0496111_0020692 3300048914 Bacteria 4585
2055 Ga0496111_0023272 3300048914 Bacteria 4349
2056 Ga0496111_0026872 3300048914 Bacteria 4067
2057 Ga0496111_0031493 3300048914 Bacteria 3778
2058 Ga0496111_0033103 3300048914 Bacteria 3686
2059 Ga0496111_0036490 3300048914 Bacteria 3514
2060 Ga0496111_0055919 3300048914 Bacteria 2854
2061 Ga0496111_0158525 3300048914 Bacteria 1680
2062 Ga0496112_0000004 3300048915 Bacteria 553294
2063 Ga0496112_0000732 3300048915 Bacteria 22851
2064 Ga0496112_0000803 3300048915 Bacteria 22130
2065 Ga0496112_0002254 3300048915 Bacteria 15406
2066 Ga0496112_0004421 3300048915 Bacteria 11903
2067 Ga0496112_0016454 3300048915 Bacteria 6929
2068 Ga0496112_0026288 3300048915 Bacteria 5598
2069 Ga0496112_0031239 3300048915 Bacteria 5163
2070 Ga0496112_0038139 3300048915 Bacteria 4692
2071 Ga0496112_0046586 3300048915 Bacteria 4253
2072 Ga0496112_0050327 3300048915 Bacteria 4085
2073 Ga0496112_0051168 3300048915 Bacteria 4052
2074 Ga0496112_0057233 3300048915 Bacteria 3838
2075 Ga0496112_0109917 3300048915 Bacteria 2727
2076 Ga0496112_0137952 3300048915 Bacteria 2409
2077 Ga0496112_0310281 3300048915 Bacteria 1523
2078 Ga0496113_0001285 3300048916 Bacteria 13859
2079 Ga0496113_0002162 3300048916 Bacteria 11352
2080 Ga0496113_0007860 3300048916 Bacteria 6895
2081 Ga0496113_0010581 3300048916 Bacteria 6105
2082 Ga0496113_0017394 3300048916 Bacteria 4989
2083 Ga0496113_0018648 3300048916 Bacteria 4836
2084 Ga0496113_0029024 3300048916 Bacteria 3988
2085 Ga0496113_0038211 3300048916 Bacteria 3529
2086 Ga0496113_0066998 3300048916 Bacteria 2721
2087 Ga0496113_0092431 3300048916 Bacteria 2333
2088 Ga0496113_0118074 3300048916 Bacteria 2071
2089 Ga0496113_0162012 3300048916 Bacteria 1768
2090 Ga0496114_0008740 3300048917 Bacteria 8025
2091 Ga0496114_0027667 3300048917 Bacteria 4647
2092 Ga0496114_0048533 3300048917 Bacteria 3531
2093 Ga0496114_0048921 3300048917 Bacteria 3517
2094 Ga0496114_0051863 3300048917 Bacteria 3416
2095 Ga0496114_0059654 3300048917 Bacteria 3187
2096 Ga0496114_0088839 3300048917 Bacteria 2622
2097 Ga0496114_0112567 3300048917 Bacteria 2333
2098 Ga0496114_0113559 3300048917 Bacteria 2322
2099 Ga0496114_0174044 3300048917 Bacteria 1877
2100 Ga0496114_0230121 3300048917 Bacteria 1629
2101 Ga0496114_0240919 3300048917 Bacteria 1590
2102 Ga0496115_0005923 3300048918 Bacteria 8918
2103 Ga0496115_0007543 3300048918 Bacteria 8012
2104 Ga0496115_0007578 3300048918 Bacteria 7995
2105 Ga0496115_0013541 3300048918 Bacteria 6170
2106 Ga0496115_0025561 3300048918 Bacteria 4599
2107 Ga0496115_0038161 3300048918 Bacteria 3810
2108 Ga0496115_0038187 3300048918 Bacteria 3809
2109 Ga0496115_0046759 3300048918 Bacteria 3460
2110 Ga0496115_0121285 3300048918 Bacteria 2151
2111 Ga0496115_0158374 3300048918 Bacteria 1871
2112 Ga0496115_0247780 3300048918 Bacteria 1467
2113 Ga0496115_0297816 3300048918 Bacteria 1322
2114 Ga0496116_0003689 3300048919 Bacteria 14990
2115 Ga0496116_0018926 3300048919 Bacteria 5288
2116 Ga0496116_0020398 3300048919 Bacteria 5034
2117 Ga0496117_0000036 3300048920 Bacteria 325635
2118 Ga0496117_0012904 3300048920 Bacteria 7324
2119 Ga0496117_0015481 3300048920 Bacteria 6500
2120 Ga0496117_0024395 3300048920 Bacteria 4785
2121 Ga0496117_0032448 3300048920 Bacteria 3967
2122 Ga0496117_0036596 3300048920 Bacteria 3670
2123 Ga0496117_0175913 3300048920 Bacteria 1236
2124 Ga0496118_0003337 3300048921 Bacteria 20313
2125 Ga0496118_0008209 3300048921 Bacteria 10846
2126 Ga0496118_0020646 3300048921 Bacteria 5834
2127 Ga0496118_0047108 3300048921 Bacteria 3346
2128 Ga0496118_0056599 3300048921 Bacteria 2946
2129 Ga0496118_0076879 3300048921 Bacteria 2370
2130 Ga0496119_0003438 3300048922 Bacteria 16444
2131 Ga0496119_0009369 3300048922 Bacteria 8419
2132 Ga0496119_0014973 3300048922 Bacteria 6019
2133 Ga0496119_0079562 3300048922 Bacteria 1893
2134 Ga0496119_0096340 3300048922 Bacteria 1670
2135 Ga0496120_0001678 3300048923 Bacteria 25416
2136 Ga0496120_0005900 3300048923 Bacteria 9553
2137 Ga0496120_0012920 3300048923 Bacteria 5651
2138 Ga0496120_0025464 3300048923 Bacteria 3671
2139 Ga0496120_0065903 3300048923 Bacteria 2005
2140 Ga0496121_0000458 3300048924 Bacteria 80207
2141 Ga0496121_0000574 3300048924 Bacteria 69107
2142 Ga0496121_0000668 3300048924 Bacteria 64093
2143 Ga0496121_0005012 3300048924 Bacteria 17321
2144 Ga0496121_0016457 3300048924 Bacteria 7634
2145 Ga0496121_0030756 3300048924 Bacteria 4925
2146 Ga0496121_0038705 3300048924 Bacteria 4216
2147 Ga0496121_0054796 3300048924 Bacteria 3329
2148 Ga0496121_0063866 3300048924 Bacteria 3005
2149 Ga0496121_0110020 3300048924 Bacteria 2103
2150 Ga0496122_0000002 3300048925 Bacteria 905834
2151 Ga0496122_0000074 3300048925 Bacteria 219900
2152 Ga0496122_0005799 3300048925 Bacteria 14518
2153 Ga0496122_0017627 3300048925 Bacteria 6662
2154 Ga0496122_0020971 3300048925 Bacteria 5871
2155 Ga0496122_0024524 3300048925 Bacteria 5275
2156 Ga0496122_0032207 3300048925 Bacteria 4341
2157 Ga0496122_0041965 3300048925 Bacteria 3607
2158 Ga0496122_0051385 3300048925 Bacteria 3132
2159 Ga0496122_0065558 3300048925 Bacteria 2632
2160 Ga0496123_0000002 3300048926 Bacteria 1811682
2161 Ga0496123_0000062 3300048926 Bacteria 219882
2162 Ga0496123_0004614 3300048926 Bacteria 14331
2163 Ga0496123_0008775 3300048926 Bacteria 9221
2164 Ga0496123_0016930 3300048926 Bacteria 5889
2165 Ga0496123_0022456 3300048926 Bacteria 4862
2166 Ga0496123_0038669 3300048926 Bacteria 3349
2167 Ga0496124_0007696 3300048927 Bacteria 11395
2168 Ga0496124_0013261 3300048927 Bacteria 8056
2169 Ga0496124_0023362 3300048927 Bacteria 5645
2170 Ga0496124_0050197 3300048927 Bacteria 3556
2171 Ga0496124_0078400 3300048927 Bacteria 2723
2172 Ga0496124_0210343 3300048927 Bacteria 1472
2173 Ga0496125_0000060 3300048928 Bacteria 264143
2174 Ga0496125_0000116 3300048928 Bacteria 180492
2175 Ga0496125_0001496 3300048928 Bacteria 33472
2176 Ga0496125_0006111 3300048928 Bacteria 13137
2177 Ga0496125_0008272 3300048928 Bacteria 10924
2178 Ga0496125_0026780 3300048928 Bacteria 5239
2179 Ga0496125_0034560 3300048928 Bacteria 4453
2180 Ga0496125_0046531 3300048928 Bacteria 3639
2181 Ga0496125_0069040 3300048928 Bacteria 2775
2182 Ga0496125_0075447 3300048928 Bacteria 2609
2183 Ga0496125_0084942 3300048928 Bacteria 2401
2184 Ga0496126_0003422 3300048929 Bacteria 20029
2185 Ga0496126_0004802 3300048929 Bacteria 15878
2186 Ga0496126_0007480 3300048929 Bacteria 11964
2187 Ga0496126_0014201 3300048929 Bacteria 8059
2188 Ga0496126_0014911 3300048929 Bacteria 7837
2189 Ga0496126_0015313 3300048929 Bacteria 7717
2190 Ga0496126_0020126 3300048929 Bacteria 6551
2191 Ga0496126_0021658 3300048929 Bacteria 6274
2192 Ga0496126_0022450 3300048929 Bacteria 6140
2193 Ga0496126_0025527 3300048929 Bacteria 5682
2194 Ga0496126_0095694 3300048929 Bacteria 2604
2195 Ga0496126_0101955 3300048929 Bacteria 2510
2196 Ga0496126_0102454 3300048929 Bacteria 2502
2197 Ga0496126_0119071 3300048929 Bacteria 2292
2198 Ga0496126_0213579 3300048929 Bacteria 1623
2199 Ga0496126_0263677 3300048929 Bacteria 1432
2200 Ga0495682_0021095 3300049460 Bacteria 2443
2201 Ga0501031_0001597 3300049568 Bacteria 14151
2202 Ga0501031_0002121 3300049568 Bacteria 12512
2203 Ga0501031_0003092 3300049568 Bacteria 10652
2204 Ga0501031_0032796 3300049568 Bacteria 3387
2205 Ga0501031_0055347 3300049568 Bacteria 2585
2206 Ga0501031_0063639 3300049568 Bacteria 2403
2207 Ga0501032_0000008 3300049569 Bacteria 240313
2208 Ga0501032_0000619 3300049569 Bacteria 28816
2209 Ga0501032_0001926 3300049569 Bacteria 16354
2210 Ga0501032_0008343 3300049569 Bacteria 7550
2211 Ga0501032_0010824 3300049569 Bacteria 6566
2212 Ga0501032_0017460 3300049569 Bacteria 5040
2213 Ga0501032_0060433 3300049569 Bacteria 2541
2214 Ga0501032_0075832 3300049569 Bacteria 2239
2215 Ga0501032_0117881 3300049569 Bacteria 1755
2216 Ga0501032_0168080 3300049569 Bacteria 1438
2217 Ga0501033_0000012 3300049570 Bacteria 241599
2218 Ga0501033_0000108 3300049570 Bacteria 79903
2219 Ga0501033_0005509 3300049570 Bacteria 10017
2220 Ga0501033_0008737 3300049570 Bacteria 7832
2221 Ga0501033_0009630 3300049570 Bacteria 7433
2222 Ga0501033_0010896 3300049570 Bacteria 6971
2223 Ga0501033_0013189 3300049570 Bacteria 6296
2224 Ga0501033_0021175 3300049570 Bacteria 4906
2225 Ga0501033_0041393 3300049570 Bacteria 3438
2226 Ga0501033_0096688 3300049570 Bacteria 2158
2227 Ga0501033_0122816 3300049570 Bacteria 1883
2228 Ga0501033_0128007 3300049570 Bacteria 1841
2229 Ga0501033_0139633 3300049570 Bacteria 1752
2230 Ga0501033_0219564 3300049570 Bacteria 1353
2231 Ga0501034_0000035 3300049571 Bacteria 241623
2232 Ga0501034_0000100 3300049571 Bacteria 159536
2233 Ga0501034_0000319 3300049571 Bacteria 84488
2234 Ga0501034_0001353 3300049571 Bacteria 33136
2235 Ga0501034_0005498 3300049571 Bacteria 13829
2236 Ga0501034_0010766 3300049571 Bacteria 9500
2237 Ga0501034_0013826 3300049571 Bacteria 8307
2238 Ga0501034_0014581 3300049571 Bacteria 8092
2239 Ga0501034_0058957 3300049571 Bacteria 3856
2240 Ga0501034_0070062 3300049571 Bacteria 3518
2241 Ga0501034_0129420 3300049571 Bacteria 2508
2242 Ga0501034_0137276 3300049571 Bacteria 2426
2243 Ga0501034_0142897 3300049571 Bacteria 2372
2244 Ga0501034_0157141 3300049571 Bacteria 2247
2245 Ga0501034_0204816 3300049571 Bacteria 1929
2246 Ga0501034_0372640 3300049571 Bacteria 1353
2247 Ga0501034_0408264 3300049571 Bacteria 1280
2248 Ga0501036_0000006 3300049572 Bacteria 241623
2249 Ga0501036_0000769 3300049572 Bacteria 23752
2250 Ga0501036_0001566 3300049572 Bacteria 17669
2251 Ga0501036_0004308 3300049572 Bacteria 11493
2252 Ga0501036_0014462 3300049572 Bacteria 6575
2253 Ga0501036_0029821 3300049572 Bacteria 4610
2254 Ga0501036_0065821 3300049572 Bacteria 3066
2255 Ga0501036_0104953 3300049572 Bacteria 2389
2256 Ga0501036_0233052 3300049572 Bacteria 1545
2257 Ga0501036_0280263 3300049572 Bacteria 1395
2258 Ga0501036_0297235 3300049572 Bacteria 1351
2259 Ga0501037_0000072 3300049573 Bacteria 94452
2260 Ga0501037_0000153 3300049573 Bacteria 64239
2261 Ga0501037_0000386 3300049573 Bacteria 36578
2262 Ga0501037_0008879 3300049573 Bacteria 7360
2263 Ga0501037_0010014 3300049573 Bacteria 6953
2264 Ga0501037_0010426 3300049573 Bacteria 6820
2265 Ga0501037_0012514 3300049573 Bacteria 6249
2266 Ga0501037_0019253 3300049573 Bacteria 5032
2267 Ga0501037_0047037 3300049573 Bacteria 3163
2268 Ga0501037_0062776 3300049573 Bacteria 2708
2269 Ga0501037_0072307 3300049573 Bacteria 2508
2270 Ga0501037_0109022 3300049573 Bacteria 1995
2271 Ga0501037_0132149 3300049573 Bacteria 1789
2272 Ga0501037_0141424 3300049573 Bacteria 1722
2273 Ga0501038_0000007 3300049574 Bacteria 210775
2274 Ga0501038_0000138 3300049574 Bacteria 62493
2275 Ga0501038_0000575 3300049574 Bacteria 32506
2276 Ga0501038_0000999 3300049574 Bacteria 25463
2277 Ga0501038_0004019 3300049574 Bacteria 13668
2278 Ga0501038_0012452 3300049574 Bacteria 7773
2279 Ga0501038_0026001 3300049574 Bacteria 5214
2280 Ga0501038_0031485 3300049574 Bacteria 4687
2281 Ga0501038_0039232 3300049574 Bacteria 4143
2282 Ga0501038_0041394 3300049574 Bacteria 4018
2283 Ga0501038_0051632 3300049574 Bacteria 3547
2284 Ga0501038_0071647 3300049574 Bacteria 2939
2285 Ga0501038_0079031 3300049574 Bacteria 2774
2286 Ga0501038_0090799 3300049574 Bacteria 2560
2287 Ga0501038_0196696 3300049574 Bacteria 1620
2288 Ga0501038_0222342 3300049574 Bacteria 1506
2289 Ga0501038_0265978 3300049574 Bacteria 1353
2290 Ga0501039_0000012 3300049575 Bacteria 241623
2291 Ga0501039_0005026 3300049575 Bacteria 10027
2292 Ga0501039_0007888 3300049575 Bacteria 8112
2293 Ga0501039_0036387 3300049575 Bacteria 3799
2294 Ga0501039_0044093 3300049575 Bacteria 3444
2295 Ga0501039_0048916 3300049575 Bacteria 3268
2296 Ga0501039_0060551 3300049575 Bacteria 2932
2297 Ga0501039_0069857 3300049575 Bacteria 2728
2298 Ga0501039_0074160 3300049575 Bacteria 2644
2299 Ga0501039_0081004 3300049575 Bacteria 2527
2300 Ga0501039_0083826 3300049575 Bacteria 2482
2301 Ga0501039_0104889 3300049575 Bacteria 2207
2302 Ga0501039_0115394 3300049575 Bacteria 2102
2303 Ga0501039_0131202 3300049575 Bacteria 1967
2304 Ga0501039_0137252 3300049575 Bacteria 1920
2305 Ga0501039_0160231 3300049575 Bacteria 1768
2306 Ga0501040_0001880 3300049576 Bacteria 13465
2307 Ga0501040_0024632 3300049576 Bacteria 4040
2308 Ga0501040_0063855 3300049576 Bacteria 2534
2309 Ga0501041_0075539 3300049577 Bacteria 2072
2310 Ga0501042_0053387 3300049578 Bacteria 2883
2311 Ga0501042_0109750 3300049578 Bacteria 1986
2312 Ga0501043_0000022 3300049579 Bacteria 154467
2313 Ga0501043_0000085 3300049579 Bacteria 83544
2314 Ga0501043_0000211 3300049579 Bacteria 53464
2315 Ga0501043_0019496 3300049579 Bacteria 5323
2316 Ga0501043_0025654 3300049579 Bacteria 4624
2317 Ga0501043_0031144 3300049579 Bacteria 4194
2318 Ga0501043_0035591 3300049579 Bacteria 3916
2319 Ga0501043_0039538 3300049579 Bacteria 3706
2320 Ga0501043_0042729 3300049579 Bacteria 3562
2321 Ga0501043_0043378 3300049579 Bacteria 3535
2322 Ga0501043_0046856 3300049579 Bacteria 3399
2323 Ga0501043_0050782 3300049579 Bacteria 3259
2324 Ga0501043_0054900 3300049579 Bacteria 3129
2325 Ga0501043_0062866 3300049579 Bacteria 2915
2326 Ga0501043_0071468 3300049579 Bacteria 2726
2327 Ga0501043_0072831 3300049579 Bacteria 2698
2328 Ga0501043_0201500 3300049579 Bacteria 1545
2329 Ga0501043_0246896 3300049579 Bacteria 1375
2330 Ga0501046_0000267 3300049580 Bacteria 53185
2331 Ga0501046_0001536 3300049580 Bacteria 22030
2332 Ga0501046_0013460 3300049580 Bacteria 6924
2333 Ga0501046_0026846 3300049580 Bacteria 4703
2334 Ga0501046_0062164 3300049580 Bacteria 2918
2335 Ga0501046_0075547 3300049580 Bacteria 2612
2336 Ga0501046_0082690 3300049580 Bacteria 2479
2337 Ga0501046_0091570 3300049580 Bacteria 2338
2338 Ga0501046_0275014 3300049580 Bacteria 1234
2339 Ga0501047_0000079 3300049581 Bacteria 122998
2340 Ga0501047_0000221 3300049581 Bacteria 68563
2341 Ga0501047_0000380 3300049581 Bacteria 50128
2342 Ga0501047_0012718 3300049581 Bacteria 7973
2343 Ga0501047_0015912 3300049581 Bacteria 7170
2344 Ga0501047_0017518 3300049581 Bacteria 6861
2345 Ga0501047_0031463 3300049581 Bacteria 5117
2346 Ga0501047_0041124 3300049581 Bacteria 4467
2347 Ga0501047_0049538 3300049581 Bacteria 4056
2348 Ga0501047_0086994 3300049581 Bacteria 3003
2349 Ga0501047_0123188 3300049581 Bacteria 2473
2350 Ga0501047_0174771 3300049581 Bacteria 2015
2351 Ga0501047_0215616 3300049581 Bacteria 1776
2352 Ga0501047_0279342 3300049581 Bacteria 1515
2353 Ga0501048_0000582 3300049582 Bacteria 25900
2354 Ga0501048_0000858 3300049582 Bacteria 22423
2355 Ga0501048_0002076 3300049582 Bacteria 15247
2356 Ga0501048_0008960 3300049582 Bacteria 7534
2357 Ga0501048_0135146 3300049582 Bacteria 1743
2358 Ga0501048_0260187 3300049582 Bacteria 1233
2359 Ga0501067_0000104 3300049583 Bacteria 48290
2360 Ga0501067_0008785 3300049583 Bacteria 5598
2361 Ga0501067_0046728 3300049583 Bacteria 2402
2362 Ga0501067_0055784 3300049583 Bacteria 2189
2363 Ga0501068_0000689 3300049584 Bacteria 17292
2364 Ga0501068_0021689 3300049584 Bacteria 3753
2365 Ga0501068_0034598 3300049584 Bacteria 3013
2366 Ga0501068_0049382 3300049584 Bacteria 2541
2367 Ga0501069_0000284 3300049585 Bacteria 23001
2368 Ga0501069_0003185 3300049585 Bacteria 8404
2369 Ga0501069_0018590 3300049585 Bacteria 3751
2370 Ga0501069_0071911 3300049585 Bacteria 1939
2371 Ga0501069_0086027 3300049585 Bacteria 1775
2372 Ga0501070_0000103 3300049586 Bacteria 74597
2373 Ga0501070_0000601 3300049586 Bacteria 32926
2374 Ga0501070_0003323 3300049586 Bacteria 13965
2375 Ga0501070_0015274 3300049586 Bacteria 6461
2376 Ga0501070_0026619 3300049586 Bacteria 4852
2377 Ga0501070_0028528 3300049586 Bacteria 4682
2378 Ga0501070_0040501 3300049586 Bacteria 3884
2379 Ga0501070_0041137 3300049586 Bacteria 3850
2380 Ga0501070_0146822 3300049586 Bacteria 1946
2381 Ga0501070_0257447 3300049586 Bacteria 1427
2382 Ga0501070_0268111 3300049586 Bacteria 1395
2383 Ga0501071_0022525 3300049587 Bacteria 4392
2384 Ga0501071_0054744 3300049587 Bacteria 2879
2385 Ga0501071_0069838 3300049587 Bacteria 2558
2386 Ga0501071_0083339 3300049587 Bacteria 2342
2387 Ga0501071_0102904 3300049587 Bacteria 2106
2388 Ga0501071_0105884 3300049587 Bacteria 2076
2389 Ga0501072_0001082 3300049588 Bacteria 20218
2390 Ga0501072_0001591 3300049588 Bacteria 16965
2391 Ga0501072_0009005 3300049588 Bacteria 7589
2392 Ga0501072_0020421 3300049588 Bacteria 5132
2393 Ga0501072_0043055 3300049588 Bacteria 3548
2394 Ga0501072_0159238 3300049588 Bacteria 1801
2395 Ga0501073_0000290 3300049589 Bacteria 33072
2396 Ga0501073_0026954 3300049589 Bacteria 4113
2397 Ga0501073_0047809 3300049589 Bacteria 3005
2398 Ga0501073_0064742 3300049589 Bacteria 2550
2399 Ga0501073_0092831 3300049589 Bacteria 2098
2400 Ga0501073_0175172 3300049589 Bacteria 1484
2401 Ga0501074_0000094 3300049590 Bacteria 42565
2402 Ga0501074_0000627 3300049590 Bacteria 21914
2403 Ga0501074_0008381 3300049590 Bacteria 7493
2404 Ga0501074_0078327 3300049590 Bacteria 2372
2405 Ga0501074_0084640 3300049590 Bacteria 2273
2406 Ga0501074_0093634 3300049590 Bacteria 2152
2407 Ga0501074_0114939 3300049590 Bacteria 1925
2408 Ga0501074_0130983 3300049590 Bacteria 1794
2409 Ga0501074_0166927 3300049590 Bacteria 1571
2410 Ga0501075_0009599 3300049591 Bacteria 6775
2411 Ga0501075_0033946 3300049591 Bacteria 3797
2412 Ga0501075_0037983 3300049591 Bacteria 3600
2413 Ga0501075_0039882 3300049591 Bacteria 3515
2414 Ga0501075_0042960 3300049591 Bacteria 3390
2415 Ga0501075_0186834 3300049591 Bacteria 1581
2416 Ga0501076_0010260 3300049592 Bacteria 6944
2417 Ga0501076_0016240 3300049592 Bacteria 5640
2418 Ga0501076_0067934 3300049592 Bacteria 2847
2419 Ga0501076_0232011 3300049592 Bacteria 1509
2420 Ga0501077_0009864 3300049593 Bacteria 5939
2421 Ga0501077_0024032 3300049593 Bacteria 3867
2422 Ga0501079_0000727 3300049741 Bacteria 22255
2423 Ga0501079_0002574 3300049741 Bacteria 13174
2424 Ga0501079_0027439 3300049741 Bacteria 4366
2425 Ga0501079_0045485 3300049741 Bacteria 3388
2426 Ga0501079_0120828 3300049741 Bacteria 2037
2427 Ga0501080_0007905 3300049742 Bacteria 9633
2428 Ga0501080_0008900 3300049742 Bacteria 9127
2429 Ga0501080_0009419 3300049742 Bacteria 8907
2430 Ga0501080_0029767 3300049742 Bacteria 5082
2431 Ga0501080_0036485 3300049742 Bacteria 4588
2432 Ga0501080_0047761 3300049742 Bacteria 3985
2433 Ga0501080_0055234 3300049742 Bacteria 3699
2434 Ga0501080_0087084 3300049742 Bacteria 2902
2435 Ga0501080_0121138 3300049742 Bacteria 2424
2436 Ga0501080_0202660 3300049742 Bacteria 1821
2437 Ga0501080_0344415 3300049742 Bacteria 1346
2438 Ga0501081_0001063 3300049743 Bacteria 16481
2439 Ga0501081_0056938 3300049743 Bacteria 2702
2440 Ga0501081_0057668 3300049743 Bacteria 2686
2441 Ga0501083_0000087 3300049744 Bacteria 62691
2442 Ga0501083_0000374 3300049744 Bacteria 28288
2443 Ga0501083_0001525 3300049744 Bacteria 15834
2444 Ga0501083_0003683 3300049744 Bacteria 10765
2445 Ga0501083_0053580 3300049744 Bacteria 2708
2446 Ga0501083_0116504 3300049744 Bacteria 1754
2447 Ga0501083_0149420 3300049744 Bacteria 1530
2448 Ga0501083_0170214 3300049744 Bacteria 1424
2449 Ga0501083_0189189 3300049744 Bacteria 1343
2450 Ga0501035_0000035 3300049822 Bacteria 166916
2451 Ga0501035_0000223 3300049822 Bacteria 67732
2452 Ga0501035_0001800 3300049822 Bacteria 21664
2453 Ga0501035_0003063 3300049822 Bacteria 16035
2454 Ga0501035_0003617 3300049822 Bacteria 14753
2455 Ga0501035_0013006 3300049822 Bacteria 7679
2456 Ga0501035_0013765 3300049822 Bacteria 7467
2457 Ga0501035_0016640 3300049822 Bacteria 6781
2458 Ga0501035_0019507 3300049822 Bacteria 6234
2459 Ga0501035_0021754 3300049822 Bacteria 5896
2460 Ga0501035_0021999 3300049822 Bacteria 5857
2461 Ga0501035_0029550 3300049822 Bacteria 4999
2462 Ga0501035_0033390 3300049822 Bacteria 4680
2463 Ga0501035_0048984 3300049822 Bacteria 3787
2464 Ga0501035_0059069 3300049822 Bacteria 3415
2465 Ga0501035_0060562 3300049822 Bacteria 3370
2466 Ga0501035_0075059 3300049822 Bacteria 2990
2467 Ga0501035_0128079 3300049822 Bacteria 2215
2468 Ga0501035_0139838 3300049822 Bacteria 2105
2469 Ga0501035_0182242 3300049822 Bacteria 1809
2470 Ga0501044_0000015 3300049823 Bacteria 241623
2471 Ga0501044_0000369 3300049823 Bacteria 56363
2472 Ga0501044_0000516 3300049823 Bacteria 47012
2473 Ga0501044_0000578 3300049823 Bacteria 44504
2474 Ga0501044_0008397 3300049823 Bacteria 11327
2475 Ga0501044_0008812 3300049823 Bacteria 11035
2476 Ga0501044_0013155 3300049823 Bacteria 8957
2477 Ga0501044_0015943 3300049823 Bacteria 8086
2478 Ga0501044_0016305 3300049823 Bacteria 7982
2479 Ga0501044_0016560 3300049823 Bacteria 7912
2480 Ga0501044_0017409 3300049823 Bacteria 7709
2481 Ga0501044_0018763 3300049823 Bacteria 7409
2482 Ga0501044_0023766 3300049823 Bacteria 6517
2483 Ga0501044_0065124 3300049823 Bacteria 3717
2484 Ga0501044_0067647 3300049823 Bacteria 3639
2485 Ga0501044_0071838 3300049823 Bacteria 3519
2486 Ga0501044_0072377 3300049823 Bacteria 3504
2487 Ga0501044_0073799 3300049823 Bacteria 3467
2488 Ga0501044_0094349 3300049823 Bacteria 3017
2489 Ga0501044_0116320 3300049823 Bacteria 2679
2490 Ga0501044_0191864 3300049823 Bacteria 2005
2491 Ga0501044_0222535 3300049823 Bacteria 1837
2492 Ga0501044_0358921 3300049823 Bacteria 1375
2493 Ga0501044_0380401 3300049823 Bacteria 1327
2494 Ga0501044_0396900 3300049823 Bacteria 1292
2495 Ga0501045_0003601 3300049824 Bacteria 10642
2496 Ga0501045_0015619 3300049824 Bacteria 5387
2497 Ga0501045_0027818 3300049824 Bacteria 4077
2498 Ga0501045_0030334 3300049824 Bacteria 3913
2499 Ga0501045_0213603 3300049824 Bacteria 1437
2500 nmdc:mga03683_21282_c1 3300050489 Bacteria 2497
2501 nmdc:mga03683_37247_c1 3300050489 Bacteria 1981
2502 nmdc:mga03683_3875_c1 3300050489 Bacteria 4888
2503 nmdc:mga03n38_380_c1 3300050490 Bacteria 10915
2504 nmdc:mga00v17_12168_c2 3300050491 Bacteria 3442
2505 nmdc:mga00v17_125571_c1 3300050491 Bacteria 1227
2506 nmdc:mga00v17_51_c1 3300050491 Bacteria 73235
2507 nmdc:mga0yw44_131209_c1 3300050492 Bacteria 1622
2508 nmdc:mga0yw44_21266_c1 3300050492 Bacteria 3616
2509 nmdc:mga0yw44_23613_c1 3300050492 Bacteria 3467
2510 nmdc:mga0yw44_2950_c1 3300050492 Bacteria 6720
2511 nmdc:mga0yw44_29741_c1 3300050492 Bacteria 3157
2512 nmdc:mga0yw44_5645_c1 3300050492 Bacteria 5950
2513 nmdc:mga0yw44_78188_c1 3300050492 Bacteria 2069
2514 nmdc:mga0k408_127740_c1 3300050493 Bacteria 1508
2515 nmdc:mga0k408_33002_c1 3300050493 Bacteria 2959
2516 nmdc:mga06z11_11646_c1 3300050494 Bacteria 3800
2517 nmdc:mga06z11_1301_c1 3300050494 Bacteria 9228
2518 nmdc:mga06z11_143627_c1 3300050494 Bacteria 1351
2519 nmdc:mga06z11_24940_c1 3300050494 Bacteria 2827
2520 nmdc:mga06z11_27745_c1 3300050494 Bacteria 2709
2521 nmdc:mga06z11_36507_c1 3300050494 Bacteria 2427
2522 nmdc:mga06z11_81524_c1 3300050494 Bacteria 1737
2523 nmdc:mga04h51_54215_c1 3300050495 Bacteria 1355
2524 nmdc:mga07m45_49149_c1 3300050496 Bacteria 2373
2525 nmdc:mga07m45_5309_c2 3300050496 Bacteria 3527
2526 nmdc:mga05p37_113589_c1 3300050507 Bacteria 3330
2527 nmdc:mga05p37_1242_c1 3300050507 Bacteria 29598
2528 nmdc:mga05p37_196059_c1 3300050507 Bacteria 2449
2529 nmdc:mga05p37_2458_c1 3300050507 Bacteria 21543
2530 nmdc:mga05p37_292909_c1 3300050507 Bacteria 1937
2531 nmdc:mga05p37_324851_c1 3300050507 Bacteria 1820
2532 nmdc:mga05p37_62833_c1 3300050507 Bacteria 4570
2533 nmdc:mga05p37_7606_c1 3300050507 Bacteria 12784
2534 nmdc:mga05p37_83403_c1 3300050507 Bacteria 3937
2535 nmdc:mga05p37_8850_c1 3300050507 Bacteria 11895
2536 nmdc:mga05p37_9470_c1 3300050507 Bacteria 11532
2537 nmdc:mga09592_10948_c1 3300050508 Bacteria 7379
2538 nmdc:mga09592_480_c1 3300050508 Bacteria 29887
2539 nmdc:mga09592_800_c1 3300050508 Bacteria 24361
2540 nmdc:mga09592_848_c1 3300050508 Bacteria 23773
2541 nmdc:mga0qj67_17812_c1 3300050509 Bacteria 5404
2542 nmdc:mga0qj67_23821_c1 3300050509 Bacteria 4714
2543 nmdc:mga0qj67_514_c1 3300050509 Bacteria 26446
2544 nmdc:mga0qj67_873_c1 3300050509 Bacteria 20663
2545 nmdc:mga06r32_117911_c1 3300050510 Bacteria 2616
2546 nmdc:mga06r32_1406_c1 3300050510 Bacteria 21718
2547 nmdc:mga06r32_417029_c1 3300050510 Bacteria 1324
2548 nmdc:mga06r32_62800_c1 3300050510 Bacteria 3579
2549 nmdc:mga06r32_94_c1 3300050510 Bacteria 61840
2550 nmdc:mga06r32_9941_c1 3300050510 Bacteria 8586
2551 nmdc:mga08y16_1532_c1 3300050511 Bacteria 23233
2552 nmdc:mga08y16_1541_c2 3300050511 Bacteria 16835
2553 nmdc:mga08y16_160_c1 3300050511 Bacteria 58113
2554 nmdc:mga08y16_1962_c1 3300050511 Bacteria 20974
2555 nmdc:mga08y16_20423_c1 3300050511 Bacteria 6991
2556 nmdc:mga08y16_236041_c1 3300050511 Bacteria 1891
2557 nmdc:mga08y16_238449_c1 3300050511 Bacteria 1880
2558 nmdc:mga08y16_2747_c1 3300050511 Bacteria 18041
2559 nmdc:mga08y16_410_c1 3300050511 Bacteria 39418
2560 nmdc:mga08y16_44609_c1 3300050511 Bacteria 4645
2561 nmdc:mga08y16_89906_c1 3300050511 Bacteria 3200
2562 nmdc:mga0n895_114842_c1 3300050512 Bacteria 2710
2563 nmdc:mga0n895_1152_c1 3300050512 Bacteria 19359
2564 nmdc:mga0n895_174865_c1 3300050512 Bacteria 2178
2565 nmdc:mga0n895_21004_c1 3300050512 Bacteria 6099
2566 nmdc:mga0n895_271922_c1 3300050512 Bacteria 1719
2567 nmdc:mga0n895_31905_c1 3300050512 Bacteria 5050
2568 nmdc:mga0n895_32724_c1 3300050512 Bacteria 4992
2569 nmdc:mga0n895_358_c1 3300050512 Bacteria 30661
2570 nmdc:mga0n895_791_c2 3300050512 Bacteria 13197
2571 nmdc:mga0rr50_266743_c1 3300050513 Bacteria 1426
2572 nmdc:mga08x19_29347_c1 3300050514 Bacteria 3449
2573 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
2574 nmdc:mga0a205_102898_c1 3300050515 Bacteria 2754
2575 nmdc:mga0a205_133555_c1 3300050515 Bacteria 2382
2576 nmdc:mga0a205_234740_c1 3300050515 Bacteria 1716
2577 nmdc:mga0a205_35179_c1 3300050515 Bacteria 4809
2578 nmdc:mga0a205_39044_c1 3300050515 Bacteria 4569
2579 Ga0495601_0000001 3300053077 Bacteria 549454
2580 Ga0495601_0000095 3300053077 Bacteria 48556
2581 Ga0495601_0000316 3300053077 Bacteria 25622
2582 Ga0495601_0002508 3300053077 Bacteria 10448
2583 Ga0495601_0004144 3300053077 Bacteria 8355
2584 Ga0495601_0006189 3300053077 Bacteria 6987
2585 Ga0495601_0031775 3300053077 Bacteria 3282
2586 Ga0495601_0033666 3300053077 Bacteria 3193
2587 Ga0495601_0041563 3300053077 Bacteria 2883
2588 Ga0495601_0042354 3300053077 Bacteria 2856
2589 Ga0495601_0133294 3300053077 Bacteria 1619
2590 Ga0495601_0155440 3300053077 Bacteria 1493
2591 Ga0495601_0170181 3300053077 Bacteria 1424
2592 Ga0495612_0000017 3300053078 Bacteria 152112
2593 Ga0495612_0000118 3300053078 Bacteria 33388
2594 Ga0495612_0000812 3300053078 Bacteria 12723
2595 Ga0495612_0000834 3300053078 Bacteria 12533
2596 Ga0495612_0012919 3300053078 Bacteria 3364
2597 Ga0495612_0100551 3300053078 Bacteria 1231
2598 Ga0500610_0033875 3300053079 Bacteria 2610
2599 Ga0500635_0000553 3300053080 Bacteria 9959
2600 Ga0495655_0009867 3300053083 Bacteria 1866
2601 Ga0495595_0000010 3300053084 Bacteria 178819
2602 Ga0495595_0000214 3300053084 Bacteria 23362
2603 Ga0495595_0000261 3300053084 Bacteria 20962
2604 Ga0495595_0002798 3300053084 Bacteria 6863
2605 Ga0495595_0017420 3300053084 Bacteria 3090
2606 Ga0495595_0017958 3300053084 Bacteria 3049
2607 Ga0495595_0033329 3300053084 Bacteria 2323
2608 Ga0495595_0035642 3300053084 Bacteria 2254
2609 Ga0495595_0037724 3300053084 Bacteria 2198
2610 Ga0495595_0045461 3300053084 Bacteria 2020
2611 Ga0495595_0066140 3300053084 Bacteria 1701
2612 Ga0495619_0000014 3300053085 Bacteria 261449
2613 Ga0495619_0000056 3300053085 Bacteria 95385
2614 Ga0495619_0000351 3300053085 Bacteria 32176
2615 Ga0495619_0000498 3300053085 Bacteria 26335
2616 Ga0495619_0001245 3300053085 Bacteria 16673
2617 Ga0495619_0002197 3300053085 Bacteria 12929
2618 Ga0495619_0012921 3300053085 Bacteria 5260
2619 Ga0495619_0023467 3300053085 Bacteria 3955
2620 Ga0495619_0027358 3300053085 Bacteria 3671
2621 Ga0495619_0030001 3300053085 Bacteria 3518
2622 Ga0495619_0037857 3300053085 Bacteria 3145
2623 Ga0495619_0078589 3300053085 Bacteria 2218
2624 Ga0495619_0079671 3300053085 Bacteria 2203
2625 Ga0495619_0086632 3300053085 Bacteria 2117
2626 Ga0495619_0184490 3300053085 Bacteria 1443
2627 Ga0495619_0205481 3300053085 Bacteria 1363
2628 Ga0495619_0241310 3300053085 Bacteria 1252
2629 Ga0500643_000035 3300053087 Bacteria 184794
2630 Ga0500643_004228 3300053087 Bacteria 6574
2631 Ga0500644_0000325 3300053088 Bacteria 24740
2632 Ga0500581_068891 3300053089 Bacteria 1782
2633 Ga0500651_0008405 3300053093 Bacteria 6072
2634 Ga0500651_0040446 3300053093 Bacteria 2937
2635 Ga0500651_0086345 3300053093 Bacteria 1938
2636 Ga0500566_0000006 3300053094 Bacteria 153632
2637 Ga0500566_0001514 3300053094 Bacteria 13633
2638 Ga0500566_0002990 3300053094 Bacteria 10093
2639 Ga0500566_0014528 3300053094 Bacteria 4627
2640 Ga0500640_000996 3300053095 Bacteria 8055
2641 Ga0500641_0001371 3300053096 Bacteria 8681
2642 Ga0500641_0003439 3300053096 Bacteria 5596
2643 Ga0500641_0011224 3300053096 Bacteria 3250
2644 Ga0500650_0000139 3300053098 Bacteria 18956
2645 Ga0500555_005851 3300053103 Bacteria 3489
2646 Ga0500556_0000002 3300053104 Bacteria 773626
2647 Ga0500556_0005941 3300053104 Bacteria 3457
2648 Ga0500557_000004 3300053105 Bacteria 202318
2649 Ga0500560_000106 3300053107 Bacteria 8608
2650 Ga0500572_000205 3300053111 Bacteria 20946
2651 Ga0500572_001372 3300053111 Bacteria 6719
2652 Ga0500572_048050 3300053111 Bacteria 1262
2653 Ga0500593_024644 3300053117 Bacteria 2672
2654 Ga0500595_000001 3300053119 Bacteria 1088438
2655 Ga0500595_000152 3300053119 Bacteria 45452
2656 Ga0500595_002016 3300053119 Bacteria 10397
2657 Ga0500595_002270 3300053119 Bacteria 9692
2658 Ga0500595_008028 3300053119 Bacteria 4332
2659 Ga0500595_010226 3300053119 Bacteria 3738
2660 Ga0500607_003322 3300053121 Bacteria 11837
2661 Ga0500607_055260 3300053121 Bacteria 2099
2662 Ga0500608_000349 3300053122 Bacteria 17817
2663 Ga0500618_002246 3300053125 Bacteria 7520
2664 Ga0500618_006498 3300053125 Bacteria 3425
2665 Ga0500618_009304 3300053125 Bacteria 2688
2666 Ga0500618_016952 3300053125 Bacteria 1817
2667 Ga0500642_0000016 3300053130 Bacteria 176560
2668 Ga0500642_0008362 3300053130 Bacteria 3538
2669 Ga0500642_0009145 3300053130 Bacteria 3424
2670 Ga0500642_0062935 3300053130 Bacteria 1671
2671 Ga0500655_000041 3300053133 Bacteria 35332
2672 Ga0500655_016003 3300053133 Bacteria 1379
2673 Ga0500658_0007755 3300053134 Bacteria 3964
2674 Ga0500559_0001029 3300053136 Bacteria 17100
2675 Ga0500559_0001124 3300053136 Bacteria 16108
2676 Ga0500559_0001576 3300053136 Bacteria 12756
2677 Ga0500559_0022304 3300053136 Bacteria 2685
2678 Ga0500559_0072796 3300053136 Bacteria 1549
2679 Ga0500561_0000260 3300053137 Bacteria 9203
2680 Ga0500568_0000125 3300053139 Bacteria 68806
2681 Ga0500568_0001161 3300053139 Bacteria 17597
2682 Ga0500568_0032309 3300053139 Bacteria 2153
2683 Ga0500573_0034555 3300053140 Bacteria 2916
2684 Ga0500603_000671 3300053150 Bacteria 8328
2685 Ga0500603_001483 3300053150 Bacteria 5353
2686 Ga0500616_0000001 3300053153 Bacteria 1986011
2687 Ga0500616_0000061 3300053153 Bacteria 249158
2688 Ga0500616_0000296 3300053153 Bacteria 72493
2689 Ga0500616_0020934 3300053153 Bacteria 3672
2690 Ga0500616_0028797 3300053153 Bacteria 3059
2691 Ga0500616_0044050 3300053153 Bacteria 2382
2692 Ga0500616_0058950 3300053153 Bacteria 1995
2693 Ga0500620_000249 3300053155 Bacteria 10481
2694 Ga0500622_0000916 3300053156 Bacteria 25118
2695 Ga0500622_0003804 3300053156 Bacteria 9828
2696 Ga0500624_000316 3300053157 Bacteria 16592
2697 Ga0500624_001547 3300053157 Bacteria 3572
2698 Ga0500627_0034808 3300053158 Bacteria 2137
2699 Ga0500627_0041302 3300053158 Bacteria 1982
2700 Ga0500630_000954 3300053159 Bacteria 13513
2701 Ga0500638_000921 3300053162 Bacteria 8347
2702 Ga0500638_032968 3300053162 Bacteria 2502
2703 Ga0500639_000016 3300053163 Bacteria 118099
2704 Ga0500636_0000142 3300053177 Bacteria 37592
2705 Ga0500636_0000262 3300053177 Bacteria 29181
2706 Ga0500636_0005190 3300053177 Bacteria 7410
2707 Ga0500636_0007135 3300053177 Bacteria 6452
2708 Ga0500636_0012297 3300053177 Bacteria 5014
2709 Ga0500637_0000652 3300053178 Bacteria 13763
2710 Ga0500637_0002374 3300053178 Bacteria 8352
2711 Ga0500637_0080535 3300053178 Bacteria 1881
2712 Ga0500611_019458 3300053727 Bacteria 1268
2713 Ga0500625_013688 3300053729 Bacteria 3735
2714 Ga0500645_000629 3300053730 Bacteria 22510
2715 Ga0500599_000991 3300053736 Bacteria 3178
2716 Ga0501084_0006359 3300054114 Bacteria 9703
2717 Ga0501084_0031091 3300054114 Bacteria 4465
2718 Ga0501084_0038762 3300054114 Bacteria 3984
2719 Ga0501084_0056864 3300054114 Bacteria 3273
2720 Ga0501084_0057730 3300054114 Bacteria 3247
2721 Ga0501084_0118145 3300054114 Bacteria 2229
2722 Ga0590075_008941 3300059424 Bacteria 2397
2723 Ga0501082_0000002 3300060353 Bacteria 186546
2724 Ga0501082_0007109 3300060353 Bacteria 9658
2725 Ga0501082_0011831 3300060353 Bacteria 7500
2726 Ga0501082_0015300 3300060353 Bacteria 6605
2727 Ga0501082_0015319 3300060353 Bacteria 6600
2728 Ga0501082_0030845 3300060353 Bacteria 4621
2729 Ga0501082_0051155 3300060353 Bacteria 3561
2730 Ga0501082_0098807 3300060353 Bacteria 2524
2731 Ga0501082_0125631 3300060353 Bacteria 2225
2732 Ga0501082_0205053 3300060353 Bacteria 1715
2733 Ga0501082_0259513 3300060353 Bacteria 1512
2734 Ga0466962_0048349 3300061719 Bacteria 2033
2735 Ga0466962_0086052 3300061719 Bacteria 1505
2736 Ga0530510_0006156 3300061734 Bacteria 8335
2737 Ga0530510_0169227 3300061734 Bacteria 1618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042131 Ga0450894_014274 Ga0450894_014274_13_897 257
2 3300047317 Ga0495604_0163032 Ga0495604_0163032_601_1563 283
3 3300046474 Ga0495605_0101675 Ga0495605_0101675_45_1070 304
4 3300025900 Ga0207710_10083539 Ga0207710_100835392 305
5 iso_pu_bacteria 8016603502 8016610234 305
6 3300046529 Ga0495652_0305259 Ga0495652_0305259_98_1138 309
7 iso_pu_bacteria 8016530956 8016534558 313
8 iso_pu_bacteria 8019619141 8019628482 313
9 iso_pu_bacteria 2965047637 2965052141 316
10 3300031249 Ga0265339_10046228 Ga0265339_100462282 320
11 3300044694 Ga0466963_0250084 Ga0466963_0250084_146_1234 324
12 3300046475 Ga0495639_0039061 Ga0495639_0039061_1036_2121 324
13 3300037068 Ga0373925_0025219 Ga0373925_0025219_75_1166 326
14 3300046511 Ga0495608_0170517 Ga0495608_0170517_74_1165 326
15 3300048906 Ga0496103_0084224 Ga0496103_0084224_863_1954 326
16 3300049573 Ga0501037_0132149 Ga0501037_0132149_681_1778 327
17 3300049580 Ga0501046_0275014 Ga0501046_0275014_126_1223 327
18 3300053727 Ga0500611_019458 Ga0500611_019458_159_1256 327
19 3300048903 Ga0496100_0029132 Ga0496100_0029132_208_1305 328
20 3300048904 Ga0496101_0168803 Ga0496101_0168803_249_1346 328
21 3300049575 Ga0501039_0160231 Ga0501039_0160231_232_1413 328
22 3300049588 Ga0501072_0159238 Ga0501072_0159238_302_1483 328
23 3300049591 Ga0501075_0042960 Ga0501075_0042960_1083_2264 328
24 3300049743 Ga0501081_0057668 Ga0501081_0057668_1360_2541 328
25 3300049823 Ga0501044_0396900 Ga0501044_0396900_69_1166 328
26 3300049824 Ga0501045_0015619 Ga0501045_0015619_369_1550 328
27 3300053125 Ga0500618_009304 Ga0500618_009304_437_1603 328
28 3300060353 Ga0501082_0125631 Ga0501082_0125631_853_2034 328
29 3300044693 Ga0466961_0040920 Ga0466961_0040920_1211_2377 330
30 3300037068 Ga0373925_0209548 Ga0373925_0209548_403_1509 331
31 3300038443 Ga0395901_0338810 Ga0395901_0338810_173_1237 331
32 3300049571 Ga0501034_0137276 Ga0501034_0137276_1278_2384 331
33 3300049593 Ga0501077_0024032 Ga0501077_0024032_1563_2669 331
34 3300005339 Ga0070660_100039991 Ga0070660_1000399912 332
35 3300035242 Ga0373962_0006951 Ga0373962_0006951_244_1374 332
36 3300009551 Ga0105238_10038823 Ga0105238_100388232 333
37 3300044901 Ga0466960_0129397 Ga0466960_0129397_43_1212 333
38 3300044712 Ga0453684_0156952 Ga0453684_0156952_1274_2440 334
39 3300021388 Ga0213875_10003211 Ga0213875_1000321111 335
40 3300025298 Ga0209050_1000671 Ga0209050_10006716 335
41 3300037853 Ga0436364_1385698 Ga0436364_1385698_1327_2496 335
42 3300049574 Ga0501038_0041394 Ga0501038_0041394_2884_4002 335
43 3300045836 Ga0466958_0010635 Ga0466958_0010635_3781_4947 336
44 3300047319 Ga0495674_0345522 Ga0495674_0345522_71_1192 336
45 3300049582 Ga0501048_0260187 Ga0501048_0260187_12_1133 336
46 3300046471 Ga0495650_0026363 Ga0495650_0026363_779_1945 339
47 3300048920 Ga0496117_0175913 Ga0496117_0175913_23_1162 341
48 3300048928 Ga0496125_0001496 Ga0496125_0001496_13814_14953 341
49 3300053153 Ga0500616_0000061 Ga0500616_0000061_229529_230668 341
50 3300006038 Ga0075365_10093037 Ga0075365_100930372 342
51 3300021384 Ga0213876_10010793 Ga0213876_100107932 342
52 3300031249 Ga0265339_10019287 Ga0265339_100192872 342
53 3300031250 Ga0265331_10009183 Ga0265331_100091835 342
54 3300031595 Ga0265313_10008621 Ga0265313_100086214 342
55 3300031711 Ga0265314_10104967 Ga0265314_101049672 342
56 3300039437 Ga0436365_1463106 Ga0436365_1463106_2562_3728 342
57 3300050492 nmdc:mga0yw44_23613_c1 nmdc:mga0yw44_23613_c1_1512_2705 342
58 3300031241 Ga0265325_10122730 Ga0265325_101227301 343
59 3300035121 Ga0373960_0015179 Ga0373960_0015179_125_1288 343
60 3300035691 Ga0373931_0003067 Ga0373931_0003067_2002_3165 343
61 3300046501 Ga0495607_0000071 Ga0495607_0000071_22938_24110 343
62 3300050511 nmdc:mga08y16_238449_c1 nmdc:mga08y16_238449_c1_256_1419 343
63 3300048088 Ga0495602_0073081 Ga0495602_0073081_1372_2544 345
64 3300035089 Ga0373944_0008808 Ga0373944_0008808_477_1628 346
65 3300035113 Ga0373936_0007442 Ga0373936_0007442_1000_2151 346
66 3300035170 Ga0373943_0009675 Ga0373943_0009675_2947_4098 346
67 3300035725 Ga0373947_0012827 Ga0373947_0012827_956_2107 346
68 3300046461 Ga0495641_0020456 Ga0495641_0020456_1988_3139 346
69 3300046491 Ga0495584_0052272 Ga0495584_0052272_128_1279 346
70 3300046492 Ga0495585_0015259 Ga0495585_0015259_2206_3357 346
71 3300046523 Ga0495644_0009287 Ga0495644_0009287_304_1455 346
72 3300046537 Ga0495598_0004524 Ga0495598_0004524_1037_2188 346
73 3300046557 Ga0495622_0021777 Ga0495622_0021777_392_1543 346
74 3300046558 Ga0495633_0018437 Ga0495633_0018437_953_2104 346
75 3300046615 Ga0495656_0009875 Ga0495656_0009875_1660_2811 346
76 3300046665 Ga0495661_0110362 Ga0495661_0110362_101_1252 346
77 3300046674 Ga0495588_0050113 Ga0495588_0050113_938_2089 346
78 3300046681 Ga0495647_0012083 Ga0495647_0012083_321_1472 346
79 3300046683 Ga0495658_0055136 Ga0495658_0055136_88_1239 346
80 3300046689 Ga0495613_0033948 Ga0495613_0033948_1740_2891 346
81 3300046691 Ga0495670_0008138 Ga0495670_0008138_1350_2501 346
82 3300046692 Ga0495671_0084324 Ga0495671_0084324_181_1332 346
83 3300047472 Ga0495686_0003430 Ga0495686_0003430_5767_6918 346
84 3300048904 Ga0496101_0006818 Ga0496101_0006818_422_1573 346
85 3300048905 Ga0496102_0002866 Ga0496102_0002866_2523_3674 346
86 3300048907 Ga0496104_0000194 Ga0496104_0000194_12810_13961 346
87 3300048907 Ga0496104_0000577 Ga0496104_0000577_5964_7115 346
88 3300048907 Ga0496104_0000591 Ga0496104_0000591_26379_27530 346
89 3300048908 Ga0496105_0005828 Ga0496105_0005828_4975_6126 346
90 3300048909 Ga0496106_0000990 Ga0496106_0000990_16076_17227 346
91 3300048910 Ga0496107_0005579 Ga0496107_0005579_7185_8336 346
92 3300048911 Ga0496108_0009720 Ga0496108_0009720_752_1903 346
93 3300048911 Ga0496108_0069354 Ga0496108_0069354_1052_2203 346
94 3300048912 Ga0496109_0005428 Ga0496109_0005428_8752_9903 346
95 3300048912 Ga0496109_0090349 Ga0496109_0090349_1043_2194 346
96 3300048913 Ga0496110_0001173 Ga0496110_0001173_7841_8992 346
97 3300048913 Ga0496110_0005945 Ga0496110_0005945_2758_3909 346
98 3300048914 Ga0496111_0006536 Ga0496111_0006536_5665_6816 346
99 3300048914 Ga0496111_0007757 Ga0496111_0007757_431_1582 346
100 3300048915 Ga0496112_0038139 Ga0496112_0038139_1581_2732 346
101 3300048915 Ga0496112_0050327 Ga0496112_0050327_1975_3126 346
102 3300048916 Ga0496113_0010581 Ga0496113_0010581_762_1913 346
103 3300048916 Ga0496113_0066998 Ga0496113_0066998_1304_2455 346
104 3300048918 Ga0496115_0121285 Ga0496115_0121285_186_1337 346
105 3300049570 Ga0501033_0219564 Ga0501033_0219564_12_1163 346
106 3300049571 Ga0501034_0372640 Ga0501034_0372640_12_1163 346
107 3300049574 Ga0501038_0222342 Ga0501038_0222342_205_1356 346
108 3300049574 Ga0501038_0265978 Ga0501038_0265978_12_1163 346
109 3300049583 Ga0501067_0055784 Ga0501067_0055784_400_1551 346
110 3300050492 nmdc:mga0yw44_29741_c1 nmdc:mga0yw44_29741_c1_390_1541 346
111 3300053077 Ga0495601_0170181 Ga0495601_0170181_96_1247 346
112 iso_pu_bacteria 2513237098 2513674409 346
113 iso_pu_bacteria 2524023210 2524465785 346
114 iso_pu_bacteria 2643221623 2644132734 346
115 iso_pu_bacteria 2738543024 2739306647 346
116 iso_pu_bacteria 2885383462 2885391462 346
117 iso_pu_bacteria 2903768456 2903777535 346
118 iso_pu_bacteria 2929212328 2929219152 346
119 iso_pu_bacteria 8002285264 8002287989 346
120 iso_pu_bacteria 8056681323 8056688320 346
121 3300031456 Ga0307513_10062899 Ga0307513_100628993 347
122 3300035089 Ga0373944_0023567 Ga0373944_0023567_485_1639 347
123 3300035111 Ga0373923_0003017 Ga0373923_0003017_554_1708 347
124 3300035113 Ga0373936_0000082 Ga0373936_0000082_7306_8460 347
125 3300035117 Ga0373953_0052471 Ga0373953_0052471_188_1342 347
126 3300035118 Ga0373954_0003768 Ga0373954_0003768_2255_3409 347
127 3300035171 Ga0373946_0001140 Ga0373946_0001140_6874_8028 347
128 3300035172 Ga0373955_0000306 Ga0373955_0000306_17992_19146 347
129 3300035410 Ga0373924_0000437 Ga0373924_0000437_4269_5423 347
130 3300035692 Ga0373935_0000287 Ga0373935_0000287_9297_10451 347
131 3300035695 Ga0373927_0006833 Ga0373927_0006833_5685_6839 347
132 3300035724 Ga0373933_0002816 Ga0373933_0002816_2157_3311 347
133 3300035725 Ga0373947_0002644 Ga0373947_0002644_4190_5344 347
134 3300036401 Ga0373937_0000269 Ga0373937_0000269_17120_18274 347
135 3300037068 Ga0373925_0000075 Ga0373925_0000075_69540_70694 347
136 3300046454 Ga0495592_0000060 Ga0495592_0000060_65454_66608 347
137 3300046459 Ga0495629_0004130 Ga0495629_0004130_1229_2383 347
138 3300046462 Ga0495651_0000762 Ga0495651_0000762_5412_6566 347
139 3300046463 Ga0495653_0000129 Ga0495653_0000129_30529_31683 347
140 3300046473 Ga0495582_0051934 Ga0495582_0051934_834_1988 347
141 3300046476 Ga0495662_0001138 Ga0495662_0001138_9486_10640 347
142 3300046477 Ga0495664_0000003 Ga0495664_0000003_17125_18279 347
143 3300046511 Ga0495608_0000005 Ga0495608_0000005_35845_36999 347
144 3300046514 Ga0495618_0000044 Ga0495618_0000044_28958_30112 347
145 3300046516 Ga0495628_0000001 Ga0495628_0000001_506526_507680 347
146 3300046517 Ga0495630_0000530 Ga0495630_0000530_17379_18533 347
147 3300046529 Ga0495652_0000002 Ga0495652_0000002_721060_722214 347
148 3300046533 Ga0495640_0000001 Ga0495640_0000001_815064_816218 347
149 3300046536 Ga0495587_0000001 Ga0495587_0000001_33795_34949 347
150 3300046543 Ga0495645_0000002 Ga0495645_0000002_506539_507693 347
151 3300046559 Ga0495667_0000039 Ga0495667_0000039_64684_65838 347
152 3300046642 Ga0495634_0000010 Ga0495634_0000010_134802_135956 347
153 3300046663 Ga0495635_0000001 Ga0495635_0000001_19619_20773 347
154 3300046675 Ga0495657_0000042 Ga0495657_0000042_48205_49359 347
155 3300046678 Ga0495599_0000013 Ga0495599_0000013_143933_145087 347
156 3300046679 Ga0495623_0000050 Ga0495623_0000050_50184_51338 347
157 3300046680 Ga0495646_0000009 Ga0495646_0000009_34628_35782 347
158 3300046683 Ga0495658_0045601 Ga0495658_0045601_408_1562 347
159 3300046689 Ga0495613_0004515 Ga0495613_0004515_5340_6494 347
160 3300046690 Ga0495624_0021002 Ga0495624_0021002_2311_3465 347
161 3300046809 Ga0495600_0000035 Ga0495600_0000035_38178_39332 347
162 3300047317 Ga0495604_0000069 Ga0495604_0000069_8544_9698 347
163 3300047319 Ga0495674_0000002 Ga0495674_0000002_506527_507681 347
164 3300047322 Ga0495680_0000497 Ga0495680_0000497_31080_32234 347
165 3300047444 Ga0495675_0000164 Ga0495675_0000164_16130_17284 347
166 3300047471 Ga0495684_0000016 Ga0495684_0000016_98243_99397 347
167 3300047673 Ga0495593_0000500 Ga0495593_0000500_17090_18244 347
168 3300048088 Ga0495602_0000240 Ga0495602_0000240_30426_31580 347
169 3300053077 Ga0495601_0000001 Ga0495601_0000001_524646_525800 347
170 3300053078 Ga0495612_0000017 Ga0495612_0000017_116431_117585 347
171 3300053084 Ga0495595_0000010 Ga0495595_0000010_143909_145063 347
172 3300053085 Ga0495619_0000014 Ga0495619_0000014_24573_25727 347
173 3300053177 Ga0500636_0000142 Ga0500636_0000142_8057_9211 347
174 3300053178 Ga0500637_0002374 Ga0500637_0002374_2290_3444 347
175 iso_pu_bacteria 2503198000 2503203487 347
176 iso_pu_bacteria 2507262055 2507508311 347
177 iso_pu_bacteria 2508501009 2508542377 347
178 iso_pu_bacteria 2508501042 2508691868 347
179 iso_pu_bacteria 2508501123 2509115904 347
180 iso_pu_bacteria 2508501127 2509141632 347
181 iso_pu_bacteria 2508501128 2509151616 347
182 iso_pu_bacteria 2509276018 2509373691 347
183 iso_pu_bacteria 2509276022 2509397904 347
184 iso_pu_bacteria 2510065059 2510316485 347
185 iso_pu_bacteria 2511231027 2511390901 347
186 iso_pu_bacteria 2511231028 2511394985 347
187 iso_pu_bacteria 2512875016 2512929624 347
188 iso_pu_bacteria 2512875024 2512964408 347
189 iso_pu_bacteria 2513237090 2513608276 347
190 iso_pu_bacteria 2513237092 2513622441 347
191 iso_pu_bacteria 2513237094 2513640621 347
192 iso_pu_bacteria 2513237095 2513645548 347
193 iso_pu_bacteria 2513237096 2513657858 347
194 iso_pu_bacteria 2513237101 2513692857 347
195 iso_pu_bacteria 2513237102 2513702397 347
196 iso_pu_bacteria 2513237104 2513718480 347
197 iso_pu_bacteria 2513237137 2513855558 347
198 iso_pu_bacteria 2513237139 2513873045 347
199 iso_pu_bacteria 2513237141 2513890205 347
200 iso_pu_bacteria 2513237145 2513920049 347
201 iso_pu_bacteria 2513237151 2513961393 347
202 iso_pu_bacteria 2513237161 2514015657 347
203 iso_pu_bacteria 2513237164 2514036959 347
204 iso_pu_bacteria 2513237305 2514421419 347
205 iso_pu_bacteria 2513237351 2514591625 347
206 iso_pu_bacteria 2515154112 2515627187 347
207 iso_pu_bacteria 2517093001 2517102768 347
208 iso_pu_bacteria 2517572143 2517892103 347
209 iso_pu_bacteria 2524023205 2524437625 347
210 iso_pu_bacteria 2528768022 2528848579 347
211 iso_pu_bacteria 2545555834 2545678747 347
212 iso_pu_bacteria 2588253730 2588515202 347
213 iso_pu_bacteria 2597489875 2597815189 347
214 iso_pu_bacteria 2599185301 2599939925 347
215 iso_pu_bacteria 2602042107 2603856742 347
216 iso_pu_bacteria 2617270735 2617347092 347
217 iso_pu_bacteria 2617270741 2617375487 347
218 iso_pu_bacteria 2643221547 2643758463 347
219 iso_pu_bacteria 2643221550 2643774116 347
220 iso_pu_bacteria 2643221551 2643774780 347
221 iso_pu_bacteria 2643221555 2643793224 347
222 iso_pu_bacteria 2643221561 2643826423 347
223 iso_pu_bacteria 2643221564 2643838617 347
224 iso_pu_bacteria 2643221570 2643867307 347
225 iso_pu_bacteria 2643221595 2643989032 347
226 iso_pu_bacteria 2643221596 2643990224 347
227 iso_pu_bacteria 2643221627 2644152217 347
228 iso_pu_bacteria 2643221651 2644288982 347
229 iso_pu_bacteria 2643221652 2644295717 347
230 iso_pu_bacteria 2643221658 2644329043 347
231 iso_pu_bacteria 2643221696 2644532690 347
232 iso_pu_bacteria 2643221733 2644730220 347
233 iso_pu_bacteria 2643221734 2644737840 347
234 iso_pu_bacteria 2643221736 2644746359 347
235 iso_pu_bacteria 2667528175 2671121859 347
236 iso_pu_bacteria 2687453392 2688600318 347
237 iso_pu_bacteria 2693429783 2694632487 347
238 iso_pu_bacteria 2693429784 2694639782 347
239 iso_pu_bacteria 2721755686 2723577604 347
240 iso_pu_bacteria 2721755755 2723844776 347
241 iso_pu_bacteria 2721755763 2723878907 347
242 iso_pu_bacteria 2728368998 2728751093 347
243 iso_pu_bacteria 2744054633 2745079558 347
244 iso_pu_bacteria 2756170246 2756673119 347
245 iso_pu_bacteria 2767802442 2770194974 347
246 iso_pu_bacteria 2773857925 2774871734 347
247 iso_pu_bacteria 2775506901 2776257767 347
248 iso_pu_bacteria 2775506902 2776272231 347
249 iso_pu_bacteria 2775506904 2776284171 347
250 iso_pu_bacteria 2791355123 2792750848 347
251 iso_pu_bacteria 2791355196 2793062692 347
252 iso_pu_bacteria 2791355199 2793079880 347
253 iso_pu_bacteria 2802429603 2805915056 347
254 iso_pu_bacteria 2816332527 2818238595 347
255 iso_pu_bacteria 2818991467 2819721663 347
256 iso_pu_bacteria 2824600985 2824602457 347
257 iso_pu_bacteria 2824609381 2824610428 347
258 iso_pu_bacteria 2824617872 2824618005 347
259 iso_pu_bacteria 2824626560 2824626673 347
260 iso_pu_bacteria 2824635225 2824636692 347
261 iso_pu_bacteria 2824644064 2824648995 347
262 iso_pu_bacteria 2824653114 2824657380 347
263 iso_pu_bacteria 2824661429 2824661466 347
264 iso_pu_bacteria 2824671348 2824674912 347
265 iso_pu_bacteria 2824679649 2824687526 347
266 iso_pu_bacteria 2824687955 2824691337 347
267 iso_pu_bacteria 2824696289 2824699483 347
268 iso_pu_bacteria 2824704595 2824709725 347
269 iso_pu_bacteria 2824714736 2824719283 347
270 iso_pu_bacteria 2824723954 2824729674 347
271 iso_pu_bacteria 2824732956 2824733351 347
272 iso_pu_bacteria 2824746037 2824746522 347
273 iso_pu_bacteria 2824753945 2824754255 347
274 iso_pu_bacteria 2824763712 2824768992 347
275 iso_pu_bacteria 2824773399 2824775350 347
276 iso_pu_bacteria 2835312727 2835315656 347
277 iso_pu_bacteria 2837651117 2837652503 347
278 iso_pu_bacteria 2838122688 2838123448 347
279 iso_pu_bacteria 2839993093 2839994547 347
280 iso_pu_bacteria 2840764183 2840765069 347
281 iso_pu_bacteria 2841734538 2841734624 347
282 iso_pu_bacteria 2841760612 2841766304 347
283 iso_pu_bacteria 2841911363 2841912323 347
284 iso_pu_bacteria 2841917233 2841919908 347
285 iso_pu_bacteria 2841941048 2841947779 347
286 iso_pu_bacteria 2841949485 2841949550 347
287 iso_pu_bacteria 2841957949 2841964145 347
288 iso_pu_bacteria 2841966195 2841971943 347
289 iso_pu_bacteria 2841974524 2841974714 347
290 iso_pu_bacteria 2841983080 2841983728 347
291 iso_pu_bacteria 2842038055 2842040088 347
292 iso_pu_bacteria 2842045827 2842046967 347
293 iso_pu_bacteria 2842871566 2842873757 347
294 iso_pu_bacteria 2844002411 2844005570 347
295 iso_pu_bacteria 2844009547 2844015631 347
296 iso_pu_bacteria 2844104063 2844106070 347
297 iso_pu_bacteria 2844315083 2844319321 347
298 iso_pu_bacteria 2847670302 2847672006 347
299 iso_pu_bacteria 2847686936 2847688231 347
300 iso_pu_bacteria 2847930680 2847936500 347
301 iso_pu_bacteria 2847939898 2847946846 347
302 iso_pu_bacteria 2849076700 2849079051 347
303 iso_pu_bacteria 2851182111 2851186576 347
304 iso_pu_bacteria 2851246043 2851246426 347
305 iso_pu_bacteria 2856314179 2856318262 347
306 iso_pu_bacteria 2856320880 2856324229 347
307 iso_pu_bacteria 2856328259 2856328612 347
308 iso_pu_bacteria 2856334872 2856338472 347
309 iso_pu_bacteria 2856342000 2856345613 347
310 iso_pu_bacteria 2856349417 2856356132 347
311 iso_pu_bacteria 2856364286 2856364842 347
312 iso_pu_bacteria 2857349434 2857354898 347
313 iso_pu_bacteria 2857367948 2857369063 347
314 iso_pu_bacteria 2857509624 2857516699 347
315 iso_pu_bacteria 2857524615 2857528220 347
316 iso_pu_bacteria 2869162929 2869165479 347
317 iso_pu_bacteria 2869242130 2869246574 347
318 iso_pu_bacteria 2869256925 2869261664 347
319 iso_pu_bacteria 2869264136 2869264631 347
320 iso_pu_bacteria 2869271264 2869277311 347
321 iso_pu_bacteria 2869278585 2869281773 347
322 iso_pu_bacteria 2869285874 2869289709 347
323 iso_pu_bacteria 2871429161 2871431775 347
324 iso_pu_bacteria 2871444079 2871450055 347
325 iso_pu_bacteria 2871459585 2871465749 347
326 iso_pu_bacteria 2871466892 2871469060 347
327 iso_pu_bacteria 2871474448 2871477876 347
328 iso_pu_bacteria 2871481445 2871486445 347
329 iso_pu_bacteria 2871488783 2871494113 347
330 iso_pu_bacteria 2871495908 2871497536 347
331 iso_pu_bacteria 2874102143 2874105529 347
332 iso_pu_bacteria 2874109183 2874115012 347
333 iso_pu_bacteria 2874116593 2874117406 347
334 iso_pu_bacteria 2874123672 2874127743 347
335 iso_pu_bacteria 2874131515 2874136450 347
336 iso_pu_bacteria 2874139085 2874140559 347
337 iso_pu_bacteria 2874146452 2874155453 347
338 iso_pu_bacteria 2874155637 2874162310 347
339 iso_pu_bacteria 2874162495 2874166579 347
340 iso_pu_bacteria 2874168670 2874175262 347
341 iso_pu_bacteria 2874590934 2874598323 347
342 iso_pu_bacteria 2874604998 2874605503 347
343 iso_pu_bacteria 2874612657 2874619472 347
344 iso_pu_bacteria 2874620515 2874627526 347
345 iso_pu_bacteria 2874628541 2874632154 347
346 iso_pu_bacteria 2874645413 2874652621 347
347 iso_pu_bacteria 2876363079 2876366814 347
348 iso_pu_bacteria 2876377896 2876379268 347
349 iso_pu_bacteria 2876386047 2876387085 347
350 iso_pu_bacteria 2876392853 2876398768 347
351 iso_pu_bacteria 2876399893 2876400604 347
352 iso_pu_bacteria 2876413966 2876420798 347
353 iso_pu_bacteria 2876420981 2876426982 347
354 iso_pu_bacteria 2876761206 2876764853 347
355 iso_pu_bacteria 2876771140 2876778199 347
356 iso_pu_bacteria 2876808645 2876813065 347
357 iso_pu_bacteria 2876818435 2876825932 347
358 iso_pu_bacteria 2878035449 2878037600 347
359 iso_pu_bacteria 2878730984 2878737016 347
360 iso_pu_bacteria 2878738818 2878742342 347
361 iso_pu_bacteria 2878745973 2878748381 347
362 iso_pu_bacteria 2878753008 2878756688 347
363 iso_pu_bacteria 2878760144 2878761754 347
364 iso_pu_bacteria 2878767105 2878768722 347
365 iso_pu_bacteria 2878774303 2878776726 347
366 iso_pu_bacteria 2878788777 2878792244 347
367 iso_pu_bacteria 2879074833 2879081993 347
368 iso_pu_bacteria 2879083081 2879089464 347
369 iso_pu_bacteria 2879099564 2879104570 347
370 iso_pu_bacteria 2879110137 2879115823 347
371 iso_pu_bacteria 2879127579 2879135115 347
372 iso_pu_bacteria 2879142872 2879149800 347
373 iso_pu_bacteria 2881147464 2881153876 347
374 iso_pu_bacteria 2881155292 2881157639 347
375 iso_pu_bacteria 2881161766 2881163000 347
376 iso_pu_bacteria 2881364244 2881368576 347
377 iso_pu_bacteria 2881665667 2881672623 347
378 iso_pu_bacteria 2881845957 2881850019 347
379 iso_pu_bacteria 2881853255 2881853941 347
380 iso_pu_bacteria 2881861095 2881864153 347
381 iso_pu_bacteria 2881927736 2881928685 347
382 iso_pu_bacteria 2882456835 2882457226 347
383 iso_pu_bacteria 2882632389 2882635326 347
384 iso_pu_bacteria 2882912400 2882919170 347
385 iso_pu_bacteria 2884298095 2884298632 347
386 iso_pu_bacteria 2885305155 2885311810 347
387 iso_pu_bacteria 2885318864 2885323888 347
388 iso_pu_bacteria 2885326080 2885333563 347
389 iso_pu_bacteria 2885334103 2885341840 347
390 iso_pu_bacteria 2885342637 2885347393 347
391 iso_pu_bacteria 2885350715 2885353419 347
392 iso_pu_bacteria 2885366525 2885369171 347
393 iso_pu_bacteria 2885409591 2885410479 347
394 iso_pu_bacteria 2888337043 2888341490 347
395 iso_pu_bacteria 2888343758 2888348637 347
396 iso_pu_bacteria 2888350351 2888350840 347
397 iso_pu_bacteria 2888378607 2888384375 347
398 iso_pu_bacteria 2888388044 2888393543 347
399 iso_pu_bacteria 2888419890 2888424803 347
400 iso_pu_bacteria 2889010040 2889013186 347
401 iso_pu_bacteria 2889016732 2889021961 347
402 iso_pu_bacteria 2889033259 2889039475 347
403 iso_pu_bacteria 2893066018 2893068661 347
404 iso_pu_bacteria 2894023352 2894024052 347
405 iso_pu_bacteria 2894232714 2894242857 347
406 iso_pu_bacteria 2894652903 2894655100 347
407 iso_pu_bacteria 2903448605 2903452989 347
408 iso_pu_bacteria 2903492973 2903502383 347
409 iso_pu_bacteria 2903492973 2903506058 347
410 iso_pu_bacteria 2903513507 2903513508 347
411 iso_pu_bacteria 2903521522 2903524681 347
412 iso_pu_bacteria 2903528002 2903531076 347
413 iso_pu_bacteria 2903540706 2903542331 347
414 iso_pu_bacteria 2903727486 2903734262 347
415 iso_pu_bacteria 2904578770 2904578825 347
416 iso_pu_bacteria 2904659560 2904665300 347
417 iso_pu_bacteria 2904666416 2904673154 347
418 iso_pu_bacteria 2904711408 2904714978 347
419 iso_pu_bacteria 2906308376 2906311998 347
420 iso_pu_bacteria 2906321335 2906323736 347
421 iso_pu_bacteria 2906328253 2906331396 347
422 iso_pu_bacteria 2906363423 2906367039 347
423 iso_pu_bacteria 2906370794 2906375078 347
424 iso_pu_bacteria 2906378014 2906381827 347
425 iso_pu_bacteria 2906386501 2906389046 347
426 iso_pu_bacteria 2906393657 2906398145 347
427 iso_pu_bacteria 2906401398 2906402428 347
428 iso_pu_bacteria 2906408224 2906408413 347
429 iso_pu_bacteria 2906414383 2906418299 347
430 iso_pu_bacteria 2906602504 2906605507 347
431 iso_pu_bacteria 2906610324 2906617234 347
432 iso_pu_bacteria 2906626472 2906633609 347
433 iso_pu_bacteria 2906635258 2906643377 347
434 iso_pu_bacteria 2906660503 2906662492 347
435 iso_pu_bacteria 2908775508 2908780453 347
436 iso_pu_bacteria 2917699015 2917702558 347
437 iso_pu_bacteria 2919073203 2919075643 347
438 iso_pu_bacteria 2919119836 2919122347 347
439 iso_pu_bacteria 2922130491 2922138664 347
440 iso_pu_bacteria 2922151315 2922153863 347
441 iso_pu_bacteria 2922158528 2922161253 347
442 iso_pu_bacteria 2922172374 2922178164 347
443 iso_pu_bacteria 2922178524 2922183517 347
444 iso_pu_bacteria 2922185730 2922193471 347
445 iso_pu_bacteria 2922361189 2922365639 347
446 iso_pu_bacteria 2922368715 2922374738 347
447 iso_pu_bacteria 2922386360 2922391253 347
448 iso_pu_bacteria 2922393267 2922400522 347
449 iso_pu_bacteria 2924718760 2924725058 347
450 iso_pu_bacteria 2924726620 2924728117 347
451 iso_pu_bacteria 2924733363 2924740365 347
452 iso_pu_bacteria 2924741084 2924742766 347
453 iso_pu_bacteria 2924748358 2924752564 347
454 iso_pu_bacteria 2924754689 2924762344 347
455 iso_pu_bacteria 2924762789 2924764425 347
456 iso_pu_bacteria 2924784321 2924788277 347
457 iso_pu_bacteria 2928521798 2928526154 347
458 iso_pu_bacteria 2929520902 2929525118 347
459 iso_pu_bacteria 2929615660 2929621811 347
460 iso_pu_bacteria 2929624759 2929629882 347
461 iso_pu_bacteria 2932784394 2932788671 347
462 iso_pu_bacteria 2932794094 2932798086 347
463 iso_pu_bacteria 2932801729 2932807058 347
464 iso_pu_bacteria 2932809354 2932817388 347
465 iso_pu_bacteria 2932818245 2932826157 347
466 iso_pu_bacteria 2932828146 2932830319 347
467 iso_pu_bacteria 2933577622 2933583913 347
468 iso_pu_bacteria 2935608549 2935609204 347
469 iso_pu_bacteria 2935616580 2935616610 347
470 iso_pu_bacteria 2935630451 2935631240 347
471 iso_pu_bacteria 2935638405 2935642060 347
472 iso_pu_bacteria 2935648319 2935650994 347
473 iso_pu_bacteria 2935656913 2935659175 347
474 iso_pu_bacteria 2935665750 2935672556 347
475 iso_pu_bacteria 2935675223 2935675973 347
476 iso_pu_bacteria 2935684952 2935685970 347
477 iso_pu_bacteria 2935694250 2935697785 347
478 iso_pu_bacteria 2935703347 2935705811 347
479 iso_pu_bacteria 2935713505 2935714522 347
480 iso_pu_bacteria 2935722832 2935725141 347
481 iso_pu_bacteria 2935732158 2935732499 347
482 iso_pu_bacteria 2935741537 2935741878 347
483 iso_pu_bacteria 2935750917 2935751935 347
484 iso_pu_bacteria 2935760218 2935765188 347
485 iso_pu_bacteria 2935769743 2935771784 347
486 iso_pu_bacteria 2935777560 2935778777 347
487 iso_pu_bacteria 2935785616 2935788835 347
488 iso_pu_bacteria 2935793552 2935795365 347
489 iso_pu_bacteria 2935801545 2935802808 347
490 iso_pu_bacteria 2935810662 2935813360 347
491 iso_pu_bacteria 2935819856 2935822364 347
492 iso_pu_bacteria 2935827899 2935830227 347
493 iso_pu_bacteria 2935837841 2935838124 347
494 iso_pu_bacteria 2935847175 2935847946 347
495 iso_pu_bacteria 2935855204 2935855234 347
496 iso_pu_bacteria 2935864058 2935867503 347
497 iso_pu_bacteria 2935873716 2935875659 347
498 iso_pu_bacteria 2935883170 2935886814 347
499 iso_pu_bacteria 2935908558 2935908834 347
500 iso_pu_bacteria 2935916978 2935919554 347
501 iso_pu_bacteria 2935926038 2935926592 347
502 iso_pu_bacteria 2935934488 2935935042 347
503 iso_pu_bacteria 2935942939 2935943492 347
504 iso_pu_bacteria 2935951376 2935951930 347
505 iso_pu_bacteria 2935959822 2935960688 347
506 iso_pu_bacteria 2935967501 2935968055 347
507 iso_pu_bacteria 2935975950 2935978681 347
508 iso_pu_bacteria 2935984226 2935987447 347
509 iso_pu_bacteria 2935992306 2935996342 347
510 iso_pu_bacteria 2936002035 2936003625 347
511 iso_pu_bacteria 2936011229 2936013590 347
512 iso_pu_bacteria 2936019824 2936022283 347
513 iso_pu_bacteria 2936028420 2936030729 347
514 iso_pu_bacteria 2936037263 2936042309 347
515 iso_pu_bacteria 2936046547 2936048542 347
516 iso_pu_bacteria 2936055302 2936058756 347
517 iso_pu_bacteria 2937813078 2937818179 347
518 iso_pu_bacteria 2937822353 2937826954 347
519 iso_pu_bacteria 2937836603 2937842756 347
520 iso_pu_bacteria 2937843397 2937846610 347
521 iso_pu_bacteria 2937848649 2937850675 347
522 iso_pu_bacteria 2937861824 2937867401 347
523 iso_pu_bacteria 2937877337 2937882663 347
524 iso_pu_bacteria 2937891427 2937893451 347
525 iso_pu_bacteria 2937972304 2937973364 347
526 iso_pu_bacteria 2937980651 2937985503 347
527 iso_pu_bacteria 2937994558 2937996186 347
528 iso_pu_bacteria 2938014810 2938019558 347
529 iso_pu_bacteria 2940556831 2940557262 347
530 iso_pu_bacteria 2941507105 2941509981 347
531 iso_pu_bacteria 2941515067 2941518932 347
532 iso_pu_bacteria 2941523033 2941525380 347
533 iso_pu_bacteria 2941531003 2941533080 347
534 iso_pu_bacteria 2941538514 2941539209 347
535 iso_pu_bacteria 2954011201 2954014948 347
536 iso_pu_bacteria 2958034702 2958037734 347
537 iso_pu_bacteria 2958041894 2958047446 347
538 iso_pu_bacteria 2958064165 2958066117 347
539 iso_pu_bacteria 2958071322 2958074935 347
540 iso_pu_bacteria 2958084443 2958089788 347
541 iso_pu_bacteria 2958092219 2958092993 347
542 iso_pu_bacteria 2958100919 2958102130 347
543 iso_pu_bacteria 2958115193 2958116807 347
544 iso_pu_bacteria 2958122699 2958124573 347
545 iso_pu_bacteria 2958130278 2958134082 347
546 iso_pu_bacteria 2958137437 2958142503 347
547 iso_pu_bacteria 2958165035 2958166656 347
548 iso_pu_bacteria 2958172287 2958179425 347
549 iso_pu_bacteria 2958179912 2958183728 347
550 iso_pu_bacteria 2961077736 2961081694 347
551 iso_pu_bacteria 2961114664 2961120300 347
552 iso_pu_bacteria 2961127735 2961132217 347
553 iso_pu_bacteria 2961136820 2961141767 347
554 iso_pu_bacteria 2961163497 2961165122 347
555 iso_pu_bacteria 2961170736 2961172978 347
556 iso_pu_bacteria 2961183825 2961184159 347
557 iso_pu_bacteria 2963644680 2963649608 347
558 iso_pu_bacteria 2965018300 2965019946 347
559 iso_pu_bacteria 2965025482 2965026233 347
560 iso_pu_bacteria 2965032056 2965036325 347
561 iso_pu_bacteria 2965040258 2965046964 347
562 iso_pu_bacteria 2965062239 2965069809 347
563 iso_pu_bacteria 2965110997 2965112597 347
564 iso_pu_bacteria 2965119406 2965124132 347
565 iso_pu_bacteria 2967996073 2967998189 347
566 iso_pu_bacteria 2968003550 2968008841 347
567 iso_pu_bacteria 2968016561 2968019431 347
568 iso_pu_bacteria 2968083720 2968084770 347
569 iso_pu_bacteria 2968091066 2968092234 347
570 iso_pu_bacteria 2968097103 2968101657 347
571 iso_pu_bacteria 2968110612 2968116767 347
572 iso_pu_bacteria 2968117919 2968118512 347
573 iso_pu_bacteria 2968128360 2968131845 347
574 iso_pu_bacteria 2968138860 2968143928 347
575 iso_pu_bacteria 2968171901 2968173523 347
576 iso_pu_bacteria 2970469710 2970472752 347
577 iso_pu_bacteria 2970489779 2970494743 347
578 iso_pu_bacteria 2970503327 2970505572 347
579 iso_pu_bacteria 2970510686 2970515872 347
580 iso_pu_bacteria 2970524798 2970529553 347
581 iso_pu_bacteria 2970532167 2970533936 347
582 iso_pu_bacteria 2970540015 2970546342 347
583 iso_pu_bacteria 2970547951 2970550631 347
584 iso_pu_bacteria 2970554993 2970556612 347
585 iso_pu_bacteria 2970593180 2970596377 347
586 iso_pu_bacteria 2977821940 2977825868 347
587 iso_pu_bacteria 2977828996 2977834834 347
588 iso_pu_bacteria 2977843712 2977851275 347
589 iso_pu_bacteria 2977851361 2977857798 347
590 iso_pu_bacteria 2977858184 2977864052 347
591 iso_pu_bacteria 2977864932 2977870575 347
592 iso_pu_bacteria 2977872689 2977875000 347
593 iso_pu_bacteria 2977898635 2977905397 347
594 iso_pu_bacteria 2977915119 2977919104 347
595 iso_pu_bacteria 2977922695 2977927636 347
596 iso_pu_bacteria 2977935797 2977938635 347
597 iso_pu_bacteria 2977942078 2977946682 347
598 iso_pu_bacteria 2977971508 2977975238 347
599 iso_pu_bacteria 2977986579 2977987666 347
600 iso_pu_bacteria 2979710463 2979716643 347
601 iso_pu_bacteria 2979742915 2979748309 347
602 iso_pu_bacteria 2979764755 2979766074 347
603 iso_pu_bacteria 2979772303 2979775124 347
604 iso_pu_bacteria 2979793036 2979796399 347
605 iso_pu_bacteria 2979808191 2979810293 347
606 iso_pu_bacteria 2987636660 2987643500 347
607 iso_pu_bacteria 2987645492 2987651597 347
608 iso_pu_bacteria 2987652177 2987654979 347
609 iso_pu_bacteria 2987659509 2987661130 347
610 iso_pu_bacteria 2987666974 2987672729 347
611 iso_pu_bacteria 2987673487 2987678369 347
612 iso_pu_bacteria 2990710928 2990711052 347
613 iso_pu_bacteria 2996310559 2996313134 347
614 iso_pu_bacteria 2996336353 2996340144 347
615 iso_pu_bacteria 2996341866 2996348568 347
616 iso_pu_bacteria 2996348954 2996352129 347
617 iso_pu_bacteria 2996386984 2996391977 347
618 iso_pu_bacteria 3000135777 3000142044 347
619 iso_pu_bacteria 3002141150 3002143081 347
620 iso_pu_bacteria 3003665799 3003671340 347
621 iso_pu_bacteria 3004167301 3004171107 347
622 iso_pu_bacteria 3004188549 3004190180 347
623 iso_pu_bacteria 3004203850 3004207045 347
624 iso_pu_bacteria 3004211236 3004214458 347
625 iso_pu_bacteria 3004218560 3004223561 347
626 iso_pu_bacteria 3004232784 3004232988 347
627 iso_pu_bacteria 3004239961 3004240702 347
628 iso_pu_bacteria 3004268573 3004273369 347
629 iso_pu_bacteria 3004275668 3004278827 347
630 iso_pu_bacteria 3004334049 3004339209 347
631 iso_pu_bacteria 3005483717 3005484594 347
632 iso_pu_bacteria 3005506211 3005510592 347
633 iso_pu_bacteria 3005587118 3005587768 347
634 iso_pu_bacteria 3005594810 3005599509 347
635 iso_pu_bacteria 3005710791 3005715180 347
636 iso_pu_bacteria 3005718088 3005722567 347
637 iso_pu_bacteria 641522639 641646688 347
638 iso_pu_bacteria 643348564 643604311 347
639 iso_pu_bacteria 649633066 649874780 347
640 iso_pu_bacteria 8002392321 8002393351 347
641 iso_pu_bacteria 8004300914 8004304733 347
642 iso_pu_bacteria 8004312739 8004318609 347
643 iso_pu_bacteria 8004374579 8004378276 347
644 iso_pu_bacteria 8004387939 8004391587 347
645 iso_pu_bacteria 8004445564 8004448495 347
646 iso_pu_bacteria 8004633249 8004633813 347
647 iso_pu_bacteria 8004640170 8004641406 347
648 iso_pu_bacteria 8004695233 8004699986 347
649 iso_pu_bacteria 8004703790 8004710689 347
650 iso_pu_bacteria 8004714634 8004716956 347
651 iso_pu_bacteria 8004727605 8004731799 347
652 iso_pu_bacteria 8006926726 8006931970 347
653 iso_pu_bacteria 8006933436 8006940272 347
654 iso_pu_bacteria 8006964411 8006967028 347
655 iso_pu_bacteria 8006973647 8006980050 347
656 iso_pu_bacteria 8006984368 8006987982 347
657 iso_pu_bacteria 8006994254 8006995712 347
658 iso_pu_bacteria 8016511872 8016521985 347
659 iso_pu_bacteria 8016522445 8016529343 347
660 iso_pu_bacteria 8016539877 8016547776 347
661 iso_pu_bacteria 8016557553 8016562729 347
662 iso_pu_bacteria 8016566248 8016572900 347
663 iso_pu_bacteria 8016575299 8016577059 347
664 iso_pu_bacteria 8016583857 8016593164 347
665 iso_pu_bacteria 8016595262 8016600511 347
666 iso_pu_bacteria 8016613128 8016614698 347
667 iso_pu_bacteria 8016622563 8016626293 347
668 iso_pu_bacteria 8016630954 8016640029 347
669 iso_pu_bacteria 8017057580 8017063680 347
670 iso_pu_bacteria 8019530166 8019534321 347
671 iso_pu_bacteria 8019547302 8019553384 347
672 iso_pu_bacteria 8019586578 8019590806 347
673 iso_pu_bacteria 8019608314 8019618005 347
674 iso_pu_bacteria 8019629233 8019634154 347
675 iso_pu_bacteria 8019638758 8019645576 347
676 iso_pu_bacteria 8019648815 8019658821 347
677 iso_pu_bacteria 8019659431 8019662031 347
678 iso_pu_bacteria 8019668869 8019671556 347
679 iso_pu_bacteria 8055617313 8055622879 347
680 iso_pu_bacteria 8055742211 8055746023 347
681 iso_pu_bacteria 8056673599 8056677654 347
682 iso_pu_bacteria 8056689827 8056695694 347
683 iso_pu_bacteria 8056967851 8056968297 347
684 iso_pu_bacteria 8057529695 8057531344 347
685 3300009545 Ga0105237_10034611 Ga0105237_100346114 348
686 3300048929 Ga0496126_0263677 Ga0496126_0263677_25_1182 348
687 iso_pu_bacteria 2508501050 2508726764 348
688 iso_pu_bacteria 2508501114 2509074599 348
689 iso_pu_bacteria 2510065057 2510306343 348
690 iso_pu_bacteria 2510917026 2511169516 348
691 iso_pu_bacteria 2511231052 2511501630 348
692 iso_pu_bacteria 2512047086 2512533069 348
693 iso_pu_bacteria 2513237086 2513586278 348
694 iso_pu_bacteria 2513237087 2513590269 348
695 iso_pu_bacteria 2513237091 2513619836 348
696 iso_pu_bacteria 2513237140 2513884257 348
697 iso_pu_bacteria 2513237143 2513906577 348
698 iso_pu_bacteria 2515154107 2515608533 348
699 iso_pu_bacteria 2516653046 2516892949 348
700 iso_pu_bacteria 2524023207 2524453579 348
701 iso_pu_bacteria 2524023228 2524534188 348
702 iso_pu_bacteria 2537561587 2537873674 348
703 iso_pu_bacteria 2551306084 2551677560 348
704 iso_pu_bacteria 2551306085 2551686386 348
705 iso_pu_bacteria 2551306086 2551693908 348
706 iso_pu_bacteria 2551306087 2551698784 348
707 iso_pu_bacteria 2551306089 2551710672 348
708 iso_pu_bacteria 2551306090 2551723972 348
709 iso_pu_bacteria 2551306091 2551725541 348
710 iso_pu_bacteria 2551306093 2551745492 348
711 iso_pu_bacteria 2554235003 2554246037 348
712 iso_pu_bacteria 2558860242 2559296197 348
713 iso_pu_bacteria 2585427633 2585997866 348
714 iso_pu_bacteria 2585427634 2586002455 348
715 iso_pu_bacteria 2595698237 2596371787 348
716 iso_pu_bacteria 2599185210 2599604649 348
717 iso_pu_bacteria 2600255279 2601612930 348
718 iso_pu_bacteria 2600255308 2601748476 348
719 iso_pu_bacteria 2643221551 2643775630 348
720 iso_pu_bacteria 2643221555 2643794077 348
721 iso_pu_bacteria 2643221558 2643810984 348
722 iso_pu_bacteria 2643221693 2644522977 348
723 iso_pu_bacteria 2738541317 2738945191 348
724 iso_pu_bacteria 2791355197 2793068812 348
725 iso_pu_bacteria 2808606387 2808988418 348
726 iso_pu_bacteria 2818991439 2819559483 348
727 iso_pu_bacteria 2828305725 2828306613 348
728 iso_pu_bacteria 2837678835 2837679652 348
729 iso_pu_bacteria 2838675328 2838679709 348
730 iso_pu_bacteria 2838714209 2838717521 348
731 iso_pu_bacteria 2838719591 2838724278 348
732 iso_pu_bacteria 2838724970 2838729405 348
733 iso_pu_bacteria 2841846520 2841850833 348
734 iso_pu_bacteria 2841859092 2841861732 348
735 iso_pu_bacteria 2842124991 2842129638 348
736 iso_pu_bacteria 2842130223 2842134782 348
737 iso_pu_bacteria 2842152218 2842156700 348
738 iso_pu_bacteria 2842170452 2842172958 348
739 iso_pu_bacteria 2842175837 2842180318 348
740 iso_pu_bacteria 2842187318 2842192022 348
741 iso_pu_bacteria 2842211629 2842216338 348
742 iso_pu_bacteria 2842224351 2842229058 348
743 iso_pu_bacteria 2842333319 2842340302 348
744 iso_pu_bacteria 2842515876 2842518002 348
745 iso_pu_bacteria 2854896431 2854901643 348
746 iso_pu_bacteria 2854916844 2854917580 348
747 iso_pu_bacteria 2855730933 2855734680 348
748 iso_pu_bacteria 2855767633 2855770270 348
749 iso_pu_bacteria 2855825444 2855825739 348
750 iso_pu_bacteria 2855839649 2855841111 348
751 iso_pu_bacteria 2857576091 2857578469 348
752 iso_pu_bacteria 2857576091 2857580800 348
753 iso_pu_bacteria 2858800743 2858801644 348
754 iso_pu_bacteria 2881412998 2881414491 348
755 iso_pu_bacteria 2882456835 2882462030 348
756 iso_pu_bacteria 2883291878 2883297215 348
757 iso_pu_bacteria 2883354860 2883359998 348
758 iso_pu_bacteria 2885374607 2885381704 348
759 iso_pu_bacteria 2889306138 2889307077 348
760 iso_pu_bacteria 2889790730 2889790833 348
761 iso_pu_bacteria 2889914905 2889915215 348
762 iso_pu_bacteria 2894772417 2894772749 348
763 iso_pu_bacteria 2899259804 2899263069 348
764 iso_pu_bacteria 2899275550 2899275571 348
765 iso_pu_bacteria 2899792073 2899792820 348
766 iso_pu_bacteria 2899803654 2899807150 348
767 iso_pu_bacteria 2899845264 2899848540 348
768 iso_pu_bacteria 2902330777 2902336954 348
769 iso_pu_bacteria 2902405164 2902411217 348
770 iso_pu_bacteria 2903748898 2903753485 348
771 iso_pu_bacteria 2904690495 2904694831 348
772 iso_pu_bacteria 2904699407 2904702225 348
773 iso_pu_bacteria 2906643746 2906645102 348
774 iso_pu_bacteria 2908739725 2908742383 348
775 iso_pu_bacteria 2908756301 2908760051 348
776 iso_pu_bacteria 2913308742 2913309817 348
777 iso_pu_bacteria 2915986958 2915992873 348
778 iso_pu_bacteria 2915993759 2915999499 348
779 iso_pu_bacteria 2916000859 2916001880 348
780 iso_pu_bacteria 2916007675 2916012755 348
781 iso_pu_bacteria 2916014648 2916020580 348
782 iso_pu_bacteria 2916021584 2916024578 348
783 iso_pu_bacteria 2916028427 2916032045 348
784 iso_pu_bacteria 2916035215 2916038975 348
785 iso_pu_bacteria 2916041962 2916045826 348
786 iso_pu_bacteria 2916048683 2916052593 348
787 iso_pu_bacteria 2916055098 2916059432 348
788 iso_pu_bacteria 2916068649 2916074132 348
789 iso_pu_bacteria 2916076590 2916078242 348
790 iso_pu_bacteria 2919114240 2919119273 348
791 iso_pu_bacteria 2919171160 2919175698 348
792 iso_pu_bacteria 2921201388 2921207163 348
793 iso_pu_bacteria 2921208531 2921215232 348
794 iso_pu_bacteria 2921237296 2921241308 348
795 iso_pu_bacteria 2921244191 2921248221 348
796 iso_pu_bacteria 2921257292 2921262407 348
797 iso_pu_bacteria 2921263974 2921267786 348
798 iso_pu_bacteria 2921282425 2921284370 348
799 iso_pu_bacteria 2921289301 2921294871 348
800 iso_pu_bacteria 2921296804 2921301871 348
801 iso_pu_bacteria 2922425934 2922430595 348
802 iso_pu_bacteria 2924144063 2924148383 348
803 iso_pu_bacteria 2924150972 2924154793 348
804 iso_pu_bacteria 2924158325 2924159802 348
805 iso_pu_bacteria 2924165586 2924167581 348
806 iso_pu_bacteria 2924172951 2924177239 348
807 iso_pu_bacteria 2924179722 2924185042 348
808 iso_pu_bacteria 2924186466 2924192386 348
809 iso_pu_bacteria 2924193448 2924198855 348
810 iso_pu_bacteria 2924200457 2924204328 348
811 iso_pu_bacteria 2924207177 2924211461 348
812 iso_pu_bacteria 2924214083 2924216964 348
813 iso_pu_bacteria 2924221636 2924227957 348
814 iso_pu_bacteria 2924228884 2924232940 348
815 iso_pu_bacteria 2926754445 2926759303 348
816 iso_pu_bacteria 2926754445 2926759916 348
817 iso_pu_bacteria 2926760298 2926763146 348
818 iso_pu_bacteria 2928125067 2928128050 348
819 iso_pu_bacteria 2928959182 2928963016 348
820 iso_pu_bacteria 2929199973 2929203587 348
821 iso_pu_bacteria 2933006813 2933011306 348
822 iso_pu_bacteria 2933011516 2933013631 348
823 iso_pu_bacteria 2933594066 2933596929 348
824 iso_pu_bacteria 2936996657 2937002534 348
825 iso_pu_bacteria 2937002841 2937007512 348
826 iso_pu_bacteria 2937009748 2937013804 348
827 iso_pu_bacteria 2937016420 2937023009 348
828 iso_pu_bacteria 2937023124 2937027727 348
829 iso_pu_bacteria 2937042894 2937048454 348
830 iso_pu_bacteria 2937049772 2937051861 348
831 iso_pu_bacteria 2937056579 2937063176 348
832 iso_pu_bacteria 2937063883 2937068830 348
833 iso_pu_bacteria 2937071275 2937077434 348
834 iso_pu_bacteria 2937091812 2937098440 348
835 iso_pu_bacteria 2937098957 2937099260 348
836 iso_pu_bacteria 2937106411 2937107956 348
837 iso_pu_bacteria 2937113482 2937117137 348
838 iso_pu_bacteria 2937119839 2937124114 348
839 iso_pu_bacteria 2937126314 2937127495 348
840 iso_pu_bacteria 2941479691 2941481212 348
841 iso_pu_bacteria 2957382221 2957386681 348
842 iso_pu_bacteria 2957388812 2957393100 348
843 iso_pu_bacteria 2957395598 2957400341 348
844 iso_pu_bacteria 2957402308 2957407190 348
845 iso_pu_bacteria 2957408893 2957412970 348
846 iso_pu_bacteria 2957415311 2957417042 348
847 iso_pu_bacteria 2957422303 2957424787 348
848 iso_pu_bacteria 2957430029 2957434905 348
849 iso_pu_bacteria 2957443900 2957448592 348
850 iso_pu_bacteria 2957450854 2957457001 348
851 iso_pu_bacteria 2957457609 2957462200 348
852 iso_pu_bacteria 2957464669 2957469066 348
853 iso_pu_bacteria 2957471148 2957474741 348
854 iso_pu_bacteria 2957478035 2957481660 348
855 iso_pu_bacteria 2957484790 2957489343 348
856 iso_pu_bacteria 2957491536 2957496170 348
857 iso_pu_bacteria 2957498199 2957503491 348
858 iso_pu_bacteria 2957505466 2957510892 348
859 iso_pu_bacteria 2960584000 2960588613 348
860 iso_pu_bacteria 2960597568 2960600382 348
861 iso_pu_bacteria 2960603979 2960608906 348
862 iso_pu_bacteria 2960610863 2960615253 348
863 iso_pu_bacteria 2960617483 2960618978 348
864 iso_pu_bacteria 2960624210 2960628219 348
865 iso_pu_bacteria 2960637947 2960642780 348
866 iso_pu_bacteria 2960645483 2960649685 348
867 iso_pu_bacteria 2960652885 2960658061 348
868 iso_pu_bacteria 2960660292 2960664428 348
869 iso_pu_bacteria 2960667422 2960669388 348
870 iso_pu_bacteria 2960674078 2960680225 348
871 iso_pu_bacteria 2960687367 2960693598 348
872 iso_pu_bacteria 2964607997 2964614299 348
873 iso_pu_bacteria 2964615318 2964618971 348
874 iso_pu_bacteria 2964621998 2964627597 348
875 iso_pu_bacteria 2964628898 2964633524 348
876 iso_pu_bacteria 2964636051 2964640913 348
877 iso_pu_bacteria 2964643177 2964647643 348
878 iso_pu_bacteria 2964649959 2964652204 348
879 iso_pu_bacteria 2964656573 2964661553 348
880 iso_pu_bacteria 2964663802 2964667035 348
881 iso_pu_bacteria 2964670856 2964671667 348
882 iso_pu_bacteria 2964678106 2964684441 348
883 iso_pu_bacteria 2964685014 2964689321 348
884 iso_pu_bacteria 2964691889 2964697377 348
885 iso_pu_bacteria 2964698721 2964703123 348
886 iso_pu_bacteria 2964705432 2964709115 348
887 iso_pu_bacteria 2964712639 2964716881 348
888 iso_pu_bacteria 2964719344 2964722853 348
889 iso_pu_bacteria 2967664464 2967670357 348
890 iso_pu_bacteria 2967671571 2967676921 348
891 iso_pu_bacteria 2967678726 2967680823 348
892 iso_pu_bacteria 2967693043 2967697499 348
893 iso_pu_bacteria 2967706974 2967713670 348
894 iso_pu_bacteria 2967714385 2967715356 348
895 iso_pu_bacteria 2967721400 2967725429 348
896 iso_pu_bacteria 2967735183 2967741500 348
897 iso_pu_bacteria 2967748971 2967753151 348
898 iso_pu_bacteria 2967755722 2967760596 348
899 iso_pu_bacteria 2967762386 2967766898 348
900 iso_pu_bacteria 2967769361 2967773081 348
901 iso_pu_bacteria 2967775926 2967779545 348
902 iso_pu_bacteria 2970019648 2970024664 348
903 iso_pu_bacteria 2970033650 2970038343 348
904 iso_pu_bacteria 2970040964 2970044998 348
905 iso_pu_bacteria 2970047711 2970051089 348
906 iso_pu_bacteria 2970054988 2970059924 348
907 iso_pu_bacteria 2970061556 2970066658 348
908 iso_pu_bacteria 2970068827 2970073633 348
909 iso_pu_bacteria 2970076120 2970079786 348
910 iso_pu_bacteria 2970082768 2970083761 348
911 iso_pu_bacteria 2970088815 2970093087 348
912 iso_pu_bacteria 2970095765 2970101127 348
913 iso_pu_bacteria 2970102677 2970107126 348
914 iso_pu_bacteria 2970109326 2970112832 348
915 iso_pu_bacteria 2970116247 2970120332 348
916 iso_pu_bacteria 2970129317 2970133788 348
917 iso_pu_bacteria 2970136068 2970138075 348
918 iso_pu_bacteria 2970149975 2970152853 348
919 iso_pu_bacteria 2970156795 2970158037 348
920 iso_pu_bacteria 2970164137 2970166408 348
921 iso_pu_bacteria 2970170962 2970176202 348
922 iso_pu_bacteria 2970177841 2970182309 348
923 iso_pu_bacteria 2970184632 2970188554 348
924 iso_pu_bacteria 2970191845 2970192692 348
925 iso_pu_bacteria 2977516862 2977521383 348
926 iso_pu_bacteria 2977523885 2977528624 348
927 iso_pu_bacteria 2977537788 2977541557 348
928 iso_pu_bacteria 2977551784 2977552677 348
929 iso_pu_bacteria 2977558990 2977563281 348
930 iso_pu_bacteria 2977565890 2977570972 348
931 iso_pu_bacteria 2977572785 2977576373 348
932 iso_pu_bacteria 2977579622 2977586244 348
933 iso_pu_bacteria 2979089926 2979091832 348
934 iso_pu_bacteria 2979100975 2979104333 348
935 iso_pu_bacteria 2984509177 2984511086 348
936 iso_pu_bacteria 2984518228 2984522551 348
937 iso_pu_bacteria 2984537506 2984541855 348
938 iso_pu_bacteria 2996310559 2996314660 348
939 iso_pu_bacteria 3005474847 3005480505 348
940 iso_pu_bacteria 643348564 643600776 348
941 iso_pu_bacteria 648276728 648740734 348
942 iso_pu_bacteria 650716007 650842594 348
943 iso_pu_bacteria 8003992118 8003993595 348
944 iso_pu_bacteria 8019555841 8019556254 348
945 iso_pu_bacteria 8019565922 8019569057 348
946 iso_pu_bacteria 8054460903 8054465417 348
947 iso_pu_bacteria 8054558443 8054560915 348
948 iso_pu_bacteria 8054609563 8054610865 348
949 iso_pu_bacteria 8055909800 8055911221 348
950 iso_pu_bacteria 8056875544 8056877614 348
951 3300035398 Ga0316574_0004257 Ga0316574_0004257_6045_7205 349
952 iso_pu_bacteria 2511231003 2511249113 349
953 iso_pu_bacteria 2511231026 2511384206 349
954 iso_pu_bacteria 2818991445 2819595472 349
955 iso_pu_bacteria 2883577096 2883580499 349
956 iso_pu_bacteria 2884811622 2884813188 349
957 iso_pu_bacteria 2884836552 2884841335 349
958 iso_pu_bacteria 2884852848 2884856209 349
959 iso_pu_bacteria 2885312484 2885316227 349
960 iso_pu_bacteria 2896154374 2896156865 349
961 3300003187 JGI25151J46595_10004420 JGI25151J46595_100044205 350
962 3300003203 JGI25406J46586_10000412 JGI25406J46586_100004129 350
963 3300005262 Ga0065165_1026652 Ga0065165_10266521 350
964 3300005327 Ga0070658_10033732 Ga0070658_100337323 350
965 3300005563 Ga0068855_100012892 Ga0068855_1000128924 350
966 3300005983 Ga0081540_1024213 Ga0081540_10242133 350
967 3300005985 Ga0081539_10000059 Ga0081539_10000059217 350
968 3300006177 Ga0075362_10010694 Ga0075362_100106943 350
969 3300006846 Ga0075430_100000132 Ga0075430_1000001328 350
970 3300009094 Ga0111539_10108668 Ga0111539_101086681 350
971 3300009147 Ga0114129_10379780 Ga0114129_103797802 350
972 3300009147 Ga0114129_10530940 Ga0114129_105309402 350
973 3300009177 Ga0105248_10038312 Ga0105248_100383124 350
974 3300010375 Ga0105239_10053228 Ga0105239_100532283 350
975 3300013102 Ga0157371_10002137 Ga0157371_100021373 350
976 3300013104 Ga0157370_10006303 Ga0157370_100063032 350
977 3300022467 Ga0224712_10040306 Ga0224712_100403062 350
978 3300025294 Ga0209025_1000291 Ga0209025_10002914 350
979 3300025321 Ga0207656_10026610 Ga0207656_100266102 350
980 3300025909 Ga0207705_10011559 Ga0207705_100115595 350
981 3300025949 Ga0207667_10002525 Ga0207667_100025255 350
982 3300031711 Ga0265314_10014338 Ga0265314_100143381 350
983 3300035170 Ga0373943_0066731 Ga0373943_0066731_81_1250 350
984 3300037068 Ga0373925_0161133 Ga0373925_0161133_451_1620 350
985 3300037312 Ga0395899_0000090 Ga0395899_0000090_101693_102967 350
986 3300037418 Ga0395900_0000017 Ga0395900_0000017_314667_315941 350
987 3300037466 Ga0395898_0000030 Ga0395898_0000030_314642_315916 350
988 3300037471 Ga0395905_0000081 Ga0395905_0000081_105474_106748 350
989 3300038443 Ga0395901_0000015 Ga0395901_0000015_53662_54936 350
990 3300038443 Ga0395901_0000055 Ga0395901_0000055_14940_16109 350
991 3300044658 Ga0466972_0023293 Ga0466972_0023293_437_1603 350
992 3300044659 Ga0466973_0019539 Ga0466973_0019539_1486_2652 350
993 3300044666 Ga0466977_0000186 Ga0466977_0000186_11558_12874 350
994 3300044683 Ga0466965_0027283 Ga0466965_0027283_380_1546 350
995 3300044684 Ga0466966_0047612 Ga0466966_0047612_458_1624 350
996 3300044693 Ga0466961_0055444 Ga0466961_0055444_789_1955 350
997 3300044693 Ga0466961_0062880 Ga0466961_0062880_1084_2250 350
998 3300044842 Ga0466957_0000233 Ga0466957_0000233_4650_5816 350
999 3300045049 Ga0466959_0022731 Ga0466959_0022731_1802_2968 350
1000 3300046558 Ga0495633_0002835 Ga0495633_0002835_2343_3512 350
1001 3300046674 Ga0495588_0097587 Ga0495588_0097587_285_1454 350
1002 3300046683 Ga0495658_0024645 Ga0495658_0024645_203_1372 350
1003 3300046692 Ga0495671_0000618 Ga0495671_0000618_22213_23382 350
1004 3300047320 Ga0495672_0037370 Ga0495672_0037370_1400_2569 350
1005 3300047443 Ga0495687_000091 Ga0495687_000091_55921_57090 350
1006 3300048908 Ga0496105_0083381 Ga0496105_0083381_843_2006 350
1007 3300048917 Ga0496114_0240919 Ga0496114_0240919_217_1380 350
1008 3300048925 Ga0496122_0065558 Ga0496122_0065558_1003_2169 350
1009 3300048929 Ga0496126_0004802 Ga0496126_0004802_11696_12862 350
1010 3300048929 Ga0496126_0095694 Ga0496126_0095694_617_1783 350
1011 3300049579 Ga0501043_0071468 Ga0501043_0071468_679_1848 350
1012 3300049579 Ga0501043_0201500 Ga0501043_0201500_274_1440 350
1013 3300050489 nmdc:mga03683_3875_c1 nmdc:mga03683_3875_c1_236_1405 350
1014 3300050509 nmdc:mga0qj67_873_c1 nmdc:mga0qj67_873_c1_10640_11803 350
1015 3300053121 Ga0500607_003322 Ga0500607_003322_5876_7063 350
1016 3300000041 ARcpr5oldR_c000002 ARcpr5oldR_00000247 351
1017 3300000042 ARSoilYngRDRAFT_c00003 ARSoilYngRDRAFT_0000329 351
1018 3300000043 ARcpr5yngRDRAFT_c000036 ARcpr5yngRDRAFT_00003619 351
1019 3300000044 ARSoilOldRDRAFT_c000002 ARSoilOldRDRAFT_00000231 351
1020 3300000045 ARCol0oldRDRAFT_c00314 ARCol0oldRDRAFT_003142 351
1021 3300000652 ARCol0yngRDRAFT_1000005 ARCol0yngRDRAFT_100000542 351
1022 3300001430 JGI24032J14994_100147 JGI24032J14994_1001472 351
1023 3300001977 JGI24746J21847_1000131 JGI24746J21847_10001316 351
1024 3300001989 JGI24739J22299_10007211 JGI24739J22299_100072113 351
1025 3300001989 JGI24739J22299_10026188 JGI24739J22299_100261881 351
1026 3300001990 JGI24737J22298_10003920 JGI24737J22298_100039202 351
1027 3300001990 JGI24737J22298_10011733 JGI24737J22298_100117333 351
1028 3300002070 JGI24750J21931_1000047 JGI24750J21931_10000474 351
1029 3300002074 JGI24748J21848_1000620 JGI24748J21848_10006202 351
1030 3300002074 JGI24748J21848_1004239 JGI24748J21848_10042392 351
1031 3300002075 JGI24738J21930_10000265 JGI24738J21930_100002659 351
1032 3300002076 JGI24749J21850_1002322 JGI24749J21850_10023222 351
1033 3300002126 JGI24035J26624_1000154 JGI24035J26624_10001543 351
1034 3300002239 JGI24034J26672_10000826 JGI24034J26672_100008262 351
1035 3300002244 JGI24742J22300_10000044 JGI24742J22300_100000443 351
1036 3300002459 JGI24751J29686_10011524 JGI24751J29686_100115242 351
1037 3300002705 JGI25156J39149_1002014 JGI25156J39149_10020144 351
1038 3300002705 JGI25156J39149_1004416 JGI25156J39149_10044163 351
1039 3300002741 JGI25157J39369_1001113 JGI25157J39369_10011135 351
1040 3300002741 JGI25157J39369_1002073 JGI25157J39369_10020732 351
1041 3300002987 JGI25159J45721_1003796 JGI25159J45721_10037962 351
1042 3300003187 JGI25151J46595_10000036 JGI25151J46595_1000003623 351
1043 3300003187 JGI25151J46595_10000209 JGI25151J46595_1000020923 351
1044 3300003187 JGI25151J46595_10000244 JGI25151J46595_1000024437 351
1045 3300003203 JGI25406J46586_10000093 JGI25406J46586_100000939 351
1046 3300003203 JGI25406J46586_10000504 JGI25406J46586_100005046 351
1047 3300003203 JGI25406J46586_10000565 JGI25406J46586_1000056515 351
1048 3300003203 JGI25406J46586_10002895 JGI25406J46586_100028954 351
1049 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016105 351
1050 3300003215 JGI25153J46596_10000462 JGI25153J46596_1000046218 351
1051 3300003215 JGI25153J46596_10000860 JGI25153J46596_1000086016 351
1052 3300003215 JGI25153J46596_10002078 JGI25153J46596_100020788 351
1053 3300003215 JGI25153J46596_10005256 JGI25153J46596_100052565 351
1054 3300003354 JGI25160J50197_1001585 JGI25160J50197_10015855 351
1055 3300003354 JGI25160J50197_1005731 JGI25160J50197_10057311 351
1056 3300003578 Ga0006562J51391_1082408 Ga0006562J51391_10824082 351
1057 3300003578 Ga0006562J51391_1082410 Ga0006562J51391_10824101 351
1058 3300003659 JGI25404J52841_10001115 JGI25404J52841_100011153 351
1059 3300003659 JGI25404J52841_10005561 JGI25404J52841_100055612 351
1060 3300003752 Ga0055539_1000125 Ga0055539_10001258 351
1061 3300003756 Ga0055533_1000132 Ga0055533_10001328 351
1062 3300003758 Ga0055532_1001641 Ga0055532_10016413 351
1063 3300003759 Ga0055525_1000171 Ga0055525_10001718 351
1064 3300003763 Ga0055529_1002195 Ga0055529_10021954 351
1065 3300003771 Ga0055526_1000017 Ga0055526_1000017196 351
1066 3300003771 Ga0055526_1000391 Ga0055526_100039114 351
1067 3300003775 Ga0055524_1000014 Ga0055524_1000014213 351
1068 3300003775 Ga0055524_1001064 Ga0055524_100106411 351
1069 3300003775 Ga0055524_1028695 Ga0055524_10286952 351
1070 3300003781 Ga0055536_1015634 Ga0055536_10156342 351
1071 3300003791 Ga0055530_10000614 Ga0055530_1000061419 351
1072 3300003791 Ga0055530_10024263 Ga0055530_100242632 351
1073 3300003792 Ga0055540_1000014 Ga0055540_100001438 351
1074 3300003792 Ga0055540_1008590 Ga0055540_10085902 351
1075 3300003794 Ga0055531_10007927 Ga0055531_100079273 351
1076 3300003794 Ga0055531_10011219 Ga0055531_100112194 351
1077 3300003841 Ga0055541_1000083 Ga0055541_100008370 351
1078 3300003856 Ga0058692_1001859 Ga0058692_10018597 351
1079 3300003911 JGI25405J52794_10001403 JGI25405J52794_100014032 351
1080 3300005262 Ga0065165_1000048 Ga0065165_100004813 351
1081 3300005262 Ga0065165_1000231 Ga0065165_10002318 351
1082 3300005262 Ga0065165_1010260 Ga0065165_10102601 351
1083 3300005262 Ga0065165_1014736 Ga0065165_10147361 351
1084 3300005276 Ga0065717_1002078 Ga0065717_10020783 351
1085 3300005289 Ga0065704_10074116 Ga0065704_100741162 351
1086 3300005289 Ga0065704_10101877 Ga0065704_101018772 351
1087 3300005290 Ga0065712_10037077 Ga0065712_100370771 351
1088 3300005290 Ga0065712_10081299 Ga0065712_100812992 351
1089 3300005290 Ga0065712_10105846 Ga0065712_101058463 351
1090 3300005293 Ga0065715_10000449 Ga0065715_100004498 351
1091 3300005293 Ga0065715_10164600 Ga0065715_101646002 351
1092 3300005328 Ga0070676_10000308 Ga0070676_100003083 351
1093 3300005329 Ga0070683_100004737 Ga0070683_1000047373 351
1094 3300005329 Ga0070683_100031574 Ga0070683_1000315743 351
1095 3300005329 Ga0070683_100054561 Ga0070683_1000545612 351
1096 3300005329 Ga0070683_100160548 Ga0070683_1001605482 351
1097 3300005329 Ga0070683_100166639 Ga0070683_1001666392 351
1098 3300005329 Ga0070683_100222817 Ga0070683_1002228172 351
1099 3300005330 Ga0070690_100002356 Ga0070690_1000023561 351
1100 3300005330 Ga0070690_100009282 Ga0070690_1000092824 351
1101 3300005330 Ga0070690_100134039 Ga0070690_1001340391 351
1102 3300005331 Ga0070670_100003132 Ga0070670_1000031322 351
1103 3300005331 Ga0070670_100003645 Ga0070670_10000364510 351
1104 3300005331 Ga0070670_100013025 Ga0070670_1000130252 351
1105 3300005331 Ga0070670_100054159 Ga0070670_1000541591 351
1106 3300005331 Ga0070670_100350918 Ga0070670_1003509181 351
1107 3300005333 Ga0070677_10000203 Ga0070677_100002033 351
1108 3300005333 Ga0070677_10093224 Ga0070677_100932241 351
1109 3300005334 Ga0068869_100000290 Ga0068869_1000002903 351
1110 3300005334 Ga0068869_100118106 Ga0068869_1001181062 351
1111 3300005334 Ga0068869_100178225 Ga0068869_1001782251 351
1112 3300005334 Ga0068869_100239011 Ga0068869_1002390112 351
1113 3300005335 Ga0070666_10033208 Ga0070666_100332081 351
1114 3300005335 Ga0070666_10068460 Ga0070666_100684602 351
1115 3300005336 Ga0070680_100006358 Ga0070680_1000063584 351
1116 3300005336 Ga0070680_100006548 Ga0070680_1000065482 351
1117 3300005336 Ga0070680_100007952 Ga0070680_1000079523 351
1118 3300005336 Ga0070680_100040562 Ga0070680_1000405623 351
1119 3300005336 Ga0070680_100096638 Ga0070680_1000966382 351
1120 3300005336 Ga0070680_100107144 Ga0070680_1001071442 351
1121 3300005336 Ga0070680_100135402 Ga0070680_1001354022 351
1122 3300005336 Ga0070680_100170904 Ga0070680_1001709041 351
1123 3300005337 Ga0070682_100000982 Ga0070682_1000009822 351
1124 3300005337 Ga0070682_100001061 Ga0070682_1000010613 351
1125 3300005337 Ga0070682_100038624 Ga0070682_1000386242 351
1126 3300005337 Ga0070682_100066366 Ga0070682_1000663662 351
1127 3300005338 Ga0068868_100000505 Ga0068868_1000005052 351
1128 3300005339 Ga0070660_100000419 Ga0070660_10000041911 351
1129 3300005339 Ga0070660_100002532 Ga0070660_1000025323 351
1130 3300005339 Ga0070660_100016441 Ga0070660_1000164413 351
1131 3300005339 Ga0070660_100042109 Ga0070660_1000421092 351
1132 3300005339 Ga0070660_100216086 Ga0070660_1002160861 351
1133 3300005340 Ga0070689_100000567 Ga0070689_1000005677 351
1134 3300005340 Ga0070689_100000784 Ga0070689_1000007846 351
1135 3300005340 Ga0070689_100006577 Ga0070689_1000065772 351
1136 3300005340 Ga0070689_100010941 Ga0070689_1000109411 351
1137 3300005340 Ga0070689_100017607 Ga0070689_1000176075 351
1138 3300005340 Ga0070689_100019683 Ga0070689_1000196834 351
1139 3300005340 Ga0070689_100024286 Ga0070689_1000242863 351
1140 3300005341 Ga0070691_10001059 Ga0070691_100010593 351
1141 3300005341 Ga0070691_10016994 Ga0070691_100169942 351
1142 3300005341 Ga0070691_10080215 Ga0070691_100802152 351
1143 3300005343 Ga0070687_100000145 Ga0070687_10000014520 351
1144 3300005343 Ga0070687_100001424 Ga0070687_1000014242 351
1145 3300005344 Ga0070661_100004369 Ga0070661_1000043696 351
1146 3300005344 Ga0070661_100015609 Ga0070661_1000156093 351
1147 3300005344 Ga0070661_100063942 Ga0070661_1000639423 351
1148 3300005344 Ga0070661_100067273 Ga0070661_1000672732 351
1149 3300005344 Ga0070661_100102307 Ga0070661_1001023072 351
1150 3300005344 Ga0070661_100151584 Ga0070661_1001515842 351
1151 3300005345 Ga0070692_10000927 Ga0070692_100009278 351
1152 3300005347 Ga0070668_100003304 Ga0070668_1000033047 351
1153 3300005347 Ga0070668_100044604 Ga0070668_1000446042 351
1154 3300005347 Ga0070668_100049906 Ga0070668_1000499064 351
1155 3300005347 Ga0070668_100071617 Ga0070668_1000716172 351
1156 3300005347 Ga0070668_100090516 Ga0070668_1000905163 351
1157 3300005347 Ga0070668_100353361 Ga0070668_1003533611 351
1158 3300005353 Ga0070669_100003579 Ga0070669_1000035793 351
1159 3300005353 Ga0070669_100026298 Ga0070669_1000262982 351
1160 3300005353 Ga0070669_100118893 Ga0070669_1001188931 351
1161 3300005353 Ga0070669_100170420 Ga0070669_1001704202 351
1162 3300005354 Ga0070675_100000977 Ga0070675_10000097714 351
1163 3300005354 Ga0070675_100006235 Ga0070675_1000062357 351
1164 3300005354 Ga0070675_100047289 Ga0070675_1000472892 351
1165 3300005354 Ga0070675_100053971 Ga0070675_1000539712 351
1166 3300005355 Ga0070671_100000457 Ga0070671_10000045723 351
1167 3300005355 Ga0070671_100005484 Ga0070671_1000054844 351
1168 3300005355 Ga0070671_100013863 Ga0070671_1000138634 351
1169 3300005355 Ga0070671_100024576 Ga0070671_1000245764 351
1170 3300005355 Ga0070671_100056174 Ga0070671_1000561742 351
1171 3300005355 Ga0070671_100102405 Ga0070671_1001024052 351
1172 3300005355 Ga0070671_100162562 Ga0070671_1001625622 351
1173 3300005356 Ga0070674_100003924 Ga0070674_1000039244 351
1174 3300005356 Ga0070674_100005104 Ga0070674_1000051043 351
1175 3300005356 Ga0070674_100010581 Ga0070674_1000105812 351
1176 3300005356 Ga0070674_100023685 Ga0070674_1000236854 351
1177 3300005364 Ga0070673_100002173 Ga0070673_10000217310 351
1178 3300005364 Ga0070673_100002183 Ga0070673_1000021836 351
1179 3300005364 Ga0070673_100091785 Ga0070673_1000917852 351
1180 3300005364 Ga0070673_100095685 Ga0070673_1000956852 351
1181 3300005365 Ga0070688_100000956 Ga0070688_1000009566 351
1182 3300005365 Ga0070688_100008606 Ga0070688_1000086063 351
1183 3300005365 Ga0070688_100036208 Ga0070688_1000362082 351
1184 3300005365 Ga0070688_100061090 Ga0070688_1000610902 351
1185 3300005365 Ga0070688_100071389 Ga0070688_1000713892 351
1186 3300005366 Ga0070659_100001451 Ga0070659_10000145114 351
1187 3300005366 Ga0070659_100016138 Ga0070659_1000161382 351
1188 3300005366 Ga0070659_100049630 Ga0070659_1000496303 351
1189 3300005366 Ga0070659_100059384 Ga0070659_1000593842 351
1190 3300005366 Ga0070659_100233404 Ga0070659_1002334042 351
1191 3300005367 Ga0070667_100156522 Ga0070667_1001565221 351
1192 3300005406 Ga0070703_10011030 Ga0070703_100110302 351
1193 3300005434 Ga0070709_10004491 Ga0070709_100044916 351
1194 3300005434 Ga0070709_10011326 Ga0070709_100113263 351
1195 3300005434 Ga0070709_10022469 Ga0070709_100224692 351
1196 3300005434 Ga0070709_10030529 Ga0070709_100305292 351
1197 3300005435 Ga0070714_100005442 Ga0070714_1000054429 351
1198 3300005435 Ga0070714_100011031 Ga0070714_1000110316 351
1199 3300005435 Ga0070714_100016605 Ga0070714_1000166054 351
1200 3300005435 Ga0070714_100016855 Ga0070714_1000168554 351
1201 3300005435 Ga0070714_100019021 Ga0070714_1000190214 351
1202 3300005435 Ga0070714_100036484 Ga0070714_1000364842 351
1203 3300005435 Ga0070714_100083816 Ga0070714_1000838162 351
1204 3300005435 Ga0070714_100194327 Ga0070714_1001943271 351
1205 3300005435 Ga0070714_100196379 Ga0070714_1001963792 351
1206 3300005436 Ga0070713_100000834 Ga0070713_10000083414 351
1207 3300005436 Ga0070713_100008105 Ga0070713_1000081053 351
1208 3300005436 Ga0070713_100015475 Ga0070713_1000154753 351
1209 3300005436 Ga0070713_100051872 Ga0070713_1000518723 351
1210 3300005436 Ga0070713_100092085 Ga0070713_1000920852 351
1211 3300005436 Ga0070713_100095586 Ga0070713_1000955862 351
1212 3300005437 Ga0070710_10000567 Ga0070710_1000056716 351
1213 3300005437 Ga0070710_10009242 Ga0070710_100092423 351
1214 3300005437 Ga0070710_10019974 Ga0070710_100199742 351
1215 3300005437 Ga0070710_10027323 Ga0070710_100273232 351
1216 3300005438 Ga0070701_10000773 Ga0070701_100007736 351
1217 3300005438 Ga0070701_10052031 Ga0070701_100520312 351
1218 3300005439 Ga0070711_100000801 Ga0070711_10000080110 351
1219 3300005439 Ga0070711_100006558 Ga0070711_1000065583 351
1220 3300005439 Ga0070711_100019620 Ga0070711_1000196203 351
1221 3300005439 Ga0070711_100067921 Ga0070711_1000679212 351
1222 3300005439 Ga0070711_100073752 Ga0070711_1000737522 351
1223 3300005439 Ga0070711_100146969 Ga0070711_1001469692 351
1224 3300005440 Ga0070705_100012088 Ga0070705_1000120882 351
1225 3300005440 Ga0070705_100114972 Ga0070705_1001149722 351
1226 3300005441 Ga0070700_100002595 Ga0070700_1000025952 351
1227 3300005441 Ga0070700_100005406 Ga0070700_1000054066 351
1228 3300005441 Ga0070700_100015662 Ga0070700_1000156623 351
1229 3300005444 Ga0070694_100005038 Ga0070694_1000050383 351
1230 3300005444 Ga0070694_100019262 Ga0070694_1000192622 351
1231 3300005445 Ga0070708_100016537 Ga0070708_1000165372 351
1232 3300005455 Ga0070663_100007329 Ga0070663_1000073293 351
1233 3300005455 Ga0070663_100013311 Ga0070663_1000133114 351
1234 3300005455 Ga0070663_100016126 Ga0070663_1000161262 351
1235 3300005455 Ga0070663_100018939 Ga0070663_1000189393 351
1236 3300005455 Ga0070663_100020358 Ga0070663_1000203582 351
1237 3300005455 Ga0070663_100080041 Ga0070663_1000800412 351
1238 3300005455 Ga0070663_100081341 Ga0070663_1000813412 351
1239 3300005455 Ga0070663_100236714 Ga0070663_1002367141 351
1240 3300005456 Ga0070678_100000204 Ga0070678_1000002043 351
1241 3300005456 Ga0070678_100006849 Ga0070678_1000068492 351
1242 3300005456 Ga0070678_100016075 Ga0070678_1000160753 351
1243 3300005456 Ga0070678_100019584 Ga0070678_1000195843 351
1244 3300005456 Ga0070678_100026143 Ga0070678_1000261433 351
1245 3300005456 Ga0070678_100062074 Ga0070678_1000620742 351
1246 3300005456 Ga0070678_100064897 Ga0070678_1000648973 351
1247 3300005456 Ga0070678_100069888 Ga0070678_1000698882 351
1248 3300005456 Ga0070678_100071249 Ga0070678_1000712492 351
1249 3300005457 Ga0070662_100051612 Ga0070662_1000516122 351
1250 3300005457 Ga0070662_100077295 Ga0070662_1000772953 351
1251 3300005457 Ga0070662_100124476 Ga0070662_1001244762 351
1252 3300005458 Ga0070681_10001622 Ga0070681_100016228 351
1253 3300005458 Ga0070681_10004974 Ga0070681_1000497411 351
1254 3300005458 Ga0070681_10016579 Ga0070681_100165792 351
1255 3300005458 Ga0070681_10018673 Ga0070681_100186733 351
1256 3300005458 Ga0070681_10034683 Ga0070681_100346832 351
1257 3300005458 Ga0070681_10062985 Ga0070681_100629854 351
1258 3300005458 Ga0070681_10064861 Ga0070681_100648612 351
1259 3300005458 Ga0070681_10106074 Ga0070681_101060742 351
1260 3300005458 Ga0070681_10301768 Ga0070681_103017682 351
1261 3300005459 Ga0068867_100016017 Ga0068867_1000160172 351
1262 3300005459 Ga0068867_100021279 Ga0068867_1000212793 351
1263 3300005459 Ga0068867_100024746 Ga0068867_1000247461 351
1264 3300005459 Ga0068867_100068926 Ga0068867_1000689262 351
1265 3300005459 Ga0068867_100095594 Ga0068867_1000955942 351
1266 3300005459 Ga0068867_100183297 Ga0068867_1001832972 351
1267 3300005466 Ga0070685_10017792 Ga0070685_100177923 351
1268 3300005466 Ga0070685_10023595 Ga0070685_100235952 351
1269 3300005466 Ga0070685_10057794 Ga0070685_100577943 351
1270 3300005467 Ga0070706_100096722 Ga0070706_1000967221 351
1271 3300005468 Ga0070707_100108628 Ga0070707_1001086282 351
1272 3300005468 Ga0070707_100190933 Ga0070707_1001909332 351
1273 3300005518 Ga0070699_100004210 Ga0070699_1000042104 351
1274 3300005530 Ga0070679_100003230 Ga0070679_10000323014 351
1275 3300005530 Ga0070679_100004369 Ga0070679_10000436912 351
1276 3300005530 Ga0070679_100006042 Ga0070679_1000060423 351
1277 3300005530 Ga0070679_100020708 Ga0070679_1000207086 351
1278 3300005530 Ga0070679_100066542 Ga0070679_1000665423 351
1279 3300005530 Ga0070679_100296983 Ga0070679_1002969831 351
1280 3300005530 Ga0070679_100437708 Ga0070679_1004377081 351
1281 3300005535 Ga0070684_100006387 Ga0070684_1000063877 351
1282 3300005535 Ga0070684_100017723 Ga0070684_1000177232 351
1283 3300005535 Ga0070684_100069493 Ga0070684_1000694931 351
1284 3300005535 Ga0070684_100138162 Ga0070684_1001381622 351
1285 3300005535 Ga0070684_100221590 Ga0070684_1002215901 351
1286 3300005536 Ga0070697_100003792 Ga0070697_1000037929 351
1287 3300005536 Ga0070697_100219633 Ga0070697_1002196331 351
1288 3300005539 Ga0068853_100000504 Ga0068853_1000005043 351
1289 3300005539 Ga0068853_100006640 Ga0068853_1000066403 351
1290 3300005539 Ga0068853_100014714 Ga0068853_1000147142 351
1291 3300005539 Ga0068853_100018347 Ga0068853_1000183473 351
1292 3300005539 Ga0068853_100028677 Ga0068853_1000286775 351
1293 3300005539 Ga0068853_100112169 Ga0068853_1001121691 351
1294 3300005543 Ga0070672_100000343 Ga0070672_10000034320 351
1295 3300005543 Ga0070672_100014311 Ga0070672_1000143113 351
1296 3300005543 Ga0070672_100014711 Ga0070672_1000147113 351
1297 3300005544 Ga0070686_100000862 Ga0070686_1000008621 351
1298 3300005544 Ga0070686_100003330 Ga0070686_1000033302 351
1299 3300005544 Ga0070686_100015191 Ga0070686_1000151912 351
1300 3300005545 Ga0070695_100000693 Ga0070695_10000069311 351
1301 3300005545 Ga0070695_100003899 Ga0070695_1000038993 351
1302 3300005545 Ga0070695_100017273 Ga0070695_1000172733 351
1303 3300005545 Ga0070695_100036710 Ga0070695_1000367103 351
1304 3300005546 Ga0070696_100008114 Ga0070696_1000081143 351
1305 3300005546 Ga0070696_100116741 Ga0070696_1001167412 351
1306 3300005547 Ga0070693_100008248 Ga0070693_1000082483 351
1307 3300005547 Ga0070693_100008941 Ga0070693_1000089412 351
1308 3300005547 Ga0070693_100124478 Ga0070693_1001244781 351
1309 3300005548 Ga0070665_100021753 Ga0070665_1000217534 351
1310 3300005548 Ga0070665_100032166 Ga0070665_1000321663 351
1311 3300005548 Ga0070665_100087707 Ga0070665_1000877073 351
1312 3300005548 Ga0070665_100095749 Ga0070665_1000957493 351
1313 3300005548 Ga0070665_100193878 Ga0070665_1001938782 351
1314 3300005548 Ga0070665_100292379 Ga0070665_1002923792 351
1315 3300005549 Ga0070704_100000799 Ga0070704_1000007993 351
1316 3300005549 Ga0070704_100002708 Ga0070704_1000027088 351
1317 3300005549 Ga0070704_100002929 Ga0070704_1000029298 351
1318 3300005549 Ga0070704_100024943 Ga0070704_1000249432 351
1319 3300005563 Ga0068855_100016222 Ga0068855_1000162228 351
1320 3300005563 Ga0068855_100019843 Ga0068855_1000198433 351
1321 3300005563 Ga0068855_100040429 Ga0068855_1000404293 351
1322 3300005563 Ga0068855_100040447 Ga0068855_1000404473 351
1323 3300005563 Ga0068855_100096594 Ga0068855_1000965943 351
1324 3300005563 Ga0068855_100146506 Ga0068855_1001465062 351
1325 3300005563 Ga0068855_100155994 Ga0068855_1001559942 351
1326 3300005563 Ga0068855_100326594 Ga0068855_1003265942 351
1327 3300005563 Ga0068855_100363645 Ga0068855_1003636452 351
1328 3300005564 Ga0070664_100022786 Ga0070664_1000227864 351
1329 3300005564 Ga0070664_100094573 Ga0070664_1000945732 351
1330 3300005577 Ga0068857_100000979 Ga0068857_1000009792 351
1331 3300005577 Ga0068857_100100623 Ga0068857_1001006232 351
1332 3300005577 Ga0068857_100139657 Ga0068857_1001396571 351
1333 3300005577 Ga0068857_100341286 Ga0068857_1003412861 351
1334 3300005578 Ga0068854_100000702 Ga0068854_1000007026 351
1335 3300005578 Ga0068854_100056438 Ga0068854_1000564382 351
1336 3300005614 Ga0068856_100000020 Ga0068856_10000002070 351
1337 3300005614 Ga0068856_100010469 Ga0068856_1000104696 351
1338 3300005614 Ga0068856_100021168 Ga0068856_1000211682 351
1339 3300005614 Ga0068856_100039666 Ga0068856_1000396666 351
1340 3300005614 Ga0068856_100276730 Ga0068856_1002767302 351
1341 3300005614 Ga0068856_100291136 Ga0068856_1002911361 351
1342 3300005615 Ga0070702_100001050 Ga0070702_1000010503 351
1343 3300005616 Ga0068852_100001019 Ga0068852_1000010193 351
1344 3300005616 Ga0068852_100002168 Ga0068852_1000021689 351
1345 3300005616 Ga0068852_100002288 Ga0068852_10000228810 351
1346 3300005616 Ga0068852_100038925 Ga0068852_1000389254 351
1347 3300005616 Ga0068852_100046632 Ga0068852_1000466321 351
1348 3300005616 Ga0068852_100052790 Ga0068852_1000527903 351
1349 3300005616 Ga0068852_100059057 Ga0068852_1000590572 351
1350 3300005616 Ga0068852_100093147 Ga0068852_1000931472 351
1351 3300005616 Ga0068852_100383865 Ga0068852_1003838652 351
1352 3300005617 Ga0068859_100045113 Ga0068859_1000451131 351
1353 3300005617 Ga0068859_100067415 Ga0068859_1000674153 351
1354 3300005617 Ga0068859_100231421 Ga0068859_1002314211 351
1355 3300005618 Ga0068864_100004079 Ga0068864_1000040798 351
1356 3300005618 Ga0068864_100241508 Ga0068864_1002415082 351
1357 3300005718 Ga0068866_10002039 Ga0068866_100020393 351
1358 3300005719 Ga0068861_100005424 Ga0068861_1000054246 351
1359 3300005719 Ga0068861_100011655 Ga0068861_1000116553 351
1360 3300005719 Ga0068861_100124311 Ga0068861_1001243112 351
1361 3300005719 Ga0068861_100303730 Ga0068861_1003037301 351
1362 3300005834 Ga0068851_10001344 Ga0068851_100013447 351
1363 3300005834 Ga0068851_10007440 Ga0068851_100074403 351
1364 3300005834 Ga0068851_10071673 Ga0068851_100716732 351
1365 3300005840 Ga0068870_10000442 Ga0068870_1000044213 351
1366 3300005841 Ga0068863_100022454 Ga0068863_1000224543 351
1367 3300005842 Ga0068858_100000657 Ga0068858_10000065713 351
1368 3300005842 Ga0068858_100024985 Ga0068858_1000249853 351
1369 3300005842 Ga0068858_100025080 Ga0068858_1000250802 351
1370 3300005842 Ga0068858_100051225 Ga0068858_1000512252 351
1371 3300005842 Ga0068858_100152855 Ga0068858_1001528552 351
1372 3300005842 Ga0068858_100258627 Ga0068858_1002586272 351
1373 3300005843 Ga0068860_100000633 Ga0068860_1000006336 351
1374 3300005843 Ga0068860_100012235 Ga0068860_1000122354 351
1375 3300005843 Ga0068860_100029184 Ga0068860_1000291843 351
1376 3300005843 Ga0068860_100140686 Ga0068860_1001406862 351
1377 3300005844 Ga0068862_100002115 Ga0068862_10000211514 351
1378 3300005844 Ga0068862_100084095 Ga0068862_1000840953 351
1379 3300005844 Ga0068862_100123886 Ga0068862_1001238862 351
1380 3300005844 Ga0068862_100154356 Ga0068862_1001543562 351
1381 3300005937 Ga0081455_10000012 Ga0081455_1000001252 351
1382 3300005937 Ga0081455_10000678 Ga0081455_1000067815 351
1383 3300005937 Ga0081455_10001814 Ga0081455_100018145 351
1384 3300005937 Ga0081455_10005602 Ga0081455_1000560210 351
1385 3300005937 Ga0081455_10008012 Ga0081455_100080123 351
1386 3300005937 Ga0081455_10011296 Ga0081455_100112966 351
1387 3300005937 Ga0081455_10044146 Ga0081455_100441463 351
1388 3300005937 Ga0081455_10056922 Ga0081455_100569223 351
1389 3300005937 Ga0081455_10067121 Ga0081455_100671212 351
1390 3300005937 Ga0081455_10071109 Ga0081455_100711092 351
1391 3300005937 Ga0081455_10240205 Ga0081455_102402051 351
1392 3300005981 Ga0081538_10005596 Ga0081538_100055968 351
1393 3300005981 Ga0081538_10011536 Ga0081538_100115363 351
1394 3300005981 Ga0081538_10053242 Ga0081538_100532422 351
1395 3300005981 Ga0081538_10059528 Ga0081538_100595281 351
1396 3300005983 Ga0081540_1000019 Ga0081540_100001967 351
1397 3300005983 Ga0081540_1000933 Ga0081540_100093321 351
1398 3300005983 Ga0081540_1001603 Ga0081540_10016033 351
1399 3300005983 Ga0081540_1001730 Ga0081540_10017304 351
1400 3300005983 Ga0081540_1002812 Ga0081540_100281212 351
1401 3300005983 Ga0081540_1004950 Ga0081540_10049505 351
1402 3300005983 Ga0081540_1011886 Ga0081540_10118862 351
1403 3300005983 Ga0081540_1027590 Ga0081540_10275903 351
1404 3300005983 Ga0081540_1047883 Ga0081540_10478831 351
1405 3300005985 Ga0081539_10000140 Ga0081539_1000014027 351
1406 3300005985 Ga0081539_10000862 Ga0081539_1000086235 351
1407 3300005985 Ga0081539_10002946 Ga0081539_100029465 351
1408 3300005985 Ga0081539_10003950 Ga0081539_1000395015 351
1409 3300005985 Ga0081539_10008084 Ga0081539_1000808410 351
1410 3300005985 Ga0081539_10041228 Ga0081539_100412282 351
1411 3300005985 Ga0081539_10044663 Ga0081539_100446633 351
1412 3300006028 Ga0070717_10000720 Ga0070717_1000072011 351
1413 3300006028 Ga0070717_10002391 Ga0070717_100023914 351
1414 3300006028 Ga0070717_10004566 Ga0070717_100045663 351
1415 3300006028 Ga0070717_10012075 Ga0070717_100120753 351
1416 3300006028 Ga0070717_10101140 Ga0070717_101011402 351
1417 3300006028 Ga0070717_10121488 Ga0070717_101214882 351
1418 3300006028 Ga0070717_10124748 Ga0070717_101247482 351
1419 3300006028 Ga0070717_10126620 Ga0070717_101266202 351
1420 3300006028 Ga0070717_10175268 Ga0070717_101752681 351
1421 3300006038 Ga0075365_10019560 Ga0075365_100195604 351
1422 3300006042 Ga0075368_10014679 Ga0075368_100146791 351
1423 3300006042 Ga0075368_10024855 Ga0075368_100248552 351
1424 3300006042 Ga0075368_10037252 Ga0075368_100372522 351
1425 3300006048 Ga0075363_100025038 Ga0075363_1000250381 351
1426 3300006048 Ga0075363_100087500 Ga0075363_1000875002 351
1427 3300006051 Ga0075364_10004310 Ga0075364_100043103 351
1428 3300006051 Ga0075364_10066064 Ga0075364_100660642 351
1429 3300006058 Ga0075432_10002045 Ga0075432_100020453 351
1430 3300006058 Ga0075432_10011462 Ga0075432_100114622 351
1431 3300006163 Ga0070715_10002602 Ga0070715_100026024 351
1432 3300006163 Ga0070715_10012885 Ga0070715_100128853 351
1433 3300006173 Ga0070716_100003115 Ga0070716_1000031156 351
1434 3300006173 Ga0070716_100004945 Ga0070716_1000049455 351
1435 3300006175 Ga0070712_100000405 Ga0070712_10000040512 351
1436 3300006175 Ga0070712_100006221 Ga0070712_1000062213 351
1437 3300006175 Ga0070712_100084821 Ga0070712_1000848212 351
1438 3300006175 Ga0070712_100096644 Ga0070712_1000966442 351
1439 3300006177 Ga0075362_10026595 Ga0075362_100265952 351
1440 3300006177 Ga0075362_10065967 Ga0075362_100659671 351
1441 3300006178 Ga0075367_10000606 Ga0075367_100006066 351
1442 3300006178 Ga0075367_10027570 Ga0075367_100275702 351
1443 3300006178 Ga0075367_10031335 Ga0075367_100313353 351
1444 3300006186 Ga0075369_10005848 Ga0075369_100058484 351
1445 3300006194 Ga0075427_10000374 Ga0075427_100003744 351
1446 3300006195 Ga0075366_10052684 Ga0075366_100526842 351
1447 3300006195 Ga0075366_10064748 Ga0075366_100647481 351
1448 3300006237 Ga0097621_100000568 Ga0097621_10000056819 351
1449 3300006237 Ga0097621_100031502 Ga0097621_1000315022 351
1450 3300006237 Ga0097621_100122529 Ga0097621_1001225291 351
1451 3300006237 Ga0097621_100159633 Ga0097621_1001596332 351
1452 3300006237 Ga0097621_100252451 Ga0097621_1002524512 351
1453 3300006353 Ga0075370_10015666 Ga0075370_100156662 351
1454 3300006353 Ga0075370_10022235 Ga0075370_100222354 351
1455 3300006358 Ga0068871_100000203 Ga0068871_10000020323 351
1456 3300006358 Ga0068871_100034225 Ga0068871_1000342252 351
1457 3300006844 Ga0075428_100001488 Ga0075428_1000014882 351
1458 3300006844 Ga0075428_100001638 Ga0075428_10000163811 351
1459 3300006844 Ga0075428_100001971 Ga0075428_1000019718 351
1460 3300006844 Ga0075428_100007729 Ga0075428_10000772911 351
1461 3300006844 Ga0075428_100045691 Ga0075428_1000456912 351
1462 3300006846 Ga0075430_100000251 Ga0075430_1000002519 351
1463 3300006846 Ga0075430_100024107 Ga0075430_1000241072 351
1464 3300006846 Ga0075430_100072799 Ga0075430_1000727992 351
1465 3300006846 Ga0075430_100102368 Ga0075430_1001023682 351
1466 3300006847 Ga0075431_100000504 Ga0075431_1000005044 351
1467 3300006847 Ga0075431_100001119 Ga0075431_10000111912 351
1468 3300006847 Ga0075431_100006760 Ga0075431_1000067606 351
1469 3300006847 Ga0075431_100017432 Ga0075431_1000174329 351
1470 3300006847 Ga0075431_100050893 Ga0075431_1000508932 351
1471 3300006847 Ga0075431_100099529 Ga0075431_1000995292 351
1472 3300006847 Ga0075431_100115251 Ga0075431_1001152512 351
1473 3300006847 Ga0075431_100236707 Ga0075431_1002367072 351
1474 3300006847 Ga0075431_100269808 Ga0075431_1002698082 351
1475 3300006852 Ga0075433_10000152 Ga0075433_100001527 351
1476 3300006852 Ga0075433_10038769 Ga0075433_100387692 351
1477 3300006852 Ga0075433_10053555 Ga0075433_100535552 351
1478 3300006871 Ga0075434_100003370 Ga0075434_1000033708 351
1479 3300006871 Ga0075434_100022796 Ga0075434_1000227965 351
1480 3300006871 Ga0075434_100025594 Ga0075434_1000255943 351
1481 3300006871 Ga0075434_100036086 Ga0075434_1000360862 351
1482 3300006871 Ga0075434_100044526 Ga0075434_1000445265 351
1483 3300006871 Ga0075434_100133060 Ga0075434_1001330602 351
1484 3300006871 Ga0075434_100176158 Ga0075434_1001761582 351
1485 3300006871 Ga0075434_100270499 Ga0075434_1002704992 351
1486 3300006880 Ga0075429_100000459 Ga0075429_1000004595 351
1487 3300006880 Ga0075429_100000855 Ga0075429_1000008552 351
1488 3300006880 Ga0075429_100002649 Ga0075429_1000026499 351
1489 3300006880 Ga0075429_100029010 Ga0075429_1000290102 351
1490 3300006880 Ga0075429_100105058 Ga0075429_1001050582 351
1491 3300006880 Ga0075429_100292969 Ga0075429_1002929691 351
1492 3300006881 Ga0068865_100000155 Ga0068865_10000015521 351
1493 3300006881 Ga0068865_100024484 Ga0068865_1000244842 351
1494 3300006881 Ga0068865_100103481 Ga0068865_1001034812 351
1495 3300006881 Ga0068865_100130394 Ga0068865_1001303942 351
1496 3300006914 Ga0075436_100003747 Ga0075436_1000037474 351
1497 3300006914 Ga0075436_100013840 Ga0075436_1000138404 351
1498 3300006931 Ga0097620_100045113 Ga0097620_1000451131 351
1499 3300006931 Ga0097620_100067407 Ga0097620_1000674071 351
1500 3300006931 Ga0097620_100068299 Ga0097620_1000682992 351
1501 3300006931 Ga0097620_100231398 Ga0097620_1002313981 351
1502 3300006941 Ga0099825_1023236 Ga0099825_10232364 351
1503 3300006942 Ga0099824_1011525 Ga0099824_10115257 351
1504 3300006942 Ga0099824_1016950 Ga0099824_10169506 351
1505 3300006943 Ga0099822_1002297 Ga0099822_100229710 351
1506 3300006946 Ga0079104_1000013 Ga0079104_100001352 351
1507 3300006946 Ga0079104_1004572 Ga0079104_10045724 351
1508 3300006946 Ga0079104_1015986 Ga0079104_10159862 351
1509 3300007076 Ga0075435_100008956 Ga0075435_1000089561 351
1510 3300007076 Ga0075435_100008983 Ga0075435_1000089834 351
1511 3300007076 Ga0075435_100020212 Ga0075435_1000202123 351
1512 3300007076 Ga0075435_100089012 Ga0075435_1000890122 351
1513 3300009011 Ga0105251_10013625 Ga0105251_100136253 351
1514 3300009036 Ga0105244_10022126 Ga0105244_100221262 351
1515 3300009093 Ga0105240_10009843 Ga0105240_100098439 351
1516 3300009093 Ga0105240_10011032 Ga0105240_100110323 351
1517 3300009093 Ga0105240_10038752 Ga0105240_100387524 351
1518 3300009093 Ga0105240_10070355 Ga0105240_100703553 351
1519 3300009093 Ga0105240_10117923 Ga0105240_101179232 351
1520 3300009093 Ga0105240_10132741 Ga0105240_101327413 351
1521 3300009093 Ga0105240_10335532 Ga0105240_103355322 351
1522 3300009094 Ga0111539_10000114 Ga0111539_1000011469 351
1523 3300009094 Ga0111539_10000367 Ga0111539_1000036751 351
1524 3300009094 Ga0111539_10000673 Ga0111539_1000067338 351
1525 3300009094 Ga0111539_10002196 Ga0111539_1000219610 351
1526 3300009094 Ga0111539_10005040 Ga0111539_1000504010 351
1527 3300009094 Ga0111539_10010049 Ga0111539_100100493 351
1528 3300009094 Ga0111539_10025425 Ga0111539_100254254 351
1529 3300009094 Ga0111539_10036276 Ga0111539_100362763 351
1530 3300009094 Ga0111539_10058399 Ga0111539_100583992 351
1531 3300009094 Ga0111539_10097831 Ga0111539_100978313 351
1532 3300009094 Ga0111539_10122343 Ga0111539_101223432 351
1533 3300009094 Ga0111539_10172350 Ga0111539_101723501 351
1534 3300009098 Ga0105245_10001558 Ga0105245_100015583 351
1535 3300009098 Ga0105245_10043604 Ga0105245_100436043 351
1536 3300009098 Ga0105245_10124344 Ga0105245_101243442 351
1537 3300009098 Ga0105245_10316628 Ga0105245_103166282 351
1538 3300009101 Ga0105247_10012387 Ga0105247_100123873 351
1539 3300009101 Ga0105247_10152833 Ga0105247_101528331 351
1540 3300009147 Ga0114129_10000593 Ga0114129_1000059339 351
1541 3300009147 Ga0114129_10007730 Ga0114129_100077308 351
1542 3300009147 Ga0114129_10012376 Ga0114129_1001237610 351
1543 3300009147 Ga0114129_10016320 Ga0114129_100163206 351
1544 3300009147 Ga0114129_10022324 Ga0114129_100223243 351
1545 3300009147 Ga0114129_10037856 Ga0114129_100378562 351
1546 3300009147 Ga0114129_10081687 Ga0114129_100816872 351
1547 3300009147 Ga0114129_10126328 Ga0114129_101263282 351
1548 3300009148 Ga0105243_10000960 Ga0105243_100009603 351
1549 3300009148 Ga0105243_10016776 Ga0105243_100167763 351
1550 3300009148 Ga0105243_10019267 Ga0105243_100192672 351
1551 3300009174 Ga0105241_10001324 Ga0105241_100013243 351
1552 3300009174 Ga0105241_10002167 Ga0105241_1000216710 351
1553 3300009174 Ga0105241_10002458 Ga0105241_1000245815 351
1554 3300009174 Ga0105241_10034550 Ga0105241_100345502 351
1555 3300009174 Ga0105241_10108268 Ga0105241_101082682 351
1556 3300009174 Ga0105241_10237971 Ga0105241_102379712 351
1557 3300009176 Ga0105242_10001412 Ga0105242_1000141214 351
1558 3300009176 Ga0105242_10134459 Ga0105242_101344592 351
1559 3300009176 Ga0105242_10329696 Ga0105242_103296961 351
1560 3300009177 Ga0105248_10001378 Ga0105248_100013783 351
1561 3300009177 Ga0105248_10004213 Ga0105248_100042135 351
1562 3300009177 Ga0105248_10009339 Ga0105248_100093396 351
1563 3300009177 Ga0105248_10048628 Ga0105248_100486282 351
1564 3300009177 Ga0105248_10124692 Ga0105248_101246923 351
1565 3300009177 Ga0105248_10130378 Ga0105248_101303782 351
1566 3300009177 Ga0105248_10326079 Ga0105248_103260792 351
1567 3300009177 Ga0105248_10631395 Ga0105248_106313951 351
1568 3300009545 Ga0105237_10007091 Ga0105237_1000709111 351
1569 3300009545 Ga0105237_10010293 Ga0105237_100102932 351
1570 3300009545 Ga0105237_10043126 Ga0105237_100431263 351
1571 3300009545 Ga0105237_10052821 Ga0105237_100528212 351
1572 3300009545 Ga0105237_10053424 Ga0105237_100534242 351
1573 3300009545 Ga0105237_10080663 Ga0105237_100806632 351
1574 3300009545 Ga0105237_10085649 Ga0105237_100856492 351
1575 3300009545 Ga0105237_10368426 Ga0105237_103684261 351
1576 3300009551 Ga0105238_10000006 Ga0105238_10000006273 351
1577 3300009551 Ga0105238_10025766 Ga0105238_100257664 351
1578 3300009551 Ga0105238_10075539 Ga0105238_100755392 351
1579 3300009551 Ga0105238_10092943 Ga0105238_100929432 351
1580 3300009553 Ga0105249_10000925 Ga0105249_100009253 351
1581 3300009553 Ga0105249_10000930 Ga0105249_1000093020 351
1582 3300009553 Ga0105249_10008708 Ga0105249_100087086 351
1583 3300009553 Ga0105249_10212680 Ga0105249_102126801 351
1584 3300010159 Ga0099796_10009432 Ga0099796_100094322 351
1585 3300010375 Ga0105239_10003131 Ga0105239_100031316 351
1586 3300010375 Ga0105239_10009354 Ga0105239_100093543 351
1587 3300010375 Ga0105239_10010180 Ga0105239_100101802 351
1588 3300010375 Ga0105239_10033065 Ga0105239_100330653 351
1589 3300010375 Ga0105239_10033364 Ga0105239_100333647 351
1590 3300010375 Ga0105239_10089057 Ga0105239_100890573 351
1591 3300010375 Ga0105239_10097520 Ga0105239_100975203 351
1592 3300010375 Ga0105239_10118722 Ga0105239_101187223 351
1593 3300010375 Ga0105239_10122398 Ga0105239_101223983 351
1594 3300010375 Ga0105239_10123931 Ga0105239_101239312 351
1595 3300010375 Ga0105239_10163330 Ga0105239_101633303 351
1596 3300010375 Ga0105239_10178685 Ga0105239_101786852 351
1597 3300010375 Ga0105239_10281271 Ga0105239_102812712 351
1598 3300010375 Ga0105239_10447064 Ga0105239_104470642 351
1599 3300011119 Ga0105246_10029413 Ga0105246_100294132 351
1600 3300011119 Ga0105246_10036496 Ga0105246_100364963 351
1601 3300011119 Ga0105246_10049577 Ga0105246_100495772 351
1602 3300011119 Ga0105246_10077053 Ga0105246_100770531 351
1603 3300011119 Ga0105246_10179703 Ga0105246_101797032 351
1604 3300012507 Ga0157342_1000469 Ga0157342_10004692 351
1605 3300012513 Ga0157326_1003442 Ga0157326_10034421 351
1606 3300013100 Ga0157373_10011335 Ga0157373_100113355 351
1607 3300013100 Ga0157373_10011392 Ga0157373_100113923 351
1608 3300013100 Ga0157373_10020149 Ga0157373_100201492 351
1609 3300013100 Ga0157373_10058571 Ga0157373_100585711 351
1610 3300013100 Ga0157373_10139478 Ga0157373_101394782 351
1611 3300013102 Ga0157371_10000268 Ga0157371_1000026840 351
1612 3300013102 Ga0157371_10004410 Ga0157371_100044105 351
1613 3300013104 Ga0157370_10009085 Ga0157370_100090855 351
1614 3300013104 Ga0157370_10013966 Ga0157370_100139662 351
1615 3300013104 Ga0157370_10031648 Ga0157370_100316486 351
1616 3300013104 Ga0157370_10056849 Ga0157370_100568494 351
1617 3300013104 Ga0157370_10159190 Ga0157370_101591902 351
1618 3300013105 Ga0157369_10018324 Ga0157369_100183244 351
1619 3300013105 Ga0157369_10058415 Ga0157369_100584155 351
1620 3300013105 Ga0157369_10082850 Ga0157369_100828503 351
1621 3300013105 Ga0157369_10391079 Ga0157369_103910792 351
1622 3300013250 Ga0171462_1007 Ga0171462_1007314 351
1623 3300013296 Ga0157374_10006983 Ga0157374_100069832 351
1624 3300013296 Ga0157374_10081595 Ga0157374_100815952 351
1625 3300013296 Ga0157374_10185883 Ga0157374_101858831 351
1626 3300013297 Ga0157378_10006990 Ga0157378_100069906 351
1627 3300013297 Ga0157378_10013694 Ga0157378_100136946 351
1628 3300013297 Ga0157378_10056690 Ga0157378_100566903 351
1629 3300013306 Ga0163162_10002587 Ga0163162_100025874 351
1630 3300013306 Ga0163162_10007934 Ga0163162_100079346 351
1631 3300013306 Ga0163162_10062058 Ga0163162_100620582 351
1632 3300013306 Ga0163162_10068389 Ga0163162_100683892 351
1633 3300013306 Ga0163162_10171987 Ga0163162_101719872 351
1634 3300013307 Ga0157372_10038427 Ga0157372_100384272 351
1635 3300013307 Ga0157372_10053251 Ga0157372_100532512 351
1636 3300013307 Ga0157372_10068346 Ga0157372_100683465 351
1637 3300013307 Ga0157372_10236564 Ga0157372_102365641 351
1638 3300013307 Ga0157372_10274136 Ga0157372_102741362 351
1639 3300013307 Ga0157372_10309064 Ga0157372_103090641 351
1640 3300013308 Ga0157375_10000697 Ga0157375_1000069723 351
1641 3300013308 Ga0157375_10006290 Ga0157375_100062902 351
1642 3300013308 Ga0157375_10019881 Ga0157375_100198812 351
1643 3300013308 Ga0157375_10042254 Ga0157375_100422543 351
1644 3300013308 Ga0157375_10153889 Ga0157375_101538892 351
1645 3300013308 Ga0157375_10157330 Ga0157375_101573302 351
1646 3300014325 Ga0163163_10002553 Ga0163163_100025538 351
1647 3300014325 Ga0163163_10020492 Ga0163163_100204925 351
1648 3300014325 Ga0163163_10022591 Ga0163163_100225913 351
1649 3300014325 Ga0163163_10036664 Ga0163163_100366643 351
1650 3300014325 Ga0163163_10073045 Ga0163163_100730454 351
1651 3300014326 Ga0157380_10002235 Ga0157380_100022358 351
1652 3300014326 Ga0157380_10022132 Ga0157380_100221326 351
1653 3300014497 Ga0182008_10022719 Ga0182008_100227192 351
1654 3300014745 Ga0157377_10000454 Ga0157377_100004542 351
1655 3300014745 Ga0157377_10018242 Ga0157377_100182423 351
1656 3300014968 Ga0157379_10000539 Ga0157379_1000053927 351
1657 3300014968 Ga0157379_10087747 Ga0157379_100877472 351
1658 3300014968 Ga0157379_10221421 Ga0157379_102214211 351
1659 3300014969 Ga0157376_10001949 Ga0157376_100019493 351
1660 3300014969 Ga0157376_10023925 Ga0157376_100239252 351
1661 3300014969 Ga0157376_10048612 Ga0157376_100486122 351
1662 3300014969 Ga0157376_10114658 Ga0157376_101146582 351
1663 3300015261 Ga0182006_1023156 Ga0182006_10231561 351
1664 3300015261 Ga0182006_1026458 Ga0182006_10264583 351
1665 3300015261 Ga0182006_1039122 Ga0182006_10391222 351
1666 3300017792 Ga0163161_10001235 Ga0163161_1000123515 351
1667 3300017792 Ga0163161_10027620 Ga0163161_100276202 351
1668 3300017792 Ga0163161_10080174 Ga0163161_100801741 351
1669 3300017792 Ga0163161_10194839 Ga0163161_101948392 351
1670 3300020070 Ga0206356_11768000 Ga0206356_117680004 351
1671 3300021320 Ga0214544_1000002 Ga0214544_1000002169 351
1672 3300021321 Ga0214542_1000001 Ga0214542_1000001519 351
1673 3300021324 Ga0214545_1000001 Ga0214545_1000001585 351
1674 3300021327 Ga0214543_1000001 Ga0214543_1000001611 351
1675 3300021361 Ga0213872_10003952 Ga0213872_100039526 351
1676 3300021361 Ga0213872_10055816 Ga0213872_100558162 351
1677 3300021377 Ga0213874_10008081 Ga0213874_100080812 351
1678 3300021384 Ga0213876_10001306 Ga0213876_1000130614 351
1679 3300021384 Ga0213876_10002183 Ga0213876_100021837 351
1680 3300021384 Ga0213876_10073389 Ga0213876_100733892 351
1681 3300021388 Ga0213875_10000036 Ga0213875_10000036143 351
1682 3300021388 Ga0213875_10021442 Ga0213875_100214423 351
1683 3300021388 Ga0213875_10021972 Ga0213875_100219723 351
1684 3300021441 Ga0213871_10001174 Ga0213871_100011742 351
1685 3300021441 Ga0213871_10009084 Ga0213871_100090841 351
1686 3300022467 Ga0224712_10065997 Ga0224712_100659971 351
1687 3300022739 Ga0228711_1000007 Ga0228711_1000007166 351
1688 3300022740 Ga0228710_1000007 Ga0228710_1000007153 351
1689 3300024225 Ga0224572_1000531 Ga0224572_10005313 351
1690 3300024227 Ga0228598_1000795 Ga0228598_10007953 351
1691 3300025206 Ga0209435_100018 Ga0209435_10001875 351
1692 3300025206 Ga0209435_100240 Ga0209435_1002402 351
1693 3300025224 Ga0209784_100009 Ga0209784_100009570 351
1694 3300025225 Ga0209566_100007 Ga0209566_100007570 351
1695 3300025226 Ga0209674_100018 Ga0209674_100018570 351
1696 3300025228 Ga0209672_101842 Ga0209672_1018424 351
1697 3300025229 Ga0209147_100051 Ga0209147_10005175 351
1698 3300025230 Ga0209563_100020 Ga0209563_100020570 351
1699 3300025233 Ga0209437_101200 Ga0209437_1012003 351
1700 3300025242 Ga0209258_101977 Ga0209258_1019772 351
1701 3300025246 Ga0209646_1000172 Ga0209646_100017275 351
1702 3300025246 Ga0209646_1000186 Ga0209646_10001865 351
1703 3300025250 Ga0209026_1000005 Ga0209026_100000597 351
1704 3300025250 Ga0209026_1000042 Ga0209026_1000042171 351
1705 3300025253 Ga0209677_100010 Ga0209677_100010570 351
1706 3300025253 Ga0209677_101018 Ga0209677_10101812 351
1707 3300025254 Ga0209148_1000056 Ga0209148_100005653 351
1708 3300025254 Ga0209148_1000475 Ga0209148_100047531 351
1709 3300025254 Ga0209148_1006213 Ga0209148_10062132 351
1710 3300025256 Ga0209759_1000538 Ga0209759_10005382 351
1711 3300025256 Ga0209759_1000547 Ga0209759_100054724 351
1712 3300025256 Ga0209759_1000933 Ga0209759_100093318 351
1713 3300025261 Ga0209233_1000068 Ga0209233_1000068106 351
1714 3300025261 Ga0209233_1002185 Ga0209233_10021853 351
1715 3300025261 Ga0209233_1003457 Ga0209233_10034574 351
1716 3300025261 Ga0209233_1004993 Ga0209233_10049932 351
1717 3300025261 Ga0209233_1025477 Ga0209233_10254772 351
1718 3300025271 Ga0207666_1000037 Ga0207666_100003714 351
1719 3300025271 Ga0207666_1000419 Ga0207666_10004193 351
1720 3300025272 Ga0209455_1000238 Ga0209455_10002387 351
1721 3300025272 Ga0209455_1001687 Ga0209455_10016872 351
1722 3300025272 Ga0209455_1002135 Ga0209455_10021353 351
1723 3300025272 Ga0209455_1009858 Ga0209455_10098583 351
1724 3300025284 Ga0209130_1001022 Ga0209130_10010227 351
1725 3300025290 Ga0207673_1000102 Ga0207673_10001025 351
1726 3300025291 Ga0209675_1000633 Ga0209675_10006335 351
1727 3300025292 Ga0209676_1003848 Ga0209676_10038484 351
1728 3300025294 Ga0209025_1000017 Ga0209025_1000017202 351
1729 3300025294 Ga0209025_1000227 Ga0209025_1000227104 351
1730 3300025294 Ga0209025_1015469 Ga0209025_10154694 351
1731 3300025294 Ga0209025_1015993 Ga0209025_10159932 351
1732 3300025295 Ga0209564_1000031 Ga0209564_100003111 351
1733 3300025295 Ga0209564_1000082 Ga0209564_100008214 351
1734 3300025295 Ga0209564_1001979 Ga0209564_100197915 351
1735 3300025295 Ga0209564_1016460 Ga0209564_10164603 351
1736 3300025297 Ga0209758_1000140 Ga0209758_10001408 351
1737 3300025297 Ga0209758_1001460 Ga0209758_10014605 351
1738 3300025297 Ga0209758_1002072 Ga0209758_10020727 351
1739 3300025297 Ga0209758_1003468 Ga0209758_10034684 351
1740 3300025297 Ga0209758_1006144 Ga0209758_10061443 351
1741 3300025297 Ga0209758_1011521 Ga0209758_10115211 351
1742 3300025298 Ga0209050_1000142 Ga0209050_100014237 351
1743 3300025299 Ga0209256_1000033 Ga0209256_1000033135 351
1744 3300025299 Ga0209256_1000130 Ga0209256_1000130114 351
1745 3300025299 Ga0209256_1001059 Ga0209256_100105913 351
1746 3300025299 Ga0209256_1004348 Ga0209256_10043486 351
1747 3300025299 Ga0209256_1031562 Ga0209256_10315622 351
1748 3300025302 Ga0207426_1000434 Ga0207426_100043452 351
1749 3300025302 Ga0207426_1000855 Ga0207426_100085528 351
1750 3300025302 Ga0207426_1018849 Ga0207426_10188493 351
1751 3300025302 Ga0207426_1025686 Ga0207426_10256862 351
1752 3300025303 Ga0209051_1000035 Ga0209051_1000035146 351
1753 3300025303 Ga0209051_1000544 Ga0209051_100054438 351
1754 3300025304 Ga0209257_1000494 Ga0209257_100049450 351
1755 3300025304 Ga0209257_1001932 Ga0209257_100193215 351
1756 3300025315 Ga0207697_10000293 Ga0207697_1000029321 351
1757 3300025321 Ga0207656_10005412 Ga0207656_100054124 351
1758 3300025321 Ga0207656_10009022 Ga0207656_100090222 351
1759 3300025735 Ga0207713_1029023 Ga0207713_10290231 351
1760 3300025885 Ga0207653_10016484 Ga0207653_100164842 351
1761 3300025893 Ga0207682_10000081 Ga0207682_1000008110 351
1762 3300025893 Ga0207682_10001282 Ga0207682_100012822 351
1763 3300025898 Ga0207692_10000504 Ga0207692_100005044 351
1764 3300025898 Ga0207692_10013638 Ga0207692_100136383 351
1765 3300025898 Ga0207692_10014597 Ga0207692_100145972 351
1766 3300025898 Ga0207692_10030702 Ga0207692_100307021 351
1767 3300025898 Ga0207692_10038782 Ga0207692_100387822 351
1768 3300025898 Ga0207692_10040515 Ga0207692_100405152 351
1769 3300025898 Ga0207692_10119510 Ga0207692_101195101 351
1770 3300025899 Ga0207642_10004660 Ga0207642_100046603 351
1771 3300025899 Ga0207642_10005716 Ga0207642_100057162 351
1772 3300025899 Ga0207642_10063847 Ga0207642_100638472 351
1773 3300025900 Ga0207710_10006913 Ga0207710_100069133 351
1774 3300025900 Ga0207710_10048821 Ga0207710_100488212 351
1775 3300025901 Ga0207688_10000487 Ga0207688_100004873 351
1776 3300025901 Ga0207688_10002068 Ga0207688_100020683 351
1777 3300025903 Ga0207680_10119664 Ga0207680_101196641 351
1778 3300025903 Ga0207680_10129668 Ga0207680_101296681 351
1779 3300025904 Ga0207647_10001362 Ga0207647_1000136214 351
1780 3300025904 Ga0207647_10004059 Ga0207647_100040598 351
1781 3300025904 Ga0207647_10007664 Ga0207647_100076646 351
1782 3300025904 Ga0207647_10010142 Ga0207647_100101428 351
1783 3300025904 Ga0207647_10013913 Ga0207647_100139134 351
1784 3300025904 Ga0207647_10024727 Ga0207647_100247272 351
1785 3300025904 Ga0207647_10125778 Ga0207647_101257782 351
1786 3300025905 Ga0207685_10061965 Ga0207685_100619652 351
1787 3300025905 Ga0207685_10078370 Ga0207685_100783701 351
1788 3300025906 Ga0207699_10000508 Ga0207699_1000050810 351
1789 3300025906 Ga0207699_10010294 Ga0207699_100102942 351
1790 3300025906 Ga0207699_10014968 Ga0207699_100149682 351
1791 3300025907 Ga0207645_10000792 Ga0207645_100007923 351
1792 3300025907 Ga0207645_10007259 Ga0207645_100072592 351
1793 3300025907 Ga0207645_10017134 Ga0207645_100171342 351
1794 3300025907 Ga0207645_10029304 Ga0207645_100293042 351
1795 3300025908 Ga0207643_10000392 Ga0207643_100003923 351
1796 3300025908 Ga0207643_10000657 Ga0207643_100006572 351
1797 3300025909 Ga0207705_10035072 Ga0207705_100350722 351
1798 3300025909 Ga0207705_10075031 Ga0207705_100750312 351
1799 3300025910 Ga0207684_10036233 Ga0207684_100362333 351
1800 3300025911 Ga0207654_10002172 Ga0207654_100021723 351
1801 3300025911 Ga0207654_10023733 Ga0207654_100237334 351
1802 3300025911 Ga0207654_10049566 Ga0207654_100495662 351
1803 3300025911 Ga0207654_10064204 Ga0207654_100642042 351
1804 3300025912 Ga0207707_10002890 Ga0207707_1000289010 351
1805 3300025912 Ga0207707_10005173 Ga0207707_100051736 351
1806 3300025912 Ga0207707_10011983 Ga0207707_100119834 351
1807 3300025912 Ga0207707_10018389 Ga0207707_100183893 351
1808 3300025912 Ga0207707_10021037 Ga0207707_100210373 351
1809 3300025912 Ga0207707_10028853 Ga0207707_100288536 351
1810 3300025912 Ga0207707_10043434 Ga0207707_100434342 351
1811 3300025912 Ga0207707_10089849 Ga0207707_100898492 351
1812 3300025912 Ga0207707_10116613 Ga0207707_101166131 351
1813 3300025912 Ga0207707_10123314 Ga0207707_101233142 351
1814 3300025912 Ga0207707_10164977 Ga0207707_101649772 351
1815 3300025912 Ga0207707_10215466 Ga0207707_102154662 351
1816 3300025912 Ga0207707_10219240 Ga0207707_102192402 351
1817 3300025912 Ga0207707_10301618 Ga0207707_103016182 351
1818 3300025913 Ga0207695_10000008 Ga0207695_1000000850 351
1819 3300025913 Ga0207695_10005095 Ga0207695_100050959 351
1820 3300025913 Ga0207695_10012818 Ga0207695_100128183 351
1821 3300025913 Ga0207695_10030124 Ga0207695_100301243 351
1822 3300025913 Ga0207695_10034276 Ga0207695_100342762 351
1823 3300025913 Ga0207695_10079160 Ga0207695_100791602 351
1824 3300025913 Ga0207695_10140481 Ga0207695_101404812 351
1825 3300025913 Ga0207695_10198453 Ga0207695_101984531 351
1826 3300025914 Ga0207671_10003541 Ga0207671_1000354111 351
1827 3300025914 Ga0207671_10018613 Ga0207671_100186133 351
1828 3300025914 Ga0207671_10040346 Ga0207671_100403463 351
1829 3300025914 Ga0207671_10043529 Ga0207671_100435292 351
1830 3300025915 Ga0207693_10000581 Ga0207693_100005816 351
1831 3300025915 Ga0207693_10002467 Ga0207693_100024676 351
1832 3300025915 Ga0207693_10002907 Ga0207693_1000290711 351
1833 3300025915 Ga0207693_10004238 Ga0207693_100042388 351
1834 3300025915 Ga0207693_10004411 Ga0207693_100044115 351
1835 3300025915 Ga0207693_10008804 Ga0207693_100088042 351
1836 3300025915 Ga0207693_10011407 Ga0207693_100114073 351
1837 3300025915 Ga0207693_10027698 Ga0207693_100276982 351
1838 3300025915 Ga0207693_10051877 Ga0207693_100518772 351
1839 3300025915 Ga0207693_10070059 Ga0207693_100700592 351
1840 3300025915 Ga0207693_10081644 Ga0207693_100816442 351
1841 3300025915 Ga0207693_10118274 Ga0207693_101182742 351
1842 3300025916 Ga0207663_10000084 Ga0207663_1000008423 351
1843 3300025916 Ga0207663_10000732 Ga0207663_100007326 351
1844 3300025916 Ga0207663_10020836 Ga0207663_100208364 351
1845 3300025917 Ga0207660_10007083 Ga0207660_100070833 351
1846 3300025917 Ga0207660_10015824 Ga0207660_100158242 351
1847 3300025917 Ga0207660_10026809 Ga0207660_100268091 351
1848 3300025917 Ga0207660_10036904 Ga0207660_100369042 351
1849 3300025917 Ga0207660_10080994 Ga0207660_100809942 351
1850 3300025917 Ga0207660_10167024 Ga0207660_101670241 351
1851 3300025917 Ga0207660_10185145 Ga0207660_101851451 351
1852 3300025918 Ga0207662_10003086 Ga0207662_100030867 351
1853 3300025918 Ga0207662_10013452 Ga0207662_100134523 351
1854 3300025918 Ga0207662_10038307 Ga0207662_100383071 351
1855 3300025919 Ga0207657_10001069 Ga0207657_1000106913 351
1856 3300025919 Ga0207657_10004955 Ga0207657_1000495512 351
1857 3300025919 Ga0207657_10047517 Ga0207657_100475172 351
1858 3300025919 Ga0207657_10061319 Ga0207657_100613192 351
1859 3300025919 Ga0207657_10070879 Ga0207657_100708792 351
1860 3300025919 Ga0207657_10141441 Ga0207657_101414412 351
1861 3300025920 Ga0207649_10001901 Ga0207649_100019013 351
1862 3300025920 Ga0207649_10032314 Ga0207649_100323143 351
1863 3300025921 Ga0207652_10006216 Ga0207652_100062166 351
1864 3300025921 Ga0207652_10011506 Ga0207652_100115069 351
1865 3300025921 Ga0207652_10019271 Ga0207652_100192713 351
1866 3300025921 Ga0207652_10024457 Ga0207652_100244572 351
1867 3300025921 Ga0207652_10024840 Ga0207652_100248404 351
1868 3300025921 Ga0207652_10149044 Ga0207652_101490442 351
1869 3300025922 Ga0207646_10083857 Ga0207646_100838571 351
1870 3300025923 Ga0207681_10000738 Ga0207681_100007386 351
1871 3300025923 Ga0207681_10204761 Ga0207681_102047612 351
1872 3300025923 Ga0207681_10264669 Ga0207681_102646691 351
1873 3300025924 Ga0207694_10000050 Ga0207694_10000050126 351
1874 3300025924 Ga0207694_10000110 Ga0207694_1000011012 351
1875 3300025924 Ga0207694_10011528 Ga0207694_100115287 351
1876 3300025924 Ga0207694_10035357 Ga0207694_100353571 351
1877 3300025924 Ga0207694_10065780 Ga0207694_100657802 351
1878 3300025924 Ga0207694_10135037 Ga0207694_101350371 351
1879 3300025924 Ga0207694_10258981 Ga0207694_102589812 351
1880 3300025925 Ga0207650_10002215 Ga0207650_100022152 351
1881 3300025925 Ga0207650_10005378 Ga0207650_100053785 351
1882 3300025925 Ga0207650_10010692 Ga0207650_100106923 351
1883 3300025925 Ga0207650_10178404 Ga0207650_101784041 351
1884 3300025926 Ga0207659_10000288 Ga0207659_100002883 351
1885 3300025926 Ga0207659_10034549 Ga0207659_100345491 351
1886 3300025926 Ga0207659_10039801 Ga0207659_100398013 351
1887 3300025926 Ga0207659_10044513 Ga0207659_100445132 351
1888 3300025927 Ga0207687_10000520 Ga0207687_1000052020 351
1889 3300025927 Ga0207687_10007944 Ga0207687_100079442 351
1890 3300025927 Ga0207687_10047813 Ga0207687_100478133 351
1891 3300025927 Ga0207687_10185784 Ga0207687_101857841 351
1892 3300025927 Ga0207687_10208913 Ga0207687_102089132 351
1893 3300025928 Ga0207700_10003137 Ga0207700_100031372 351
1894 3300025928 Ga0207700_10008693 Ga0207700_100086932 351
1895 3300025928 Ga0207700_10015401 Ga0207700_100154013 351
1896 3300025928 Ga0207700_10018117 Ga0207700_100181172 351
1897 3300025928 Ga0207700_10020581 Ga0207700_100205812 351
1898 3300025928 Ga0207700_10073707 Ga0207700_100737072 351
1899 3300025928 Ga0207700_10084327 Ga0207700_100843272 351
1900 3300025928 Ga0207700_10101369 Ga0207700_101013692 351
1901 3300025928 Ga0207700_10120743 Ga0207700_101207431 351
1902 3300025929 Ga0207664_10016357 Ga0207664_100163574 351
1903 3300025929 Ga0207664_10018977 Ga0207664_100189773 351
1904 3300025929 Ga0207664_10029248 Ga0207664_100292482 351
1905 3300025929 Ga0207664_10039092 Ga0207664_100390924 351
1906 3300025929 Ga0207664_10054997 Ga0207664_100549972 351
1907 3300025929 Ga0207664_10083524 Ga0207664_100835242 351
1908 3300025929 Ga0207664_10160779 Ga0207664_101607792 351
1909 3300025931 Ga0207644_10006166 Ga0207644_100061667 351
1910 3300025931 Ga0207644_10009382 Ga0207644_100093826 351
1911 3300025931 Ga0207644_10010162 Ga0207644_100101624 351
1912 3300025931 Ga0207644_10020651 Ga0207644_100206512 351
1913 3300025931 Ga0207644_10066682 Ga0207644_100666823 351
1914 3300025932 Ga0207690_10000953 Ga0207690_100009533 351
1915 3300025932 Ga0207690_10020076 Ga0207690_100200763 351
1916 3300025932 Ga0207690_10051950 Ga0207690_100519502 351
1917 3300025932 Ga0207690_10105442 Ga0207690_101054421 351
1918 3300025933 Ga0207706_10009006 Ga0207706_100090063 351
1919 3300025933 Ga0207706_10020589 Ga0207706_100205893 351
1920 3300025933 Ga0207706_10022836 Ga0207706_100228363 351
1921 3300025933 Ga0207706_10025278 Ga0207706_100252783 351
1922 3300025933 Ga0207706_10026762 Ga0207706_100267623 351
1923 3300025933 Ga0207706_10034150 Ga0207706_100341503 351
1924 3300025934 Ga0207686_10004859 Ga0207686_100048594 351
1925 3300025935 Ga0207709_10004590 Ga0207709_100045903 351
1926 3300025935 Ga0207709_10009427 Ga0207709_100094274 351
1927 3300025935 Ga0207709_10092041 Ga0207709_100920412 351
1928 3300025936 Ga0207670_10000731 Ga0207670_100007318 351
1929 3300025936 Ga0207670_10002332 Ga0207670_100023323 351
1930 3300025936 Ga0207670_10016264 Ga0207670_100162644 351
1931 3300025936 Ga0207670_10085361 Ga0207670_100853612 351
1932 3300025936 Ga0207670_10096410 Ga0207670_100964102 351
1933 3300025937 Ga0207669_10000538 Ga0207669_1000053812 351
1934 3300025937 Ga0207669_10007894 Ga0207669_100078942 351
1935 3300025937 Ga0207669_10014485 Ga0207669_100144852 351
1936 3300025937 Ga0207669_10020048 Ga0207669_100200481 351
1937 3300025938 Ga0207704_10001761 Ga0207704_100017612 351
1938 3300025938 Ga0207704_10008415 Ga0207704_100084153 351
1939 3300025938 Ga0207704_10118292 Ga0207704_101182922 351
1940 3300025938 Ga0207704_10131047 Ga0207704_101310471 351
1941 3300025938 Ga0207704_10185300 Ga0207704_101853001 351
1942 3300025939 Ga0207665_10001296 Ga0207665_1000129615 351
1943 3300025939 Ga0207665_10001463 Ga0207665_100014632 351
1944 3300025939 Ga0207665_10002892 Ga0207665_1000289210 351
1945 3300025939 Ga0207665_10003511 Ga0207665_100035112 351
1946 3300025939 Ga0207665_10017491 Ga0207665_100174912 351
1947 3300025939 Ga0207665_10024541 Ga0207665_100245412 351
1948 3300025939 Ga0207665_10125079 Ga0207665_101250792 351
1949 3300025940 Ga0207691_10001399 Ga0207691_1000139911 351
1950 3300025940 Ga0207691_10001984 Ga0207691_100019843 351
1951 3300025940 Ga0207691_10018717 Ga0207691_100187173 351
1952 3300025940 Ga0207691_10048406 Ga0207691_100484063 351
1953 3300025941 Ga0207711_10002344 Ga0207711_1000234410 351
1954 3300025941 Ga0207711_10010081 Ga0207711_100100815 351
1955 3300025941 Ga0207711_10022179 Ga0207711_100221792 351
1956 3300025941 Ga0207711_10024759 Ga0207711_100247593 351
1957 3300025941 Ga0207711_10034149 Ga0207711_100341493 351
1958 3300025942 Ga0207689_10000503 Ga0207689_1000050313 351
1959 3300025942 Ga0207689_10003495 Ga0207689_100034958 351
1960 3300025942 Ga0207689_10010214 Ga0207689_100102143 351
1961 3300025944 Ga0207661_10001274 Ga0207661_1000127415 351
1962 3300025944 Ga0207661_10036312 Ga0207661_100363123 351
1963 3300025944 Ga0207661_10044111 Ga0207661_100441112 351
1964 3300025945 Ga0207679_10007046 Ga0207679_100070464 351
1965 3300025945 Ga0207679_10093556 Ga0207679_100935562 351
1966 3300025945 Ga0207679_10159422 Ga0207679_101594222 351
1967 3300025949 Ga0207667_10005244 Ga0207667_1000524416 351
1968 3300025949 Ga0207667_10006325 Ga0207667_100063254 351
1969 3300025949 Ga0207667_10012846 Ga0207667_100128467 351
1970 3300025949 Ga0207667_10021610 Ga0207667_100216103 351
1971 3300025949 Ga0207667_10046023 Ga0207667_100460234 351
1972 3300025949 Ga0207667_10054142 Ga0207667_100541424 351
1973 3300025949 Ga0207667_10115861 Ga0207667_101158611 351
1974 3300025960 Ga0207651_10012345 Ga0207651_100123453 351
1975 3300025960 Ga0207651_10012534 Ga0207651_100125343 351
1976 3300025960 Ga0207651_10014181 Ga0207651_100141813 351
1977 3300025960 Ga0207651_10040996 Ga0207651_100409962 351
1978 3300025960 Ga0207651_10104472 Ga0207651_101044722 351
1979 3300025961 Ga0207712_10001942 Ga0207712_100019422 351
1980 3300025961 Ga0207712_10005326 Ga0207712_100053263 351
1981 3300025961 Ga0207712_10028620 Ga0207712_100286203 351
1982 3300025961 Ga0207712_10239083 Ga0207712_102390831 351
1983 3300025972 Ga0207668_10003473 Ga0207668_100034732 351
1984 3300025972 Ga0207668_10025269 Ga0207668_100252692 351
1985 3300025972 Ga0207668_10028713 Ga0207668_100287133 351
1986 3300025972 Ga0207668_10045029 Ga0207668_100450293 351
1987 3300025972 Ga0207668_10057581 Ga0207668_100575812 351
1988 3300025981 Ga0207640_10007626 Ga0207640_100076261 351
1989 3300025981 Ga0207640_10046659 Ga0207640_100466592 351
1990 3300025981 Ga0207640_10050100 Ga0207640_100501002 351
1991 3300025986 Ga0207658_10012739 Ga0207658_100127393 351
1992 3300025986 Ga0207658_10349489 Ga0207658_103494891 351
1993 3300026023 Ga0207677_10002538 Ga0207677_100025383 351
1994 3300026023 Ga0207677_10047395 Ga0207677_100473952 351
1995 3300026023 Ga0207677_10096948 Ga0207677_100969481 351
1996 3300026035 Ga0207703_10013028 Ga0207703_100130283 351
1997 3300026035 Ga0207703_10064594 Ga0207703_100645943 351
1998 3300026035 Ga0207703_10113385 Ga0207703_101133852 351
1999 3300026041 Ga0207639_10002783 Ga0207639_100027833 351
2000 3300026041 Ga0207639_10008102 Ga0207639_100081022 351
2001 3300026041 Ga0207639_10009386 Ga0207639_100093862 351
2002 3300026041 Ga0207639_10010395 Ga0207639_100103954 351
2003 3300026041 Ga0207639_10150609 Ga0207639_101506092 351
2004 3300026041 Ga0207639_10216561 Ga0207639_102165612 351
2005 3300026067 Ga0207678_10001725 Ga0207678_1000172514 351
2006 3300026067 Ga0207678_10004088 Ga0207678_100040884 351
2007 3300026067 Ga0207678_10009392 Ga0207678_100093925 351
2008 3300026067 Ga0207678_10027585 Ga0207678_100275852 351
2009 3300026067 Ga0207678_10048870 Ga0207678_100488703 351
2010 3300026067 Ga0207678_10069767 Ga0207678_100697673 351
2011 3300026067 Ga0207678_10104634 Ga0207678_101046342 351
2012 3300026067 Ga0207678_10147494 Ga0207678_101474942 351
2013 3300026075 Ga0207708_10000547 Ga0207708_1000054713 351
2014 3300026075 Ga0207708_10004170 Ga0207708_100041706 351
2015 3300026075 Ga0207708_10007309 Ga0207708_100073097 351
2016 3300026078 Ga0207702_10000002 Ga0207702_10000002236 351
2017 3300026078 Ga0207702_10000126 Ga0207702_1000012678 351
2018 3300026078 Ga0207702_10023264 Ga0207702_100232643 351
2019 3300026078 Ga0207702_10032072 Ga0207702_100320722 351
2020 3300026078 Ga0207702_10061307 Ga0207702_100613072 351
2021 3300026078 Ga0207702_10236649 Ga0207702_102366491 351
2022 3300026088 Ga0207641_10003985 Ga0207641_100039852 351
2023 3300026089 Ga0207648_10001178 Ga0207648_100011786 351
2024 3300026089 Ga0207648_10001416 Ga0207648_1000141620 351
2025 3300026089 Ga0207648_10038200 Ga0207648_100382004 351
2026 3300026089 Ga0207648_10045343 Ga0207648_100453433 351
2027 3300026089 Ga0207648_10098110 Ga0207648_100981102 351
2028 3300026089 Ga0207648_10125780 Ga0207648_101257802 351
2029 3300026089 Ga0207648_10126834 Ga0207648_101268342 351
2030 3300026095 Ga0207676_10001299 Ga0207676_100012993 351
2031 3300026095 Ga0207676_10002095 Ga0207676_100020953 351
2032 3300026095 Ga0207676_10054111 Ga0207676_100541112 351
2033 3300026095 Ga0207676_10071537 Ga0207676_100715373 351
2034 3300026095 Ga0207676_10100799 Ga0207676_101007991 351
2035 3300026095 Ga0207676_10167048 Ga0207676_101670482 351
2036 3300026095 Ga0207676_10417416 Ga0207676_104174161 351
2037 3300026116 Ga0207674_10007592 Ga0207674_100075924 351
2038 3300026116 Ga0207674_10042017 Ga0207674_100420173 351
2039 3300026116 Ga0207674_10046689 Ga0207674_100466894 351
2040 3300026116 Ga0207674_10079786 Ga0207674_100797863 351
2041 3300026116 Ga0207674_10086147 Ga0207674_100861472 351
2042 3300026116 Ga0207674_10204712 Ga0207674_102047123 351
2043 3300026116 Ga0207674_10355247 Ga0207674_103552471 351
2044 3300026118 Ga0207675_100000190 Ga0207675_10000019038 351
2045 3300026118 Ga0207675_100002065 Ga0207675_10000206514 351
2046 3300026118 Ga0207675_100016489 Ga0207675_1000164897 351
2047 3300026118 Ga0207675_100023453 Ga0207675_1000234534 351
2048 3300026121 Ga0207683_10000069 Ga0207683_1000006948 351
2049 3300026121 Ga0207683_10002867 Ga0207683_1000286712 351
2050 3300026121 Ga0207683_10014712 Ga0207683_100147123 351
2051 3300026121 Ga0207683_10020473 Ga0207683_100204733 351
2052 3300026121 Ga0207683_10042619 Ga0207683_100426192 351
2053 3300026121 Ga0207683_10073526 Ga0207683_100735262 351
2054 3300026121 Ga0207683_10078716 Ga0207683_100787162 351
2055 3300026121 Ga0207683_10088268 Ga0207683_100882682 351
2056 3300026121 Ga0207683_10092545 Ga0207683_100925452 351
2057 3300026121 Ga0207683_10113164 Ga0207683_101131643 351
2058 3300026142 Ga0207698_10006596 Ga0207698_100065964 351
2059 3300026142 Ga0207698_10027648 Ga0207698_100276484 351
2060 3300026142 Ga0207698_10029389 Ga0207698_100293893 351
2061 3300026142 Ga0207698_10073697 Ga0207698_100736973 351
2062 3300026142 Ga0207698_10110754 Ga0207698_101107542 351
2063 3300027111 Ga0209281_1000076 Ga0209281_100007628 351
2064 3300027111 Ga0209281_1000128 Ga0209281_100012838 351
2065 3300027111 Ga0209281_1000496 Ga0209281_100049636 351
2066 3300027111 Ga0209281_1007629 Ga0209281_10076291 351
2067 3300027296 Ga0209389_1000040 Ga0209389_100004064 351
2068 3300027296 Ga0209389_1000123 Ga0209389_100012337 351
2069 3300027312 Ga0209371_1000022 Ga0209371_1000022506 351
2070 3300027312 Ga0209371_1002845 Ga0209371_10028452 351
2071 3300027357 Ga0209589_1000001 Ga0209589_1000001208 351
2072 3300027357 Ga0209589_1000036 Ga0209589_100003637 351
2073 3300027360 Ga0209969_1002406 Ga0209969_10024062 351
2074 3300027361 Ga0209489_100001 Ga0209489_100001208 351
2075 3300027361 Ga0209489_100006 Ga0209489_100006365 351
2076 3300027363 Ga0209700_100001 Ga0209700_100001208 351
2077 3300027363 Ga0209700_100005 Ga0209700_100005235 351
2078 3300027543 Ga0209999_1003561 Ga0209999_10035612 351
2079 3300027617 Ga0210002_1001002 Ga0210002_10010023 351
2080 3300027666 Ga0209282_1000039 Ga0209282_100003961 351
2081 3300027666 Ga0209282_1000100 Ga0209282_100010029 351
2082 3300027682 Ga0209971_1004787 Ga0209971_10047872 351
2083 3300027695 Ga0209966_1000576 Ga0209966_10005766 351
2084 3300027717 Ga0209998_10000606 Ga0209998_100006063 351
2085 3300027717 Ga0209998_10002913 Ga0209998_100029132 351
2086 3300027866 Ga0209813_10013666 Ga0209813_100136661 351
2087 3300027876 Ga0209974_10046815 Ga0209974_100468152 351
2088 3300027907 Ga0207428_10000198 Ga0207428_1000019857 351
2089 3300027907 Ga0207428_10000312 Ga0207428_1000031237 351
2090 3300027907 Ga0207428_10000578 Ga0207428_1000057811 351
2091 3300027907 Ga0207428_10000908 Ga0207428_1000090821 351
2092 3300027907 Ga0207428_10008834 Ga0207428_100088343 351
2093 3300027907 Ga0207428_10051612 Ga0207428_100516122 351
2094 3300028379 Ga0268266_10059811 Ga0268266_100598113 351
2095 3300028379 Ga0268266_10103610 Ga0268266_101036102 351
2096 3300028379 Ga0268266_10173694 Ga0268266_101736941 351
2097 3300028380 Ga0268265_10065606 Ga0268265_100656062 351
2098 3300028381 Ga0268264_10000065 Ga0268264_10000065235 351
2099 3300028381 Ga0268264_10004307 Ga0268264_100043073 351
2100 3300028381 Ga0268264_10051309 Ga0268264_100513091 351
2101 3300028556 Ga0265337_1002249 Ga0265337_10022497 351
2102 3300028556 Ga0265337_1002492 Ga0265337_10024926 351
2103 3300028558 Ga0265326_10011167 Ga0265326_100111672 351
2104 3300028573 Ga0265334_10001756 Ga0265334_100017568 351
2105 3300028573 Ga0265334_10032169 Ga0265334_100321692 351
2106 3300028577 Ga0265318_10004183 Ga0265318_100041831 351
2107 3300028653 Ga0265323_10001892 Ga0265323_100018922 351
2108 3300028654 Ga0265322_10019041 Ga0265322_100190412 351
2109 3300028666 Ga0265336_10001788 Ga0265336_100017884 351
2110 3300028786 Ga0307517_10000008 Ga0307517_100000082 351
2111 3300028800 Ga0265338_10000321 Ga0265338_100003217 351
2112 3300028800 Ga0265338_10022608 Ga0265338_100226084 351
2113 3300028800 Ga0265338_10033094 Ga0265338_100330945 351
2114 3300028800 Ga0265338_10143091 Ga0265338_101430912 351
2115 3300029957 Ga0265324_10002078 Ga0265324_100020787 351
2116 3300030500 Ga0268256_1000019 Ga0268256_100001914 351
2117 3300030500 Ga0268256_1004441 Ga0268256_10044415 351
2118 3300030521 Ga0307511_10075112 Ga0307511_100751122 351
2119 3300030744 Ga0316181_1006667 Ga0316181_10066672 351
2120 3300031090 Ga0265760_10014211 Ga0265760_100142112 351
2121 3300031238 Ga0265332_10004954 Ga0265332_100049543 351
2122 3300031240 Ga0265320_10042368 Ga0265320_100423682 351
2123 3300031241 Ga0265325_10000004 Ga0265325_100000049 351
2124 3300031241 Ga0265325_10000172 Ga0265325_1000017216 351
2125 3300031241 Ga0265325_10003859 Ga0265325_100038595 351
2126 3300031241 Ga0265325_10005573 Ga0265325_100055733 351
2127 3300031241 Ga0265325_10008790 Ga0265325_100087903 351
2128 3300031241 Ga0265325_10023370 Ga0265325_100233703 351
2129 3300031241 Ga0265325_10082433 Ga0265325_100824331 351
2130 3300031247 Ga0265340_10000674 Ga0265340_100006744 351
2131 3300031247 Ga0265340_10013956 Ga0265340_100139562 351
2132 3300031247 Ga0265340_10017773 Ga0265340_100177732 351
2133 3300031247 Ga0265340_10034740 Ga0265340_100347402 351
2134 3300031247 Ga0265340_10038971 Ga0265340_100389712 351
2135 3300031247 Ga0265340_10047672 Ga0265340_100476722 351
2136 3300031249 Ga0265339_10000330 Ga0265339_1000033020 351
2137 3300031249 Ga0265339_10003099 Ga0265339_100030993 351
2138 3300031249 Ga0265339_10004140 Ga0265339_100041406 351
2139 3300031249 Ga0265339_10009592 Ga0265339_100095926 351
2140 3300031250 Ga0265331_10022871 Ga0265331_100228711 351
2141 3300031344 Ga0265316_10057734 Ga0265316_100577342 351
2142 3300031344 Ga0265316_10114951 Ga0265316_101149512 351
2143 3300031344 Ga0265316_10245546 Ga0265316_102455461 351
2144 3300031456 Ga0307513_10002722 Ga0307513_100027223 351
2145 3300031456 Ga0307513_10035190 Ga0307513_100351904 351
2146 3300031456 Ga0307513_10102323 Ga0307513_101023231 351
2147 3300031456 Ga0307513_10322657 Ga0307513_103226571 351
2148 3300031507 Ga0307509_10089892 Ga0307509_100898924 351
2149 3300031507 Ga0307509_10244860 Ga0307509_102448602 351
2150 3300031548 Ga0307408_100090426 Ga0307408_1000904262 351
2151 3300031595 Ga0265313_10000176 Ga0265313_1000017624 351
2152 3300031595 Ga0265313_10000572 Ga0265313_1000057220 351
2153 3300031595 Ga0265313_10002253 Ga0265313_100022534 351
2154 3300031595 Ga0265313_10016010 Ga0265313_100160102 351
2155 3300031595 Ga0265313_10016397 Ga0265313_100163973 351
2156 3300031595 Ga0265313_10042830 Ga0265313_100428301 351
2157 3300031595 Ga0265313_10087204 Ga0265313_100872042 351
2158 3300031616 Ga0307508_10000018 Ga0307508_10000018109 351
2159 3300031616 Ga0307508_10080781 Ga0307508_100807812 351
2160 3300031616 Ga0307508_10158279 Ga0307508_101582792 351
2161 3300031665 Ga0316575_10041734 Ga0316575_100417342 351
2162 3300031711 Ga0265314_10001133 Ga0265314_1000113322 351
2163 3300031711 Ga0265314_10002100 Ga0265314_1000210012 351
2164 3300031711 Ga0265314_10009137 Ga0265314_100091377 351
2165 3300031711 Ga0265314_10024621 Ga0265314_100246213 351
2166 3300031711 Ga0265314_10088673 Ga0265314_100886732 351
2167 3300031712 Ga0265342_10000148 Ga0265342_1000014868 351
2168 3300031712 Ga0265342_10000196 Ga0265342_1000019624 351
2169 3300031712 Ga0265342_10005459 Ga0265342_100054596 351
2170 3300031712 Ga0265342_10015115 Ga0265342_100151152 351
2171 3300031730 Ga0307516_10014561 Ga0307516_100145616 351
2172 3300031730 Ga0307516_10066954 Ga0307516_100669542 351
2173 3300031730 Ga0307516_10071784 Ga0307516_100717842 351
2174 3300031824 Ga0307413_10005951 Ga0307413_100059512 351
2175 3300031852 Ga0307410_10006626 Ga0307410_100066266 351
2176 3300031852 Ga0307410_10151734 Ga0307410_101517342 351
2177 3300031901 Ga0307406_10062745 Ga0307406_100627452 351
2178 3300031903 Ga0307407_10105260 Ga0307407_101052602 351
2179 3300031903 Ga0307407_10143414 Ga0307407_101434142 351
2180 3300031911 Ga0307412_10001651 Ga0307412_100016516 351
2181 3300031911 Ga0307412_10165201 Ga0307412_101652012 351
2182 3300031967 Ga0315914_1000010 Ga0315914_100001010 351
2183 3300031995 Ga0307409_100107636 Ga0307409_1001076363 351
2184 3300031995 Ga0307409_100157231 Ga0307409_1001572312 351
2185 3300031995 Ga0307409_100276336 Ga0307409_1002763362 351
2186 3300032004 Ga0307414_10031373 Ga0307414_100313733 351
2187 3300032004 Ga0307414_10070407 Ga0307414_100704072 351
2188 3300032005 Ga0307411_10041309 Ga0307411_100413093 351
2189 3300032005 Ga0307411_10229286 Ga0307411_102292861 351
2190 3300033179 Ga0307507_10024914 Ga0307507_100249142 351
2191 3300033180 Ga0307510_10002813 Ga0307510_1000281325 351
2192 3300033180 Ga0307510_10020196 Ga0307510_100201968 351
2193 3300033180 Ga0307510_10061161 Ga0307510_100611611 351
2194 3300033180 Ga0307510_10067745 Ga0307510_100677453 351
2195 3300033430 Ga0315913_1000005 Ga0315913_100000510 351
2196 3300033442 Ga0315911_1000006 Ga0315911_1000006314 351
2197 3300033464 Ga0315915_1000012 Ga0315915_1000012153 351
2198 3300034816 Ga0373930_0000062 Ga0373930_0000062_366_1532 351
2199 3300034817 Ga0373948_0000051 Ga0373948_0000051_211_1377 351
2200 3300034818 Ga0373950_0000418 Ga0373950_0000418_3152_4318 351
2201 3300034818 Ga0373950_0001085 Ga0373950_0001085_224_1390 351
2202 3300034818 Ga0373950_0002232 Ga0373950_0002232_67_1233 351
2203 3300034819 Ga0373958_0000123 Ga0373958_0000123_60_1226 351
2204 3300034820 Ga0373959_0000191 Ga0373959_0000191_5417_6583 351
2205 3300034957 Ga0373938_0000141 Ga0373938_0000141_835_2001 351
2206 3300034957 Ga0373938_0000287 Ga0373938_0000287_6742_7908 351
2207 3300035083 Ga0373926_0014543 Ga0373926_0014543_457_1623 351
2208 3300035083 Ga0373926_0023841 Ga0373926_0023841_189_1355 351
2209 3300035084 Ga0373928_0003217 Ga0373928_0003217_640_1806 351
2210 3300035085 Ga0373929_0001387 Ga0373929_0001387_897_2063 351
2211 3300035085 Ga0373929_0012687 Ga0373929_0012687_11_1180 351
2212 3300035086 Ga0373934_0004739 Ga0373934_0004739_2754_3920 351
2213 3300035086 Ga0373934_0011693 Ga0373934_0011693_1409_2578 351
2214 3300035086 Ga0373934_0070997 Ga0373934_0070997_82_1248 351
2215 3300035088 Ga0373940_0000365 Ga0373940_0000365_4427_5593 351
2216 3300035088 Ga0373940_0008793 Ga0373940_0008793_648_1814 351
2217 3300035089 Ga0373944_0003497 Ga0373944_0003497_28_1194 351
2218 3300035089 Ga0373944_0009077 Ga0373944_0009077_1320_2486 351
2219 3300035089 Ga0373944_0037297 Ga0373944_0037297_40_1206 351
2220 3300035090 Ga0373949_0004024 Ga0373949_0004024_162_1328 351
2221 3300035090 Ga0373949_0007442 Ga0373949_0007442_93_1259 351
2222 3300035091 Ga0373951_0001019 Ga0373951_0001019_3381_4547 351
2223 3300035092 Ga0373952_0000465 Ga0373952_0000465_173_1339 351
2224 3300035092 Ga0373952_0002504 Ga0373952_0002504_381_1547 351
2225 3300035092 Ga0373952_0010270 Ga0373952_0010270_153_1319 351
2226 3300035111 Ga0373923_0003695 Ga0373923_0003695_1320_2486 351
2227 3300035111 Ga0373923_0006013 Ga0373923_0006013_1682_2851 351
2228 3300035111 Ga0373923_0012345 Ga0373923_0012345_781_1947 351
2229 3300035111 Ga0373923_0013075 Ga0373923_0013075_18_1241 351
2230 3300035111 Ga0373923_0017037 Ga0373923_0017037_959_2128 351
2231 3300035112 Ga0373932_0000305 Ga0373932_0000305_7391_8557 351
2232 3300035112 Ga0373932_0001852 Ga0373932_0001852_526_1692 351
2233 3300035112 Ga0373932_0026993 Ga0373932_0026993_379_1545 351
2234 3300035113 Ga0373936_0000290 Ga0373936_0000290_13042_14211 351
2235 3300035113 Ga0373936_0000946 Ga0373936_0000946_7887_9053 351
2236 3300035113 Ga0373936_0012489 Ga0373936_0012489_1185_2354 351
2237 3300035113 Ga0373936_0013610 Ga0373936_0013610_1170_2339 351
2238 3300035113 Ga0373936_0014254 Ga0373936_0014254_95_1264 351
2239 3300035113 Ga0373936_0057060 Ga0373936_0057060_344_1510 351
2240 3300035114 Ga0373939_0000355 Ga0373939_0000355_7261_8427 351
2241 3300035114 Ga0373939_0003430 Ga0373939_0003430_2245_3411 351
2242 3300035114 Ga0373939_0005402 Ga0373939_0005402_908_2074 351
2243 3300035115 Ga0373941_0001908 Ga0373941_0001908_1827_2993 351
2244 3300035115 Ga0373941_0002882 Ga0373941_0002882_2403_3572 351
2245 3300035116 Ga0373945_0005133 Ga0373945_0005133_1313_2479 351
2246 3300035116 Ga0373945_0034466 Ga0373945_0034466_586_1755 351
2247 3300035116 Ga0373945_0059657 Ga0373945_0059657_95_1264 351
2248 3300035117 Ga0373953_0006758 Ga0373953_0006758_483_1652 351
2249 3300035117 Ga0373953_0010746 Ga0373953_0010746_79_1245 351
2250 3300035117 Ga0373953_0026996 Ga0373953_0026996_743_1912 351
2251 3300035117 Ga0373953_0035276 Ga0373953_0035276_732_1898 351
2252 3300035118 Ga0373954_0006443 Ga0373954_0006443_1199_2365 351
2253 3300035118 Ga0373954_0009287 Ga0373954_0009287_611_1891 351
2254 3300035118 Ga0373954_0009326 Ga0373954_0009326_2173_3339 351
2255 3300035118 Ga0373954_0012508 Ga0373954_0012508_2324_3490 351
2256 3300035118 Ga0373954_0012944 Ga0373954_0012944_684_1850 351
2257 3300035118 Ga0373954_0035182 Ga0373954_0035182_578_1747 351
2258 3300035118 Ga0373954_0085459 Ga0373954_0085459_335_1501 351
2259 3300035119 Ga0373956_0005842 Ga0373956_0005842_1227_2393 351
2260 3300035119 Ga0373956_0027831 Ga0373956_0027831_400_1680 351
2261 3300035119 Ga0373956_0037968 Ga0373956_0037968_506_1672 351
2262 3300035120 Ga0373957_0003174 Ga0373957_0003174_3603_4772 351
2263 3300035120 Ga0373957_0003945 Ga0373957_0003945_2016_3182 351
2264 3300035120 Ga0373957_0029892 Ga0373957_0029892_743_1912 351
2265 3300035120 Ga0373957_0046275 Ga0373957_0046275_322_1488 351
2266 3300035121 Ga0373960_0000049 Ga0373960_0000049_14624_15790 351
2267 3300035121 Ga0373960_0000939 Ga0373960_0000939_1929_3095 351
2268 3300035121 Ga0373960_0006872 Ga0373960_0006872_1258_2424 351
2269 3300035121 Ga0373960_0012406 Ga0373960_0012406_853_2031 351
2270 3300035170 Ga0373943_0000731 Ga0373943_0000731_2213_3379 351
2271 3300035170 Ga0373943_0001740 Ga0373943_0001740_650_1816 351
2272 3300035170 Ga0373943_0032340 Ga0373943_0032340_948_2114 351
2273 3300035171 Ga0373946_0004807 Ga0373946_0004807_3575_4741 351
2274 3300035171 Ga0373946_0012296 Ga0373946_0012296_1135_2304 351
2275 3300035171 Ga0373946_0014320 Ga0373946_0014320_342_1508 351
2276 3300035171 Ga0373946_0042153 Ga0373946_0042153_260_1426 351
2277 3300035172 Ga0373955_0004397 Ga0373955_0004397_4007_5173 351
2278 3300035172 Ga0373955_0020245 Ga0373955_0020245_18_1280 351
2279 3300035172 Ga0373955_0027638 Ga0373955_0027638_51_1220 351
2280 3300035207 Ga0373942_0000263 Ga0373942_0000263_77_1243 351
2281 3300035207 Ga0373942_0002162 Ga0373942_0002162_3183_4349 351
2282 3300035241 Ga0373961_0000821 Ga0373961_0000821_3476_4642 351
2283 3300035242 Ga0373962_0000166 Ga0373962_0000166_7129_8295 351
2284 3300035242 Ga0373962_0001762 Ga0373962_0001762_2217_3383 351
2285 3300035242 Ga0373962_0004665 Ga0373962_0004665_609_1775 351
2286 3300035410 Ga0373924_0005336 Ga0373924_0005336_1972_3138 351
2287 3300035410 Ga0373924_0008896 Ga0373924_0008896_49_1329 351
2288 3300035410 Ga0373924_0025681 Ga0373924_0025681_375_1544 351
2289 3300035410 Ga0373924_0033174 Ga0373924_0033174_222_1391 351
2290 3300035410 Ga0373924_0054754 Ga0373924_0054754_33_1202 351
2291 3300035691 Ga0373931_0000251 Ga0373931_0000251_21580_22746 351
2292 3300035691 Ga0373931_0002892 Ga0373931_0002892_2681_3850 351
2293 3300035691 Ga0373931_0003885 Ga0373931_0003885_2259_3437 351
2294 3300035691 Ga0373931_0006942 Ga0373931_0006942_3503_4681 351
2295 3300035691 Ga0373931_0007466 Ga0373931_0007466_1049_2215 351
2296 3300035691 Ga0373931_0014118 Ga0373931_0014118_1359_2525 351
2297 3300035691 Ga0373931_0058607 Ga0373931_0058607_609_1775 351
2298 3300035692 Ga0373935_0000382 Ga0373935_0000382_16509_17678 351
2299 3300035692 Ga0373935_0004967 Ga0373935_0004967_852_2018 351
2300 3300035692 Ga0373935_0012579 Ga0373935_0012579_3614_4780 351
2301 3300035692 Ga0373935_0019053 Ga0373935_0019053_2095_3273 351
2302 3300035692 Ga0373935_0025698 Ga0373935_0025698_2167_3333 351
2303 3300035692 Ga0373935_0032906 Ga0373935_0032906_1257_2423 351
2304 3300035692 Ga0373935_0103576 Ga0373935_0103576_632_1801 351
2305 3300035692 Ga0373935_0107899 Ga0373935_0107899_617_1783 351
2306 3300035695 Ga0373927_0001986 Ga0373927_0001986_11552_12718 351
2307 3300035695 Ga0373927_0002885 Ga0373927_0002885_8479_9648 351
2308 3300035695 Ga0373927_0003772 Ga0373927_0003772_2010_3179 351
2309 3300035695 Ga0373927_0006211 Ga0373927_0006211_4619_5785 351
2310 3300035695 Ga0373927_0024472 Ga0373927_0024472_1176_2345 351
2311 3300035695 Ga0373927_0027258 Ga0373927_0027258_666_1835 351
2312 3300035695 Ga0373927_0034185 Ga0373927_0034185_676_1842 351
2313 3300035695 Ga0373927_0035489 Ga0373927_0035489_409_1575 351
2314 3300035695 Ga0373927_0048028 Ga0373927_0048028_750_1919 351
2315 3300035695 Ga0373927_0049440 Ga0373927_0049440_1066_2235 351
2316 3300035695 Ga0373927_0057068 Ga0373927_0057068_720_1889 351
2317 3300035695 Ga0373927_0120841 Ga0373927_0120841_40_1206 351
2318 3300035724 Ga0373933_0000110 Ga0373933_0000110_14695_15864 351
2319 3300035724 Ga0373933_0004137 Ga0373933_0004137_1779_3059 351
2320 3300035724 Ga0373933_0005829 Ga0373933_0005829_4090_5256 351
2321 3300035724 Ga0373933_0006160 Ga0373933_0006160_2340_3506 351
2322 3300035724 Ga0373933_0008646 Ga0373933_0008646_845_2011 351
2323 3300035724 Ga0373933_0020415 Ga0373933_0020415_508_1677 351
2324 3300035725 Ga0373947_0000156 Ga0373947_0000156_7726_8892 351
2325 3300035725 Ga0373947_0001850 Ga0373947_0001850_9297_10466 351
2326 3300035725 Ga0373947_0004465 Ga0373947_0004465_6238_7404 351
2327 3300035725 Ga0373947_0004860 Ga0373947_0004860_3112_4281 351
2328 3300035725 Ga0373947_0005528 Ga0373947_0005528_2475_3641 351
2329 3300035725 Ga0373947_0008142 Ga0373947_0008142_2277_3443 351
2330 3300035725 Ga0373947_0011440 Ga0373947_0011440_2520_3686 351
2331 3300035725 Ga0373947_0022837 Ga0373947_0022837_767_2047 351
2332 3300035725 Ga0373947_0042745 Ga0373947_0042745_561_1730 351
2333 3300035725 Ga0373947_0088100 Ga0373947_0088100_734_1903 351
2334 3300035725 Ga0373947_0101709 Ga0373947_0101709_16_1182 351
2335 3300036401 Ga0373937_0003306 Ga0373937_0003306_1323_2603 351
2336 3300036401 Ga0373937_0007162 Ga0373937_0007162_112_1278 351
2337 3300036401 Ga0373937_0007207 Ga0373937_0007207_8378_9544 351
2338 3300036401 Ga0373937_0008870 Ga0373937_0008870_3396_4565 351
2339 3300036401 Ga0373937_0012150 Ga0373937_0012150_4798_5964 351
2340 3300036401 Ga0373937_0022596 Ga0373937_0022596_1361_2530 351
2341 3300036401 Ga0373937_0023869 Ga0373937_0023869_4256_5422 351
2342 3300036401 Ga0373937_0039555 Ga0373937_0039555_1335_2504 351
2343 3300036401 Ga0373937_0046402 Ga0373937_0046402_1272_2438 351
2344 3300036401 Ga0373937_0048939 Ga0373937_0048939_234_1403 351
2345 3300036401 Ga0373937_0052305 Ga0373937_0052305_1806_2975 351
2346 3300036401 Ga0373937_0122394 Ga0373937_0122394_787_1956 351
2347 3300036401 Ga0373937_0191120 Ga0373937_0191120_291_1457 351
2348 3300036401 Ga0373937_0203326 Ga0373937_0203326_496_1674 351
2349 3300036401 Ga0373937_0205428 Ga0373937_0205428_55_1224 351
2350 3300036401 Ga0373937_0393298 Ga0373937_0393298_94_1260 351
2351 3300037068 Ga0373925_0002634 Ga0373925_0002634_4138_5307 351
2352 3300037068 Ga0373925_0002995 Ga0373925_0002995_3397_4563 351
2353 3300037068 Ga0373925_0030557 Ga0373925_0030557_1313_2479 351
2354 3300037068 Ga0373925_0050209 Ga0373925_0050209_1839_3005 351
2355 3300037068 Ga0373925_0058607 Ga0373925_0058607_508_1674 351
2356 3300037068 Ga0373925_0076823 Ga0373925_0076823_1154_2323 351
2357 3300037068 Ga0373925_0122814 Ga0373925_0122814_348_1514 351
2358 3300037068 Ga0373925_0161974 Ga0373925_0161974_557_1726 351
2359 3300037312 Ga0395899_0021302 Ga0395899_0021302_857_2023 351
2360 3300037312 Ga0395899_0031696 Ga0395899_0031696_2119_3285 351
2361 3300037312 Ga0395899_0141965 Ga0395899_0141965_266_1435 351
2362 3300037418 Ga0395900_0000940 Ga0395900_0000940_3542_4711 351
2363 3300037418 Ga0395900_0034081 Ga0395900_0034081_746_1912 351
2364 3300037418 Ga0395900_0147352 Ga0395900_0147352_784_1950 351
2365 3300037418 Ga0395900_0206362 Ga0395900_0206362_551_1717 351
2366 3300037466 Ga0395898_0029285 Ga0395898_0029285_3657_4826 351
2367 3300037466 Ga0395898_0029616 Ga0395898_0029616_757_1923 351
2368 3300037466 Ga0395898_0032592 Ga0395898_0032592_3415_4590 351
2369 3300037466 Ga0395898_0061821 Ga0395898_0061821_2000_3166 351
2370 3300037466 Ga0395898_0079128 Ga0395898_0079128_1850_3019 351
2371 3300037466 Ga0395898_0118976 Ga0395898_0118976_1276_2442 351
2372 3300037466 Ga0395898_0140265 Ga0395898_0140265_748_1914 351
2373 3300037471 Ga0395905_0004739 Ga0395905_0004739_1314_2489 351
2374 3300037471 Ga0395905_0005715 Ga0395905_0005715_6868_8043 351
2375 3300037471 Ga0395905_0030761 Ga0395905_0030761_786_1952 351
2376 3300037471 Ga0395905_0079814 Ga0395905_0079814_100_1266 351
2377 3300037471 Ga0395905_0180690 Ga0395905_0180690_157_1323 351
2378 3300037853 Ga0436364_0281278 Ga0436364_0281278_4194_5360 351
2379 3300037853 Ga0436364_0400687 Ga0436364_0400687_903_2072 351
2380 3300037853 Ga0436364_0409058 Ga0436364_0409058_57_1229 351
2381 3300037853 Ga0436364_0529683 Ga0436364_0529683_3765_4931 351
2382 3300037853 Ga0436364_0711898 Ga0436364_0711898_1015_2184 351
2383 3300037853 Ga0436364_0777339 Ga0436364_0777339_778_1947 351
2384 3300037853 Ga0436364_0817653 Ga0436364_0817653_13802_14974 351
2385 3300037853 Ga0436364_1320386 Ga0436364_1320386_77_1246 351
2386 3300038443 Ga0395901_0024150 Ga0395901_0024150_4633_5799 351
2387 3300038443 Ga0395901_0050570 Ga0395901_0050570_640_1806 351
2388 3300038443 Ga0395901_0051490 Ga0395901_0051490_2297_3463 351
2389 3300038443 Ga0395901_0072724 Ga0395901_0072724_1733_2902 351
2390 3300038443 Ga0395901_0083716 Ga0395901_0083716_1151_2317 351
2391 3300038443 Ga0395901_0132765 Ga0395901_0132765_1208_2374 351
2392 3300038443 Ga0395901_0353499 Ga0395901_0353499_163_1329 351
2393 3300039062 Ga0400483_222177 Ga0400483_222177_615_1781 351
2394 3300039062 Ga0400483_222778 Ga0400483_222778_2482_3648 351
2395 3300039062 Ga0400483_239471 Ga0400483_239471_566_1732 351
2396 3300039437 Ga0436365_0134733 Ga0436365_0134733_1234_2400 351
2397 3300039437 Ga0436365_0154683 Ga0436365_0154683_3431_4645 351
2398 3300039437 Ga0436365_1332159 Ga0436365_1332159_7986_9155 351
2399 3300039437 Ga0436365_1713855 Ga0436365_1713855_778_1947 351
2400 3300039437 Ga0436365_1748556 Ga0436365_1748556_738_1904 351
2401 3300039437 Ga0436365_1892050 Ga0436365_1892050_1120_2289 351
2402 3300039438 Ga0436360_0049575 Ga0436360_0049575_1332_2501 351
2403 3300039438 Ga0436360_0370851 Ga0436360_0370851_401_1570 351
2404 3300039438 Ga0436360_0822831 Ga0436360_0822831_393_1562 351
2405 3300039438 Ga0436360_1106222 Ga0436360_1106222_4636_5808 351
2406 3300039447 Ga0436361_0052401 Ga0436361_0052401_8471_9652 351
2407 3300039447 Ga0436361_0365828 Ga0436361_0365828_3092_4303 351
2408 3300039447 Ga0436361_1108010 Ga0436361_1108010_57_1229 351
2409 3300039450 Ga0436363_0267009 Ga0436363_0267009_49_1215 351
2410 3300039450 Ga0436363_0410105 Ga0436363_0410105_573_1739 351
2411 3300039450 Ga0436363_0660862 Ga0436363_0660862_1658_3052 351
2412 3300039450 Ga0436363_0878076 Ga0436363_0878076_485_1702 351
2413 3300039450 Ga0436363_1159398 Ga0436363_1159398_235_1404 351
2414 3300039450 Ga0436363_1595676 Ga0436363_1595676_444_1613 351
2415 3300039453 Ga0436362_0057416 Ga0436362_0057416_225_1439 351
2416 3300039453 Ga0436362_1133249 Ga0436362_1133249_713_1885 351
2417 3300041408 Ga0439453_0000022 Ga0439453_0000022_2197_3363 351
2418 3300041413 Ga0439465_0022466 Ga0439465_0022466_282_1448 351
2419 3300042007 Ga0439449_0007041 Ga0439449_0007041_2434_3603 351
2420 3300042015 Ga0439462_0024753 Ga0439462_0024753_151_1320 351
2421 3300042137 Ga0450902_000021 Ga0450902_000021_5656_6825 351
2422 3300042876 Ga0451577_0214895 Ga0451577_0214895_126_1295 351
2423 3300042993 Ga0439440_0029940 Ga0439440_0029940_53_1219 351
2424 3300044658 Ga0466972_0000160 Ga0466972_0000160_2747_3916 351
2425 3300044658 Ga0466972_0001455 Ga0466972_0001455_545_1714 351
2426 3300044658 Ga0466972_0031030 Ga0466972_0031030_274_1452 351
2427 3300044684 Ga0466966_0006283 Ga0466966_0006283_3508_4677 351
2428 3300044693 Ga0466961_0000154 Ga0466961_0000154_37366_38535 351
2429 3300044693 Ga0466961_0069702 Ga0466961_0069702_203_1369 351
2430 3300044693 Ga0466961_0144001 Ga0466961_0144001_49_1218 351
2431 3300044694 Ga0466963_0004891 Ga0466963_0004891_3383_4552 351
2432 3300044694 Ga0466963_0011092 Ga0466963_0011092_2320_3486 351
2433 3300044694 Ga0466963_0024315 Ga0466963_0024315_453_1631 351
2434 3300044694 Ga0466963_0115850 Ga0466963_0115850_19_1188 351
2435 3300044712 Ga0453684_0125689 Ga0453684_0125689_995_2161 351
2436 3300044735 Ga0466968_0027966 Ga0466968_0027966_518_1687 351
2437 3300044735 Ga0466968_0032688 Ga0466968_0032688_489_1655 351
2438 3300044842 Ga0466957_0019829 Ga0466957_0019829_407_1585 351
2439 3300044842 Ga0466957_0044390 Ga0466957_0044390_1226_2395 351
2440 3300044842 Ga0466957_0086419 Ga0466957_0086419_702_1871 351
2441 3300045049 Ga0466959_0012963 Ga0466959_0012963_3061_4230 351
2442 3300045049 Ga0466959_0016488 Ga0466959_0016488_549_1715 351
2443 3300045049 Ga0466959_0202610 Ga0466959_0202610_20_1189 351
2444 3300045051 Ga0451576_0011255 Ga0451576_0011255_4027_5193 351
2445 3300045051 Ga0451576_0027106 Ga0451576_0027106_1107_2273 351
2446 3300045836 Ga0466958_0074628 Ga0466958_0074628_184_1353 351
2447 3300045836 Ga0466958_0108940 Ga0466958_0108940_396_1574 351
2448 3300045976 Ga0466967_0003827 Ga0466967_0003827_5859_7025 351
2449 3300045976 Ga0466967_0022912 Ga0466967_0022912_1164_2330 351
2450 3300045976 Ga0466967_0137698 Ga0466967_0137698_793_1962 351
2451 3300045976 Ga0466967_0431118 Ga0466967_0431118_88_1257 351
2452 3300046453 Ga0495627_001678 Ga0495627_001678_6520_7689 351
2453 3300046454 Ga0495592_0001659 Ga0495592_0001659_6749_7915 351
2454 3300046454 Ga0495592_0002937 Ga0495592_0002937_8200_9366 351
2455 3300046454 Ga0495592_0016948 Ga0495592_0016948_3564_4733 351
2456 3300046454 Ga0495592_0039427 Ga0495592_0039427_1771_2940 351
2457 3300046454 Ga0495592_0053403 Ga0495592_0053403_528_1697 351
2458 3300046454 Ga0495592_0082148 Ga0495592_0082148_736_1905 351
2459 3300046454 Ga0495592_0107397 Ga0495592_0107397_546_1712 351
2460 3300046455 Ga0495603_0006274 Ga0495603_0006274_4827_5996 351
2461 3300046455 Ga0495603_0008489 Ga0495603_0008489_2151_3317 351
2462 3300046455 Ga0495603_0009274 Ga0495603_0009274_3382_4551 351
2463 3300046455 Ga0495603_0030358 Ga0495603_0030358_340_1509 351
2464 3300046455 Ga0495603_0168148 Ga0495603_0168148_77_1246 351
2465 3300046459 Ga0495629_0000820 Ga0495629_0000820_5640_6806 351
2466 3300046459 Ga0495629_0001281 Ga0495629_0001281_2081_3250 351
2467 3300046459 Ga0495629_0005499 Ga0495629_0005499_5633_6913 351
2468 3300046459 Ga0495629_0021353 Ga0495629_0021353_237_1406 351
2469 3300046459 Ga0495629_0041636 Ga0495629_0041636_1686_2855 351
2470 3300046459 Ga0495629_0070245 Ga0495629_0070245_715_1881 351
2471 3300046459 Ga0495629_0138616 Ga0495629_0138616_422_1591 351
2472 3300046459 Ga0495629_0156648 Ga0495629_0156648_256_1422 351
2473 3300046460 Ga0495638_0034133 Ga0495638_0034133_693_1859 351
2474 3300046460 Ga0495638_0047300 Ga0495638_0047300_36_1202 351
2475 3300046460 Ga0495638_0112582 Ga0495638_0112582_119_1297 351
2476 3300046461 Ga0495641_0013534 Ga0495641_0013534_1455_2621 351
2477 3300046461 Ga0495641_0033444 Ga0495641_0033444_819_1988 351
2478 3300046462 Ga0495651_0000821 Ga0495651_0000821_15467_16636 351
2479 3300046462 Ga0495651_0004144 Ga0495651_0004144_5184_6464 351
2480 3300046462 Ga0495651_0008754 Ga0495651_0008754_6163_7329 351
2481 3300046462 Ga0495651_0029252 Ga0495651_0029252_1518_2684 351
2482 3300046462 Ga0495651_0048772 Ga0495651_0048772_297_1466 351
2483 3300046462 Ga0495651_0175092 Ga0495651_0175092_231_1397 351
2484 3300046463 Ga0495653_0002057 Ga0495653_0002057_8142_9422 351
2485 3300046463 Ga0495653_0002307 Ga0495653_0002307_11889_13058 351
2486 3300046463 Ga0495653_0010963 Ga0495653_0010963_1084_2250 351
2487 3300046463 Ga0495653_0063797 Ga0495653_0063797_1549_2715 351
2488 3300046463 Ga0495653_0211822 Ga0495653_0211822_60_1226 351
2489 3300046472 Ga0495580_0006533 Ga0495580_0006533_1317_2483 351
2490 3300046472 Ga0495580_0010022 Ga0495580_0010022_4474_5640 351
2491 3300046473 Ga0495582_0002118 Ga0495582_0002118_3998_5164 351
2492 3300046473 Ga0495582_0002522 Ga0495582_0002522_4937_6103 351
2493 3300046473 Ga0495582_0037881 Ga0495582_0037881_224_1390 351
2494 3300046473 Ga0495582_0098419 Ga0495582_0098419_189_1355 351
2495 3300046475 Ga0495639_0000077 Ga0495639_0000077_34148_35317 351
2496 3300046475 Ga0495639_0067982 Ga0495639_0067982_390_1559 351
2497 3300046476 Ga0495662_0000558 Ga0495662_0000558_262_1428 351
2498 3300046476 Ga0495662_0003102 Ga0495662_0003102_4447_5613 351
2499 3300046476 Ga0495662_0005023 Ga0495662_0005023_4231_5400 351
2500 3300046476 Ga0495662_0024743 Ga0495662_0024743_273_1439 351
2501 3300046476 Ga0495662_0070723 Ga0495662_0070723_337_1506 351
2502 3300046477 Ga0495664_0000393 Ga0495664_0000393_7883_9049 351
2503 3300046477 Ga0495664_0008391 Ga0495664_0008391_1742_2908 351
2504 3300046477 Ga0495664_0015614 Ga0495664_0015614_766_2046 351
2505 3300046477 Ga0495664_0037381 Ga0495664_0037381_987_2153 351
2506 3300046477 Ga0495664_0057799 Ga0495664_0057799_1112_2278 351
2507 3300046477 Ga0495664_0082115 Ga0495664_0082115_160_1326 351
2508 3300046491 Ga0495584_0033835 Ga0495584_0033835_944_2110 351
2509 3300046491 Ga0495584_0060796 Ga0495584_0060796_174_1343 351
2510 3300046491 Ga0495584_0090714 Ga0495584_0090714_319_1485 351
2511 3300046492 Ga0495585_0001819 Ga0495585_0001819_6219_7385 351
2512 3300046492 Ga0495585_0148941 Ga0495585_0148941_41_1210 351
2513 3300046499 Ga0495594_0004654 Ga0495594_0004654_5088_6257 351
2514 3300046499 Ga0495594_0008785 Ga0495594_0008785_2266_3432 351
2515 3300046499 Ga0495594_0035529 Ga0495594_0035529_232_1398 351
2516 3300046499 Ga0495594_0036792 Ga0495594_0036792_1241_2407 351
2517 3300046501 Ga0495607_0000280 Ga0495607_0000280_40000_41172 351
2518 3300046501 Ga0495607_0015399 Ga0495607_0015399_1381_2547 351
2519 3300046507 Ga0495606_0001988 Ga0495606_0001988_23448_24617 351
2520 3300046511 Ga0495608_0000180 Ga0495608_0000180_4564_5844 351
2521 3300046511 Ga0495608_0000456 Ga0495608_0000456_11281_12447 351
2522 3300046511 Ga0495608_0022036 Ga0495608_0022036_2289_3455 351
2523 3300046511 Ga0495608_0035091 Ga0495608_0035091_1367_2536 351
2524 3300046511 Ga0495608_0060608 Ga0495608_0060608_1123_2292 351
2525 3300046511 Ga0495608_0111535 Ga0495608_0111535_479_1648 351
2526 3300046511 Ga0495608_0131640 Ga0495608_0131640_135_1304 351
2527 3300046512 Ga0495610_0035245 Ga0495610_0035245_676_1845 351
2528 3300046512 Ga0495610_0063639 Ga0495610_0063639_18_1187 351
2529 3300046513 Ga0495616_0010819 Ga0495616_0010819_199_1368 351
2530 3300046514 Ga0495618_0004121 Ga0495618_0004121_7087_8253 351
2531 3300046514 Ga0495618_0004321 Ga0495618_0004321_5181_6347 351
2532 3300046514 Ga0495618_0008722 Ga0495618_0008722_1320_2600 351
2533 3300046514 Ga0495618_0088268 Ga0495618_0088268_444_1610 351
2534 3300046515 Ga0495620_0033982 Ga0495620_0033982_667_1836 351
2535 3300046516 Ga0495628_0001503 Ga0495628_0001503_10107_11273 351
2536 3300046516 Ga0495628_0022057 Ga0495628_0022057_2176_3342 351
2537 3300046516 Ga0495628_0047631 Ga0495628_0047631_1324_2493 351
2538 3300046516 Ga0495628_0055004 Ga0495628_0055004_1002_2168 351
2539 3300046516 Ga0495628_0069229 Ga0495628_0069229_1080_2249 351
2540 3300046516 Ga0495628_0069396 Ga0495628_0069396_739_1908 351
2541 3300046516 Ga0495628_0117253 Ga0495628_0117253_734_1903 351
2542 3300046517 Ga0495630_0001279 Ga0495630_0001279_13687_14856 351
2543 3300046517 Ga0495630_0011535 Ga0495630_0011535_2584_3750 351
2544 3300046517 Ga0495630_0029799 Ga0495630_0029799_1383_2549 351
2545 3300046517 Ga0495630_0035236 Ga0495630_0035236_2425_3591 351
2546 3300046517 Ga0495630_0080145 Ga0495630_0080145_908_2077 351
2547 3300046517 Ga0495630_0085140 Ga0495630_0085140_1007_2176 351
2548 3300046517 Ga0495630_0173753 Ga0495630_0173753_65_1231 351
2549 3300046520 Ga0495637_0034213 Ga0495637_0034213_475_1644 351
2550 3300046520 Ga0495637_0034650 Ga0495637_0034650_97_1263 351
2551 3300046522 Ga0495643_0021142 Ga0495643_0021142_297_1574 351
2552 3300046523 Ga0495644_0000332 Ga0495644_0000332_15975_17141 351
2553 3300046524 Ga0495648_0004264 Ga0495648_0004264_4684_5853 351
2554 3300046524 Ga0495648_0006745 Ga0495648_0006745_144_1313 351
2555 3300046525 Ga0495663_0009551 Ga0495663_0009551_245_1411 351
2556 3300046526 Ga0495666_0006830 Ga0495666_0006830_338_1507 351
2557 3300046526 Ga0495666_0015122 Ga0495666_0015122_802_1968 351
2558 3300046528 Ga0495642_0014122 Ga0495642_0014122_1380_2657 351
2559 3300046529 Ga0495652_0002402 Ga0495652_0002402_6334_7500 351
2560 3300046529 Ga0495652_0003331 Ga0495652_0003331_6265_7545 351
2561 3300046529 Ga0495652_0005063 Ga0495652_0005063_4022_5191 351
2562 3300046529 Ga0495652_0010705 Ga0495652_0010705_3033_4199 351
2563 3300046529 Ga0495652_0051726 Ga0495652_0051726_906_2072 351
2564 3300046529 Ga0495652_0057979 Ga0495652_0057979_1318_2487 351
2565 3300046529 Ga0495652_0155033 Ga0495652_0155033_160_1329 351
2566 3300046529 Ga0495652_0174810 Ga0495652_0174810_396_1565 351
2567 3300046529 Ga0495652_0208727 Ga0495652_0208727_170_1336 351
2568 3300046530 Ga0495654_0044044 Ga0495654_0044044_651_1820 351
2569 3300046531 Ga0495665_0005354 Ga0495665_0005354_2790_3956 351
2570 3300046531 Ga0495665_0007168 Ga0495665_0007168_2512_3678 351
2571 3300046531 Ga0495665_0052102 Ga0495665_0052102_229_1398 351
2572 3300046531 Ga0495665_0085239 Ga0495665_0085239_305_1471 351
2573 3300046533 Ga0495640_0001485 Ga0495640_0001485_277_1443 351
2574 3300046533 Ga0495640_0004699 Ga0495640_0004699_3118_4398 351
2575 3300046533 Ga0495640_0009310 Ga0495640_0009310_5916_7082 351
2576 3300046533 Ga0495640_0010468 Ga0495640_0010468_238_1404 351
2577 3300046533 Ga0495640_0018557 Ga0495640_0018557_820_1989 351
2578 3300046533 Ga0495640_0030218 Ga0495640_0030218_2432_3601 351
2579 3300046533 Ga0495640_0036301 Ga0495640_0036301_500_1666 351
2580 3300046533 Ga0495640_0080681 Ga0495640_0080681_750_1916 351
2581 3300046533 Ga0495640_0149600 Ga0495640_0149600_108_1277 351
2582 3300046535 Ga0495586_0025121 Ga0495586_0025121_732_1898 351
2583 3300046535 Ga0495586_0034731 Ga0495586_0034731_938_2104 351
2584 3300046536 Ga0495587_0006392 Ga0495587_0006392_2115_3395 351
2585 3300046536 Ga0495587_0006778 Ga0495587_0006778_4564_5730 351
2586 3300046536 Ga0495587_0009149 Ga0495587_0009149_142_1311 351
2587 3300046536 Ga0495587_0016455 Ga0495587_0016455_2082_3251 351
2588 3300046536 Ga0495587_0055111 Ga0495587_0055111_962_2131 351
2589 3300046539 Ga0495621_0039499 Ga0495621_0039499_314_1480 351
2590 3300046542 Ga0495597_0044482 Ga0495597_0044482_523_1800 351
2591 3300046543 Ga0495645_0000399 Ga0495645_0000399_15709_16875 351
2592 3300046543 Ga0495645_0000911 Ga0495645_0000911_2099_3268 351
2593 3300046543 Ga0495645_0016639 Ga0495645_0016639_3173_4339 351
2594 3300046543 Ga0495645_0021556 Ga0495645_0021556_1086_2366 351
2595 3300046543 Ga0495645_0054262 Ga0495645_0054262_1220_2389 351
2596 3300046543 Ga0495645_0064957 Ga0495645_0064957_963_2132 351
2597 3300046557 Ga0495622_0001874 Ga0495622_0001874_1536_2702 351
2598 3300046557 Ga0495622_0011900 Ga0495622_0011900_2000_3169 351
2599 3300046557 Ga0495622_0015051 Ga0495622_0015051_454_1623 351
2600 3300046557 Ga0495622_0094905 Ga0495622_0094905_69_1235 351
2601 3300046558 Ga0495633_0039921 Ga0495633_0039921_26_1195 351
2602 3300046559 Ga0495667_0000832 Ga0495667_0000832_3033_4199 351
2603 3300046559 Ga0495667_0003030 Ga0495667_0003030_1566_2846 351
2604 3300046559 Ga0495667_0033501 Ga0495667_0033501_292_1458 351
2605 3300046559 Ga0495667_0039300 Ga0495667_0039300_1869_3035 351
2606 3300046559 Ga0495667_0040203 Ga0495667_0040203_1783_2949 351
2607 3300046559 Ga0495667_0053211 Ga0495667_0053211_1363_2532 351
2608 3300046559 Ga0495667_0056873 Ga0495667_0056873_422_1591 351
2609 3300046615 Ga0495656_0000480 Ga0495656_0000480_2084_3250 351
2610 3300046615 Ga0495656_0005889 Ga0495656_0005889_200_1369 351
2611 3300046615 Ga0495656_0010749 Ga0495656_0010749_2079_3248 351
2612 3300046615 Ga0495656_0025146 Ga0495656_0025146_1138_2304 351
2613 3300046615 Ga0495656_0034711 Ga0495656_0034711_578_1744 351
2614 3300046616 Ga0495668_0066126 Ga0495668_0066126_382_1560 351
2615 3300046642 Ga0495634_0001976 Ga0495634_0001976_5085_6254 351
2616 3300046642 Ga0495634_0007301 Ga0495634_0007301_26_1192 351
2617 3300046642 Ga0495634_0011570 Ga0495634_0011570_3735_4901 351
2618 3300046642 Ga0495634_0022903 Ga0495634_0022903_58_1227 351
2619 3300046642 Ga0495634_0069268 Ga0495634_0069268_432_1601 351
2620 3300046642 Ga0495634_0078394 Ga0495634_0078394_738_1904 351
2621 3300046642 Ga0495634_0126035 Ga0495634_0126035_21_1187 351
2622 3300046660 Ga0495625_0001042 Ga0495625_0001042_28501_29676 351
2623 3300046660 Ga0495625_0060789 Ga0495625_0060789_146_1324 351
2624 3300046660 Ga0495625_0159260 Ga0495625_0159260_316_1485 351
2625 3300046663 Ga0495635_0002471 Ga0495635_0002471_238_1407 351
2626 3300046663 Ga0495635_0014085 Ga0495635_0014085_617_1897 351
2627 3300046663 Ga0495635_0014978 Ga0495635_0014978_804_1970 351
2628 3300046663 Ga0495635_0017755 Ga0495635_0017755_774_1940 351
2629 3300046663 Ga0495635_0027461 Ga0495635_0027461_1661_2827 351
2630 3300046663 Ga0495635_0027843 Ga0495635_0027843_2054_3223 351
2631 3300046663 Ga0495635_0034447 Ga0495635_0034447_509_1678 351
2632 3300046663 Ga0495635_0100736 Ga0495635_0100736_364_1530 351
2633 3300046664 Ga0495659_0014731 Ga0495659_0014731_1329_2495 351
2634 3300046665 Ga0495661_0003988 Ga0495661_0003988_4935_6212 351
2635 3300046665 Ga0495661_0022266 Ga0495661_0022266_1763_2932 351
2636 3300046665 Ga0495661_0144400 Ga0495661_0144400_20_1189 351
2637 3300046674 Ga0495588_0001123 Ga0495588_0001123_4005_5171 351
2638 3300046674 Ga0495588_0001283 Ga0495588_0001283_6403_7572 351
2639 3300046674 Ga0495588_0046212 Ga0495588_0046212_423_1589 351
2640 3300046675 Ga0495657_0008710 Ga0495657_0008710_604_1770 351
2641 3300046675 Ga0495657_0015882 Ga0495657_0015882_660_1829 351
2642 3300046675 Ga0495657_0016840 Ga0495657_0016840_1679_2848 351
2643 3300046675 Ga0495657_0059158 Ga0495657_0059158_538_1704 351
2644 3300046678 Ga0495599_0003635 Ga0495599_0003635_3892_5058 351
2645 3300046678 Ga0495599_0005435 Ga0495599_0005435_3449_4618 351
2646 3300046678 Ga0495599_0010526 Ga0495599_0010526_955_2235 351
2647 3300046678 Ga0495599_0060421 Ga0495599_0060421_545_1714 351
2648 3300046678 Ga0495599_0094460 Ga0495599_0094460_64_1230 351
2649 3300046678 Ga0495599_0139257 Ga0495599_0139257_298_1464 351
2650 3300046679 Ga0495623_0000372 Ga0495623_0000372_1276_2442 351
2651 3300046679 Ga0495623_0009213 Ga0495623_0009213_4589_5755 351
2652 3300046679 Ga0495623_0009394 Ga0495623_0009394_397_1677 351
2653 3300046679 Ga0495623_0010249 Ga0495623_0010249_2859_4028 351
2654 3300046679 Ga0495623_0017926 Ga0495623_0017926_1325_2494 351
2655 3300046679 Ga0495623_0026859 Ga0495623_0026859_2269_3435 351
2656 3300046679 Ga0495623_0147730 Ga0495623_0147730_177_1343 351
2657 3300046680 Ga0495646_0001728 Ga0495646_0001728_5465_6631 351
2658 3300046680 Ga0495646_0013938 Ga0495646_0013938_1400_2569 351
2659 3300046680 Ga0495646_0015084 Ga0495646_0015084_3551_4720 351
2660 3300046680 Ga0495646_0021040 Ga0495646_0021040_1336_2505 351
2661 3300046680 Ga0495646_0024603 Ga0495646_0024603_2585_3751 351
2662 3300046680 Ga0495646_0025467 Ga0495646_0025467_1588_2754 351
2663 3300046680 Ga0495646_0028255 Ga0495646_0028255_1899_3179 351
2664 3300046680 Ga0495646_0071640 Ga0495646_0071640_720_1889 351
2665 3300046680 Ga0495646_0074176 Ga0495646_0074176_554_1723 351
2666 3300046681 Ga0495647_0000134 Ga0495647_0000134_15876_17042 351
2667 3300046683 Ga0495658_0000479 Ga0495658_0000479_16455_17621 351
2668 3300046683 Ga0495658_0001615 Ga0495658_0001615_1682_2851 351
2669 3300046683 Ga0495658_0013570 Ga0495658_0013570_2670_3836 351
2670 3300046683 Ga0495658_0018146 Ga0495658_0018146_380_1546 351
2671 3300046683 Ga0495658_0018389 Ga0495658_0018389_1786_2955 351
2672 3300046683 Ga0495658_0031178 Ga0495658_0031178_1462_2628 351
2673 3300046683 Ga0495658_0101589 Ga0495658_0101589_221_1387 351
2674 3300046684 Ga0495669_0026867 Ga0495669_0026867_1078_2244 351
2675 3300046684 Ga0495669_0043054 Ga0495669_0043054_295_1464 351
2676 3300046684 Ga0495669_0108558 Ga0495669_0108558_18_1184 351
2677 3300046689 Ga0495613_0013924 Ga0495613_0013924_443_1612 351
2678 3300046689 Ga0495613_0017495 Ga0495613_0017495_1959_3125 351
2679 3300046689 Ga0495613_0054098 Ga0495613_0054098_1078_2247 351
2680 3300046689 Ga0495613_0122846 Ga0495613_0122846_101_1267 351
2681 3300046689 Ga0495613_0145084 Ga0495613_0145084_511_1677 351
2682 3300046690 Ga0495624_0002021 Ga0495624_0002021_5051_6220 351
2683 3300046690 Ga0495624_0003130 Ga0495624_0003130_11073_12239 351
2684 3300046690 Ga0495624_0005517 Ga0495624_0005517_6772_7938 351
2685 3300046690 Ga0495624_0018581 Ga0495624_0018581_2160_3326 351
2686 3300046690 Ga0495624_0061013 Ga0495624_0061013_189_1355 351
2687 3300046690 Ga0495624_0064486 Ga0495624_0064486_72_1238 351
2688 3300046691 Ga0495670_0014312 Ga0495670_0014312_1464_2630 351
2689 3300046691 Ga0495670_0118683 Ga0495670_0118683_161_1330 351
2690 3300046692 Ga0495671_0015600 Ga0495671_0015600_1385_2554 351
2691 3300046692 Ga0495671_0056245 Ga0495671_0056245_430_1596 351
2692 3300046692 Ga0495671_0068501 Ga0495671_0068501_451_1620 351
2693 3300046794 Ga0495589_0029050 Ga0495589_0029050_971_2137 351
2694 3300046794 Ga0495589_0102532 Ga0495589_0102532_59_1225 351
2695 3300046809 Ga0495600_0011402 Ga0495600_0011402_468_1634 351
2696 3300046809 Ga0495600_0012452 Ga0495600_0012452_1074_2354 351
2697 3300046809 Ga0495600_0022024 Ga0495600_0022024_314_1480 351
2698 3300046809 Ga0495600_0049651 Ga0495600_0049651_902_2068 351
2699 3300047315 Ga0495581_0000503 Ga0495581_0000503_13749_14918 351
2700 3300047315 Ga0495581_0014816 Ga0495581_0014816_1114_2280 351
2701 3300047315 Ga0495581_0015374 Ga0495581_0015374_802_1968 351
2702 3300047315 Ga0495581_0103190 Ga0495581_0103190_310_1476 351
2703 3300047315 Ga0495581_0152153 Ga0495581_0152153_148_1314 351
2704 3300047317 Ga0495604_0000241 Ga0495604_0000241_21112_22392 351
2705 3300047317 Ga0495604_0000702 Ga0495604_0000702_20130_21299 351
2706 3300047317 Ga0495604_0003178 Ga0495604_0003178_5628_6794 351
2707 3300047317 Ga0495604_0006376 Ga0495604_0006376_4799_5965 351
2708 3300047317 Ga0495604_0023347 Ga0495604_0023347_2121_3290 351
2709 3300047317 Ga0495604_0049389 Ga0495604_0049389_550_1719 351
2710 3300047317 Ga0495604_0085915 Ga0495604_0085915_277_1443 351
2711 3300047317 Ga0495604_0157590 Ga0495604_0157590_262_1431 351
2712 3300047318 Ga0495636_0060692 Ga0495636_0060692_372_1538 351
2713 3300047319 Ga0495674_0001363 Ga0495674_0001363_9100_10380 351
2714 3300047319 Ga0495674_0009848 Ga0495674_0009848_3614_4783 351
2715 3300047319 Ga0495674_0010172 Ga0495674_0010172_7713_8879 351
2716 3300047319 Ga0495674_0010576 Ga0495674_0010576_605_1771 351
2717 3300047319 Ga0495674_0017131 Ga0495674_0017131_4976_6142 351
2718 3300047319 Ga0495674_0035825 Ga0495674_0035825_2950_4119 351
2719 3300047319 Ga0495674_0081957 Ga0495674_0081957_1034_2200 351
2720 3300047319 Ga0495674_0093453 Ga0495674_0093453_776_1945 351
2721 3300047319 Ga0495674_0096869 Ga0495674_0096869_698_1867 351
2722 3300047319 Ga0495674_0142364 Ga0495674_0142364_149_1318 351
2723 3300047319 Ga0495674_0295740 Ga0495674_0295740_133_1302 351
2724 3300047320 Ga0495672_0020588 Ga0495672_0020588_13_1182 351
2725 3300047320 Ga0495672_0024913 Ga0495672_0024913_1028_2197 351
2726 3300047320 Ga0495672_0078278 Ga0495672_0078278_358_1527 351
2727 3300047321 Ga0495676_0009761 Ga0495676_0009761_2341_3507 351
2728 3300047321 Ga0495676_0024072 Ga0495676_0024072_207_1376 351
2729 3300047321 Ga0495676_0035814 Ga0495676_0035814_1951_3117 351
2730 3300047321 Ga0495676_0105518 Ga0495676_0105518_61_1230 351
2731 3300047322 Ga0495680_0000994 Ga0495680_0000994_12212_13492 351
2732 3300047322 Ga0495680_0002292 Ga0495680_0002292_492_1658 351
2733 3300047322 Ga0495680_0002523 Ga0495680_0002523_15099_16265 351
2734 3300047322 Ga0495680_0006821 Ga0495680_0006821_295_1461 351
2735 3300047322 Ga0495680_0007750 Ga0495680_0007750_3983_5152 351
2736 3300047322 Ga0495680_0019186 Ga0495680_0019186_2951_4117 351
2737 3300047322 Ga0495680_0050134 Ga0495680_0050134_2052_3221 351
2738 3300047322 Ga0495680_0117700 Ga0495680_0117700_599_1765 351
2739 3300047323 Ga0495683_0066187 Ga0495683_0066187_132_1301 351
2740 3300047443 Ga0495687_010818 Ga0495687_010818_1631_2800 351
2741 3300047444 Ga0495675_0003053 Ga0495675_0003053_6237_7403 351
2742 3300047444 Ga0495675_0011479 Ga0495675_0011479_3899_5068 351
2743 3300047444 Ga0495675_0021384 Ga0495675_0021384_785_2065 351
2744 3300047444 Ga0495675_0028161 Ga0495675_0028161_881_2047 351
2745 3300047444 Ga0495675_0114789 Ga0495675_0114789_138_1307 351
2746 3300047470 Ga0495681_0011395 Ga0495681_0011395_2209_3378 351
2747 3300047471 Ga0495684_0002016 Ga0495684_0002016_1338_2504 351
2748 3300047471 Ga0495684_0006620 Ga0495684_0006620_7547_8713 351
2749 3300047471 Ga0495684_0009241 Ga0495684_0009241_4477_5646 351
2750 3300047471 Ga0495684_0010790 Ga0495684_0010790_5120_6400 351
2751 3300047471 Ga0495684_0013942 Ga0495684_0013942_2259_3428 351
2752 3300047471 Ga0495684_0016455 Ga0495684_0016455_413_1582 351
2753 3300047471 Ga0495684_0017301 Ga0495684_0017301_3658_4824 351
2754 3300047471 Ga0495684_0055741 Ga0495684_0055741_493_1659 351
2755 3300047471 Ga0495684_0067103 Ga0495684_0067103_450_1616 351
2756 3300047471 Ga0495684_0160931 Ga0495684_0160931_429_1598 351
2757 3300047471 Ga0495684_0174443 Ga0495684_0174443_314_1483 351
2758 3300047472 Ga0495686_0014825 Ga0495686_0014825_130_1299 351
2759 3300047472 Ga0495686_0097311 Ga0495686_0097311_394_1563 351
2760 3300047673 Ga0495593_0001200 Ga0495593_0001200_2221_3390 351
2761 3300047673 Ga0495593_0008925 Ga0495593_0008925_2733_3899 351
2762 3300047673 Ga0495593_0011269 Ga0495593_0011269_340_1506 351
2763 3300047673 Ga0495593_0047105 Ga0495593_0047105_1117_2283 351
2764 3300048088 Ga0495602_0001314 Ga0495602_0001314_14807_15973 351
2765 3300048088 Ga0495602_0002214 Ga0495602_0002214_6648_7817 351
2766 3300048088 Ga0495602_0002373 Ga0495602_0002373_9218_10387 351
2767 3300048088 Ga0495602_0015855 Ga0495602_0015855_1366_2532 351
2768 3300048089 Ga0495614_0007099 Ga0495614_0007099_2493_3659 351
2769 3300048089 Ga0495614_0042403 Ga0495614_0042403_763_1932 351
2770 3300048090 Ga0495615_0016460 Ga0495615_0016460_353_1519 351
2771 3300048903 Ga0496100_0000894 Ga0496100_0000894_7614_8780 351
2772 3300048903 Ga0496100_0001914 Ga0496100_0001914_7725_8903 351
2773 3300048903 Ga0496100_0017089 Ga0496100_0017089_1259_2425 351
2774 3300048903 Ga0496100_0149792 Ga0496100_0149792_182_1348 351
2775 3300048903 Ga0496100_0202533 Ga0496100_0202533_33_1202 351
2776 3300048904 Ga0496101_0002235 Ga0496101_0002235_7688_8854 351
2777 3300048904 Ga0496101_0010083 Ga0496101_0010083_1923_3089 351
2778 3300048904 Ga0496101_0017259 Ga0496101_0017259_2714_3880 351
2779 3300048904 Ga0496101_0017359 Ga0496101_0017359_3111_4289 351
2780 3300048904 Ga0496101_0018376 Ga0496101_0018376_3156_4325 351
2781 3300048904 Ga0496101_0034478 Ga0496101_0034478_1150_2316 351
2782 3300048904 Ga0496101_0038342 Ga0496101_0038342_1709_2878 351
2783 3300048904 Ga0496101_0050303 Ga0496101_0050303_1272_2441 351
2784 3300048904 Ga0496101_0086232 Ga0496101_0086232_649_1818 351
2785 3300048904 Ga0496101_0100572 Ga0496101_0100572_70_1263 351
2786 3300048904 Ga0496101_0144441 Ga0496101_0144441_512_1678 351
2787 3300048905 Ga0496102_0005027 Ga0496102_0005027_3424_4593 351
2788 3300048905 Ga0496102_0007763 Ga0496102_0007763_5003_6169 351
2789 3300048905 Ga0496102_0012150 Ga0496102_0012150_2752_3921 351
2790 3300048905 Ga0496102_0017100 Ga0496102_0017100_5111_6277 351
2791 3300048905 Ga0496102_0020900 Ga0496102_0020900_2990_4156 351
2792 3300048905 Ga0496102_0083804 Ga0496102_0083804_434_1609 351
2793 3300048905 Ga0496102_0084929 Ga0496102_0084929_100_1278 351
2794 3300048905 Ga0496102_0094089 Ga0496102_0094089_1069_2238 351
2795 3300048905 Ga0496102_0124750 Ga0496102_0124750_1169_2335 351
2796 3300048905 Ga0496102_0152258 Ga0496102_0152258_980_2149 351
2797 3300048905 Ga0496102_0171071 Ga0496102_0171071_311_1480 351
2798 3300048905 Ga0496102_0388576 Ga0496102_0388576_21_1301 351
2799 3300048906 Ga0496103_0002892 Ga0496103_0002892_520_1686 351
2800 3300048906 Ga0496103_0003599 Ga0496103_0003599_7688_8854 351
2801 3300048906 Ga0496103_0006142 Ga0496103_0006142_2444_3610 351
2802 3300048906 Ga0496103_0052397 Ga0496103_0052397_1341_2507 351
2803 3300048906 Ga0496103_0053875 Ga0496103_0053875_581_1756 351
2804 3300048906 Ga0496103_0074492 Ga0496103_0074492_79_1248 351
2805 3300048906 Ga0496103_0103945 Ga0496103_0103945_617_1786 351
2806 3300048907 Ga0496104_0000061 Ga0496104_0000061_40379_41545 351
2807 3300048907 Ga0496104_0001608 Ga0496104_0001608_14834_16003 351
2808 3300048907 Ga0496104_0005904 Ga0496104_0005904_4597_5763 351
2809 3300048907 Ga0496104_0009816 Ga0496104_0009816_6238_7404 351
2810 3300048907 Ga0496104_0010521 Ga0496104_0010521_6621_7787 351
2811 3300048907 Ga0496104_0011884 Ga0496104_0011884_6591_7769 351
2812 3300048907 Ga0496104_0016737 Ga0496104_0016737_1080_2255 351
2813 3300048907 Ga0496104_0020587 Ga0496104_0020587_2740_3909 351
2814 3300048907 Ga0496104_0044813 Ga0496104_0044813_1240_2406 351
2815 3300048907 Ga0496104_0072979 Ga0496104_0072979_407_1573 351
2816 3300048907 Ga0496104_0189988 Ga0496104_0189988_393_1559 351
2817 3300048908 Ga0496105_0000365 Ga0496105_0000365_12740_13906 351
2818 3300048908 Ga0496105_0002920 Ga0496105_0002920_5434_6600 351
2819 3300048908 Ga0496105_0003112 Ga0496105_0003112_6120_7286 351
2820 3300048908 Ga0496105_0004541 Ga0496105_0004541_8975_10144 351
2821 3300048908 Ga0496105_0006281 Ga0496105_0006281_1935_3104 351
2822 3300048908 Ga0496105_0014088 Ga0496105_0014088_3039_4217 351
2823 3300048908 Ga0496105_0014128 Ga0496105_0014128_2841_4010 351
2824 3300048908 Ga0496105_0024367 Ga0496105_0024367_192_1358 351
2825 3300048908 Ga0496105_0027670 Ga0496105_0027670_1022_2191 351
2826 3300048909 Ga0496106_0001140 Ga0496106_0001140_13483_14652 351
2827 3300048909 Ga0496106_0002884 Ga0496106_0002884_2063_3229 351
2828 3300048909 Ga0496106_0007418 Ga0496106_0007418_4320_5486 351
2829 3300048909 Ga0496106_0020125 Ga0496106_0020125_132_1298 351
2830 3300048909 Ga0496106_0024426 Ga0496106_0024426_2173_3339 351
2831 3300048909 Ga0496106_0043386 Ga0496106_0043386_473_1642 351
2832 3300048909 Ga0496106_0063690 Ga0496106_0063690_1187_2356 351
2833 3300048909 Ga0496106_0070094 Ga0496106_0070094_836_2014 351
2834 3300048909 Ga0496106_0123320 Ga0496106_0123320_677_1846 351
2835 3300048909 Ga0496106_0210197 Ga0496106_0210197_45_1301 351
2836 3300048910 Ga0496107_0005244 Ga0496107_0005244_94_1260 351
2837 3300048910 Ga0496107_0016685 Ga0496107_0016685_3734_4909 351
2838 3300048910 Ga0496107_0020521 Ga0496107_0020521_2219_3385 351
2839 3300048910 Ga0496107_0022051 Ga0496107_0022051_1986_3152 351
2840 3300048910 Ga0496107_0031230 Ga0496107_0031230_2604_3773 351
2841 3300048910 Ga0496107_0046671 Ga0496107_0046671_1875_3053 351
2842 3300048910 Ga0496107_0059511 Ga0496107_0059511_524_1699 351
2843 3300048910 Ga0496107_0060830 Ga0496107_0060830_976_2145 351
2844 3300048910 Ga0496107_0070560 Ga0496107_0070560_742_1911 351
2845 3300048910 Ga0496107_0090658 Ga0496107_0090658_821_1990 351
2846 3300048911 Ga0496108_0000322 Ga0496108_0000322_17978_19144 351
2847 3300048911 Ga0496108_0000515 Ga0496108_0000515_18031_19206 351
2848 3300048911 Ga0496108_0001664 Ga0496108_0001664_5456_6622 351
2849 3300048911 Ga0496108_0002753 Ga0496108_0002753_1818_2984 351
2850 3300048911 Ga0496108_0015807 Ga0496108_0015807_2975_4141 351
2851 3300048911 Ga0496108_0029173 Ga0496108_0029173_526_1692 351
2852 3300048911 Ga0496108_0039592 Ga0496108_0039592_784_1953 351
2853 3300048911 Ga0496108_0048324 Ga0496108_0048324_291_1460 351
2854 3300048911 Ga0496108_0055977 Ga0496108_0055977_835_2001 351
2855 3300048911 Ga0496108_0203032 Ga0496108_0203032_329_1498 351
2856 3300048911 Ga0496108_0300997 Ga0496108_0300997_39_1205 351
2857 3300048911 Ga0496108_0346332 Ga0496108_0346332_73_1251 351
2858 3300048912 Ga0496109_0000394 Ga0496109_0000394_31864_33030 351
2859 3300048912 Ga0496109_0001619 Ga0496109_0001619_16447_17613 351
2860 3300048912 Ga0496109_0002891 Ga0496109_0002891_35_1210 351
2861 3300048912 Ga0496109_0003998 Ga0496109_0003998_919_2085 351
2862 3300048912 Ga0496109_0004579 Ga0496109_0004579_6010_7176 351
2863 3300048912 Ga0496109_0016198 Ga0496109_0016198_873_2042 351
2864 3300048912 Ga0496109_0025734 Ga0496109_0025734_3085_4254 351
2865 3300048912 Ga0496109_0035560 Ga0496109_0035560_967_2133 351
2866 3300048912 Ga0496109_0131368 Ga0496109_0131368_519_1688 351
2867 3300048913 Ga0496110_0009681 Ga0496110_0009681_3649_4815 351
2868 3300048913 Ga0496110_0017791 Ga0496110_0017791_439_1608 351
2869 3300048913 Ga0496110_0024430 Ga0496110_0024430_1168_2334 351
2870 3300048913 Ga0496110_0031329 Ga0496110_0031329_877_2043 351
2871 3300048913 Ga0496110_0037159 Ga0496110_0037159_1545_2711 351
2872 3300048913 Ga0496110_0076056 Ga0496110_0076056_1197_2363 351
2873 3300048913 Ga0496110_0096299 Ga0496110_0096299_1302_2468 351
2874 3300048913 Ga0496110_0141887 Ga0496110_0141887_517_1686 351
2875 3300048913 Ga0496110_0220308 Ga0496110_0220308_124_1302 351
2876 3300048913 Ga0496110_0229379 Ga0496110_0229379_36_1202 351
2877 3300048913 Ga0496110_0229641 Ga0496110_0229641_36_1202 351
2878 3300048914 Ga0496111_0010326 Ga0496111_0010326_4494_5660 351
2879 3300048914 Ga0496111_0020692 Ga0496111_0020692_556_1722 351
2880 3300048914 Ga0496111_0023272 Ga0496111_0023272_3059_4225 351
2881 3300048914 Ga0496111_0026872 Ga0496111_0026872_2718_3896 351
2882 3300048914 Ga0496111_0031493 Ga0496111_0031493_2102_3268 351
2883 3300048914 Ga0496111_0033103 Ga0496111_0033103_391_1557 351
2884 3300048914 Ga0496111_0036490 Ga0496111_0036490_18_1184 351
2885 3300048914 Ga0496111_0055919 Ga0496111_0055919_668_1837 351
2886 3300048914 Ga0496111_0158525 Ga0496111_0158525_12_1178 351
2887 3300048915 Ga0496112_0000004 Ga0496112_0000004_312801_313970 351
2888 3300048915 Ga0496112_0000732 Ga0496112_0000732_16290_17456 351
2889 3300048915 Ga0496112_0000803 Ga0496112_0000803_9131_10297 351
2890 3300048915 Ga0496112_0002254 Ga0496112_0002254_12625_13791 351
2891 3300048915 Ga0496112_0004421 Ga0496112_0004421_4617_5783 351
2892 3300048915 Ga0496112_0016454 Ga0496112_0016454_1218_2387 351
2893 3300048915 Ga0496112_0031239 Ga0496112_0031239_2429_3598 351
2894 3300048915 Ga0496112_0046586 Ga0496112_0046586_1635_2804 351
2895 3300048915 Ga0496112_0051168 Ga0496112_0051168_2444_3610 351
2896 3300048915 Ga0496112_0057233 Ga0496112_0057233_2533_3702 351
2897 3300048915 Ga0496112_0109917 Ga0496112_0109917_1243_2409 351
2898 3300048915 Ga0496112_0137952 Ga0496112_0137952_351_1517 351
2899 3300048915 Ga0496112_0310281 Ga0496112_0310281_252_1421 351
2900 3300048916 Ga0496113_0001285 Ga0496113_0001285_12198_13364 351
2901 3300048916 Ga0496113_0002162 Ga0496113_0002162_5907_7073 351
2902 3300048916 Ga0496113_0007860 Ga0496113_0007860_4912_6081 351
2903 3300048916 Ga0496113_0017394 Ga0496113_0017394_1004_2173 351
2904 3300048916 Ga0496113_0018648 Ga0496113_0018648_1433_2599 351
2905 3300048916 Ga0496113_0029024 Ga0496113_0029024_2202_3380 351
2906 3300048916 Ga0496113_0038211 Ga0496113_0038211_256_1425 351
2907 3300048916 Ga0496113_0092431 Ga0496113_0092431_169_1344 351
2908 3300048916 Ga0496113_0118074 Ga0496113_0118074_796_1962 351
2909 3300048916 Ga0496113_0162012 Ga0496113_0162012_343_1512 351
2910 3300048917 Ga0496114_0008740 Ga0496114_0008740_2906_4072 351
2911 3300048917 Ga0496114_0027667 Ga0496114_0027667_3247_4413 351
2912 3300048917 Ga0496114_0048533 Ga0496114_0048533_1268_2437 351
2913 3300048917 Ga0496114_0048921 Ga0496114_0048921_187_1365 351
2914 3300048917 Ga0496114_0051863 Ga0496114_0051863_1674_2840 351
2915 3300048917 Ga0496114_0059654 Ga0496114_0059654_524_1690 351
2916 3300048917 Ga0496114_0088839 Ga0496114_0088839_287_1453 351
2917 3300048917 Ga0496114_0112567 Ga0496114_0112567_938_2107 351
2918 3300048917 Ga0496114_0113559 Ga0496114_0113559_142_1308 351
2919 3300048917 Ga0496114_0174044 Ga0496114_0174044_236_1405 351
2920 3300048917 Ga0496114_0230121 Ga0496114_0230121_172_1338 351
2921 3300048918 Ga0496115_0005923 Ga0496115_0005923_7283_8449 351
2922 3300048918 Ga0496115_0007543 Ga0496115_0007543_5216_6382 351
2923 3300048918 Ga0496115_0007578 Ga0496115_0007578_2512_3681 351
2924 3300048918 Ga0496115_0013541 Ga0496115_0013541_3803_4969 351
2925 3300048918 Ga0496115_0025561 Ga0496115_0025561_1989_3155 351
2926 3300048918 Ga0496115_0038161 Ga0496115_0038161_478_1644 351
2927 3300048918 Ga0496115_0038187 Ga0496115_0038187_870_2039 351
2928 3300048918 Ga0496115_0046759 Ga0496115_0046759_1288_2454 351
2929 3300048918 Ga0496115_0158374 Ga0496115_0158374_490_1659 351
2930 3300048918 Ga0496115_0247780 Ga0496115_0247780_138_1307 351
2931 3300048918 Ga0496115_0297816 Ga0496115_0297816_28_1206 351
2932 3300048919 Ga0496116_0003689 Ga0496116_0003689_13776_14945 351
2933 3300048919 Ga0496116_0018926 Ga0496116_0018926_2426_3601 351
2934 3300048919 Ga0496116_0020398 Ga0496116_0020398_1668_2840 351
2935 3300048920 Ga0496117_0000036 Ga0496117_0000036_40168_41337 351
2936 3300048920 Ga0496117_0012904 Ga0496117_0012904_5788_7044 351
2937 3300048920 Ga0496117_0015481 Ga0496117_0015481_642_1811 351
2938 3300048920 Ga0496117_0024395 Ga0496117_0024395_2490_3659 351
2939 3300048920 Ga0496117_0032448 Ga0496117_0032448_2420_3589 351
2940 3300048920 Ga0496117_0036596 Ga0496117_0036596_754_1926 351
2941 3300048921 Ga0496118_0003337 Ga0496118_0003337_16725_17894 351
2942 3300048921 Ga0496118_0008209 Ga0496118_0008209_8484_9653 351
2943 3300048921 Ga0496118_0020646 Ga0496118_0020646_4479_5735 351
2944 3300048921 Ga0496118_0047108 Ga0496118_0047108_1795_2967 351
2945 3300048921 Ga0496118_0056599 Ga0496118_0056599_1226_2401 351
2946 3300048921 Ga0496118_0076879 Ga0496118_0076879_692_1861 351
2947 3300048922 Ga0496119_0003438 Ga0496119_0003438_10224_11393 351
2948 3300048922 Ga0496119_0009369 Ga0496119_0009369_6948_8120 351
2949 3300048922 Ga0496119_0014973 Ga0496119_0014973_2536_3714 351
2950 3300048922 Ga0496119_0079562 Ga0496119_0079562_307_1473 351
2951 3300048922 Ga0496119_0096340 Ga0496119_0096340_446_1615 351
2952 3300048923 Ga0496120_0001678 Ga0496120_0001678_12303_13481 351
2953 3300048923 Ga0496120_0005900 Ga0496120_0005900_649_1821 351
2954 3300048923 Ga0496120_0012920 Ga0496120_0012920_2797_3966 351
2955 3300048923 Ga0496120_0025464 Ga0496120_0025464_835_2013 351
2956 3300048923 Ga0496120_0065903 Ga0496120_0065903_824_1993 351
2957 3300048924 Ga0496121_0000458 Ga0496121_0000458_70798_71967 351
2958 3300048924 Ga0496121_0000574 Ga0496121_0000574_39165_40337 351
2959 3300048924 Ga0496121_0000668 Ga0496121_0000668_44111_45280 351
2960 3300048924 Ga0496121_0005012 Ga0496121_0005012_2575_3744 351
2961 3300048924 Ga0496121_0016457 Ga0496121_0016457_3766_4935 351
2962 3300048924 Ga0496121_0030756 Ga0496121_0030756_3174_4361 351
2963 3300048924 Ga0496121_0038705 Ga0496121_0038705_1605_2774 351
2964 3300048924 Ga0496121_0054796 Ga0496121_0054796_434_1603 351
2965 3300048924 Ga0496121_0063866 Ga0496121_0063866_769_1935 351
2966 3300048924 Ga0496121_0110020 Ga0496121_0110020_737_1906 351
2967 3300048925 Ga0496122_0000002 Ga0496122_0000002_850203_851372 351
2968 3300048925 Ga0496122_0000074 Ga0496122_0000074_155161_156330 351
2969 3300048925 Ga0496122_0005799 Ga0496122_0005799_2370_3539 351
2970 3300048925 Ga0496122_0020971 Ga0496122_0020971_1688_2863 351
2971 3300048925 Ga0496122_0024524 Ga0496122_0024524_2450_3619 351
2972 3300048925 Ga0496122_0032207 Ga0496122_0032207_2450_3703 351
2973 3300048925 Ga0496122_0041965 Ga0496122_0041965_2367_3536 351
2974 3300048925 Ga0496122_0051385 Ga0496122_0051385_1206_2375 351
2975 3300048926 Ga0496123_0000002 Ga0496123_0000002_850203_851372 351
2976 3300048926 Ga0496123_0000002 Ga0496123_0000002_960311_961480 351
2977 3300048926 Ga0496123_0000062 Ga0496123_0000062_155143_156312 351
2978 3300048926 Ga0496123_0008775 Ga0496123_0008775_2856_4025 351
2979 3300048926 Ga0496123_0016930 Ga0496123_0016930_1688_2863 351
2980 3300048926 Ga0496123_0022456 Ga0496123_0022456_1889_3058 351
2981 3300048926 Ga0496123_0038669 Ga0496123_0038669_1288_2460 351
2982 3300048927 Ga0496124_0007696 Ga0496124_0007696_3999_5168 351
2983 3300048927 Ga0496124_0013261 Ga0496124_0013261_4445_5614 351
2984 3300048927 Ga0496124_0023362 Ga0496124_0023362_672_1841 351
2985 3300048927 Ga0496124_0050197 Ga0496124_0050197_875_2044 351
2986 3300048927 Ga0496124_0078400 Ga0496124_0078400_1405_2574 351
2987 3300048927 Ga0496124_0210343 Ga0496124_0210343_47_1216 351
2988 3300048928 Ga0496125_0000060 Ga0496125_0000060_37489_38658 351
2989 3300048928 Ga0496125_0000116 Ga0496125_0000116_84087_85259 351
2990 3300048928 Ga0496125_0006111 Ga0496125_0006111_1714_2889 351
2991 3300048928 Ga0496125_0008272 Ga0496125_0008272_4918_6165 351
2992 3300048928 Ga0496125_0026780 Ga0496125_0026780_2375_3631 351
2993 3300048928 Ga0496125_0034560 Ga0496125_0034560_12_1181 351
2994 3300048928 Ga0496125_0046531 Ga0496125_0046531_930_2099 351
2995 3300048928 Ga0496125_0069040 Ga0496125_0069040_393_1562 351
2996 3300048928 Ga0496125_0075447 Ga0496125_0075447_689_1861 351
2997 3300048928 Ga0496125_0084942 Ga0496125_0084942_512_1678 351
2998 3300048929 Ga0496126_0003422 Ga0496126_0003422_6892_8061 351
2999 3300048929 Ga0496126_0007480 Ga0496126_0007480_10499_11668 351
3000 3300048929 Ga0496126_0014201 Ga0496126_0014201_4497_5666 351
3001 3300048929 Ga0496126_0014911 Ga0496126_0014911_1993_3162 351
3002 3300048929 Ga0496126_0015313 Ga0496126_0015313_3207_4376 351
3003 3300048929 Ga0496126_0020126 Ga0496126_0020126_4743_5912 351
3004 3300048929 Ga0496126_0021658 Ga0496126_0021658_3711_4880 351
3005 3300048929 Ga0496126_0022450 Ga0496126_0022450_3081_4328 351
3006 3300048929 Ga0496126_0025527 Ga0496126_0025527_1573_2742 351
3007 3300048929 Ga0496126_0101955 Ga0496126_0101955_703_1869 351
3008 3300048929 Ga0496126_0102454 Ga0496126_0102454_22_1191 351
3009 3300048929 Ga0496126_0119071 Ga0496126_0119071_423_1592 351
3010 3300048929 Ga0496126_0213579 Ga0496126_0213579_31_1209 351
3011 3300049460 Ga0495682_0021095 Ga0495682_0021095_1242_2411 351
3012 3300049568 Ga0501031_0001597 Ga0501031_0001597_4733_5902 351
3013 3300049568 Ga0501031_0002121 Ga0501031_0002121_7179_8348 351
3014 3300049568 Ga0501031_0003092 Ga0501031_0003092_5882_7048 351
3015 3300049568 Ga0501031_0032796 Ga0501031_0032796_1877_3043 351
3016 3300049568 Ga0501031_0055347 Ga0501031_0055347_230_1399 351
3017 3300049568 Ga0501031_0063639 Ga0501031_0063639_999_2210 351
3018 3300049569 Ga0501032_0000008 Ga0501032_0000008_28209_29399 351
3019 3300049569 Ga0501032_0000619 Ga0501032_0000619_20973_22142 351
3020 3300049569 Ga0501032_0001926 Ga0501032_0001926_10187_11353 351
3021 3300049569 Ga0501032_0008343 Ga0501032_0008343_6021_7187 351
3022 3300049569 Ga0501032_0010824 Ga0501032_0010824_2936_4102 351
3023 3300049569 Ga0501032_0017460 Ga0501032_0017460_2148_3317 351
3024 3300049569 Ga0501032_0060433 Ga0501032_0060433_139_1305 351
3025 3300049569 Ga0501032_0075832 Ga0501032_0075832_44_1276 351
3026 3300049569 Ga0501032_0117881 Ga0501032_0117881_50_1282 351
3027 3300049569 Ga0501032_0168080 Ga0501032_0168080_46_1212 351
3028 3300049570 Ga0501033_0000012 Ga0501033_0000012_212225_213415 351
3029 3300049570 Ga0501033_0000108 Ga0501033_0000108_33273_34442 351
3030 3300049570 Ga0501033_0005509 Ga0501033_0005509_7742_8908 351
3031 3300049570 Ga0501033_0008737 Ga0501033_0008737_4252_5421 351
3032 3300049570 Ga0501033_0009630 Ga0501033_0009630_6001_7167 351
3033 3300049570 Ga0501033_0010896 Ga0501033_0010896_1521_2687 351
3034 3300049570 Ga0501033_0013189 Ga0501033_0013189_4419_5585 351
3035 3300049570 Ga0501033_0021175 Ga0501033_0021175_2904_4070 351
3036 3300049570 Ga0501033_0041393 Ga0501033_0041393_2072_3244 351
3037 3300049570 Ga0501033_0096688 Ga0501033_0096688_71_1237 351
3038 3300049570 Ga0501033_0122816 Ga0501033_0122816_105_1271 351
3039 3300049570 Ga0501033_0128007 Ga0501033_0128007_334_1503 351
3040 3300049570 Ga0501033_0139633 Ga0501033_0139633_505_1674 351
3041 3300049571 Ga0501034_0000035 Ga0501034_0000035_212225_213415 351
3042 3300049571 Ga0501034_0000100 Ga0501034_0000100_130340_131509 351
3043 3300049571 Ga0501034_0000319 Ga0501034_0000319_73108_74274 351
3044 3300049571 Ga0501034_0001353 Ga0501034_0001353_22030_23202 351
3045 3300049571 Ga0501034_0005498 Ga0501034_0005498_4994_6217 351
3046 3300049571 Ga0501034_0010766 Ga0501034_0010766_6397_7563 351
3047 3300049571 Ga0501034_0013826 Ga0501034_0013826_5049_6215 351
3048 3300049571 Ga0501034_0014581 Ga0501034_0014581_5653_6819 351
3049 3300049571 Ga0501034_0058957 Ga0501034_0058957_1148_2317 351
3050 3300049571 Ga0501034_0070062 Ga0501034_0070062_253_1419 351
3051 3300049571 Ga0501034_0129420 Ga0501034_0129420_938_2107 351
3052 3300049571 Ga0501034_0142897 Ga0501034_0142897_1083_2249 351
3053 3300049571 Ga0501034_0157141 Ga0501034_0157141_613_1779 351
3054 3300049571 Ga0501034_0204816 Ga0501034_0204816_718_1884 351
3055 3300049571 Ga0501034_0408264 Ga0501034_0408264_37_1206 351
3056 3300049572 Ga0501036_0000006 Ga0501036_0000006_212225_213415 351
3057 3300049572 Ga0501036_0000769 Ga0501036_0000769_4007_5173 351
3058 3300049572 Ga0501036_0001566 Ga0501036_0001566_458_1690 351
3059 3300049572 Ga0501036_0004308 Ga0501036_0004308_3401_4570 351
3060 3300049572 Ga0501036_0014462 Ga0501036_0014462_2575_3741 351
3061 3300049572 Ga0501036_0029821 Ga0501036_0029821_1232_2479 351
3062 3300049572 Ga0501036_0065821 Ga0501036_0065821_1785_3008 351
3063 3300049572 Ga0501036_0104953 Ga0501036_0104953_991_2157 351
3064 3300049572 Ga0501036_0233052 Ga0501036_0233052_251_1423 351
3065 3300049572 Ga0501036_0280263 Ga0501036_0280263_100_1329 351
3066 3300049572 Ga0501036_0297235 Ga0501036_0297235_105_1292 351
3067 3300049573 Ga0501037_0000072 Ga0501037_0000072_28209_29399 351
3068 3300049573 Ga0501037_0000153 Ga0501037_0000153_14503_15672 351
3069 3300049573 Ga0501037_0000386 Ga0501037_0000386_6014_7180 351
3070 3300049573 Ga0501037_0008879 Ga0501037_0008879_1917_3086 351
3071 3300049573 Ga0501037_0010014 Ga0501037_0010014_418_1587 351
3072 3300049573 Ga0501037_0010426 Ga0501037_0010426_518_1684 351
3073 3300049573 Ga0501037_0012514 Ga0501037_0012514_4262_5428 351
3074 3300049573 Ga0501037_0019253 Ga0501037_0019253_1830_2999 351
3075 3300049573 Ga0501037_0047037 Ga0501037_0047037_54_1226 351
3076 3300049573 Ga0501037_0062776 Ga0501037_0062776_233_1399 351
3077 3300049573 Ga0501037_0072307 Ga0501037_0072307_948_2114 351
3078 3300049573 Ga0501037_0109022 Ga0501037_0109022_62_1231 351
3079 3300049573 Ga0501037_0141424 Ga0501037_0141424_157_1323 351
3080 3300049574 Ga0501038_0000007 Ga0501038_0000007_28209_29399 351
3081 3300049574 Ga0501038_0000138 Ga0501038_0000138_48802_49971 351
3082 3300049574 Ga0501038_0000575 Ga0501038_0000575_25856_27088 351
3083 3300049574 Ga0501038_0000999 Ga0501038_0000999_17543_18712 351
3084 3300049574 Ga0501038_0004019 Ga0501038_0004019_10492_11658 351
3085 3300049574 Ga0501038_0012452 Ga0501038_0012452_4230_5399 351
3086 3300049574 Ga0501038_0026001 Ga0501038_0026001_1391_2560 351
3087 3300049574 Ga0501038_0031485 Ga0501038_0031485_2227_3393 351
3088 3300049574 Ga0501038_0039232 Ga0501038_0039232_2079_3290 351
3089 3300049574 Ga0501038_0051632 Ga0501038_0051632_1142_2308 351
3090 3300049574 Ga0501038_0071647 Ga0501038_0071647_1747_2913 351
3091 3300049574 Ga0501038_0079031 Ga0501038_0079031_1472_2641 351
3092 3300049574 Ga0501038_0090799 Ga0501038_0090799_876_2042 351
3093 3300049574 Ga0501038_0196696 Ga0501038_0196696_152_1318 351
3094 3300049575 Ga0501039_0000012 Ga0501039_0000012_212225_213415 351
3095 3300049575 Ga0501039_0005026 Ga0501039_0005026_393_1562 351
3096 3300049575 Ga0501039_0007888 Ga0501039_0007888_1448_2680 351
3097 3300049575 Ga0501039_0036387 Ga0501039_0036387_152_1318 351
3098 3300049575 Ga0501039_0044093 Ga0501039_0044093_1081_2328 351
3099 3300049575 Ga0501039_0048916 Ga0501039_0048916_293_1459 351
3100 3300049575 Ga0501039_0060551 Ga0501039_0060551_993_2159 351
3101 3300049575 Ga0501039_0069857 Ga0501039_0069857_840_2009 351
3102 3300049575 Ga0501039_0074160 Ga0501039_0074160_963_2129 351
3103 3300049575 Ga0501039_0081004 Ga0501039_0081004_1022_2188 351
3104 3300049575 Ga0501039_0083826 Ga0501039_0083826_778_1947 351
3105 3300049575 Ga0501039_0104889 Ga0501039_0104889_537_1748 351
3106 3300049575 Ga0501039_0115394 Ga0501039_0115394_82_1254 351
3107 3300049575 Ga0501039_0131202 Ga0501039_0131202_204_1427 351
3108 3300049575 Ga0501039_0137252 Ga0501039_0137252_455_1624 351
3109 3300049576 Ga0501040_0001880 Ga0501040_0001880_930_2120 351
3110 3300049576 Ga0501040_0024632 Ga0501040_0024632_1685_2851 351
3111 3300049576 Ga0501040_0063855 Ga0501040_0063855_452_1618 351
3112 3300049577 Ga0501041_0075539 Ga0501041_0075539_52_1221 351
3113 3300049578 Ga0501042_0053387 Ga0501042_0053387_395_1564 351
3114 3300049578 Ga0501042_0109750 Ga0501042_0109750_283_1515 351
3115 3300049579 Ga0501043_0000022 Ga0501043_0000022_88666_89832 351
3116 3300049579 Ga0501043_0000085 Ga0501043_0000085_44827_45996 351
3117 3300049579 Ga0501043_0000211 Ga0501043_0000211_28209_29399 351
3118 3300049579 Ga0501043_0019496 Ga0501043_0019496_3169_4401 351
3119 3300049579 Ga0501043_0025654 Ga0501043_0025654_2224_3390 351
3120 3300049579 Ga0501043_0031144 Ga0501043_0031144_766_1932 351
3121 3300049579 Ga0501043_0035591 Ga0501043_0035591_1910_3133 351
3122 3300049579 Ga0501043_0039538 Ga0501043_0039538_1979_3145 351
3123 3300049579 Ga0501043_0042729 Ga0501043_0042729_508_1719 351
3124 3300049579 Ga0501043_0043378 Ga0501043_0043378_1623_2789 351
3125 3300049579 Ga0501043_0046856 Ga0501043_0046856_1074_2243 351
3126 3300049579 Ga0501043_0050782 Ga0501043_0050782_151_1320 351
3127 3300049579 Ga0501043_0054900 Ga0501043_0054900_214_1380 351
3128 3300049579 Ga0501043_0062866 Ga0501043_0062866_1223_2470 351
3129 3300049579 Ga0501043_0072831 Ga0501043_0072831_944_2110 351
3130 3300049579 Ga0501043_0246896 Ga0501043_0246896_191_1357 351
3131 3300049580 Ga0501046_0000267 Ga0501046_0000267_45846_47015 351
3132 3300049580 Ga0501046_0001536 Ga0501046_0001536_14307_15539 351
3133 3300049580 Ga0501046_0013460 Ga0501046_0013460_5608_6774 351
3134 3300049580 Ga0501046_0026846 Ga0501046_0026846_2773_4020 351
3135 3300049580 Ga0501046_0062164 Ga0501046_0062164_1651_2817 351
3136 3300049580 Ga0501046_0075547 Ga0501046_0075547_1201_2367 351
3137 3300049580 Ga0501046_0082690 Ga0501046_0082690_124_1293 351
3138 3300049580 Ga0501046_0091570 Ga0501046_0091570_344_1510 351
3139 3300049581 Ga0501047_0000079 Ga0501047_0000079_114121_115344 351
3140 3300049581 Ga0501047_0000221 Ga0501047_0000221_32967_34136 351
3141 3300049581 Ga0501047_0000380 Ga0501047_0000380_30006_31196 351
3142 3300049581 Ga0501047_0012718 Ga0501047_0012718_1606_2772 351
3143 3300049581 Ga0501047_0015912 Ga0501047_0015912_1630_2796 351
3144 3300049581 Ga0501047_0017518 Ga0501047_0017518_59_1291 351
3145 3300049581 Ga0501047_0031463 Ga0501047_0031463_1397_2563 351
3146 3300049581 Ga0501047_0041124 Ga0501047_0041124_569_1735 351
3147 3300049581 Ga0501047_0049538 Ga0501047_0049538_2082_3251 351
3148 3300049581 Ga0501047_0086994 Ga0501047_0086994_645_1811 351
3149 3300049581 Ga0501047_0123188 Ga0501047_0123188_853_2019 351
3150 3300049581 Ga0501047_0174771 Ga0501047_0174771_833_1999 351
3151 3300049581 Ga0501047_0215616 Ga0501047_0215616_177_1343 351
3152 3300049581 Ga0501047_0279342 Ga0501047_0279342_294_1460 351
3153 3300049582 Ga0501048_0000582 Ga0501048_0000582_9103_10326 351
3154 3300049582 Ga0501048_0000858 Ga0501048_0000858_18504_19673 351
3155 3300049582 Ga0501048_0002076 Ga0501048_0002076_6363_7610 351
3156 3300049582 Ga0501048_0008960 Ga0501048_0008960_2129_3295 351
3157 3300049582 Ga0501048_0135146 Ga0501048_0135146_290_1456 351
3158 3300049583 Ga0501067_0000104 Ga0501067_0000104_2206_3375 351
3159 3300049583 Ga0501067_0008785 Ga0501067_0008785_778_1944 351
3160 3300049583 Ga0501067_0046728 Ga0501067_0046728_747_1913 351
3161 3300049584 Ga0501068_0000689 Ga0501068_0000689_7127_8296 351
3162 3300049584 Ga0501068_0021689 Ga0501068_0021689_1087_2319 351
3163 3300049584 Ga0501068_0034598 Ga0501068_0034598_1794_2963 351
3164 3300049584 Ga0501068_0049382 Ga0501068_0049382_1159_2370 351
3165 3300049585 Ga0501069_0000284 Ga0501069_0000284_21530_22696 351
3166 3300049585 Ga0501069_0003185 Ga0501069_0003185_5455_6624 351
3167 3300049585 Ga0501069_0018590 Ga0501069_0018590_709_1875 351
3168 3300049585 Ga0501069_0071911 Ga0501069_0071911_219_1388 351
3169 3300049585 Ga0501069_0086027 Ga0501069_0086027_68_1234 351
3170 3300049586 Ga0501070_0000103 Ga0501070_0000103_35422_36588 351
3171 3300049586 Ga0501070_0000601 Ga0501070_0000601_7072_8241 351
3172 3300049586 Ga0501070_0003323 Ga0501070_0003323_6916_8082 351
3173 3300049586 Ga0501070_0015274 Ga0501070_0015274_2263_3429 351
3174 3300049586 Ga0501070_0026619 Ga0501070_0026619_382_1614 351
3175 3300049586 Ga0501070_0028528 Ga0501070_0028528_528_1751 351
3176 3300049586 Ga0501070_0040501 Ga0501070_0040501_2182_3348 351
3177 3300049586 Ga0501070_0041137 Ga0501070_0041137_811_1977 351
3178 3300049586 Ga0501070_0146822 Ga0501070_0146822_45_1211 351
3179 3300049586 Ga0501070_0257447 Ga0501070_0257447_64_1242 351
3180 3300049586 Ga0501070_0268111 Ga0501070_0268111_61_1227 351
3181 3300049587 Ga0501071_0022525 Ga0501071_0022525_1634_2881 351
3182 3300049587 Ga0501071_0054744 Ga0501071_0054744_285_1451 351
3183 3300049587 Ga0501071_0069838 Ga0501071_0069838_413_1579 351
3184 3300049587 Ga0501071_0083339 Ga0501071_0083339_912_2144 351
3185 3300049587 Ga0501071_0102904 Ga0501071_0102904_14_1180 351
3186 3300049587 Ga0501071_0105884 Ga0501071_0105884_219_1388 351
3187 3300049588 Ga0501072_0001082 Ga0501072_0001082_18665_19831 351
3188 3300049588 Ga0501072_0001591 Ga0501072_0001591_11538_12707 351
3189 3300049588 Ga0501072_0009005 Ga0501072_0009005_1174_2340 351
3190 3300049588 Ga0501072_0020421 Ga0501072_0020421_2201_3448 351
3191 3300049588 Ga0501072_0043055 Ga0501072_0043055_1367_2533 351
3192 3300049589 Ga0501073_0000290 Ga0501073_0000290_23482_24651 351
3193 3300049589 Ga0501073_0026954 Ga0501073_0026954_1985_3151 351
3194 3300049589 Ga0501073_0047809 Ga0501073_0047809_688_1857 351
3195 3300049589 Ga0501073_0064742 Ga0501073_0064742_345_1511 351
3196 3300049589 Ga0501073_0092831 Ga0501073_0092831_247_1413 351
3197 3300049589 Ga0501073_0175172 Ga0501073_0175172_276_1445 351
3198 3300049590 Ga0501074_0000094 Ga0501074_0000094_37127_38296 351
3199 3300049590 Ga0501074_0000627 Ga0501074_0000627_1377_2543 351
3200 3300049590 Ga0501074_0008381 Ga0501074_0008381_365_1531 351
3201 3300049590 Ga0501074_0078327 Ga0501074_0078327_81_1271 351
3202 3300049590 Ga0501074_0084640 Ga0501074_0084640_1030_2196 351
3203 3300049590 Ga0501074_0093634 Ga0501074_0093634_249_1418 351
3204 3300049590 Ga0501074_0114939 Ga0501074_0114939_154_1323 351
3205 3300049590 Ga0501074_0130983 Ga0501074_0130983_45_1211 351
3206 3300049590 Ga0501074_0166927 Ga0501074_0166927_258_1424 351
3207 3300049591 Ga0501075_0009599 Ga0501075_0009599_962_2209 351
3208 3300049591 Ga0501075_0033946 Ga0501075_0033946_1996_3162 351
3209 3300049591 Ga0501075_0037983 Ga0501075_0037983_1170_2336 351
3210 3300049591 Ga0501075_0039882 Ga0501075_0039882_1914_3083 351
3211 3300049591 Ga0501075_0186834 Ga0501075_0186834_56_1225 351
3212 3300049592 Ga0501076_0010260 Ga0501076_0010260_3636_4802 351
3213 3300049592 Ga0501076_0016240 Ga0501076_0016240_3440_4609 351
3214 3300049592 Ga0501076_0067934 Ga0501076_0067934_257_1423 351
3215 3300049592 Ga0501076_0232011 Ga0501076_0232011_40_1206 351
3216 3300049593 Ga0501077_0009864 Ga0501077_0009864_3864_5090 351
3217 3300049741 Ga0501079_0000727 Ga0501079_0000727_11583_12752 351
3218 3300049741 Ga0501079_0002574 Ga0501079_0002574_1635_2804 351
3219 3300049741 Ga0501079_0027439 Ga0501079_0027439_1116_2363 351
3220 3300049741 Ga0501079_0045485 Ga0501079_0045485_196_1362 351
3221 3300049741 Ga0501079_0120828 Ga0501079_0120828_24_1190 351
3222 3300049742 Ga0501080_0007905 Ga0501080_0007905_2522_3688 351
3223 3300049742 Ga0501080_0008900 Ga0501080_0008900_7655_8878 351
3224 3300049742 Ga0501080_0009419 Ga0501080_0009419_3589_4755 351
3225 3300049742 Ga0501080_0029767 Ga0501080_0029767_312_1478 351
3226 3300049742 Ga0501080_0036485 Ga0501080_0036485_2301_3467 351
3227 3300049742 Ga0501080_0047761 Ga0501080_0047761_2740_3909 351
3228 3300049742 Ga0501080_0055234 Ga0501080_0055234_263_1429 351
3229 3300049742 Ga0501080_0087084 Ga0501080_0087084_1212_2378 351
3230 3300049742 Ga0501080_0121138 Ga0501080_0121138_1243_2409 351
3231 3300049742 Ga0501080_0202660 Ga0501080_0202660_414_1583 351
3232 3300049742 Ga0501080_0344415 Ga0501080_0344415_46_1212 351
3233 3300049743 Ga0501081_0001063 Ga0501081_0001063_8758_9927 351
3234 3300049743 Ga0501081_0056938 Ga0501081_0056938_996_2162 351
3235 3300049744 Ga0501083_0000087 Ga0501083_0000087_38208_39377 351
3236 3300049744 Ga0501083_0000374 Ga0501083_0000374_26822_27988 351
3237 3300049744 Ga0501083_0001525 Ga0501083_0001525_10845_12038 351
3238 3300049744 Ga0501083_0003683 Ga0501083_0003683_3012_4235 351
3239 3300049744 Ga0501083_0053580 Ga0501083_0053580_1145_2311 351
3240 3300049744 Ga0501083_0116504 Ga0501083_0116504_375_1544 351
3241 3300049744 Ga0501083_0149420 Ga0501083_0149420_130_1296 351
3242 3300049744 Ga0501083_0170214 Ga0501083_0170214_77_1243 351
3243 3300049744 Ga0501083_0189189 Ga0501083_0189189_136_1305 351
3244 3300049822 Ga0501035_0000035 Ga0501035_0000035_137518_138708 351
3245 3300049822 Ga0501035_0000223 Ga0501035_0000223_38757_39926 351
3246 3300049822 Ga0501035_0001800 Ga0501035_0001800_7047_8213 351
3247 3300049822 Ga0501035_0003063 Ga0501035_0003063_8940_10106 351
3248 3300049822 Ga0501035_0003617 Ga0501035_0003617_345_1511 351
3249 3300049822 Ga0501035_0013006 Ga0501035_0013006_154_1320 351
3250 3300049822 Ga0501035_0013765 Ga0501035_0013765_4887_6053 351
3251 3300049822 Ga0501035_0016640 Ga0501035_0016640_2235_3401 351
3252 3300049822 Ga0501035_0019507 Ga0501035_0019507_558_1727 351
3253 3300049822 Ga0501035_0021754 Ga0501035_0021754_1137_2303 351
3254 3300049822 Ga0501035_0021999 Ga0501035_0021999_64_1230 351
3255 3300049822 Ga0501035_0029550 Ga0501035_0029550_17_1189 351
3256 3300049822 Ga0501035_0033390 Ga0501035_0033390_2938_4110 351
3257 3300049822 Ga0501035_0048984 Ga0501035_0048984_2550_3716 351
3258 3300049822 Ga0501035_0059069 Ga0501035_0059069_1926_3095 351
3259 3300049822 Ga0501035_0060562 Ga0501035_0060562_444_1613 351
3260 3300049822 Ga0501035_0075059 Ga0501035_0075059_1130_2296 351
3261 3300049822 Ga0501035_0128079 Ga0501035_0128079_226_1473 351
3262 3300049822 Ga0501035_0139838 Ga0501035_0139838_184_1416 351
3263 3300049822 Ga0501035_0182242 Ga0501035_0182242_515_1681 351
3264 3300049823 Ga0501044_0000015 Ga0501044_0000015_28209_29399 351
3265 3300049823 Ga0501044_0000369 Ga0501044_0000369_50271_51440 351
3266 3300049823 Ga0501044_0000516 Ga0501044_0000516_19200_20366 351
3267 3300049823 Ga0501044_0000578 Ga0501044_0000578_37258_38424 351
3268 3300049823 Ga0501044_0008397 Ga0501044_0008397_5541_6773 351
3269 3300049823 Ga0501044_0008812 Ga0501044_0008812_7792_8961 351
3270 3300049823 Ga0501044_0013155 Ga0501044_0013155_5775_6947 351
3271 3300049823 Ga0501044_0015943 Ga0501044_0015943_1667_2833 351
3272 3300049823 Ga0501044_0016305 Ga0501044_0016305_5221_6387 351
3273 3300049823 Ga0501044_0016560 Ga0501044_0016560_434_1600 351
3274 3300049823 Ga0501044_0017409 Ga0501044_0017409_280_1446 351
3275 3300049823 Ga0501044_0018763 Ga0501044_0018763_1999_3168 351
3276 3300049823 Ga0501044_0023766 Ga0501044_0023766_3417_4640 351
3277 3300049823 Ga0501044_0065124 Ga0501044_0065124_2130_3296 351
3278 3300049823 Ga0501044_0067647 Ga0501044_0067647_2384_3595 351
3279 3300049823 Ga0501044_0071838 Ga0501044_0071838_320_1486 351
3280 3300049823 Ga0501044_0072377 Ga0501044_0072377_1172_2341 351
3281 3300049823 Ga0501044_0073799 Ga0501044_0073799_861_2027 351
3282 3300049823 Ga0501044_0094349 Ga0501044_0094349_482_1651 351
3283 3300049823 Ga0501044_0116320 Ga0501044_0116320_1426_2592 351
3284 3300049823 Ga0501044_0191864 Ga0501044_0191864_91_1257 351
3285 3300049823 Ga0501044_0222535 Ga0501044_0222535_437_1606 351
3286 3300049823 Ga0501044_0358921 Ga0501044_0358921_191_1357 351
3287 3300049823 Ga0501044_0380401 Ga0501044_0380401_124_1290 351
3288 3300049824 Ga0501045_0003601 Ga0501045_0003601_376_1542 351
3289 3300049824 Ga0501045_0027818 Ga0501045_0027818_1715_2962 351
3290 3300049824 Ga0501045_0030334 Ga0501045_0030334_55_1224 351
3291 3300049824 Ga0501045_0213603 Ga0501045_0213603_155_1321 351
3292 3300050489 nmdc:mga03683_21282_c1 nmdc:mga03683_21282_c1_840_2009 351
3293 3300050489 nmdc:mga03683_37247_c1 nmdc:mga03683_37247_c1_403_1569 351
3294 3300050490 nmdc:mga03n38_380_c1 nmdc:mga03n38_380_c1_9405_10574 351
3295 3300050491 nmdc:mga00v17_12168_c2 nmdc:mga00v17_12168_c2_1615_2871 351
3296 3300050491 nmdc:mga00v17_125571_c1 nmdc:mga00v17_125571_c1_12_1178 351
3297 3300050491 nmdc:mga00v17_51_c1 nmdc:mga00v17_51_c1_70740_71909 351
3298 3300050492 nmdc:mga0yw44_131209_c1 nmdc:mga0yw44_131209_c1_324_1502 351
3299 3300050492 nmdc:mga0yw44_21266_c1 nmdc:mga0yw44_21266_c1_2023_3189 351
3300 3300050492 nmdc:mga0yw44_2950_c1 nmdc:mga0yw44_2950_c1_2191_3384 351
3301 3300050492 nmdc:mga0yw44_5645_c1 nmdc:mga0yw44_5645_c1_3911_5080 351
3302 3300050492 nmdc:mga0yw44_78188_c1 nmdc:mga0yw44_78188_c1_794_1963 351
3303 3300050493 nmdc:mga0k408_127740_c1 nmdc:mga0k408_127740_c1_124_1293 351
3304 3300050493 nmdc:mga0k408_33002_c1 nmdc:mga0k408_33002_c1_1021_2187 351
3305 3300050494 nmdc:mga06z11_11646_c1 nmdc:mga06z11_11646_c1_955_2124 351
3306 3300050494 nmdc:mga06z11_1301_c1 nmdc:mga06z11_1301_c1_59_1228 351
3307 3300050494 nmdc:mga06z11_143627_c1 nmdc:mga06z11_143627_c1_84_1250 351
3308 3300050494 nmdc:mga06z11_24940_c1 nmdc:mga06z11_24940_c1_1625_2794 351
3309 3300050494 nmdc:mga06z11_27745_c1 nmdc:mga06z11_27745_c1_1367_2533 351
3310 3300050494 nmdc:mga06z11_36507_c1 nmdc:mga06z11_36507_c1_349_1518 351
3311 3300050494 nmdc:mga06z11_81524_c1 nmdc:mga06z11_81524_c1_413_1591 351
3312 3300050495 nmdc:mga04h51_54215_c1 nmdc:mga04h51_54215_c1_117_1286 351
3313 3300050496 nmdc:mga07m45_49149_c1 nmdc:mga07m45_49149_c1_141_1307 351
3314 3300050496 nmdc:mga07m45_5309_c2 nmdc:mga07m45_5309_c2_270_1439 351
3315 3300050507 nmdc:mga05p37_113589_c1 nmdc:mga05p37_113589_c1_28_1194 351
3316 3300050507 nmdc:mga05p37_1242_c1 nmdc:mga05p37_1242_c1_8623_9882 351
3317 3300050507 nmdc:mga05p37_196059_c1 nmdc:mga05p37_196059_c1_881_2047 351
3318 3300050507 nmdc:mga05p37_2458_c1 nmdc:mga05p37_2458_c1_442_1611 351
3319 3300050507 nmdc:mga05p37_292909_c1 nmdc:mga05p37_292909_c1_161_1327 351
3320 3300050507 nmdc:mga05p37_324851_c1 nmdc:mga05p37_324851_c1_508_1677 351
3321 3300050507 nmdc:mga05p37_62833_c1 nmdc:mga05p37_62833_c1_674_1840 351
3322 3300050507 nmdc:mga05p37_7606_c1 nmdc:mga05p37_7606_c1_10853_12112 351
3323 3300050507 nmdc:mga05p37_83403_c1 nmdc:mga05p37_83403_c1_951_2117 351
3324 3300050507 nmdc:mga05p37_8850_c1 nmdc:mga05p37_8850_c1_7867_9036 351
3325 3300050507 nmdc:mga05p37_9470_c1 nmdc:mga05p37_9470_c1_2615_3781 351
3326 3300050508 nmdc:mga09592_10948_c1 nmdc:mga09592_10948_c1_5806_6972 351
3327 3300050508 nmdc:mga09592_480_c1 nmdc:mga09592_480_c1_20006_21265 351
3328 3300050508 nmdc:mga09592_800_c1 nmdc:mga09592_800_c1_18589_19758 351
3329 3300050508 nmdc:mga09592_848_c1 nmdc:mga09592_848_c1_19672_20841 351
3330 3300050509 nmdc:mga0qj67_17812_c1 nmdc:mga0qj67_17812_c1_1182_2348 351
3331 3300050509 nmdc:mga0qj67_23821_c1 nmdc:mga0qj67_23821_c1_2650_3816 351
3332 3300050509 nmdc:mga0qj67_514_c1 nmdc:mga0qj67_514_c1_14165_15424 351
3333 3300050510 nmdc:mga06r32_117911_c1 nmdc:mga06r32_117911_c1_576_1742 351
3334 3300050510 nmdc:mga06r32_1406_c1 nmdc:mga06r32_1406_c1_526_1695 351
3335 3300050510 nmdc:mga06r32_417029_c1 nmdc:mga06r32_417029_c1_38_1207 351
3336 3300050510 nmdc:mga06r32_62800_c1 nmdc:mga06r32_62800_c1_1289_2455 351
3337 3300050510 nmdc:mga06r32_94_c1 nmdc:mga06r32_94_c1_57504_58673 351
3338 3300050510 nmdc:mga06r32_9941_c1 nmdc:mga06r32_9941_c1_5580_6746 351
3339 3300050511 nmdc:mga08y16_1532_c1 nmdc:mga08y16_1532_c1_14073_15332 351
3340 3300050511 nmdc:mga08y16_1541_c2 nmdc:mga08y16_1541_c2_13604_14773 351
3341 3300050511 nmdc:mga08y16_160_c1 nmdc:mga08y16_160_c1_29218_30387 351
3342 3300050511 nmdc:mga08y16_1962_c1 nmdc:mga08y16_1962_c1_14702_15868 351
3343 3300050511 nmdc:mga08y16_20423_c1 nmdc:mga08y16_20423_c1_2278_3444 351
3344 3300050511 nmdc:mga08y16_236041_c1 nmdc:mga08y16_236041_c1_255_1421 351
3345 3300050511 nmdc:mga08y16_2747_c1 nmdc:mga08y16_2747_c1_15749_16918 351
3346 3300050511 nmdc:mga08y16_410_c1 nmdc:mga08y16_410_c1_33967_35133 351
3347 3300050511 nmdc:mga08y16_44609_c1 nmdc:mga08y16_44609_c1_2751_3917 351
3348 3300050511 nmdc:mga08y16_89906_c1 nmdc:mga08y16_89906_c1_943_2109 351
3349 3300050512 nmdc:mga0n895_114842_c1 nmdc:mga0n895_114842_c1_1347_2516 351
3350 3300050512 nmdc:mga0n895_1152_c1 nmdc:mga0n895_1152_c1_1046_2305 351
3351 3300050512 nmdc:mga0n895_174865_c1 nmdc:mga0n895_174865_c1_972_2138 351
3352 3300050512 nmdc:mga0n895_21004_c1 nmdc:mga0n895_21004_c1_4751_5917 351
3353 3300050512 nmdc:mga0n895_271922_c1 nmdc:mga0n895_271922_c1_418_1584 351
3354 3300050512 nmdc:mga0n895_31905_c1 nmdc:mga0n895_31905_c1_899_2065 351
3355 3300050512 nmdc:mga0n895_32724_c1 nmdc:mga0n895_32724_c1_1205_2371 351
3356 3300050512 nmdc:mga0n895_358_c1 nmdc:mga0n895_358_c1_29215_30474 351
3357 3300050512 nmdc:mga0n895_791_c2 nmdc:mga0n895_791_c2_5124_6290 351
3358 3300050513 nmdc:mga0rr50_266743_c1 nmdc:mga0rr50_266743_c1_227_1393 351
3359 3300050514 nmdc:mga08x19_29347_c1 nmdc:mga08x19_29347_c1_659_1825 351
3360 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_400170_401339 351
3361 3300050515 nmdc:mga0a205_102898_c1 nmdc:mga0a205_102898_c1_1075_2241 351
3362 3300050515 nmdc:mga0a205_133555_c1 nmdc:mga0a205_133555_c1_812_1978 351
3363 3300050515 nmdc:mga0a205_234740_c1 nmdc:mga0a205_234740_c1_175_1341 351
3364 3300050515 nmdc:mga0a205_35179_c1 nmdc:mga0a205_35179_c1_1115_2281 351
3365 3300050515 nmdc:mga0a205_39044_c1 nmdc:mga0a205_39044_c1_620_1786 351
3366 3300053077 Ga0495601_0000095 Ga0495601_0000095_637_1803 351
3367 3300053077 Ga0495601_0000316 Ga0495601_0000316_15914_17080 351
3368 3300053077 Ga0495601_0002508 Ga0495601_0002508_4923_6089 351
3369 3300053077 Ga0495601_0006189 Ga0495601_0006189_607_1773 351
3370 3300053077 Ga0495601_0031775 Ga0495601_0031775_66_1232 351
3371 3300053077 Ga0495601_0033666 Ga0495601_0033666_74_1240 351
3372 3300053077 Ga0495601_0041563 Ga0495601_0041563_32_1201 351
3373 3300053077 Ga0495601_0042354 Ga0495601_0042354_1034_2314 351
3374 3300053077 Ga0495601_0133294 Ga0495601_0133294_386_1555 351
3375 3300053077 Ga0495601_0155440 Ga0495601_0155440_80_1246 351
3376 3300053078 Ga0495612_0000118 Ga0495612_0000118_27299_28465 351
3377 3300053078 Ga0495612_0000812 Ga0495612_0000812_5744_6910 351
3378 3300053078 Ga0495612_0000834 Ga0495612_0000834_8855_10024 351
3379 3300053078 Ga0495612_0012919 Ga0495612_0012919_898_2064 351
3380 3300053078 Ga0495612_0100551 Ga0495612_0100551_49_1218 351
3381 3300053079 Ga0500610_0033875 Ga0500610_0033875_1282_2448 351
3382 3300053080 Ga0500635_0000553 Ga0500635_0000553_4327_5496 351
3383 3300053083 Ga0495655_0009867 Ga0495655_0009867_249_1415 351
3384 3300053084 Ga0495595_0000214 Ga0495595_0000214_21177_22457 351
3385 3300053084 Ga0495595_0000261 Ga0495595_0000261_4261_5427 351
3386 3300053084 Ga0495595_0002798 Ga0495595_0002798_2262_3428 351
3387 3300053084 Ga0495595_0017420 Ga0495595_0017420_1905_3074 351
3388 3300053084 Ga0495595_0017958 Ga0495595_0017958_292_1458 351
3389 3300053084 Ga0495595_0033329 Ga0495595_0033329_660_1826 351
3390 3300053084 Ga0495595_0035642 Ga0495595_0035642_256_1422 351
3391 3300053084 Ga0495595_0037724 Ga0495595_0037724_432_1601 351
3392 3300053084 Ga0495595_0066140 Ga0495595_0066140_403_1572 351
3393 3300053085 Ga0495619_0000056 Ga0495619_0000056_1427_2593 351
3394 3300053085 Ga0495619_0000351 Ga0495619_0000351_8405_9685 351
3395 3300053085 Ga0495619_0000498 Ga0495619_0000498_5770_6936 351
3396 3300053085 Ga0495619_0001245 Ga0495619_0001245_5032_6201 351
3397 3300053085 Ga0495619_0002197 Ga0495619_0002197_1038_2204 351
3398 3300053085 Ga0495619_0012921 Ga0495619_0012921_3069_4238 351
3399 3300053085 Ga0495619_0027358 Ga0495619_0027358_599_1765 351
3400 3300053085 Ga0495619_0030001 Ga0495619_0030001_261_1427 351
3401 3300053085 Ga0495619_0037857 Ga0495619_0037857_1820_2986 351
3402 3300053085 Ga0495619_0078589 Ga0495619_0078589_767_1933 351
3403 3300053085 Ga0495619_0079671 Ga0495619_0079671_636_1814 351
3404 3300053085 Ga0495619_0086632 Ga0495619_0086632_341_1507 351
3405 3300053085 Ga0495619_0184490 Ga0495619_0184490_53_1219 351
3406 3300053085 Ga0495619_0205481 Ga0495619_0205481_30_1196 351
3407 3300053085 Ga0495619_0241310 Ga0495619_0241310_68_1237 351
3408 3300053087 Ga0500643_000035 Ga0500643_000035_75933_77108 351
3409 3300053087 Ga0500643_004228 Ga0500643_004228_1353_2519 351
3410 3300053088 Ga0500644_0000325 Ga0500644_0000325_18487_19653 351
3411 3300053089 Ga0500581_068891 Ga0500581_068891_98_1267 351
3412 3300053093 Ga0500651_0008405 Ga0500651_0008405_842_2008 351
3413 3300053093 Ga0500651_0040446 Ga0500651_0040446_1637_2806 351
3414 3300053093 Ga0500651_0086345 Ga0500651_0086345_590_1759 351
3415 3300053094 Ga0500566_0000006 Ga0500566_0000006_73146_74315 351
3416 3300053094 Ga0500566_0001514 Ga0500566_0001514_1212_2381 351
3417 3300053094 Ga0500566_0002990 Ga0500566_0002990_8671_9840 351
3418 3300053094 Ga0500566_0014528 Ga0500566_0014528_2014_3180 351
3419 3300053095 Ga0500640_000996 Ga0500640_000996_6537_7706 351
3420 3300053096 Ga0500641_0001371 Ga0500641_0001371_4618_5784 351
3421 3300053096 Ga0500641_0003439 Ga0500641_0003439_908_2077 351
3422 3300053096 Ga0500641_0011224 Ga0500641_0011224_270_1436 351
3423 3300053098 Ga0500650_0000139 Ga0500650_0000139_12307_13476 351
3424 3300053103 Ga0500555_005851 Ga0500555_005851_852_2027 351
3425 3300053104 Ga0500556_0000002 Ga0500556_0000002_421048_422217 351
3426 3300053104 Ga0500556_0005941 Ga0500556_0005941_1559_2734 351
3427 3300053105 Ga0500557_000004 Ga0500557_000004_76696_77871 351
3428 3300053107 Ga0500560_000106 Ga0500560_000106_6135_7304 351
3429 3300053111 Ga0500572_001372 Ga0500572_001372_2535_3704 351
3430 3300053111 Ga0500572_048050 Ga0500572_048050_27_1196 351
3431 3300053117 Ga0500593_024644 Ga0500593_024644_80_1246 351
3432 3300053119 Ga0500595_000001 Ga0500595_000001_258996_260162 351
3433 3300053119 Ga0500595_000152 Ga0500595_000152_26747_27916 351
3434 3300053119 Ga0500595_002016 Ga0500595_002016_6810_7979 351
3435 3300053119 Ga0500595_002270 Ga0500595_002270_6589_7758 351
3436 3300053119 Ga0500595_008028 Ga0500595_008028_3104_4273 351
3437 3300053119 Ga0500595_010226 Ga0500595_010226_1907_3076 351
3438 3300053121 Ga0500607_055260 Ga0500607_055260_495_1664 351
3439 3300053122 Ga0500608_000349 Ga0500608_000349_3506_4675 351
3440 3300053125 Ga0500618_002246 Ga0500618_002246_1150_2337 351
3441 3300053125 Ga0500618_006498 Ga0500618_006498_1145_2320 351
3442 3300053125 Ga0500618_016952 Ga0500618_016952_590_1759 351
3443 3300053130 Ga0500642_0000016 Ga0500642_0000016_133859_135028 351
3444 3300053130 Ga0500642_0008362 Ga0500642_0008362_2318_3487 351
3445 3300053130 Ga0500642_0009145 Ga0500642_0009145_1351_2520 351
3446 3300053130 Ga0500642_0062935 Ga0500642_0062935_298_1464 351
3447 3300053133 Ga0500655_000041 Ga0500655_000041_10917_12086 351
3448 3300053133 Ga0500655_016003 Ga0500655_016003_81_1250 351
3449 3300053134 Ga0500658_0007755 Ga0500658_0007755_1725_2894 351
3450 3300053136 Ga0500559_0001029 Ga0500559_0001029_6714_7883 351
3451 3300053136 Ga0500559_0001124 Ga0500559_0001124_7783_8952 351
3452 3300053136 Ga0500559_0022304 Ga0500559_0022304_904_2073 351
3453 3300053136 Ga0500559_0072796 Ga0500559_0072796_331_1500 351
3454 3300053137 Ga0500561_0000260 Ga0500561_0000260_5082_6251 351
3455 3300053139 Ga0500568_0000125 Ga0500568_0000125_54122_55288 351
3456 3300053139 Ga0500568_0001161 Ga0500568_0001161_10979_12148 351
3457 3300053139 Ga0500568_0032309 Ga0500568_0032309_717_1883 351
3458 3300053140 Ga0500573_0034555 Ga0500573_0034555_343_1512 351
3459 3300053150 Ga0500603_000671 Ga0500603_000671_2894_4063 351
3460 3300053150 Ga0500603_001483 Ga0500603_001483_3115_4284 351
3461 3300053153 Ga0500616_0000001 Ga0500616_0000001_1719373_1720539 351
3462 3300053153 Ga0500616_0000296 Ga0500616_0000296_40518_41711 351
3463 3300053153 Ga0500616_0020934 Ga0500616_0020934_192_1361 351
3464 3300053153 Ga0500616_0028797 Ga0500616_0028797_1156_2331 351
3465 3300053153 Ga0500616_0044050 Ga0500616_0044050_1185_2351 351
3466 3300053153 Ga0500616_0058950 Ga0500616_0058950_396_1562 351
3467 3300053155 Ga0500620_000249 Ga0500620_000249_5745_6911 351
3468 3300053156 Ga0500622_0000916 Ga0500622_0000916_18826_19995 351
3469 3300053156 Ga0500622_0003804 Ga0500622_0003804_5960_7129 351
3470 3300053157 Ga0500624_000316 Ga0500624_000316_1770_2939 351
3471 3300053157 Ga0500624_001547 Ga0500624_001547_1545_2714 351
3472 3300053158 Ga0500627_0034808 Ga0500627_0034808_483_1652 351
3473 3300053158 Ga0500627_0041302 Ga0500627_0041302_120_1286 351
3474 3300053159 Ga0500630_000954 Ga0500630_000954_5552_6721 351
3475 3300053162 Ga0500638_000921 Ga0500638_000921_678_1847 351
3476 3300053162 Ga0500638_032968 Ga0500638_032968_1290_2459 351
3477 3300053163 Ga0500639_000016 Ga0500639_000016_56736_57905 351
3478 3300053177 Ga0500636_0000262 Ga0500636_0000262_24253_25422 351
3479 3300053177 Ga0500636_0005190 Ga0500636_0005190_165_1334 351
3480 3300053177 Ga0500636_0007135 Ga0500636_0007135_1563_2732 351
3481 3300053177 Ga0500636_0012297 Ga0500636_0012297_2175_3344 351
3482 3300053178 Ga0500637_0000652 Ga0500637_0000652_11041_12210 351
3483 3300053178 Ga0500637_0080535 Ga0500637_0080535_471_1640 351
3484 3300053729 Ga0500625_013688 Ga0500625_013688_438_1613 351
3485 3300053730 Ga0500645_000629 Ga0500645_000629_1524_2690 351
3486 3300053736 Ga0500599_000991 Ga0500599_000991_870_2045 351
3487 3300054114 Ga0501084_0006359 Ga0501084_0006359_4545_5714 351
3488 3300054114 Ga0501084_0031091 Ga0501084_0031091_853_2019 351
3489 3300054114 Ga0501084_0038762 Ga0501084_0038762_1874_3121 351
3490 3300054114 Ga0501084_0056864 Ga0501084_0056864_1754_2923 351
3491 3300054114 Ga0501084_0057730 Ga0501084_0057730_2011_3177 351
3492 3300054114 Ga0501084_0118145 Ga0501084_0118145_921_2087 351
3493 3300059424 Ga0590075_008941 Ga0590075_008941_454_1623 351
3494 3300060353 Ga0501082_0000002 Ga0501082_0000002_156094_157260 351
3495 3300060353 Ga0501082_0007109 Ga0501082_0007109_6895_8064 351
3496 3300060353 Ga0501082_0011831 Ga0501082_0011831_1422_2591 351
3497 3300060353 Ga0501082_0015300 Ga0501082_0015300_5342_6514 351
3498 3300060353 Ga0501082_0015319 Ga0501082_0015319_1492_2658 351
3499 3300060353 Ga0501082_0030845 Ga0501082_0030845_1822_2988 351
3500 3300060353 Ga0501082_0051155 Ga0501082_0051155_243_1409 351
3501 3300060353 Ga0501082_0098807 Ga0501082_0098807_963_2129 351
3502 3300060353 Ga0501082_0205053 Ga0501082_0205053_190_1356 351
3503 3300060353 Ga0501082_0259513 Ga0501082_0259513_313_1482 351
3504 3300061719 Ga0466962_0048349 Ga0466962_0048349_158_1324 351
3505 3300061719 Ga0466962_0086052 Ga0466962_0086052_147_1316 351
3506 3300061734 Ga0530510_0006156 Ga0530510_0006156_1018_2184 351
3507 3300061734 Ga0530510_0169227 Ga0530510_0169227_50_1237 351
3508 iso_pu_bacteria 2508501114 2509079242 351
3509 iso_pu_bacteria 2521172590 2521559739 351
3510 iso_pu_bacteria 2548876994 2550693059 351
3511 iso_pu_bacteria 2551306416 2553006225 351
3512 iso_pu_bacteria 2765235838 2765570997 351
3513 iso_pu_bacteria 2808606386 2808984834 351
3514 iso_pu_bacteria 2808606415 2809128240 351
3515 iso_pu_bacteria 2808606419 2809147861 351
3516 iso_pu_bacteria 2818991449 2819616036 351
3517 iso_pu_bacteria 2839094727 2839099311 351
3518 iso_pu_bacteria 2852618963 2852620728 351
3519 iso_pu_bacteria 2884811622 2884815888 351
3520 iso_pu_bacteria 2884836552 2884838724 351
3521 iso_pu_bacteria 2884852848 2884855016 351
3522 iso_pu_bacteria 2896154374 2896156316 351
3523 iso_pu_bacteria 2904439833 2904443374 351
3524 iso_pu_bacteria 2904530477 2904533085 351
3525 iso_pu_bacteria 2904584206 2904585638 351
3526 iso_pu_bacteria 2904589729 2904593987 351
3527 iso_pu_bacteria 2904601388 2904603858 351
3528 iso_pu_bacteria 2919046199 2919047566 351
3529 iso_pu_bacteria 2919079590 2919081902 351
3530 iso_pu_bacteria 2923510766 2923513511 351
3531 iso_pu_bacteria 2924776078 2924780142 351
3532 iso_pu_bacteria 2928130867 2928135570 351
3533 iso_pu_bacteria 637000159 637079368 351
3534 3300002244 JGI24742J22300_10001628 JGI24742J22300_100016281 352
3535 3300005435 Ga0070714_100042403 Ga0070714_1000424032 352
3536 3300005468 Ga0070707_100064794 Ga0070707_1000647943 352
3537 3300007076 Ga0075435_100128461 Ga0075435_1001284612 352
3538 3300021388 Ga0213875_10002463 Ga0213875_100024638 352
3539 3300025912 Ga0207707_10011878 Ga0207707_100118785 352
3540 3300025922 Ga0207646_10005334 Ga0207646_100053343 352
3541 3300025925 Ga0207650_10159713 Ga0207650_101597131 352
3542 3300025926 Ga0207659_10169141 Ga0207659_101691411 352
3543 3300025939 Ga0207665_10180038 Ga0207665_101800381 352
3544 3300026035 Ga0207703_10001883 Ga0207703_1000188311 352
3545 3300026078 Ga0207702_10004224 Ga0207702_1000422412 352
3546 3300037853 Ga0436364_0010736 Ga0436364_0010736_8553_9722 352
3547 3300037853 Ga0436364_0612608 Ga0436364_0612608_427_1596 352
3548 3300039438 Ga0436360_0205335 Ga0436360_0205335_1925_3097 352
3549 3300046533 Ga0495640_0127557 Ga0495640_0127557_172_1341 352
3550 3300046809 Ga0495600_0129028 Ga0495600_0129028_385_1554 352
3551 3300048915 Ga0496112_0026288 Ga0496112_0026288_32_1219 352
3552 3300048925 Ga0496122_0017627 Ga0496122_0017627_1015_2190 352
3553 3300048926 Ga0496123_0004614 Ga0496123_0004614_7743_8918 352
3554 3300053077 Ga0495601_0004144 Ga0495601_0004144_3597_4766 352
3555 3300053084 Ga0495595_0045461 Ga0495595_0045461_676_1845 352
3556 3300053085 Ga0495619_0023467 Ga0495619_0023467_257_1426 352
3557 3300053111 Ga0500572_000205 Ga0500572_000205_15207_16379 352
3558 3300053136 Ga0500559_0001576 Ga0500559_0001576_8556_9728 352
3559 3300026078 Ga0207702_10326981 Ga0207702_103269811 356
3560 2209111006 2214544919 2213593386 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

279

423

0.95

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

107

162

0.92

PF02803

Thiolase_C

Thiolase, C-terminal domain

278

417

0.86

PF00108

Thiolase_N

Thiolase, N-terminal domain

39

263

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bi9-assembly2.cif.gz_C crystal structure of wild-type scp2 thiolase from trypanosoma brucei. 0.9121 1 342
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.91 2 342
6et9-assembly1.cif.gz_C structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.9089 2 342
3zbg-assembly1.cif.gz_B crystal structure of wild-type scp2 thiolase from leishmania mexicana at 1.85 a 0.9085 2 342
3zbl-assembly1.cif.gz_B crystal structure of scp2 thiolase from leishmania mexicana: the c123s mutant. 0.908 1 342
ID Description Score Start End Superfamily
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9089 3 342 3.40.47.10
af_A4I0C0_12_441_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9088 2 342 3.40.47.10
af_A4I0C0_12_441_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8939 2 342 3.40.47.10
af_I6XWJ8_3_408_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8916 1 342 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8911 3 342 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A435D576-F1-model_v4 Thiolase domain-containing protein 0.9896 65 256 GO:0016747
AF-A0A528AKN5-F1-model_v4 Thiolase domain-containing protein 0.9889 1 231 GO:0016747
AF-A0A529K1P4-F1-model_v4 Thiolase domain-containing protein 0.9887 94 295 GO:0016746
AF-A0A3S1Z625-F1-model_v4 deleted 0.9871 27 232
AF-A0A5R2MUF1-F1-model_v4 Thiolase domain-containing protein 0.9865 9 106 GO:0016747

Feature Viewer

pLDDT pTM Quality
85.28 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map