F497334

General Info

Members Datasets Scaffolds Average Seq Length
3545 1487 2647 492

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0009452|Ga0501070_0009452_5446_7143
Length 565
Sequence MAGVRRDGKRLHGRLSGPRLELPHAKCCECLFIIRKTWYLPLPSVTNGQALQPGARAVQTLPRTTMARIIESVTGAEALTFDDVLLQPGHSEVMPGQTDIRTRIAGDIDLNLPILSAAMDTVTDSRLAIAMAQAGGIGVIHRNFSPVEQAEEVRQVKKFESGMVVNPVTIGPEATLADALALMRAHGISGIPVVENGGAGGQKTGHLVGILTNRDVRFASNPNQKVYELMTRESLVTVKENVDQEEAKRLLHKHRIEKLLVVDPAGNCVGLITVKDIEKSQLNPNATKDIQGRLRAAAATSVGDDGFERAERLIDAGVDLLVIDTAHGHSQRVLDAVTRAKKLSNSVRIVAGNVATAEGTQALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLSAIMAAAETADRAGVTVIADGGIKYSGDLAKALAAGASAAMIGSLLAGTDESPGEVYLHQGRSFKAYRGMGSVGAMARGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVAGVLHQLAGGLRAAMGYVGAPDLEALRVRAQFVRISGAGLRESHTHDVAITRESPNYPGAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276019 Ensifer aridi TW10 Isolate Nodule
9 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
10 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
11 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
12 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
13 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
14 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
15 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
16 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
17 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
18 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
19 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
20 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
21 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
22 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
23 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
24 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
25 2512875024 Mesorhizobium loti R88b Isolate Nodule
26 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
27 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
28 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
29 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
30 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
31 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
32 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
33 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
36 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
37 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
38 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
39 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
40 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
41 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
42 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
43 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
44 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
45 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
47 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
48 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
49 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
50 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
51 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
52 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
53 2516143018 Ensifer sp. BR816 Isolate Nodule
54 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
55 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
56 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
57 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
58 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
59 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
60 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
61 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
62 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
63 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
64 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
65 2534681786 Brucella suis 92/29 Isolate Unclassified
66 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
67 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
68 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
69 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
70 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
71 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
72 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
73 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
74 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
75 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
76 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
77 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
78 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
79 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
80 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
81 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
82 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
83 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
84 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
85 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
86 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
87 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
88 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
89 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
90 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
91 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
92 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
93 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
94 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
95 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
96 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
97 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
98 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
99 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
100 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
101 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
102 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
103 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
104 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
105 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
106 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
107 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
108 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
109 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
110 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
111 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
112 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
113 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
114 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
115 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
116 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
117 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
118 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
119 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
120 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
121 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
122 2643221557 Ensifer sp. Root558 Isolate Unclassified
123 2643221558 Rhizobium sp. Root149 Isolate Unclassified
124 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
125 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
126 2643221568 Rhizobium sp. Root564 Isolate Unclassified
127 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
128 2643221580 Devosia sp. Root635 Isolate Unclassified
129 2643221582 Rhizobium sp. Root651 Isolate Unclassified
130 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
131 2643221599 Rhizobium sp. Root708 Isolate Unclassified
132 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
133 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
134 2643221610 Ensifer sp. Root74 Isolate Unclassified
135 2643221618 Ensifer sp. Root231 Isolate Unclassified
136 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
137 2643221626 Ensifer sp. Root31 Isolate Unclassified
138 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
139 2643221629 Devosia sp. Root105 Isolate Unclassified
140 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
141 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
142 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
143 2643221655 Ensifer sp. Root1252 Isolate Unclassified
144 2643221659 Ensifer sp. Root127 Isolate Unclassified
145 2643221662 Devosia sp. Root413D1 Isolate Unclassified
146 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
147 2643221668 Ensifer sp. Root423 Isolate Unclassified
148 2643221674 Devosia sp. Root436 Isolate Unclassified
149 2643221675 Ensifer sp. Root1298 Isolate Unclassified
150 2643221680 Ensifer sp. Root1312 Isolate Unclassified
151 2643221693 Rhizobium sp. Root491 Isolate Unclassified
152 2643221698 Ensifer sp. Root142 Isolate Unclassified
153 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
154 2643221712 Ensifer sp. Root258 Isolate Unclassified
155 2643221718 Rhizobium sp. Root268 Isolate Unclassified
156 2643221723 Ensifer sp. Root278 Isolate Unclassified
157 2643221726 Ensifer sp. Root954 Isolate Unclassified
158 2643221734 Bosea sp. Root670 Isolate Unclassified
159 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
160 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
161 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
162 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
163 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
164 2718217882 Rhizobium sp. N741 Isolate Nodule
165 2718217927 Rhizobium sp. N324 Isolate Nodule
166 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
167 2718218009 Rhizobium sp. N561 Isolate Nodule
168 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
169 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
170 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
171 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
172 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
173 2718218363 Rhizobium sp. N113 Isolate Nodule
174 2718218365 Rhizobium sp. N731 Isolate Nodule
175 2718218366 Rhizobium sp. N621 Isolate Nodule
176 2718218423 Rhizobium sp. N941 Isolate Nodule
177 2721755514 Rhizobium sp. N6212 Isolate Nodule
178 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
179 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
180 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
181 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
182 2721755809 Rhizobium sp. N541 Isolate Nodule
183 2721755810 Rhizobium sp. N871 Isolate Nodule
184 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
185 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
186 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
187 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
188 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
189 2728369365 Rhizobium sp. N1341 Isolate Nodule
190 2728369397 Rhizobium sp. N1314 Isolate Nodule
191 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
192 2738541293 Rhizobium sp. GV031 Isolate Unclassified
193 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
194 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
195 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
196 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
197 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
198 2738543024 Aminobacter sp. AP02 Isolate Unclassified
199 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
200 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
201 2751185800 Brucella pituitosa AA2 Isolate Unclassified
202 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
203 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
204 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
205 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
206 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
207 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
208 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
209 2773857925 Microvirga vignae BR3299 Isolate Unclassified
210 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
211 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
212 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
213 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
214 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
215 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
216 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
217 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
218 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
219 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
220 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
221 2791355256 Rhizobium sp. M10 Isolate Nodule
222 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
223 2791355260 Rhizobium sp. L9 Isolate Nodule
224 2791355261 Rhizobium sp. J15 Isolate Nodule
225 2791355262 Rhizobium sp. M1 Isolate Nodule
226 2791355263 Rhizobium chutanense C5 Isolate Nodule
227 2791355264 Rhizobium sp. S9 Isolate Nodule
228 2791355265 Rhizobium sp. H4 Isolate Nodule
229 2791355266 Rhizobium sp. L43 Isolate Nodule
230 2791355267 Rhizobium sp. L18 Isolate Nodule
231 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
232 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
233 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
234 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
235 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
236 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
237 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
238 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
239 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
240 2802429633 Rhizobium anhuiense J3 Isolate Nodule
241 2802429634 Rhizobium anhuiense S10 Isolate Nodule
242 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
243 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
244 2802429637 Rhizobium anhuiense C15 Isolate Nodule
245 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
246 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
247 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
248 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
249 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
250 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
251 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
252 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
253 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
254 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
255 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
256 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
257 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
258 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
259 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
260 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
261 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
262 2838048938 Rhizobium pisi 27/80 Isolate Nodule
263 2838061910 Rhizobium phaseoli L15 Isolate Nodule
264 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
265 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
266 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
267 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
268 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
269 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
270 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
271 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
272 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
273 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
274 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
275 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
276 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
277 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
278 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
279 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
280 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
281 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
282 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
283 2841760612 Bosea sp. Tri-49 Isolate Nodule
284 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
285 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
286 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
287 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
288 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
289 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
290 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
291 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
292 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
293 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
294 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
295 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
296 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
297 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
298 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
299 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
300 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
301 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
302 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
303 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
304 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
305 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
306 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
307 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
308 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
309 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
310 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
311 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
312 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
313 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
314 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
315 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
316 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
317 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
318 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
319 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
320 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
321 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
322 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
323 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
324 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
325 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
326 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
327 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
328 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
329 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
330 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
331 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
332 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
333 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
334 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
335 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
336 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
337 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
338 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
339 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
340 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
341 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
342 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
343 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
344 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
345 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
346 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
347 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
348 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
349 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
350 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
351 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
352 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
353 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
354 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
355 2844104063 Bosea sp. Tri-39 Isolate Nodule
356 2844163670 Ensifer sp. 1H6 Isolate Unclassified
357 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
358 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
359 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
360 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
361 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
362 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
363 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
364 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
365 2851246043 Bosea sp. Tri-54 Isolate Nodule
366 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
367 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
368 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
369 2854911287 Brucella lupini LUP21 Isolate Unclassified
370 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
371 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
372 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
373 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
374 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
375 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
376 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
377 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
378 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
379 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
380 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
381 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
382 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
383 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
384 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
385 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
386 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
387 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
388 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
389 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
390 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
391 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
392 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
393 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
394 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
395 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
396 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
397 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
398 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
399 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
400 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
401 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
402 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
403 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
404 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
405 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
406 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
407 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
408 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
409 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
410 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
411 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
412 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
413 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
414 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
415 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
416 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
417 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
418 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
419 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
420 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
421 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
422 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
423 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
424 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
425 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
426 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
427 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
428 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
429 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
430 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
431 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
432 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
433 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
434 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
435 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
436 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
437 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
438 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
439 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
440 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
441 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
442 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
443 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
444 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
445 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
446 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
447 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
448 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
449 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
450 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
451 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
452 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
453 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
454 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
455 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
456 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
457 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
458 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
459 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
460 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
461 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
462 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
463 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
464 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
465 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
466 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
467 2902330777 Methylobacterium sp. 2A Isolate Unclassified
468 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
469 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
470 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
471 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
472 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
473 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
474 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
475 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
476 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
477 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
478 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
479 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
480 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
481 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
482 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
483 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
484 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
485 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
486 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
487 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
488 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
489 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
490 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
491 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
492 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
493 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
494 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
495 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
496 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
497 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
498 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
499 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
500 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
501 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
502 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
503 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
504 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
505 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
506 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
507 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
508 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
509 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
510 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
511 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
512 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
513 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
514 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
515 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
516 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
517 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
518 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
519 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
520 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
521 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
522 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
523 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
524 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
525 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
526 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
527 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
528 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
529 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
530 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
531 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
532 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
533 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
534 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
535 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
536 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
537 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
538 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
539 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
540 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
541 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
542 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
543 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
544 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
545 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
546 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
547 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
548 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
549 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
550 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
551 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
552 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
553 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
554 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
555 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
556 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
557 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
558 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
559 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
560 2932401849 Devosia sp. 2618 Isolate Rhizosphere
561 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
562 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
563 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
564 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
565 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
566 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
567 2933599457 Rhizobium phaseoli M3 Isolate Nodule
568 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
569 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
570 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
571 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
572 2936381700 Rhizobium chutanense C16 Isolate Unclassified
573 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
574 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
575 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
576 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
577 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
578 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
579 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
580 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
581 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
582 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
583 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
584 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
585 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
586 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
587 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
588 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
589 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
590 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
591 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
592 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
593 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
594 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
595 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
596 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
597 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
598 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
599 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
600 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
601 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
602 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
603 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
604 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
605 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
606 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
607 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
608 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
609 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
610 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
611 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
612 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
613 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
614 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
615 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
616 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
617 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
618 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
619 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
620 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
621 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
622 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
623 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
624 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
625 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
626 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
627 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
628 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
629 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
630 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
631 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
632 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
633 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
634 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
635 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
636 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
637 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
638 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
639 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
640 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
641 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
642 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
643 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
644 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
645 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
646 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
647 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
648 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
649 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
650 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
651 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
652 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
653 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
654 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
655 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
656 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
657 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
658 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
659 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
660 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
661 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
662 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
663 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
664 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
665 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
666 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
667 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
668 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
669 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
670 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
671 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
672 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
673 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
674 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
675 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
676 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
677 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
678 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
679 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
680 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
681 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
682 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
683 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
684 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
685 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
686 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
687 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
688 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
689 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
690 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
691 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
692 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
693 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
694 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
695 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
696 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
697 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
698 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
699 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
700 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
701 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
702 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
703 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
704 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
705 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
706 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
707 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
708 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
709 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
710 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
711 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
712 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
713 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
714 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
715 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
716 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
717 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
718 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
719 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
720 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
721 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
722 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
723 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
724 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
725 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
726 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
727 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
728 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
729 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
730 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
731 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
732 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
733 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
734 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
735 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
736 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
737 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
738 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
739 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
740 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
741 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
742 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
743 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
744 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
745 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
746 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
747 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
748 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
749 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
750 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
751 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
752 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
753 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
754 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
755 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
756 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
757 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
758 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
759 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
760 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
761 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
762 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
763 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
764 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
765 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
766 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
767 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
768 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
769 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
770 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
771 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
772 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
773 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
774 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
775 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
776 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
777 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
778 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
779 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
780 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
781 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
782 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
783 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
784 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
785 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
786 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
787 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
788 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
789 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
790 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
791 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
792 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
793 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
794 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
795 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
796 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
797 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
798 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
799 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
800 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
801 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
802 2996887358 Rhizobium sp. R711 Isolate Nodule
803 2996893221 Rhizobium sp. R635 Isolate Nodule
804 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
805 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
806 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
807 3004167301 Mesorhizobium loti 582 Isolate Unclassified
808 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
809 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
810 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
811 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
812 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
813 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
814 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
815 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
816 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
817 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
818 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
819 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
820 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
821 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
822 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
823 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
824 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
825 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
826 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
827 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
828 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
829 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
830 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
831 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
832 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
833 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
834 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
835 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
836 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
837 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
838 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
839 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
840 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
841 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
842 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
843 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
844 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
845 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
846 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
847 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
848 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
849 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
850 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
851 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
852 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
853 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
854 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
855 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
856 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
857 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
858 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
859 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
860 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
861 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
862 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
863 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
864 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
865 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
866 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
867 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
868 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
869 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
870 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
871 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
872 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
873 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
874 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
875 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
876 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
877 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
878 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
879 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
880 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
881 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
882 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
883 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
884 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
885 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
886 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
887 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
888 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
889 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
890 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
891 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
892 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
893 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
894 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
895 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
896 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
897 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
898 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
899 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
900 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
901 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
902 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
903 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
904 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
905 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
906 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
907 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
908 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
909 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
910 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
911 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
912 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
913 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
914 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
915 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
916 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
917 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
918 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
919 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
920 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
921 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
922 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
923 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
924 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
925 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
926 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
927 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
928 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
929 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
930 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
931 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
932 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
933 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
934 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
935 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
936 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
937 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
938 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
939 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
940 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
941 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
942 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
943 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
944 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
945 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
946 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
947 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
948 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
949 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
950 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
951 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
952 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
953 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
954 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
955 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
956 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
957 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
958 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
959 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
960 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
961 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
962 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
963 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
964 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
965 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
966 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
967 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
968 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
969 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
970 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
971 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
972 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
973 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
974 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
975 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
976 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
977 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
978 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
979 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
980 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
981 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
982 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
983 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
984 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
985 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
986 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
987 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
988 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
989 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
990 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
991 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
992 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
993 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
994 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
995 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
996 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
997 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
998 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
999 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1000 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1001 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1002 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1003 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1004 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
1005 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
1006 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1007 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
1008 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1009 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1010 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1011 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1012 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
1013 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1014 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1015 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1016 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1017 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1018 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1019 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1020 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1021 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1022 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1023 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1024 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1025 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1026 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1027 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
1028 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1029 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1030 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1031 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1032 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1033 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1034 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1035 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1036 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1037 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1038 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1039 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1040 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1041 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1042 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1043 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1044 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1045 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1046 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1047 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1048 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1049 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1050 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1051 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1052 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1053 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1054 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1055 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1056 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1057 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1058 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1059 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1060 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1061 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1062 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1063 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1064 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1065 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1066 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1067 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1068 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1069 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1070 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1071 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1072 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1073 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1074 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1075 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1076 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1077 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1078 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1079 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1080 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1081 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1082 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1083 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1084 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1085 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1086 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1087 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1088 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1089 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1090 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1091 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1092 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1093 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1094 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1095 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1096 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1097 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1098 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1099 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1103 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
1104 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
1113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
1114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
1139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
1142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
1145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1150 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
1157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1158 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1159 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
1162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1191 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1192 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
1193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1198 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
1199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
1200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
1201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1202 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1203 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
1204 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
1205 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
1206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
1208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
1209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1333 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
1334 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
1335 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
1336 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
1337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
1338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
1339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1346 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
1347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1365 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1366 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1369 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1370 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1374 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1377 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1379 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1380 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1382 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
1383 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
1384 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1385 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1386 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1390 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1391 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1392 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1393 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1396 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1397 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1398 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1399 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
1400 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1404 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
1405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1406 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1407 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1408 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1409 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1410 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1411 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1414 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1415 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1416 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1417 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1418 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1419 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1420 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1421 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1422 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1423 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1424 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1425 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1426 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1427 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1428 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1429 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1430 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1431 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1432 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1433 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1434 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1435 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1436 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1437 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1438 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1439 8005258706 Rhizobium sp. R693 Isolate Nodule
1440 8005275841 Rhizobium sp. N4311 Isolate Nodule
1441 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1442 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1443 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1444 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1445 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1446 8005321885 Rhizobium sp. R72 Isolate Nodule
1447 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1448 8005382845 Rhizobium sp. R634 Isolate Nodule
1449 8005395548 Rhizobium sp. R339 Isolate Nodule
1450 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1451 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1452 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1453 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1454 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1455 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1456 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1457 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1458 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1459 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1460 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1461 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1462 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1463 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1464 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1465 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
1466 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1467 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1468 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1469 8018176218 Rhizobium sp. N122 Isolate Nodule
1470 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1471 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1472 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1473 8024501048 Rhizobium sp. H4 Isolate Nodule
1474 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1475 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1476 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1477 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
1478 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
1479 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1480 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1481 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1482 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1483 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1484 8056382006 Rhizobium croatiense 13T Isolate Nodule
1485 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1486 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1487 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.56
Metatranscriptomes 0.11
Isolates 25.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 9.2
Nodule 18.42
Rhizoplane 3.64
Rhizosphere 59.63
Stem 0
Stem Tuber 0
Unclassified 8.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002908 3300000549 Bacteria 2331
2 JGI24752J21851_1000025 3300001976 Bacteria 17520
3 JGI24752J21851_1002699 3300001976 Bacteria 2357
4 JGI24740J21852_10003721 3300001979 Bacteria 6639
5 JGI24740J21852_10004434 3300001979 Bacteria 6039
6 JGI24739J22299_10003492 3300001989 Bacteria 5995
7 JGI24737J22298_10000015 3300001990 Bacteria 49821
8 JGI24737J22298_10000174 3300001990 Bacteria 20703
9 JGI24737J22298_10001075 3300001990 Bacteria 9631
10 JGI24737J22298_10002253 3300001990 Bacteria 6869
11 JGI24737J22298_10008038 3300001990 Bacteria 3546
12 JGI24743J22301_10009561 3300001991 Bacteria 1720
13 JGI24743J22301_10010265 3300001991 Bacteria 1669
14 JGI24735J21928_10001091 3300002067 Bacteria 9690
15 JGI24750J21931_1000901 3300002070 Bacteria 4038
16 JGI24748J21848_1000032 3300002074 Bacteria 79791
17 JGI24738J21930_10000590 3300002075 Bacteria 10442
18 JGI24738J21930_10005517 3300002075 Bacteria 3025
19 JGI24749J21850_1001131 3300002076 Bacteria 3789
20 JGI24034J26672_10000022 3300002239 Bacteria 116342
21 JGI25155J39150_1000023 3300002704 Bacteria 136961
22 JGI25156J39149_1000094 3300002705 Bacteria 65145
23 JGI25162J39368_1000177 3300002737 Bacteria 68786
24 JGI25162J39368_1000803 3300002737 Bacteria 20853
25 JGI25154J39366_1000067 3300002738 Bacteria 100452
26 JGI25158J39367_1000091 3300002739 Bacteria 21033
27 JGI25157J39369_1000043 3300002741 Bacteria 122537
28 JGI25157J39369_1000053 3300002741 Bacteria 110228
29 JGI25152J39213_1001312 3300002773 Bacteria 11110
30 JGI25152J39213_1003296 3300002773 Bacteria 5580
31 JGI25152J39213_1004814 3300002773 Bacteria 4136
32 JGI25150J39212_1000012 3300002774 Bacteria 182468
33 JGI25150J39212_1004137 3300002774 Bacteria 3271
34 JGI25159J45721_1000016 3300002987 Bacteria 139656
35 JGI25159J45721_1000279 3300002987 Bacteria 24002
36 JGI25159J45721_1000452 3300002987 Bacteria 18938
37 JGI25151J46595_10000025 3300003187 Bacteria 213302
38 JGI25151J46595_10000250 3300003187 Bacteria 62876
39 JGI25151J46595_10003372 3300003187 Bacteria 8844
40 JGI25151J46595_10023198 3300003187 Bacteria 2562
41 JGI25406J46586_10001405 3300003203 Bacteria 11381
42 JGI25165J46597_1000046 3300003214 Bacteria 255996
43 JGI25165J46597_1000050 3300003214 Bacteria 242776
44 JGI25165J46597_1000219 3300003214 Bacteria 79946
45 JGI25165J46597_1000415 3300003214 Bacteria 44714
46 JGI25165J46597_1001749 3300003214 Bacteria 9495
47 JGI25153J46596_10000006 3300003215 Bacteria 447760
48 JGI25153J46596_10000232 3300003215 Bacteria 47116
49 JGI25153J46596_10000740 3300003215 Bacteria 20002
50 JGI25153J46596_10001872 3300003215 Bacteria 12465
51 JGI25153J46596_10002613 3300003215 Bacteria 10304
52 JGI25153J46596_10002759 3300003215 Bacteria 9992
53 JGI25153J46596_10003191 3300003215 Bacteria 9219
54 JGI25153J46596_10003437 3300003215 Bacteria 8871
55 JGI25153J46596_10010628 3300003215 Bacteria 4145
56 JGI25153J46596_10012063 3300003215 Bacteria 3767
57 JGI25160J50197_1000002 3300003354 Bacteria 561707
58 JGI25160J50197_1000046 3300003354 Bacteria 141352
59 JGI25160J50197_1001887 3300003354 Bacteria 10051
60 JGI25160J50197_1005755 3300003354 Bacteria 5111
61 JGI25160J50197_1006040 3300003354 Bacteria 4952
62 JGI25161J50226_1000031 3300003374 Bacteria 141352
63 JGI25161J50226_1000074 3300003374 Bacteria 85547
64 JGI25161J50226_1001359 3300003374 Bacteria 7523
65 JGI25161J50226_1004730 3300003374 Bacteria 2791
66 Ga0006562J51391_1019531 3300003578 Bacteria 1718
67 Ga0006562J51391_1020014 3300003578 Bacteria 1800
68 Ga0055525_1000040 3300003759 Bacteria 286933
69 Ga0055542_1000046 3300003762 Bacteria 201922
70 Ga0055542_1000459 3300003762 Bacteria 38478
71 Ga0055542_1001485 3300003762 Bacteria 11506
72 Ga0055529_1000007 3300003763 Bacteria 403604
73 Ga0055526_1000207 3300003771 Bacteria 50680
74 Ga0055526_1000495 3300003771 Bacteria 31316
75 Ga0055526_1002214 3300003771 Bacteria 13327
76 Ga0055526_1005759 3300003771 Bacteria 6988
77 Ga0055524_1000136 3300003775 Bacteria 87249
78 Ga0055524_1009780 3300003775 Bacteria 3869
79 Ga0055524_1010072 3300003775 Bacteria 3789
80 Ga0055536_1000122 3300003781 Bacteria 66977
81 Ga0055536_1001284 3300003781 Bacteria 15464
82 Ga0055528_1000146 3300003790 Bacteria 57915
83 Ga0055528_1002867 3300003790 Bacteria 8972
84 Ga0055528_1003099 3300003790 Bacteria 8532
85 Ga0055528_1006186 3300003790 Bacteria 5455
86 Ga0055528_1011059 3300003790 Bacteria 3614
87 Ga0055530_10002772 3300003791 Bacteria 10825
88 Ga0055530_10014674 3300003791 Bacteria 2597
89 Ga0055540_1000111 3300003792 Bacteria 88263
90 Ga0055540_1003680 3300003792 Bacteria 7289
91 Ga0055540_1009887 3300003792 Bacteria 3232
92 Ga0055531_10000400 3300003794 Bacteria 41645
93 Ga0055531_10003612 3300003794 Bacteria 9778
94 Ga0055531_10004694 3300003794 Bacteria 8178
95 Ga0055531_10007389 3300003794 Bacteria 6012
96 Ga0055531_10027937 3300003794 Bacteria 1961
97 Ga0058692_1009615 3300003856 Bacteria 2426
98 Ga0055543_1000008 3300004625 Bacteria 202062
99 Ga0055543_1000022 3300004625 Bacteria 140745
100 Ga0055543_1000188 3300004625 Bacteria 50290
101 Ga0055543_1002371 3300004625 Bacteria 6290
102 Ga0065165_1000058 3300005262 Bacteria 184784
103 Ga0065165_1000238 3300005262 Bacteria 95406
104 Ga0065165_1000336 3300005262 Bacteria 76934
105 Ga0065165_1013029 3300005262 Bacteria 3335
106 Ga0065165_1014251 3300005262 Bacteria 3098
107 Ga0065704_10000280 3300005289 Bacteria 50510
108 Ga0065712_10000298 3300005290 Bacteria 14350
109 Ga0065712_10001004 3300005290 Bacteria 14263
110 Ga0065712_10072317 3300005290 Bacteria 4805
111 Ga0065712_10112744 3300005290 Bacteria 1795
112 Ga0065715_10000438 3300005293 Bacteria 11637
113 Ga0065715_10000949 3300005293 Bacteria 9195
114 Ga0065715_10013370 3300005293 Bacteria 2720
115 Ga0065715_10098768 3300005293 Bacteria 3501
116 Ga0065715_10121271 3300005293 Bacteria 2234
117 Ga0065715_10129750 3300005293 Bacteria 2040
118 Ga0065715_10134294 3300005293 Bacteria 1942
119 Ga0065707_10001241 3300005295 Bacteria 9754
120 Ga0065707_10007223 3300005295 Bacteria 3540
121 Ga0065707_10015980 3300005295 Bacteria 2718
122 Ga0065707_10081716 3300005295 Bacteria 73074
123 Ga0065707_10099158 3300005295 Bacteria 3027
124 Ga0070658_10000001 3300005327 Bacteria 856789
125 Ga0070658_10000085 3300005327 Bacteria 87440
126 Ga0070658_10000105 3300005327 Bacteria 75360
127 Ga0070658_10000218 3300005327 Bacteria 50854
128 Ga0070658_10006056 3300005327 Bacteria 9807
129 Ga0070658_10008340 3300005327 Bacteria 8335
130 Ga0070658_10013578 3300005327 Bacteria 6534
131 Ga0070658_10014360 3300005327 Bacteria 6354
132 Ga0070658_10016441 3300005327 Bacteria 5921
133 Ga0070658_10024885 3300005327 Bacteria 4801
134 Ga0070658_10027152 3300005327 Bacteria 4596
135 Ga0070658_10202107 3300005327 Bacteria 1677
136 Ga0070676_10009069 3300005328 Bacteria 5382
137 Ga0070676_10016112 3300005328 Bacteria 4129
138 Ga0070676_10018310 3300005328 Bacteria 3880
139 Ga0070676_10020625 3300005328 Bacteria 3682
140 Ga0070676_10064135 3300005328 Bacteria 2190
141 Ga0070683_100119767 3300005329 Bacteria 2486
142 Ga0070683_100281893 3300005329 Bacteria 1581
143 Ga0070690_100000056 3300005330 Bacteria 54517
144 Ga0070690_100002487 3300005330 Bacteria 9910
145 Ga0070670_100000039 3300005331 Bacteria 152618
146 Ga0070670_100000173 3300005331 Bacteria 58127
147 Ga0070670_100001683 3300005331 Bacteria 17959
148 Ga0070670_100010259 3300005331 Bacteria 7993
149 Ga0070670_100018106 3300005331 Bacteria 6047
150 Ga0070670_100029430 3300005331 Bacteria 4729
151 Ga0070670_100030693 3300005331 Bacteria 4628
152 Ga0070670_100033549 3300005331 Bacteria 4421
153 Ga0070670_100070437 3300005331 Bacteria 3002
154 Ga0070670_100153174 3300005331 Bacteria 1996
155 Ga0070670_100155562 3300005331 Bacteria 1980
156 Ga0070670_100161670 3300005331 Bacteria 1941
157 Ga0070677_10001267 3300005333 Bacteria 8095
158 Ga0068869_100000968 3300005334 Bacteria 16703
159 Ga0068869_100003515 3300005334 Bacteria 9610
160 Ga0068869_100055896 3300005334 Bacteria 2877
161 Ga0068869_100080292 3300005334 Bacteria 2433
162 Ga0070666_10000002 3300005335 Bacteria 478684
163 Ga0070666_10000589 3300005335 Bacteria 21952
164 Ga0070666_10003993 3300005335 Bacteria 8950
165 Ga0070666_10056531 3300005335 Bacteria 2650
166 Ga0070680_100014926 3300005336 Bacteria 6079
167 Ga0070680_100088160 3300005336 Bacteria 2566
168 Ga0070682_100015779 3300005337 Bacteria 4383
169 Ga0070682_100034035 3300005337 Bacteria 3099
170 Ga0070682_100065811 3300005337 Bacteria 2304
171 Ga0068868_100000116 3300005338 Bacteria 50098
172 Ga0068868_100000117 3300005338 Bacteria 50053
173 Ga0068868_100025826 3300005338 Bacteria 4472
174 Ga0070660_100000177 3300005339 Bacteria 42137
175 Ga0070660_100000235 3300005339 Bacteria 36822
176 Ga0070660_100000411 3300005339 Bacteria 28455
177 Ga0070660_100003809 3300005339 Bacteria 10420
178 Ga0070660_100004861 3300005339 Bacteria 9282
179 Ga0070660_100007715 3300005339 Bacteria 7501
180 Ga0070660_100022640 3300005339 Bacteria 4649
181 Ga0070660_100039577 3300005339 Bacteria 3584
182 Ga0070660_100112280 3300005339 Bacteria 2169
183 Ga0070689_100007699 3300005340 Bacteria 7545
184 Ga0070689_100038724 3300005340 Bacteria 3648
185 Ga0070689_100123879 3300005340 Bacteria 2067
186 Ga0070689_100155739 3300005340 Bacteria 1845
187 Ga0070687_100039978 3300005343 Bacteria 2360
188 Ga0070661_100010394 3300005344 Bacteria 6470
189 Ga0070692_10011317 3300005345 Bacteria 4091
190 Ga0070668_100000155 3300005347 Bacteria 43650
191 Ga0070668_100003153 3300005347 Bacteria 12162
192 Ga0070668_100017323 3300005347 Bacteria 5395
193 Ga0070668_100019099 3300005347 Bacteria 5153
194 Ga0070668_100046576 3300005347 Bacteria 3330
195 Ga0070668_100097735 3300005347 Bacteria 2322
196 Ga0070668_100109185 3300005347 Bacteria 2201
197 Ga0070669_100000042 3300005353 Bacteria 123396
198 Ga0070669_100000170 3300005353 Bacteria 57161
199 Ga0070669_100000471 3300005353 Bacteria 30589
200 Ga0070669_100000661 3300005353 Bacteria 25473
201 Ga0070669_100028620 3300005353 Bacteria 4013
202 Ga0070675_100011932 3300005354 Bacteria 6809
203 Ga0070675_100015671 3300005354 Bacteria 5999
204 Ga0070675_100020107 3300005354 Bacteria 5327
205 Ga0070675_100026079 3300005354 Bacteria 4688
206 Ga0070675_100040588 3300005354 Bacteria 3800
207 Ga0070675_100051012 3300005354 Bacteria 3399
208 Ga0070675_100058613 3300005354 Bacteria 3176
209 Ga0070675_100059099 3300005354 Bacteria 3162
210 Ga0070671_100000010 3300005355 Bacteria 202799
211 Ga0070671_100000050 3300005355 Bacteria 80843
212 Ga0070671_100001477 3300005355 Bacteria 17556
213 Ga0070671_100007392 3300005355 Bacteria 8777
214 Ga0070671_100015470 3300005355 Bacteria 6164
215 Ga0070671_100041923 3300005355 Bacteria 3804
216 Ga0070671_100060673 3300005355 Bacteria 3149
217 Ga0070671_100066017 3300005355 Bacteria 3015
218 Ga0070671_100135678 3300005355 Bacteria 2075
219 Ga0070671_100167660 3300005355 Bacteria 1857
220 Ga0070674_100004120 3300005356 Bacteria 8256
221 Ga0070674_100007969 3300005356 Bacteria 6275
222 Ga0070674_100012755 3300005356 Bacteria 5170
223 Ga0070674_100045642 3300005356 Bacteria 2994
224 Ga0070674_100157478 3300005356 Bacteria 1720
225 Ga0070673_100000007 3300005364 Bacteria 177157
226 Ga0070673_100008254 3300005364 Bacteria 6915
227 Ga0070673_100009454 3300005364 Bacteria 6544
228 Ga0070673_100020749 3300005364 Bacteria 4744
229 Ga0070673_100024021 3300005364 Bacteria 4461
230 Ga0070673_100071624 3300005364 Bacteria 2786
231 Ga0070673_100103183 3300005364 Bacteria 2352
232 Ga0070688_100002287 3300005365 Bacteria 9674
233 Ga0070688_100023190 3300005365 Bacteria 3648
234 Ga0070659_100000001 3300005366 Bacteria 576390
235 Ga0070659_100002929 3300005366 Bacteria 12163
236 Ga0070659_100004771 3300005366 Bacteria 9690
237 Ga0070659_100005736 3300005366 Bacteria 8939
238 Ga0070659_100044589 3300005366 Bacteria 3472
239 Ga0070659_100050538 3300005366 Bacteria 3268
240 Ga0070659_100105594 3300005366 Bacteria 2270
241 Ga0070667_100000231 3300005367 Bacteria 63589
242 Ga0070667_100000664 3300005367 Bacteria 33378
243 Ga0070667_100007388 3300005367 Bacteria 9125
244 Ga0070667_100008470 3300005367 Bacteria 8527
245 Ga0070667_100015251 3300005367 Bacteria 6352
246 Ga0070667_100097259 3300005367 Bacteria 2539
247 Ga0070667_100101945 3300005367 Bacteria 2480
248 Ga0070667_100154637 3300005367 Bacteria 2017
249 Ga0070709_10032902 3300005434 Bacteria 3131
250 Ga0070714_100002221 3300005435 Bacteria 14300
251 Ga0070714_100009700 3300005435 Bacteria 7582
252 Ga0070714_100013422 3300005435 Bacteria 6565
253 Ga0070714_100014177 3300005435 Bacteria 6399
254 Ga0070713_100003849 3300005436 Bacteria 9936
255 Ga0070713_100014233 3300005436 Bacteria 5898
256 Ga0070713_100021449 3300005436 Bacteria 4970
257 Ga0070710_10004631 3300005437 Bacteria 6504
258 Ga0070711_100002712 3300005439 Bacteria 10159
259 Ga0070711_100020619 3300005439 Bacteria 4252
260 Ga0070705_100016501 3300005440 Bacteria 3839
261 Ga0070705_100053586 3300005440 Bacteria 2362
262 Ga0070700_100014792 3300005441 Bacteria 4409
263 Ga0070694_100008760 3300005444 Bacteria 6198
264 Ga0070694_100075141 3300005444 Bacteria 2337
265 Ga0070708_100004356 3300005445 Bacteria 11120
266 Ga0070708_100033165 3300005445 Bacteria 4485
267 Ga0070708_100117337 3300005445 Bacteria 2451
268 Ga0070663_100000441 3300005455 Bacteria 21992
269 Ga0070663_100004063 3300005455 Bacteria 8544
270 Ga0070663_100029063 3300005455 Bacteria 3772
271 Ga0070663_100032274 3300005455 Bacteria 3608
272 Ga0070678_100039171 3300005456 Bacteria 3341
273 Ga0070678_100041836 3300005456 Bacteria 3251
274 Ga0070662_100000592 3300005457 Bacteria 22043
275 Ga0070662_100010659 3300005457 Bacteria 6046
276 Ga0070662_100011067 3300005457 Bacteria 5940
277 Ga0070662_100019891 3300005457 Bacteria 4567
278 Ga0070662_100052356 3300005457 Bacteria 2950
279 Ga0070662_100119057 3300005457 Bacteria 2022
280 Ga0070681_10000005 3300005458 Bacteria 183053
281 Ga0070681_10020487 3300005458 Bacteria 6628
282 Ga0070681_10031170 3300005458 Bacteria 5352
283 Ga0070681_10033013 3300005458 Bacteria 5196
284 Ga0070681_10116054 3300005458 Bacteria 2614
285 Ga0068867_100000010 3300005459 Bacteria 129593
286 Ga0068867_100000722 3300005459 Bacteria 22083
287 Ga0068867_100016854 3300005459 Bacteria 5192
288 Ga0068867_100018816 3300005459 Bacteria 4913
289 Ga0070685_10002211 3300005466 Bacteria 10039
290 Ga0070685_10005780 3300005466 Bacteria 6286
291 Ga0070685_10057960 3300005466 Bacteria 2256
292 Ga0070706_100000386 3300005467 Bacteria 52878
293 Ga0070707_100009552 3300005468 Bacteria 9011
294 Ga0070707_100054744 3300005468 Bacteria 3826
295 Ga0070698_100010315 3300005471 Bacteria 9971
296 Ga0070679_100006956 3300005530 Bacteria 10555
297 Ga0070679_100023127 3300005530 Bacteria 6081
298 Ga0070679_100066890 3300005530 Bacteria 3583
299 Ga0070697_100004144 3300005536 Bacteria 11109
300 Ga0070697_100012214 3300005536 Bacteria 6725
301 Ga0068853_100002364 3300005539 Bacteria 14106
302 Ga0068853_100020943 3300005539 Bacteria 5442
303 Ga0068853_100023778 3300005539 Bacteria 5133
304 Ga0068853_100024090 3300005539 Bacteria 5101
305 Ga0068853_100087985 3300005539 Bacteria 2726
306 Ga0068853_100133684 3300005539 Bacteria 2222
307 Ga0070672_100018311 3300005543 Bacteria 5060
308 Ga0070672_100020245 3300005543 Bacteria 4848
309 Ga0070672_100021535 3300005543 Bacteria 4720
310 Ga0070672_100021657 3300005543 Bacteria 4708
311 Ga0070672_100029312 3300005543 Bacteria 4126
312 Ga0070672_100082768 3300005543 Bacteria 2575
313 Ga0070672_100111273 3300005543 Bacteria 2232
314 Ga0070686_100000335 3300005544 Bacteria 30423
315 Ga0070686_100000364 3300005544 Bacteria 28895
316 Ga0070686_100005610 3300005544 Bacteria 6952
317 Ga0070686_100035868 3300005544 Bacteria 3065
318 Ga0070686_100146429 3300005544 Bacteria 1649
319 Ga0070695_100001320 3300005545 Bacteria 13725
320 Ga0070696_100006660 3300005546 Bacteria 7717
321 Ga0070696_100082301 3300005546 Bacteria 2282
322 Ga0070696_100118718 3300005546 Bacteria 1912
323 Ga0070693_100003111 3300005547 Bacteria 7705
324 Ga0070693_100066108 3300005547 Bacteria 2115
325 Ga0070693_100077457 3300005547 Bacteria 1973
326 Ga0070693_100091426 3300005547 Bacteria 1835
327 Ga0070665_100000036 3300005548 Bacteria 314603
328 Ga0070665_100000075 3300005548 Bacteria 189496
329 Ga0070665_100000086 3300005548 Bacteria 178229
330 Ga0070665_100000166 3300005548 Bacteria 120121
331 Ga0070665_100000634 3300005548 Bacteria 47873
332 Ga0070665_100001079 3300005548 Bacteria 33925
333 Ga0070665_100001799 3300005548 Bacteria 24308
334 Ga0070665_100007375 3300005548 Bacteria 11186
335 Ga0070665_100011778 3300005548 Bacteria 8833
336 Ga0070665_100015522 3300005548 Bacteria 7652
337 Ga0070665_100018572 3300005548 Bacteria 6969
338 Ga0070665_100022890 3300005548 Bacteria 6291
339 Ga0070665_100028006 3300005548 Bacteria 5676
340 Ga0070665_100033391 3300005548 Bacteria 5177
341 Ga0070665_100093762 3300005548 Bacteria 3007
342 Ga0070665_100116629 3300005548 Bacteria 2673
343 Ga0070665_100150793 3300005548 Bacteria 2328
344 Ga0070704_100001042 3300005549 Bacteria 14315
345 Ga0070704_100004648 3300005549 Bacteria 7942
346 Ga0068855_100000034 3300005563 Bacteria 166436
347 Ga0068855_100000586 3300005563 Bacteria 44740
348 Ga0068855_100002239 3300005563 Bacteria 23911
349 Ga0068855_100007701 3300005563 Bacteria 13005
350 Ga0068855_100010744 3300005563 Bacteria 11051
351 Ga0068855_100024375 3300005563 Bacteria 7239
352 Ga0068855_100032128 3300005563 Bacteria 6267
353 Ga0068855_100034025 3300005563 Bacteria 6079
354 Ga0068855_100083523 3300005563 Bacteria 3699
355 Ga0068855_100085382 3300005563 Bacteria 3652
356 Ga0068855_100115446 3300005563 Bacteria 3078
357 Ga0068855_100134704 3300005563 Bacteria 2819
358 Ga0068855_100158218 3300005563 Bacteria 2573
359 Ga0070664_100001087 3300005564 Bacteria 21427
360 Ga0070664_100001771 3300005564 Bacteria 17311
361 Ga0070664_100022528 3300005564 Bacteria 5195
362 Ga0070664_100085143 3300005564 Bacteria 2730
363 Ga0068857_100053521 3300005577 Bacteria 3581
364 Ga0068857_100060920 3300005577 Bacteria 3353
365 Ga0068857_100087206 3300005577 Bacteria 2791
366 Ga0068857_100154462 3300005577 Bacteria 2080
367 Ga0068857_100189150 3300005577 Bacteria 1875
368 Ga0068854_100001233 3300005578 Bacteria 15333
369 Ga0068854_100001371 3300005578 Bacteria 14658
370 Ga0068854_100102709 3300005578 Bacteria 2145
371 Ga0068856_100001292 3300005614 Bacteria 26366
372 Ga0068856_100047071 3300005614 Bacteria 4248
373 Ga0068856_100089957 3300005614 Bacteria 3053
374 Ga0068856_100112510 3300005614 Bacteria 2720
375 Ga0068856_100136923 3300005614 Bacteria 2454
376 Ga0068852_100000075 3300005616 Bacteria 69379
377 Ga0068852_100000283 3300005616 Bacteria 33859
378 Ga0068852_100000736 3300005616 Bacteria 21492
379 Ga0068852_100002830 3300005616 Bacteria 12030
380 Ga0068852_100026259 3300005616 Bacteria 4731
381 Ga0068852_100036825 3300005616 Bacteria 4098
382 Ga0068852_100056230 3300005616 Bacteria 3399
383 Ga0068852_100077269 3300005616 Bacteria 2942
384 Ga0068852_100170709 3300005616 Bacteria 2038
385 Ga0068852_100184212 3300005616 Bacteria 1965
386 Ga0068859_100002741 3300005617 Bacteria 17868
387 Ga0068859_100003336 3300005617 Bacteria 16326
388 Ga0068859_100008942 3300005617 Bacteria 10115
389 Ga0068859_100009706 3300005617 Bacteria 9718
390 Ga0068859_100014908 3300005617 Bacteria 7804
391 Ga0068859_100014962 3300005617 Bacteria 7787
392 Ga0068859_100045143 3300005617 Bacteria 4427
393 Ga0068859_100049484 3300005617 Bacteria 4220
394 Ga0068859_100051424 3300005617 Bacteria 4141
395 Ga0068859_100058898 3300005617 Bacteria 3869
396 Ga0068859_100074478 3300005617 Bacteria 3434
397 Ga0068859_100082305 3300005617 Bacteria 3262
398 Ga0068864_100000068 3300005618 Bacteria 115507
399 Ga0068864_100000188 3300005618 Bacteria 56337
400 Ga0068864_100001352 3300005618 Bacteria 20391
401 Ga0068864_100009005 3300005618 Bacteria 8231
402 Ga0068864_100035092 3300005618 Bacteria 4268
403 Ga0068864_100134610 3300005618 Bacteria 2224
404 Ga0068866_10010834 3300005718 Bacteria 3922
405 Ga0068861_100002930 3300005719 Bacteria 11267
406 Ga0068861_100022249 3300005719 Bacteria 4565
407 Ga0068861_100023879 3300005719 Bacteria 4415
408 Ga0068861_100025349 3300005719 Bacteria 4299
409 Ga0068861_100025806 3300005719 Bacteria 4266
410 Ga0068861_100158452 3300005719 Bacteria 1865
411 Ga0068851_10014873 3300005834 Bacteria 3701
412 Ga0068851_10027033 3300005834 Bacteria 2825
413 Ga0068870_10011891 3300005840 Bacteria 4050
414 Ga0068863_100000095 3300005841 Bacteria 96080
415 Ga0068863_100000758 3300005841 Bacteria 32348
416 Ga0068863_100002834 3300005841 Bacteria 17170
417 Ga0068863_100005294 3300005841 Bacteria 12737
418 Ga0068863_100020162 3300005841 Bacteria 6378
419 Ga0068863_100056065 3300005841 Bacteria 3731
420 Ga0068863_100115094 3300005841 Bacteria 2562
421 Ga0068863_100116209 3300005841 Bacteria 2550
422 Ga0068863_100200470 3300005841 Bacteria 1920
423 Ga0068858_100000688 3300005842 Bacteria 35297
424 Ga0068858_100001148 3300005842 Bacteria 27405
425 Ga0068858_100001956 3300005842 Bacteria 21024
426 Ga0068858_100002740 3300005842 Bacteria 17718
427 Ga0068858_100003325 3300005842 Bacteria 16006
428 Ga0068858_100007049 3300005842 Bacteria 10915
429 Ga0068858_100024077 3300005842 Bacteria 5674
430 Ga0068858_100034063 3300005842 Bacteria 4724
431 Ga0068860_100000001 3300005843 Bacteria 703043
432 Ga0068860_100000151 3300005843 Bacteria 112208
433 Ga0068860_100000303 3300005843 Bacteria 68443
434 Ga0068860_100002485 3300005843 Bacteria 19341
435 Ga0068860_100002747 3300005843 Bacteria 18315
436 Ga0068860_100004218 3300005843 Bacteria 14732
437 Ga0068860_100005984 3300005843 Bacteria 12245
438 Ga0068860_100021613 3300005843 Bacteria 6230
439 Ga0068860_100028014 3300005843 Bacteria 5424
440 Ga0068860_100028188 3300005843 Bacteria 5406
441 Ga0068860_100059828 3300005843 Bacteria 3621
442 Ga0068860_100063042 3300005843 Bacteria 3521
443 Ga0068860_100065246 3300005843 Bacteria 3458
444 Ga0068860_100090704 3300005843 Bacteria 2911
445 Ga0068860_100115336 3300005843 Bacteria 2569
446 Ga0068860_100117599 3300005843 Bacteria 2543
447 Ga0068860_100208419 3300005843 Bacteria 1896
448 Ga0068862_100000092 3300005844 Bacteria 106896
449 Ga0068862_100000350 3300005844 Bacteria 49916
450 Ga0068862_100000620 3300005844 Bacteria 36954
451 Ga0068862_100000802 3300005844 Bacteria 31167
452 Ga0068862_100002760 3300005844 Bacteria 15388
453 Ga0068862_100005273 3300005844 Bacteria 10841
454 Ga0068862_100005821 3300005844 Bacteria 10278
455 Ga0068862_100006038 3300005844 Bacteria 10085
456 Ga0068862_100006309 3300005844 Bacteria 9858
457 Ga0068862_100007884 3300005844 Bacteria 8812
458 Ga0068862_100121314 3300005844 Bacteria 2304
459 Ga0068862_100229498 3300005844 Bacteria 1684
460 Ga0081455_10000255 3300005937 Bacteria 69927
461 Ga0081455_10004379 3300005937 Bacteria 15904
462 Ga0081538_10024493 3300005981 Bacteria 4297
463 Ga0081538_10044613 3300005981 Bacteria 2762
464 Ga0081540_1032916 3300005983 Bacteria 2822
465 Ga0081539_10000056 3300005985 Bacteria 256522
466 Ga0081539_10000305 3300005985 Bacteria 110570
467 Ga0081539_10001435 3300005985 Bacteria 40814
468 Ga0081539_10003038 3300005985 Bacteria 21740
469 Ga0081539_10006821 3300005985 Bacteria 10695
470 Ga0081539_10015017 3300005985 Bacteria 5674
471 Ga0081539_10048123 3300005985 Bacteria 2428
472 Ga0070717_10028144 3300006028 Bacteria 4495
473 Ga0075365_10001131 3300006038 Bacteria 11668
474 Ga0075365_10001442 3300006038 Bacteria 10777
475 Ga0075365_10013682 3300006038 Bacteria 4864
476 Ga0075365_10025392 3300006038 Bacteria 3750
477 Ga0075365_10037277 3300006038 Bacteria 3156
478 Ga0075368_10000597 3300006042 Bacteria 10880
479 Ga0075368_10012090 3300006042 Bacteria 3151
480 Ga0075364_10000145 3300006051 Bacteria 31120
481 Ga0075364_10000257 3300006051 Bacteria 25641
482 Ga0075364_10010285 3300006051 Bacteria 5646
483 Ga0075364_10072680 3300006051 Bacteria 2267
484 Ga0070715_10005582 3300006163 Bacteria 4205
485 Ga0070716_100017583 3300006173 Bacteria 3710
486 Ga0070712_100017266 3300006175 Bacteria 4670
487 Ga0070712_100067873 3300006175 Bacteria 2539
488 Ga0075362_10000083 3300006177 Bacteria 26049
489 Ga0075362_10000203 3300006177 Bacteria 16577
490 Ga0075362_10002222 3300006177 Bacteria 6449
491 Ga0075362_10006581 3300006177 Bacteria 4339
492 Ga0075362_10036398 3300006177 Bacteria 2153
493 Ga0075367_10002842 3300006178 Bacteria 8043
494 Ga0075367_10022098 3300006178 Bacteria 3564
495 Ga0075367_10057251 3300006178 Bacteria 2318
496 Ga0075367_10066356 3300006178 Bacteria 2162
497 Ga0075369_10001615 3300006186 Bacteria 7755
498 Ga0075369_10007922 3300006186 Bacteria 4070
499 Ga0075366_10001961 3300006195 Bacteria 10413
500 Ga0075366_10002219 3300006195 Bacteria 9909
501 Ga0075366_10002989 3300006195 Bacteria 8815
502 Ga0075366_10010067 3300006195 Bacteria 5300
503 Ga0075366_10035402 3300006195 Bacteria 2943
504 Ga0097621_100000035 3300006237 Bacteria 68179
505 Ga0097621_100000312 3300006237 Bacteria 32930
506 Ga0075370_10000017 3300006353 Bacteria 60451
507 Ga0075370_10001381 3300006353 Bacteria 10466
508 Ga0075370_10015624 3300006353 Bacteria 4069
509 Ga0075370_10052255 3300006353 Bacteria 2318
510 Ga0068871_100000287 3300006358 Bacteria 35135
511 Ga0068871_100005425 3300006358 Bacteria 8940
512 Ga0068871_100160669 3300006358 Bacteria 1921
513 Ga0068871_100176020 3300006358 Bacteria 1837
514 Ga0075428_100000011 3300006844 Bacteria 194129
515 Ga0075428_100000582 3300006844 Bacteria 37313
516 Ga0075428_100001156 3300006844 Bacteria 28246
517 Ga0075428_100004959 3300006844 Bacteria 14783
518 Ga0075428_100016561 3300006844 Bacteria 8139
519 Ga0075428_100018421 3300006844 Bacteria 7720
520 Ga0075428_100023468 3300006844 Bacteria 6827
521 Ga0075428_100042819 3300006844 Bacteria 4978
522 Ga0075428_100051815 3300006844 Bacteria 4501
523 Ga0075428_100059596 3300006844 Bacteria 4180
524 Ga0075428_100092910 3300006844 Bacteria 3289
525 Ga0075428_100145689 3300006844 Bacteria 2574
526 Ga0075428_100167925 3300006844 Bacteria 2380
527 Ga0075428_100168452 3300006844 Bacteria 2376
528 Ga0075428_100236391 3300006844 Bacteria 1971
529 Ga0075430_100000936 3300006846 Bacteria 22910
530 Ga0075430_100041590 3300006846 Bacteria 3888
531 Ga0075430_100054046 3300006846 Bacteria 3379
532 Ga0075430_100061942 3300006846 Bacteria 3143
533 Ga0075431_100013998 3300006847 Bacteria 8102
534 Ga0075431_100021660 3300006847 Bacteria 6573
535 Ga0075431_100028747 3300006847 Bacteria 5716
536 Ga0075431_100030928 3300006847 Bacteria 5514
537 Ga0075431_100032281 3300006847 Bacteria 5395
538 Ga0075431_100054395 3300006847 Bacteria 4127
539 Ga0075431_100055281 3300006847 Bacteria 4094
540 Ga0075431_100069251 3300006847 Bacteria 3640
541 Ga0075431_100268569 3300006847 Bacteria 1729
542 Ga0075433_10000535 3300006852 Bacteria 24966
543 Ga0075433_10046531 3300006852 Bacteria 3774
544 Ga0075433_10069982 3300006852 Bacteria 3083
545 Ga0075434_100015056 3300006871 Bacteria 7405
546 Ga0075434_100102768 3300006871 Bacteria 2866
547 Ga0075429_100013075 3300006880 Bacteria 7200
548 Ga0075429_100014627 3300006880 Bacteria 6802
549 Ga0075429_100022206 3300006880 Bacteria 5505
550 Ga0075429_100040699 3300006880 Bacteria 4046
551 Ga0075429_100040790 3300006880 Bacteria 4042
552 Ga0068865_100000008 3300006881 Bacteria 177158
553 Ga0068865_100000650 3300006881 Bacteria 19640
554 Ga0068865_100012687 3300006881 Bacteria 5310
555 Ga0068865_100021957 3300006881 Bacteria 4156
556 Ga0068865_100055256 3300006881 Bacteria 2762
557 Ga0075436_100004211 3300006914 Bacteria 9869
558 Ga0075436_100010651 3300006914 Bacteria 6305
559 Ga0075436_100014198 3300006914 Bacteria 5452
560 Ga0075436_100037912 3300006914 Bacteria 3327
561 Ga0097620_100002741 3300006931 Bacteria 17868
562 Ga0097620_100003336 3300006931 Bacteria 16326
563 Ga0097620_100008942 3300006931 Bacteria 10115
564 Ga0097620_100009705 3300006931 Bacteria 9718
565 Ga0097620_100014908 3300006931 Bacteria 7804
566 Ga0097620_100014961 3300006931 Bacteria 7787
567 Ga0097620_100045143 3300006931 Bacteria 4427
568 Ga0097620_100049483 3300006931 Bacteria 4220
569 Ga0097620_100051427 3300006931 Bacteria 4141
570 Ga0097620_100058896 3300006931 Bacteria 3869
571 Ga0097620_100074480 3300006931 Bacteria 3434
572 Ga0097620_100082302 3300006931 Bacteria 3262
573 Ga0079104_1000069 3300006946 Bacteria 153993
574 Ga0079104_1006348 3300006946 Bacteria 4498
575 Ga0079104_1009848 3300006946 Bacteria 3202
576 Ga0099826_10003316 3300006948 Bacteria 10869
577 Ga0099826_10010012 3300006948 Bacteria 7089
578 Ga0075435_100003221 3300007076 Bacteria 11049
579 Ga0075435_100122990 3300007076 Bacteria 2166
580 Ga0075435_100171080 3300007076 Bacteria 1832
581 Ga0075435_100200777 3300007076 Bacteria 1690
582 Ga0105251_10032869 3300009011 Bacteria 2581
583 Ga0105250_10008875 3300009092 Bacteria 4253
584 Ga0105240_10000278 3300009093 Bacteria 101540
585 Ga0105240_10000784 3300009093 Bacteria 57586
586 Ga0105240_10001788 3300009093 Bacteria 36269
587 Ga0105240_10002106 3300009093 Bacteria 32565
588 Ga0105240_10002316 3300009093 Bacteria 30823
589 Ga0105240_10004918 3300009093 Bacteria 20090
590 Ga0105240_10008098 3300009093 Bacteria 15094
591 Ga0105240_10018168 3300009093 Bacteria 9453
592 Ga0105240_10018510 3300009093 Bacteria 9350
593 Ga0105240_10038279 3300009093 Bacteria 6153
594 Ga0105240_10039019 3300009093 Bacteria 6084
595 Ga0105240_10044256 3300009093 Bacteria 5659
596 Ga0105240_10080850 3300009093 Bacteria 3995
597 Ga0105240_10089737 3300009093 Bacteria 3759
598 Ga0105240_10092735 3300009093 Bacteria 3687
599 Ga0105240_10135817 3300009093 Bacteria 2945
600 Ga0105240_10251575 3300009093 Bacteria 2043
601 Ga0105240_10252354 3300009093 Bacteria 2039
602 Ga0111539_10000011 3300009094 Bacteria 356900
603 Ga0111539_10000100 3300009094 Bacteria 91427
604 Ga0111539_10001118 3300009094 Bacteria 35458
605 Ga0111539_10001539 3300009094 Bacteria 30721
606 Ga0111539_10004333 3300009094 Bacteria 18572
607 Ga0111539_10006734 3300009094 Bacteria 14784
608 Ga0111539_10007181 3300009094 Bacteria 14276
609 Ga0111539_10008266 3300009094 Bacteria 13244
610 Ga0111539_10010548 3300009094 Bacteria 11633
611 Ga0111539_10014411 3300009094 Bacteria 9867
612 Ga0111539_10028816 3300009094 Bacteria 6772
613 Ga0111539_10066201 3300009094 Bacteria 4267
614 Ga0111539_10093960 3300009094 Bacteria 3523
615 Ga0111539_10151504 3300009094 Bacteria 2714
616 Ga0111539_10201842 3300009094 Bacteria 2319
617 Ga0111539_10259072 3300009094 Bacteria 2025
618 Ga0111539_10261232 3300009094 Bacteria 2015
619 Ga0105245_10000146 3300009098 Bacteria 66619
620 Ga0105245_10003848 3300009098 Bacteria 13353
621 Ga0105245_10012964 3300009098 Bacteria 7267
622 Ga0105245_10026408 3300009098 Bacteria 5111
623 Ga0105245_10043582 3300009098 Bacteria 4002
624 Ga0105245_10054340 3300009098 Bacteria 3597
625 Ga0105245_10060032 3300009098 Bacteria 3425
626 Ga0105245_10159062 3300009098 Bacteria 2142
627 Ga0105247_10003542 3300009101 Bacteria 10147
628 Ga0105247_10006552 3300009101 Bacteria 7201
629 Ga0105247_10017670 3300009101 Bacteria 4278
630 Ga0105247_10022841 3300009101 Bacteria 3768
631 Ga0105247_10040303 3300009101 Bacteria 2855
632 Ga0114129_10000186 3300009147 Bacteria 69381
633 Ga0114129_10000540 3300009147 Bacteria 46396
634 Ga0114129_10001097 3300009147 Bacteria 35568
635 Ga0114129_10006133 3300009147 Bacteria 17044
636 Ga0114129_10010140 3300009147 Bacteria 13430
637 Ga0114129_10013538 3300009147 Bacteria 11625
638 Ga0114129_10015936 3300009147 Bacteria 10688
639 Ga0114129_10017842 3300009147 Bacteria 10106
640 Ga0114129_10018606 3300009147 Bacteria 9889
641 Ga0114129_10022217 3300009147 Bacteria 9007
642 Ga0114129_10028588 3300009147 Bacteria 7899
643 Ga0114129_10037573 3300009147 Bacteria 6836
644 Ga0114129_10045078 3300009147 Bacteria 6200
645 Ga0114129_10060185 3300009147 Bacteria 5310
646 Ga0114129_10074076 3300009147 Bacteria 4742
647 Ga0114129_10092903 3300009147 Bacteria 4180
648 Ga0114129_10219035 3300009147 Bacteria 2569
649 Ga0114129_10327724 3300009147 Bacteria 2034
650 Ga0105243_10000080 3300009148 Bacteria 109765
651 Ga0105243_10057312 3300009148 Bacteria 3101
652 Ga0105243_10073161 3300009148 Bacteria 2776
653 Ga0105241_10014442 3300009174 Bacteria 5783
654 Ga0105241_10069686 3300009174 Bacteria 2727
655 Ga0105242_10000862 3300009176 Bacteria 23518
656 Ga0105242_10005594 3300009176 Bacteria 9699
657 Ga0105242_10009883 3300009176 Bacteria 7310
658 Ga0105242_10010587 3300009176 Bacteria 7081
659 Ga0105248_10000594 3300009177 Bacteria 41228
660 Ga0105248_10007672 3300009177 Bacteria 11857
661 Ga0105248_10008945 3300009177 Bacteria 11014
662 Ga0105248_10009214 3300009177 Bacteria 10858
663 Ga0105248_10014742 3300009177 Bacteria 8606
664 Ga0105248_10015047 3300009177 Bacteria 8519
665 Ga0105248_10016403 3300009177 Bacteria 8152
666 Ga0105248_10019949 3300009177 Bacteria 7422
667 Ga0105248_10032489 3300009177 Bacteria 5833
668 Ga0105248_10035417 3300009177 Bacteria 5583
669 Ga0105248_10035567 3300009177 Bacteria 5572
670 Ga0105248_10089636 3300009177 Bacteria 3462
671 Ga0105248_10090227 3300009177 Bacteria 3451
672 Ga0105248_10094454 3300009177 Bacteria 3367
673 Ga0105248_10148758 3300009177 Bacteria 2642
674 Ga0105248_10154289 3300009177 Bacteria 2591
675 Ga0105248_10226850 3300009177 Bacteria 2103
676 Ga0105248_10253539 3300009177 Bacteria 1980
677 Ga0105237_10000434 3300009545 Bacteria 59528
678 Ga0105237_10001177 3300009545 Bacteria 34962
679 Ga0105237_10014258 3300009545 Bacteria 8323
680 Ga0105237_10036707 3300009545 Bacteria 4959
681 Ga0105237_10058537 3300009545 Bacteria 3856
682 Ga0105237_10112260 3300009545 Bacteria 2718
683 Ga0105238_10001167 3300009551 Bacteria 26450
684 Ga0105238_10006370 3300009551 Bacteria 11739
685 Ga0105238_10006836 3300009551 Bacteria 11387
686 Ga0105238_10013041 3300009551 Bacteria 8387
687 Ga0105238_10013292 3300009551 Bacteria 8308
688 Ga0105238_10013401 3300009551 Bacteria 8276
689 Ga0105238_10033409 3300009551 Bacteria 5236
690 Ga0105238_10040503 3300009551 Bacteria 4720
691 Ga0105238_10060407 3300009551 Bacteria 3794
692 Ga0105249_10000026 3300009553 Bacteria 232053
693 Ga0105249_10000100 3300009553 Bacteria 119358
694 Ga0105249_10001350 3300009553 Bacteria 21430
695 Ga0105249_10013149 3300009553 Bacteria 7305
696 Ga0105249_10013245 3300009553 Bacteria 7278
697 Ga0105249_10030891 3300009553 Bacteria 4843
698 Ga0105249_10046066 3300009553 Bacteria 3969
699 Ga0105249_10048683 3300009553 Bacteria 3864
700 Ga0105249_10069797 3300009553 Bacteria 3243
701 Ga0105249_10159280 3300009553 Bacteria 2180
702 Ga0105249_10163639 3300009553 Bacteria 2152
703 Ga0105249_10206461 3300009553 Bacteria 1925
704 Ga0123341_1000175 3300009765 Bacteria 32159
705 Ga0105239_10002965 3300010375 Bacteria 21160
706 Ga0105239_10008930 3300010375 Bacteria 11339
707 Ga0105239_10023326 3300010375 Bacteria 6814
708 Ga0105239_10109529 3300010375 Bacteria 3061
709 Ga0105239_10113734 3300010375 Bacteria 3001
710 Ga0105239_10157905 3300010375 Bacteria 2534
711 Ga0105239_10158602 3300010375 Bacteria 2527
712 Ga0105239_10198996 3300010375 Bacteria 2244
713 Ga0105239_10247019 3300010375 Bacteria 2004
714 Ga0105239_10369584 3300010375 Bacteria 1621
715 Ga0105246_10003798 3300011119 Bacteria 9152
716 Ga0157373_10002971 3300013100 Bacteria 12844
717 Ga0157373_10019604 3300013100 Bacteria 4920
718 Ga0157373_10026508 3300013100 Bacteria 4185
719 Ga0157373_10031637 3300013100 Bacteria 3808
720 Ga0157373_10057516 3300013100 Bacteria 2758
721 Ga0157373_10112184 3300013100 Bacteria 1917
722 Ga0157371_10000058 3300013102 Bacteria 171756
723 Ga0157371_10000097 3300013102 Bacteria 134150
724 Ga0157371_10017089 3300013102 Bacteria 5398
725 Ga0157371_10056865 3300013102 Bacteria 2774
726 Ga0157370_10000063 3300013104 Bacteria 114697
727 Ga0157370_10000792 3300013104 Bacteria 39754
728 Ga0157370_10001488 3300013104 Bacteria 29012
729 Ga0157370_10005670 3300013104 Bacteria 13955
730 Ga0157370_10018302 3300013104 Bacteria 7047
731 Ga0157370_10019342 3300013104 Bacteria 6835
732 Ga0157370_10030524 3300013104 Bacteria 5281
733 Ga0157370_10033624 3300013104 Bacteria 4999
734 Ga0157370_10051519 3300013104 Bacteria 3932
735 Ga0157370_10099912 3300013104 Bacteria 2719
736 Ga0157370_10111004 3300013104 Bacteria 2563
737 Ga0157370_10121246 3300013104 Bacteria 2441
738 Ga0157370_10146438 3300013104 Bacteria 2199
739 Ga0157370_10170154 3300013104 Bacteria 2025
740 Ga0157369_10000027 3300013105 Bacteria 213988
741 Ga0157369_10000691 3300013105 Bacteria 43536
742 Ga0157369_10000833 3300013105 Bacteria 39452
743 Ga0157369_10008366 3300013105 Bacteria 11865
744 Ga0157369_10008708 3300013105 Bacteria 11635
745 Ga0157369_10043077 3300013105 Bacteria 4921
746 Ga0157369_10164886 3300013105 Bacteria 2338
747 Ga0157369_10311775 3300013105 Bacteria 1636
748 Ga0171463_1001 3300013249 Bacteria 1406070
749 Ga0157374_10000464 3300013296 Bacteria 36789
750 Ga0157374_10016812 3300013296 Bacteria 6437
751 Ga0157374_10037002 3300013296 Bacteria 4475
752 Ga0157378_10005791 3300013297 Bacteria 10829
753 Ga0157378_10087305 3300013297 Bacteria 2829
754 Ga0163162_10017589 3300013306 Bacteria 6995
755 Ga0163162_10028890 3300013306 Bacteria 5488
756 Ga0163162_10031618 3300013306 Bacteria 5251
757 Ga0163162_10047442 3300013306 Bacteria 4305
758 Ga0163162_10082127 3300013306 Bacteria 3294
759 Ga0163162_10259034 3300013306 Bacteria 1871
760 Ga0157372_10004166 3300013307 Bacteria 15478
761 Ga0157372_10019961 3300013307 Bacteria 7224
762 Ga0157372_10036244 3300013307 Bacteria 5436
763 Ga0157372_10404708 3300013307 Bacteria 1590
764 Ga0157375_10000511 3300013308 Bacteria 34901
765 Ga0157375_10008007 3300013308 Bacteria 9254
766 Ga0157375_10015839 3300013308 Bacteria 6756
767 Ga0157375_10027203 3300013308 Bacteria 5343
768 Ga0157375_10159955 3300013308 Bacteria 2393
769 Ga0163163_10000007 3300014325 Bacteria 288439
770 Ga0163163_10000019 3300014325 Bacteria 199037
771 Ga0163163_10001418 3300014325 Bacteria 20279
772 Ga0163163_10002488 3300014325 Bacteria 15587
773 Ga0163163_10010614 3300014325 Bacteria 8297
774 Ga0163163_10013430 3300014325 Bacteria 7500
775 Ga0163163_10035523 3300014325 Bacteria 4836
776 Ga0163163_10035620 3300014325 Bacteria 4829
777 Ga0163163_10057658 3300014325 Bacteria 3840
778 Ga0163163_10065133 3300014325 Bacteria 3616
779 Ga0163163_10105693 3300014325 Bacteria 2841
780 Ga0163163_10194343 3300014325 Bacteria 2077
781 Ga0157380_10001740 3300014326 Bacteria 14356
782 Ga0157380_10001897 3300014326 Bacteria 13855
783 Ga0157380_10027699 3300014326 Bacteria 4311
784 Ga0157380_10157256 3300014326 Bacteria 1971
785 Ga0157379_10000463 3300014968 Bacteria 32854
786 Ga0157379_10003701 3300014968 Bacteria 13007
787 Ga0157379_10005617 3300014968 Bacteria 10779
788 Ga0157379_10009525 3300014968 Bacteria 8457
789 Ga0157379_10014999 3300014968 Bacteria 6797
790 Ga0157379_10238544 3300014968 Bacteria 1649
791 Ga0157376_10000087 3300014969 Bacteria 70163
792 Ga0157376_10004146 3300014969 Bacteria 10050
793 Ga0157376_10028578 3300014969 Bacteria 4433
794 Ga0182006_1019088 3300015261 Bacteria 2890
795 Ga0183363_1147 3300015690 Bacteria 17691
796 Ga0163161_10000008 3300017792 Bacteria 294642
797 Ga0163161_10025910 3300017792 Bacteria 4152
798 Ga0163161_10050700 3300017792 Bacteria 3005
799 Ga0163161_10116130 3300017792 Bacteria 2006
800 Ga0214544_1000008 3300021320 Bacteria 326027
801 Ga0214542_1000011 3300021321 Bacteria 238260
802 Ga0214542_1022817 3300021321 Bacteria 3912
803 Ga0214543_1000003 3300021327 Bacteria 692327
804 Ga0214543_1000004 3300021327 Bacteria 527190
805 Ga0213872_10007941 3300021361 Bacteria 5175
806 Ga0213874_10025780 3300021377 Bacteria 1661
807 Ga0213876_10000683 3300021384 Bacteria 24041
808 Ga0213876_10008649 3300021384 Bacteria 5509
809 Ga0213876_10014028 3300021384 Bacteria 4247
810 Ga0213876_10045815 3300021384 Bacteria 2312
811 Ga0213876_10062674 3300021384 Bacteria 1963
812 Ga0213875_10008717 3300021388 Bacteria 5174
813 Ga0228711_1001272 3300022739 Bacteria 36396
814 Ga0228710_1001367 3300022740 Bacteria 36396
815 Ga0209435_100011 3300025206 Bacteria 413027
816 Ga0209436_100516 3300025208 Bacteria 16861
817 Ga0207672_1000406 3300025223 Bacteria 5462
818 Ga0209563_100019 3300025230 Bacteria 697828
819 Ga0209563_104139 3300025230 Bacteria 2826
820 Ga0207427_100512 3300025231 Bacteria 20550
821 Ga0209437_100036 3300025233 Bacteria 469153
822 Ga0209437_100086 3300025233 Bacteria 254578
823 Ga0207425_1000012 3300025245 Bacteria 528324
824 Ga0207425_1000840 3300025245 Bacteria 15261
825 Ga0207425_1003029 3300025245 Bacteria 5577
826 Ga0207425_1007051 3300025245 Bacteria 3006
827 Ga0207425_1008265 3300025245 Bacteria 2677
828 Ga0209646_1000024 3300025246 Bacteria 413027
829 Ga0209026_1000002 3300025250 Bacteria 1136158
830 Ga0209026_1000030 3300025250 Bacteria 329811
831 Ga0209026_1000658 3300025250 Bacteria 21101
832 Ga0209026_1001810 3300025250 Bacteria 8805
833 Ga0209677_101617 3300025253 Bacteria 9499
834 Ga0209148_1000026 3300025254 Bacteria 629213
835 Ga0209148_1000116 3300025254 Bacteria 190078
836 Ga0209148_1000123 3300025254 Bacteria 185406
837 Ga0209759_1000011 3300025256 Bacteria 413027
838 Ga0209759_1000156 3300025256 Bacteria 117222
839 Ga0209129_1000086 3300025258 Bacteria 181543
840 Ga0209129_1000123 3300025258 Bacteria 133661
841 Ga0209129_1000316 3300025258 Bacteria 42919
842 Ga0209129_1000563 3300025258 Bacteria 25595
843 Ga0209129_1001248 3300025258 Bacteria 14586
844 Ga0209129_1004270 3300025258 Bacteria 5704
845 Ga0209129_1006734 3300025258 Bacteria 3624
846 Ga0209233_1000013 3300025261 Bacteria 1013785
847 Ga0209233_1000041 3300025261 Bacteria 515463
848 Ga0209233_1000066 3300025261 Bacteria 381218
849 Ga0209233_1000110 3300025261 Bacteria 260825
850 Ga0209233_1000166 3300025261 Bacteria 152270
851 Ga0209233_1000258 3300025261 Bacteria 80118
852 Ga0209233_1000350 3300025261 Bacteria 43454
853 Ga0209233_1008343 3300025261 Bacteria 3213
854 Ga0209233_1009557 3300025261 Bacteria 2945
855 Ga0209455_1000005 3300025272 Bacteria 1416756
856 Ga0209455_1000513 3300025272 Bacteria 27536
857 Ga0209673_1000015 3300025273 Bacteria 530618
858 Ga0209673_1000091 3300025273 Bacteria 201875
859 Ga0209673_1000919 3300025273 Bacteria 37355
860 Ga0209673_1002894 3300025273 Bacteria 10885
861 Ga0209673_1003122 3300025273 Bacteria 10126
862 Ga0209673_1003237 3300025273 Bacteria 9842
863 Ga0209673_1004304 3300025273 Bacteria 7693
864 Ga0209673_1007565 3300025273 Bacteria 4975
865 Ga0209130_1000002 3300025284 Bacteria 722648
866 Ga0209130_1000008 3300025284 Bacteria 581232
867 Ga0209130_1000088 3300025284 Bacteria 152927
868 Ga0209675_1002087 3300025291 Bacteria 10622
869 Ga0209676_1000026 3300025292 Bacteria 574599
870 Ga0209676_1000045 3300025292 Bacteria 412331
871 Ga0209676_1000046 3300025292 Bacteria 409173
872 Ga0209676_1000972 3300025292 Bacteria 34519
873 Ga0209676_1005324 3300025292 Bacteria 6779
874 Ga0209025_1000024 3300025294 Bacteria 528324
875 Ga0209025_1000407 3300025294 Bacteria 87041
876 Ga0209025_1001129 3300025294 Bacteria 38238
877 Ga0209025_1001595 3300025294 Bacteria 28547
878 Ga0209025_1003038 3300025294 Bacteria 16550
879 Ga0209025_1003170 3300025294 Bacteria 15999
880 Ga0209025_1006436 3300025294 Bacteria 9112
881 Ga0209025_1012456 3300025294 Bacteria 5446
882 Ga0209025_1018409 3300025294 Bacteria 3960
883 Ga0209025_1027582 3300025294 Bacteria 2812
884 Ga0209564_1000077 3300025295 Bacteria 281592
885 Ga0209564_1000091 3300025295 Bacteria 249103
886 Ga0209564_1000845 3300025295 Bacteria 41202
887 Ga0209564_1001578 3300025295 Bacteria 22285
888 Ga0209564_1001820 3300025295 Bacteria 19586
889 Ga0209564_1020814 3300025295 Bacteria 2388
890 Ga0209758_1000001 3300025297 Bacteria 1981790
891 Ga0209758_1000036 3300025297 Bacteria 441671
892 Ga0209758_1000046 3300025297 Bacteria 364931
893 Ga0209758_1000140 3300025297 Bacteria 174267
894 Ga0209758_1000321 3300025297 Bacteria 92591
895 Ga0209758_1000336 3300025297 Bacteria 87439
896 Ga0209758_1000602 3300025297 Bacteria 55848
897 Ga0209758_1000670 3300025297 Bacteria 51248
898 Ga0209758_1000877 3300025297 Bacteria 41329
899 Ga0209758_1001026 3300025297 Bacteria 36693
900 Ga0209758_1001612 3300025297 Bacteria 25773
901 Ga0209758_1001968 3300025297 Bacteria 22196
902 Ga0209758_1002567 3300025297 Bacteria 18250
903 Ga0209050_1000031 3300025298 Bacteria 458181
904 Ga0209050_1000929 3300025298 Bacteria 38383
905 Ga0209050_1002819 3300025298 Bacteria 13880
906 Ga0209050_1004231 3300025298 Bacteria 9873
907 Ga0209050_1009835 3300025298 Bacteria 4814
908 Ga0209256_1000057 3300025299 Bacteria 281592
909 Ga0209256_1000180 3300025299 Bacteria 123687
910 Ga0209256_1002068 3300025299 Bacteria 17685
911 Ga0209256_1004851 3300025299 Bacteria 8127
912 Ga0209256_1006061 3300025299 Bacteria 6594
913 Ga0209256_1007494 3300025299 Bacteria 5362
914 Ga0209256_1010951 3300025299 Bacteria 3711
915 Ga0209256_1015168 3300025299 Bacteria 2714
916 Ga0207426_1000012 3300025302 Bacteria 730942
917 Ga0207426_1000013 3300025302 Bacteria 721897
918 Ga0207426_1000016 3300025302 Bacteria 581232
919 Ga0207426_1000063 3300025302 Bacteria 358920
920 Ga0207426_1000172 3300025302 Bacteria 163690
921 Ga0207426_1000278 3300025302 Bacteria 105775
922 Ga0207426_1001284 3300025302 Bacteria 21757
923 Ga0209051_1000084 3300025303 Bacteria 190324
924 Ga0209051_1001391 3300025303 Bacteria 20798
925 Ga0209051_1009000 3300025303 Bacteria 5200
926 Ga0209051_1019005 3300025303 Bacteria 3017
927 Ga0209051_1026806 3300025303 Bacteria 2312
928 Ga0209257_1000191 3300025304 Bacteria 152659
929 Ga0209257_1000404 3300025304 Bacteria 83872
930 Ga0209257_1000489 3300025304 Bacteria 71195
931 Ga0209257_1000522 3300025304 Bacteria 66723
932 Ga0209257_1000907 3300025304 Bacteria 41463
933 Ga0209257_1002244 3300025304 Bacteria 19810
934 Ga0209257_1005200 3300025304 Bacteria 9345
935 Ga0209257_1007156 3300025304 Bacteria 6859
936 Ga0207697_10000004 3300025315 Bacteria 90016
937 Ga0207697_10009901 3300025315 Bacteria 4098
938 Ga0207656_10006505 3300025321 Bacteria 4207
939 Ga0207656_10045028 3300025321 Bacteria 1887
940 Ga0207682_10000861 3300025893 Bacteria 14082
941 Ga0207642_10040011 3300025899 Bacteria 2042
942 Ga0207710_10008854 3300025900 Bacteria 4237
943 Ga0207710_10016185 3300025900 Bacteria 3154
944 Ga0207710_10023833 3300025900 Bacteria 2631
945 Ga0207688_10014451 3300025901 Bacteria 4292
946 Ga0207680_10000004 3300025903 Bacteria 827324
947 Ga0207680_10000126 3300025903 Bacteria 35872
948 Ga0207680_10063877 3300025903 Bacteria 2255
949 Ga0207647_10000352 3300025904 Bacteria 37248
950 Ga0207647_10003168 3300025904 Bacteria 12342
951 Ga0207647_10007669 3300025904 Bacteria 7776
952 Ga0207647_10017108 3300025904 Bacteria 4936
953 Ga0207647_10073249 3300025904 Bacteria 2064
954 Ga0207645_10000533 3300025907 Bacteria 31622
955 Ga0207645_10000726 3300025907 Bacteria 27432
956 Ga0207645_10007509 3300025907 Bacteria 7693
957 Ga0207645_10096244 3300025907 Bacteria 1907
958 Ga0207643_10012145 3300025908 Bacteria 4654
959 Ga0207643_10056538 3300025908 Bacteria 2232
960 Ga0207705_10000002 3300025909 Bacteria 2046852
961 Ga0207705_10000022 3300025909 Bacteria 302232
962 Ga0207705_10000075 3300025909 Bacteria 123551
963 Ga0207705_10000116 3300025909 Bacteria 89237
964 Ga0207705_10001139 3300025909 Bacteria 21654
965 Ga0207705_10001216 3300025909 Bacteria 20824
966 Ga0207705_10002147 3300025909 Bacteria 15290
967 Ga0207705_10003226 3300025909 Bacteria 12416
968 Ga0207705_10003824 3300025909 Bacteria 11451
969 Ga0207705_10024429 3300025909 Bacteria 4312
970 Ga0207705_10031317 3300025909 Bacteria 3795
971 Ga0207705_10036046 3300025909 Bacteria 3540
972 Ga0207705_10086619 3300025909 Bacteria 2289
973 Ga0207684_10000062 3300025910 Bacteria 202863
974 Ga0207684_10041021 3300025910 Bacteria 3926
975 Ga0207654_10001444 3300025911 Bacteria 12596
976 Ga0207654_10031154 3300025911 Bacteria 2935
977 Ga0207707_10000005 3300025912 Bacteria 382024
978 Ga0207707_10017795 3300025912 Bacteria 6198
979 Ga0207707_10056177 3300025912 Bacteria 3425
980 Ga0207707_10060609 3300025912 Bacteria 3291
981 Ga0207707_10116077 3300025912 Bacteria 2339
982 Ga0207695_10000004 3300025913 Bacteria 1288665
983 Ga0207695_10000376 3300025913 Bacteria 101548
984 Ga0207695_10000549 3300025913 Bacteria 77356
985 Ga0207695_10001723 3300025913 Bacteria 34990
986 Ga0207695_10002257 3300025913 Bacteria 28858
987 Ga0207695_10002784 3300025913 Bacteria 25453
988 Ga0207695_10006568 3300025913 Bacteria 15049
989 Ga0207695_10008535 3300025913 Bacteria 12805
990 Ga0207695_10009927 3300025913 Bacteria 11698
991 Ga0207695_10012074 3300025913 Bacteria 10384
992 Ga0207695_10013530 3300025913 Bacteria 9723
993 Ga0207695_10022536 3300025913 Bacteria 7146
994 Ga0207695_10032559 3300025913 Bacteria 5703
995 Ga0207695_10036124 3300025913 Bacteria 5345
996 Ga0207695_10038104 3300025913 Bacteria 5181
997 Ga0207695_10040048 3300025913 Bacteria 5030
998 Ga0207695_10042212 3300025913 Bacteria 4875
999 Ga0207695_10059631 3300025913 Bacteria 3955
1000 Ga0207695_10076426 3300025913 Bacteria 3404
1001 Ga0207695_10178276 3300025913 Bacteria 2047
1002 Ga0207695_10178572 3300025913 Bacteria 2045
1003 Ga0207671_10000732 3300025914 Bacteria 41620
1004 Ga0207671_10000870 3300025914 Bacteria 38250
1005 Ga0207671_10001968 3300025914 Bacteria 22661
1006 Ga0207671_10003257 3300025914 Bacteria 16330
1007 Ga0207671_10025590 3300025914 Bacteria 4432
1008 Ga0207671_10041806 3300025914 Bacteria 3393
1009 Ga0207671_10084860 3300025914 Bacteria 2379
1010 Ga0207693_10015726 3300025915 Bacteria 6063
1011 Ga0207693_10040113 3300025915 Bacteria 3687
1012 Ga0207663_10000347 3300025916 Bacteria 20128
1013 Ga0207663_10013918 3300025916 Bacteria 4390
1014 Ga0207660_10026246 3300025917 Bacteria 3965
1015 Ga0207660_10088272 3300025917 Bacteria 2293
1016 Ga0207660_10114801 3300025917 Bacteria 2032
1017 Ga0207662_10017045 3300025918 Bacteria 4104
1018 Ga0207662_10047470 3300025918 Bacteria 2543
1019 Ga0207657_10000082 3300025919 Bacteria 89667
1020 Ga0207657_10000128 3300025919 Bacteria 76013
1021 Ga0207657_10000551 3300025919 Bacteria 39953
1022 Ga0207657_10001403 3300025919 Bacteria 25687
1023 Ga0207657_10001933 3300025919 Bacteria 22370
1024 Ga0207657_10003250 3300025919 Bacteria 17399
1025 Ga0207657_10004163 3300025919 Bacteria 15330
1026 Ga0207657_10005142 3300025919 Bacteria 13713
1027 Ga0207657_10006930 3300025919 Bacteria 11679
1028 Ga0207657_10008726 3300025919 Bacteria 10259
1029 Ga0207657_10010077 3300025919 Bacteria 9449
1030 Ga0207657_10013622 3300025919 Bacteria 7974
1031 Ga0207657_10015864 3300025919 Bacteria 7279
1032 Ga0207657_10016244 3300025919 Bacteria 7184
1033 Ga0207657_10028899 3300025919 Bacteria 5051
1034 Ga0207657_10047741 3300025919 Bacteria 3741
1035 Ga0207649_10000085 3300025920 Bacteria 79657
1036 Ga0207649_10000874 3300025920 Bacteria 19101
1037 Ga0207649_10001955 3300025920 Bacteria 11752
1038 Ga0207652_10000320 3300025921 Bacteria 49730
1039 Ga0207652_10034988 3300025921 Bacteria 4237
1040 Ga0207652_10060055 3300025921 Bacteria 3279
1041 Ga0207652_10150496 3300025921 Bacteria 2084
1042 Ga0207652_10226693 3300025921 Bacteria 1684
1043 Ga0207646_10004539 3300025922 Bacteria 15032
1044 Ga0207646_10022313 3300025922 Bacteria 5834
1045 Ga0207646_10034227 3300025922 Bacteria 4592
1046 Ga0207646_10036028 3300025922 Bacteria 4467
1047 Ga0207681_10000002 3300025923 Bacteria 985597
1048 Ga0207681_10000090 3300025923 Bacteria 78944
1049 Ga0207681_10000297 3300025923 Bacteria 36667
1050 Ga0207681_10001396 3300025923 Bacteria 15605
1051 Ga0207681_10003530 3300025923 Bacteria 9739
1052 Ga0207681_10014232 3300025923 Bacteria 4938
1053 Ga0207681_10028518 3300025923 Bacteria 3616
1054 Ga0207681_10030631 3300025923 Bacteria 3508
1055 Ga0207681_10087133 3300025923 Bacteria 2221
1056 Ga0207694_10000010 3300025924 Bacteria 439722
1057 Ga0207694_10000725 3300025924 Bacteria 29645
1058 Ga0207694_10000733 3300025924 Bacteria 29483
1059 Ga0207694_10001459 3300025924 Bacteria 20221
1060 Ga0207694_10037068 3300025924 Bacteria 3742
1061 Ga0207694_10044342 3300025924 Bacteria 3434
1062 Ga0207694_10055399 3300025924 Bacteria 3078
1063 Ga0207694_10059629 3300025924 Bacteria 2968
1064 Ga0207694_10067952 3300025924 Bacteria 2782
1065 Ga0207694_10073634 3300025924 Bacteria 2673
1066 Ga0207650_10000161 3300025925 Bacteria 81097
1067 Ga0207650_10000899 3300025925 Bacteria 22456
1068 Ga0207650_10000969 3300025925 Bacteria 21577
1069 Ga0207650_10001681 3300025925 Bacteria 15720
1070 Ga0207650_10017278 3300025925 Bacteria 5049
1071 Ga0207650_10019579 3300025925 Bacteria 4758
1072 Ga0207650_10022332 3300025925 Bacteria 4477
1073 Ga0207650_10040605 3300025925 Bacteria 3405
1074 Ga0207659_10002905 3300025926 Bacteria 10199
1075 Ga0207659_10004333 3300025926 Bacteria 8575
1076 Ga0207659_10011142 3300025926 Bacteria 5673
1077 Ga0207659_10087522 3300025926 Bacteria 2319
1078 Ga0207659_10095221 3300025926 Bacteria 2232
1079 Ga0207687_10003057 3300025927 Bacteria 11348
1080 Ga0207687_10015031 3300025927 Bacteria 5070
1081 Ga0207687_10036850 3300025927 Bacteria 3333
1082 Ga0207700_10044321 3300025928 Bacteria 3274
1083 Ga0207664_10003349 3300025929 Bacteria 10653
1084 Ga0207664_10029848 3300025929 Bacteria 4158
1085 Ga0207644_10000002 3300025931 Bacteria 942221
1086 Ga0207644_10000003 3300025931 Bacteria 585905
1087 Ga0207644_10000456 3300025931 Bacteria 26391
1088 Ga0207644_10000755 3300025931 Bacteria 20528
1089 Ga0207644_10001492 3300025931 Bacteria 15069
1090 Ga0207644_10004790 3300025931 Bacteria 8806
1091 Ga0207644_10045675 3300025931 Bacteria 3117
1092 Ga0207644_10097261 3300025931 Bacteria 2205
1093 Ga0207690_10000001 3300025932 Bacteria 807539
1094 Ga0207690_10000002 3300025932 Bacteria 807473
1095 Ga0207690_10000003 3300025932 Bacteria 783011
1096 Ga0207690_10000004 3300025932 Bacteria 746138
1097 Ga0207690_10000110 3300025932 Bacteria 67145
1098 Ga0207690_10001051 3300025932 Bacteria 17671
1099 Ga0207690_10008820 3300025932 Bacteria 5986
1100 Ga0207690_10015486 3300025932 Bacteria 4622
1101 Ga0207690_10020058 3300025932 Bacteria 4124
1102 Ga0207690_10023474 3300025932 Bacteria 3849
1103 Ga0207706_10000203 3300025933 Bacteria 65753
1104 Ga0207706_10002860 3300025933 Bacteria 16752
1105 Ga0207706_10009244 3300025933 Bacteria 9058
1106 Ga0207706_10025725 3300025933 Bacteria 5272
1107 Ga0207706_10031480 3300025933 Bacteria 4725
1108 Ga0207706_10092135 3300025933 Bacteria 2665
1109 Ga0207686_10001863 3300025934 Bacteria 11717
1110 Ga0207686_10014186 3300025934 Bacteria 4430
1111 Ga0207686_10021670 3300025934 Bacteria 3692
1112 Ga0207686_10036101 3300025934 Bacteria 2972
1113 Ga0207686_10052905 3300025934 Bacteria 2536
1114 Ga0207709_10001194 3300025935 Bacteria 18758
1115 Ga0207670_10017741 3300025936 Bacteria 4309
1116 Ga0207670_10020316 3300025936 Bacteria 4079
1117 Ga0207670_10065215 3300025936 Bacteria 2498
1118 Ga0207669_10004102 3300025937 Bacteria 6379
1119 Ga0207669_10009330 3300025937 Bacteria 4666
1120 Ga0207669_10045837 3300025937 Bacteria 2579
1121 Ga0207704_10000013 3300025938 Bacteria 170478
1122 Ga0207704_10006858 3300025938 Bacteria 5341
1123 Ga0207704_10007220 3300025938 Bacteria 5232
1124 Ga0207704_10029178 3300025938 Bacteria 3072
1125 Ga0207704_10074847 3300025938 Bacteria 2163
1126 Ga0207665_10038392 3300025939 Bacteria 3188
1127 Ga0207691_10001512 3300025940 Bacteria 23124
1128 Ga0207691_10007445 3300025940 Bacteria 10539
1129 Ga0207691_10018012 3300025940 Bacteria 6686
1130 Ga0207691_10020717 3300025940 Bacteria 6218
1131 Ga0207691_10036328 3300025940 Bacteria 4564
1132 Ga0207691_10062215 3300025940 Bacteria 3388
1133 Ga0207691_10077578 3300025940 Bacteria 2992
1134 Ga0207691_10088768 3300025940 Bacteria 2773
1135 Ga0207691_10144905 3300025940 Bacteria 2091
1136 Ga0207691_10159656 3300025940 Bacteria 1978
1137 Ga0207711_10001901 3300025941 Bacteria 19015
1138 Ga0207711_10006319 3300025941 Bacteria 9993
1139 Ga0207711_10024032 3300025941 Bacteria 5101
1140 Ga0207711_10025053 3300025941 Bacteria 5005
1141 Ga0207711_10028549 3300025941 Bacteria 4696
1142 Ga0207711_10039636 3300025941 Bacteria 4008
1143 Ga0207711_10042870 3300025941 Bacteria 3857
1144 Ga0207711_10047847 3300025941 Bacteria 3658
1145 Ga0207711_10071621 3300025941 Bacteria 3008
1146 Ga0207711_10078688 3300025941 Bacteria 2877
1147 Ga0207711_10095844 3300025941 Bacteria 2618
1148 Ga0207711_10095956 3300025941 Bacteria 2616
1149 Ga0207689_10000114 3300025942 Bacteria 66389
1150 Ga0207689_10001353 3300025942 Bacteria 23520
1151 Ga0207689_10095643 3300025942 Bacteria 2440
1152 Ga0207689_10107170 3300025942 Bacteria 2297
1153 Ga0207689_10161543 3300025942 Bacteria 1846
1154 Ga0207661_10049776 3300025944 Bacteria 3337
1155 Ga0207679_10001178 3300025945 Bacteria 16658
1156 Ga0207679_10002830 3300025945 Bacteria 10761
1157 Ga0207679_10016161 3300025945 Bacteria 4949
1158 Ga0207679_10032052 3300025945 Bacteria 3685
1159 Ga0207679_10062746 3300025945 Bacteria 2771
1160 Ga0207679_10132087 3300025945 Bacteria 2004
1161 Ga0207667_10000010 3300025949 Bacteria 477432
1162 Ga0207667_10000065 3300025949 Bacteria 186655
1163 Ga0207667_10000113 3300025949 Bacteria 131083
1164 Ga0207667_10007689 3300025949 Bacteria 12901
1165 Ga0207667_10008421 3300025949 Bacteria 12258
1166 Ga0207667_10011692 3300025949 Bacteria 10185
1167 Ga0207667_10016606 3300025949 Bacteria 8309
1168 Ga0207667_10025417 3300025949 Bacteria 6480
1169 Ga0207667_10026375 3300025949 Bacteria 6350
1170 Ga0207667_10051356 3300025949 Bacteria 4347
1171 Ga0207667_10082540 3300025949 Bacteria 3329
1172 Ga0207667_10091959 3300025949 Bacteria 3134
1173 Ga0207667_10095021 3300025949 Bacteria 3077
1174 Ga0207667_10098499 3300025949 Bacteria 3017
1175 Ga0207667_10113916 3300025949 Bacteria 2788
1176 Ga0207667_10129302 3300025949 Bacteria 2601
1177 Ga0207667_10144559 3300025949 Bacteria 2448
1178 Ga0207667_10157185 3300025949 Bacteria 2339
1179 Ga0207667_10165499 3300025949 Bacteria 2274
1180 Ga0207667_10234630 3300025949 Bacteria 1878
1181 Ga0207651_10000013 3300025960 Bacteria 177573
1182 Ga0207651_10006047 3300025960 Bacteria 6284
1183 Ga0207651_10008026 3300025960 Bacteria 5664
1184 Ga0207651_10049238 3300025960 Bacteria 2854
1185 Ga0207651_10132231 3300025960 Bacteria 1912
1186 Ga0207712_10000001 3300025961 Bacteria 750309
1187 Ga0207712_10000008 3300025961 Bacteria 527957
1188 Ga0207712_10002493 3300025961 Bacteria 11847
1189 Ga0207712_10027757 3300025961 Bacteria 3782
1190 Ga0207712_10031021 3300025961 Bacteria 3597
1191 Ga0207712_10057955 3300025961 Bacteria 2735
1192 Ga0207712_10104128 3300025961 Bacteria 2115
1193 Ga0207668_10000046 3300025972 Bacteria 102051
1194 Ga0207668_10000323 3300025972 Bacteria 31013
1195 Ga0207668_10000489 3300025972 Bacteria 24856
1196 Ga0207668_10000769 3300025972 Bacteria 19619
1197 Ga0207668_10001916 3300025972 Bacteria 12180
1198 Ga0207668_10036200 3300025972 Bacteria 3293
1199 Ga0207640_10000532 3300025981 Bacteria 22823
1200 Ga0207640_10000777 3300025981 Bacteria 18152
1201 Ga0207640_10011810 3300025981 Bacteria 4957
1202 Ga0207640_10084005 3300025981 Bacteria 2185
1203 Ga0207658_10000381 3300025986 Bacteria 43297
1204 Ga0207658_10002567 3300025986 Bacteria 13190
1205 Ga0207658_10002711 3300025986 Bacteria 12780
1206 Ga0207658_10006709 3300025986 Bacteria 7843
1207 Ga0207658_10019792 3300025986 Bacteria 4657
1208 Ga0207658_10023280 3300025986 Bacteria 4322
1209 Ga0207658_10033569 3300025986 Bacteria 3662
1210 Ga0207658_10042754 3300025986 Bacteria 3289
1211 Ga0207658_10081886 3300025986 Bacteria 2477
1212 Ga0207658_10121860 3300025986 Bacteria 2081
1213 Ga0207658_10123592 3300025986 Bacteria 2068
1214 Ga0207677_10000599 3300026023 Bacteria 22231
1215 Ga0207703_10000717 3300026035 Bacteria 32692
1216 Ga0207703_10000968 3300026035 Bacteria 27762
1217 Ga0207703_10002031 3300026035 Bacteria 17877
1218 Ga0207703_10002383 3300026035 Bacteria 16346
1219 Ga0207703_10009335 3300026035 Bacteria 7710
1220 Ga0207703_10011972 3300026035 Bacteria 6756
1221 Ga0207703_10026921 3300026035 Bacteria 4529
1222 Ga0207703_10043742 3300026035 Bacteria 3596
1223 Ga0207703_10062481 3300026035 Bacteria 3051
1224 Ga0207703_10161525 3300026035 Bacteria 1963
1225 Ga0207703_10187356 3300026035 Bacteria 1830
1226 Ga0207639_10000649 3300026041 Bacteria 23939
1227 Ga0207639_10001013 3300026041 Bacteria 19111
1228 Ga0207639_10025979 3300026041 Bacteria 4252
1229 Ga0207639_10070342 3300026041 Bacteria 2733
1230 Ga0207639_10169024 3300026041 Bacteria 1850
1231 Ga0207678_10002809 3300026067 Bacteria 15793
1232 Ga0207678_10002995 3300026067 Bacteria 15276
1233 Ga0207678_10007971 3300026067 Bacteria 9337
1234 Ga0207678_10013198 3300026067 Bacteria 7249
1235 Ga0207678_10022801 3300026067 Bacteria 5482
1236 Ga0207678_10024755 3300026067 Bacteria 5241
1237 Ga0207678_10030637 3300026067 Bacteria 4696
1238 Ga0207678_10069201 3300026067 Bacteria 3026
1239 Ga0207678_10112004 3300026067 Bacteria 2328
1240 Ga0207708_10023066 3300026075 Bacteria 4702
1241 Ga0207708_10055127 3300026075 Bacteria 3031
1242 Ga0207702_10000335 3300026078 Bacteria 53978
1243 Ga0207702_10003186 3300026078 Bacteria 15168
1244 Ga0207702_10007158 3300026078 Bacteria 9546
1245 Ga0207702_10012460 3300026078 Bacteria 7077
1246 Ga0207702_10013342 3300026078 Bacteria 6834
1247 Ga0207702_10015105 3300026078 Bacteria 6402
1248 Ga0207702_10015795 3300026078 Bacteria 6252
1249 Ga0207702_10036350 3300026078 Bacteria 4119
1250 Ga0207702_10055860 3300026078 Bacteria 3350
1251 Ga0207702_10059377 3300026078 Bacteria 3258
1252 Ga0207702_10122186 3300026078 Bacteria 2332
1253 Ga0207702_10138114 3300026078 Bacteria 2202
1254 Ga0207702_10155075 3300026078 Bacteria 2087
1255 Ga0207702_10173365 3300026078 Bacteria 1980
1256 Ga0207702_10208947 3300026078 Bacteria 1814
1257 Ga0207641_10000148 3300026088 Bacteria 99601
1258 Ga0207641_10001619 3300026088 Bacteria 21967
1259 Ga0207641_10002980 3300026088 Bacteria 15314
1260 Ga0207641_10008651 3300026088 Bacteria 8404
1261 Ga0207641_10010320 3300026088 Bacteria 7678
1262 Ga0207641_10014132 3300026088 Bacteria 6543
1263 Ga0207641_10016139 3300026088 Bacteria 6116
1264 Ga0207641_10022686 3300026088 Bacteria 5167
1265 Ga0207641_10024712 3300026088 Bacteria 4952
1266 Ga0207641_10028994 3300026088 Bacteria 4576
1267 Ga0207641_10062714 3300026088 Bacteria 3173
1268 Ga0207641_10173737 3300026088 Bacteria 1969
1269 Ga0207641_10174737 3300026088 Bacteria 1963
1270 Ga0207641_10183534 3300026088 Bacteria 1918
1271 Ga0207641_10208902 3300026088 Bacteria 1804
1272 Ga0207641_10224143 3300026088 Bacteria 1745
1273 Ga0207648_10000025 3300026089 Bacteria 131593
1274 Ga0207648_10000465 3300026089 Bacteria 45161
1275 Ga0207648_10000683 3300026089 Bacteria 37970
1276 Ga0207648_10020965 3300026089 Bacteria 5883
1277 Ga0207648_10035170 3300026089 Bacteria 4414
1278 Ga0207676_10000184 3300026095 Bacteria 55154
1279 Ga0207676_10000685 3300026095 Bacteria 26828
1280 Ga0207676_10001987 3300026095 Bacteria 14886
1281 Ga0207676_10008536 3300026095 Bacteria 7283
1282 Ga0207676_10093330 3300026095 Bacteria 2477
1283 Ga0207676_10107992 3300026095 Bacteria 2322
1284 Ga0207674_10001996 3300026116 Bacteria 25880
1285 Ga0207674_10005358 3300026116 Bacteria 15258
1286 Ga0207674_10007306 3300026116 Bacteria 12871
1287 Ga0207674_10009274 3300026116 Bacteria 11276
1288 Ga0207674_10014318 3300026116 Bacteria 8764
1289 Ga0207674_10019262 3300026116 Bacteria 7397
1290 Ga0207674_10033232 3300026116 Bacteria 5402
1291 Ga0207674_10039452 3300026116 Bacteria 4894
1292 Ga0207674_10106406 3300026116 Bacteria 2783
1293 Ga0207674_10149210 3300026116 Bacteria 2295
1294 Ga0207674_10149627 3300026116 Bacteria 2292
1295 Ga0207675_100001093 3300026118 Bacteria 26859
1296 Ga0207675_100001532 3300026118 Bacteria 23157
1297 Ga0207675_100001590 3300026118 Bacteria 22733
1298 Ga0207675_100146875 3300026118 Bacteria 2243
1299 Ga0207675_100158128 3300026118 Bacteria 2160
1300 Ga0207683_10063991 3300026121 Bacteria 3240
1301 Ga0207683_10071412 3300026121 Bacteria 3069
1302 Ga0207683_10121483 3300026121 Bacteria 2345
1303 Ga0207683_10122056 3300026121 Bacteria 2340
1304 Ga0207683_10126761 3300026121 Bacteria 2294
1305 Ga0207683_10128714 3300026121 Bacteria 2276
1306 Ga0207698_10000005 3300026142 Bacteria 295687
1307 Ga0207698_10000396 3300026142 Bacteria 25123
1308 Ga0207698_10003038 3300026142 Bacteria 10059
1309 Ga0207698_10004273 3300026142 Bacteria 8697
1310 Ga0207698_10036537 3300026142 Bacteria 3607
1311 Ga0207698_10125852 3300026142 Bacteria 2179
1312 Ga0207698_10128562 3300026142 Bacteria 2160
1313 Ga0207698_10152504 3300026142 Bacteria 2008
1314 Ga0207698_10190102 3300026142 Bacteria 1828
1315 Ga0209281_1000192 3300027111 Bacteria 140252
1316 Ga0209281_1000629 3300027111 Bacteria 39061
1317 Ga0209281_1000665 3300027111 Bacteria 36397
1318 Ga0209371_1000009 3300027312 Bacteria 963030
1319 Ga0209371_1000853 3300027312 Bacteria 24684
1320 Ga0209371_1013153 3300027312 Bacteria 2345
1321 Ga0209981_1000348 3300027378 Bacteria 5938
1322 Ga0209282_1000172 3300027666 Bacteria 36305
1323 Ga0209282_1000224 3300027666 Bacteria 29523
1324 Ga0209282_1006939 3300027666 Bacteria 7066
1325 Ga0209971_1011596 3300027682 Bacteria 2088
1326 Ga0209998_10001089 3300027717 Bacteria 6789
1327 Ga0209974_10000723 3300027876 Bacteria 11291
1328 Ga0207428_10000212 3300027907 Bacteria 80663
1329 Ga0207428_10002530 3300027907 Bacteria 18243
1330 Ga0207428_10003169 3300027907 Bacteria 16100
1331 Ga0207428_10004109 3300027907 Bacteria 13949
1332 Ga0207428_10027825 3300027907 Bacteria 4704
1333 Ga0207428_10058874 3300027907 Bacteria 3047
1334 Ga0207428_10068549 3300027907 Bacteria 2790
1335 Ga0207428_10069369 3300027907 Bacteria 2772
1336 Ga0207428_10072998 3300027907 Bacteria 2693
1337 Ga0207428_10104652 3300027907 Bacteria 2184
1338 Ga0207428_10114145 3300027907 Bacteria 2076
1339 Ga0268266_10000002 3300028379 Bacteria 3059047
1340 Ga0268266_10000005 3300028379 Bacteria 1448194
1341 Ga0268266_10000042 3300028379 Bacteria 316826
1342 Ga0268266_10000215 3300028379 Bacteria 100801
1343 Ga0268266_10000468 3300028379 Bacteria 58386
1344 Ga0268266_10001066 3300028379 Bacteria 34388
1345 Ga0268266_10001771 3300028379 Bacteria 24516
1346 Ga0268266_10002087 3300028379 Bacteria 22114
1347 Ga0268266_10007931 3300028379 Bacteria 9500
1348 Ga0268266_10011822 3300028379 Bacteria 7567
1349 Ga0268266_10014889 3300028379 Bacteria 6678
1350 Ga0268266_10051731 3300028379 Bacteria 3526
1351 Ga0268266_10055798 3300028379 Bacteria 3397
1352 Ga0268266_10084200 3300028379 Bacteria 2777
1353 Ga0268266_10084451 3300028379 Bacteria 2772
1354 Ga0268266_10099932 3300028379 Bacteria 2555
1355 Ga0268266_10116859 3300028379 Bacteria 2370
1356 Ga0268266_10131212 3300028379 Bacteria 2241
1357 Ga0268266_10145828 3300028379 Bacteria 2128
1358 Ga0268265_10000091 3300028380 Bacteria 115237
1359 Ga0268265_10000260 3300028380 Bacteria 60001
1360 Ga0268265_10000481 3300028380 Bacteria 41838
1361 Ga0268265_10000611 3300028380 Bacteria 35660
1362 Ga0268265_10001389 3300028380 Bacteria 20536
1363 Ga0268265_10002755 3300028380 Bacteria 12978
1364 Ga0268265_10003095 3300028380 Bacteria 12138
1365 Ga0268265_10008799 3300028380 Bacteria 6821
1366 Ga0268265_10025497 3300028380 Bacteria 4198
1367 Ga0268265_10036803 3300028380 Bacteria 3587
1368 Ga0268265_10060525 3300028380 Bacteria 2902
1369 Ga0268265_10069422 3300028380 Bacteria 2736
1370 Ga0268265_10073569 3300028380 Bacteria 2669
1371 Ga0268265_10082452 3300028380 Bacteria 2543
1372 Ga0268265_10102437 3300028380 Bacteria 2316
1373 Ga0268265_10108204 3300028380 Bacteria 2263
1374 Ga0268264_10000006 3300028381 Bacteria 827324
1375 Ga0268264_10000010 3300028381 Bacteria 596543
1376 Ga0268264_10000059 3300028381 Bacteria 306927
1377 Ga0268264_10000399 3300028381 Bacteria 62094
1378 Ga0268264_10010227 3300028381 Bacteria 7765
1379 Ga0268264_10012613 3300028381 Bacteria 6960
1380 Ga0268264_10013574 3300028381 Bacteria 6706
1381 Ga0268264_10031932 3300028381 Bacteria 4320
1382 Ga0268264_10032326 3300028381 Bacteria 4293
1383 Ga0268264_10056007 3300028381 Bacteria 3295
1384 Ga0268264_10067122 3300028381 Bacteria 3027
1385 Ga0268264_10105159 3300028381 Bacteria 2462
1386 Ga0268264_10147506 3300028381 Bacteria 2105
1387 Ga0268264_10157781 3300028381 Bacteria 2040
1388 Ga0265337_1006668 3300028556 Bacteria 4411
1389 Ga0265326_10008735 3300028558 Bacteria 3044
1390 Ga0265334_10003958 3300028573 Bacteria 6666
1391 Ga0265318_10001720 3300028577 Bacteria 12528
1392 Ga0265318_10007162 3300028577 Bacteria 5070
1393 Ga0265323_10000205 3300028653 Bacteria 35181
1394 Ga0265336_10015103 3300028666 Bacteria 2548
1395 Ga0307515_10018100 3300028794 Bacteria 12783
1396 Ga0265338_10003950 3300028800 Bacteria 20434
1397 Ga0265338_10012084 3300028800 Bacteria 9871
1398 Ga0265338_10014174 3300028800 Bacteria 8906
1399 Ga0265338_10026942 3300028800 Bacteria 5782
1400 Ga0268256_1000010 3300030500 Bacteria 963034
1401 Ga0268256_1009008 3300030500 Bacteria 3360
1402 Ga0268256_1015416 3300030500 Bacteria 2230
1403 Ga0307511_10002855 3300030521 Bacteria 17911
1404 Ga0265332_10037976 3300031238 Bacteria 2088
1405 Ga0265328_10000013 3300031239 Bacteria 156079
1406 Ga0265328_10002663 3300031239 Bacteria 7987
1407 Ga0265328_10006063 3300031239 Bacteria 5145
1408 Ga0265328_10008673 3300031239 Bacteria 4176
1409 Ga0265320_10000341 3300031240 Bacteria 38089
1410 Ga0265325_10001298 3300031241 Bacteria 17692
1411 Ga0265325_10004252 3300031241 Bacteria 9086
1412 Ga0265325_10007437 3300031241 Bacteria 6554
1413 Ga0265325_10010903 3300031241 Bacteria 5236
1414 Ga0265325_10022202 3300031241 Bacteria 3480
1415 Ga0265325_10058748 3300031241 Bacteria 1958
1416 Ga0265329_10028088 3300031242 Bacteria 1846
1417 Ga0265340_10003946 3300031247 Bacteria 8348
1418 Ga0265340_10011282 3300031247 Bacteria 4756
1419 Ga0265340_10011382 3300031247 Bacteria 4726
1420 Ga0265340_10035956 3300031247 Bacteria 2457
1421 Ga0265339_10000187 3300031249 Bacteria 52396
1422 Ga0265339_10002952 3300031249 Bacteria 12018
1423 Ga0265339_10007637 3300031249 Bacteria 6963
1424 Ga0265339_10042974 3300031249 Bacteria 2501
1425 Ga0265339_10099829 3300031249 Bacteria 1512
1426 Ga0265331_10000007 3300031250 Bacteria 331074
1427 Ga0265331_10001068 3300031250 Bacteria 21329
1428 Ga0265331_10002691 3300031250 Bacteria 11841
1429 Ga0265331_10005449 3300031250 Bacteria 7680
1430 Ga0265331_10033495 3300031250 Unclassified 2540
1431 Ga0265331_10041807 3300031250 Bacteria 2226
1432 Ga0265331_10041898 3300031250 Bacteria 2223
1433 Ga0265331_10049431 3300031250 Bacteria 2020
1434 Ga0265327_10000430 3300031251 Bacteria 76023
1435 Ga0265327_10000988 3300031251 Bacteria 40530
1436 Ga0265327_10003263 3300031251 Bacteria 15721
1437 Ga0265327_10004119 3300031251 Bacteria 13128
1438 Ga0265316_10002266 3300031344 Bacteria 20162
1439 Ga0265316_10033002 3300031344 Bacteria 4220
1440 Ga0265316_10037488 3300031344 Bacteria 3912
1441 Ga0265316_10061511 3300031344 Bacteria 2916
1442 Ga0307513_10008076 3300031456 Bacteria 13509
1443 Ga0307513_10022694 3300031456 Bacteria 7365
1444 Ga0307509_10001121 3300031507 Bacteria 45933
1445 Ga0307408_100113550 3300031548 Bacteria 2085
1446 Ga0265313_10000225 3300031595 Bacteria 60933
1447 Ga0265313_10003110 3300031595 Bacteria 13719
1448 Ga0265313_10004928 3300031595 Bacteria 10002
1449 Ga0265313_10005056 3300031595 Bacteria 9833
1450 Ga0265313_10007221 3300031595 Bacteria 7644
1451 Ga0265313_10008225 3300031595 Bacteria 6966
1452 Ga0265313_10008351 3300031595 Bacteria 6891
1453 Ga0265313_10037235 3300031595 Bacteria 2435
1454 Ga0307508_10027860 3300031616 Bacteria 5112
1455 Ga0307508_10031277 3300031616 Bacteria 4812
1456 Ga0316575_10019482 3300031665 Bacteria 2595
1457 Ga0316575_10053381 3300031665 Bacteria 1610
1458 Ga0316579_10000296 3300031691 Bacteria 15312
1459 Ga0265314_10003818 3300031711 Bacteria 14391
1460 Ga0265314_10012052 3300031711 Bacteria 7087
1461 Ga0265314_10019788 3300031711 Bacteria 5205
1462 Ga0265314_10026538 3300031711 Bacteria 4351
1463 Ga0265314_10033132 3300031711 Bacteria 3792
1464 Ga0265314_10033399 3300031711 Bacteria 3773
1465 Ga0265314_10080792 3300031711 Bacteria 2145
1466 Ga0265314_10115725 3300031711 Bacteria 1696
1467 Ga0265342_10002601 3300031712 Bacteria 15462
1468 Ga0265342_10003618 3300031712 Bacteria 12590
1469 Ga0265342_10024479 3300031712 Bacteria 3810
1470 Ga0265342_10033245 3300031712 Bacteria 3173
1471 Ga0265342_10081696 3300031712 Unclassified 1866
1472 Ga0316576_10006360 3300031727 Bacteria 7344
1473 Ga0316576_10030591 3300031727 Bacteria 3813
1474 Ga0316576_10061119 3300031727 Bacteria 2761
1475 Ga0316576_10090862 3300031727 Bacteria 2275
1476 Ga0307516_10000042 3300031730 Bacteria 142687
1477 Ga0307516_10014368 3300031730 Bacteria 8380
1478 Ga0307516_10118374 3300031730 Bacteria 2442
1479 Ga0307405_10000238 3300031731 Bacteria 20020
1480 Ga0307405_10033021 3300031731 Bacteria 3066
1481 Ga0307405_10050186 3300031731 Bacteria 2582
1482 Ga0307405_10051962 3300031731 Bacteria 2546
1483 Ga0316577_10010466 3300031733 Bacteria 5009
1484 Ga0307413_10015559 3300031824 Bacteria 3902
1485 Ga0307410_10001366 3300031852 Bacteria 10966
1486 Ga0307410_10006046 3300031852 Bacteria 6487
1487 Ga0307410_10044736 3300031852 Bacteria 2943
1488 Ga0307410_10069516 3300031852 Bacteria 2436
1489 Ga0307406_10002833 3300031901 Bacteria 9450
1490 Ga0307406_10039579 3300031901 Bacteria 2926
1491 Ga0307406_10060474 3300031901 Bacteria 2443
1492 Ga0307406_10075087 3300031901 Bacteria 2229
1493 Ga0307407_10011566 3300031903 Bacteria 4206
1494 Ga0307407_10053110 3300031903 Bacteria 2330
1495 Ga0307407_10057937 3300031903 Bacteria 2250
1496 Ga0307412_10015389 3300031911 Bacteria 4535
1497 Ga0307412_10022458 3300031911 Bacteria 3868
1498 Ga0307412_10024225 3300031911 Bacteria 3745
1499 Ga0307412_10117974 3300031911 Bacteria 1906
1500 Ga0315914_1001342 3300031967 Bacteria 36422
1501 Ga0307409_100036320 3300031995 Bacteria 3621
1502 Ga0307409_100093824 3300031995 Bacteria 2467
1503 Ga0307409_100136837 3300031995 Bacteria 2104
1504 Ga0307409_100216505 3300031995 Bacteria 1726
1505 Ga0307416_100019280 3300032002 Bacteria 4832
1506 Ga0307416_100047900 3300032002 Bacteria 3387
1507 Ga0307416_100062106 3300032002 Bacteria 3053
1508 Ga0307416_100067065 3300032002 Bacteria 2958
1509 Ga0307416_100133634 3300032002 Bacteria 2239
1510 Ga0307416_100141448 3300032002 Bacteria 2188
1511 Ga0307416_100142159 3300032002 Bacteria 2183
1512 Ga0307416_100165532 3300032002 Bacteria 2050
1513 Ga0307414_10000446 3300032004 Bacteria 21819
1514 Ga0307414_10001003 3300032004 Bacteria 14423
1515 Ga0307414_10038329 3300032004 Bacteria 3218
1516 Ga0307414_10067501 3300032004 Bacteria 2562
1517 Ga0307414_10166565 3300032004 Bacteria 1757
1518 Ga0307414_10176580 3300032004 Bacteria 1713
1519 Ga0307414_10204208 3300032004 Bacteria 1610
1520 Ga0307411_10005091 3300032005 Bacteria 6408
1521 Ga0307411_10019818 3300032005 Bacteria 3895
1522 Ga0307411_10039431 3300032005 Bacteria 2988
1523 Ga0307415_100026994 3300032126 Bacteria 3631
1524 Ga0307507_10119157 3300033179 Bacteria 2119
1525 Ga0307510_10003707 3300033180 Bacteria 17860
1526 Ga0307510_10054892 3300033180 Bacteria 4167
1527 Ga0307510_10160945 3300033180 Bacteria 1842
1528 Ga0315913_1000452 3300033430 Bacteria 36290
1529 Ga0315915_1000691 3300033464 Bacteria 36672
1530 Ga0373934_0004901 3300035086 Bacteria 4954
1531 Ga0373934_0016076 3300035086 Bacteria 2843
1532 Ga0373940_0001759 3300035088 Bacteria 4026
1533 Ga0373949_0000739 3300035090 Bacteria 10554
1534 Ga0373923_0007440 3300035111 Bacteria 3851
1535 Ga0373932_0000959 3300035112 Bacteria 8431
1536 Ga0373936_0000006 3300035113 Bacteria 318697
1537 Ga0373939_0001496 3300035114 Bacteria 5665
1538 Ga0373941_0006418 3300035115 Bacteria 2834
1539 Ga0373941_0012732 3300035115 Bacteria 2206
1540 Ga0373954_0036358 3300035118 Bacteria 2286
1541 Ga0373943_0002067 3300035170 Bacteria 9112
1542 Ga0373943_0117997 3300035170 Bacteria 1407
1543 Ga0373946_0013824 3300035171 Bacteria 3039
1544 Ga0373946_0019587 3300035171 Bacteria 2608
1545 Ga0373955_0002868 3300035172 Bacteria 7564
1546 Ga0373955_0141624 3300035172 Bacteria 1410
1547 Ga0373942_0002277 3300035207 Bacteria 4690
1548 Ga0373961_0001481 3300035241 Bacteria 6888
1549 Ga0373962_0001940 3300035242 Bacteria 4929
1550 Ga0316574_0046904 3300035398 Bacteria 2680
1551 Ga0316574_0107567 3300035398 Bacteria 1787
1552 Ga0373924_0003051 3300035410 Bacteria 5714
1553 Ga0373931_0010226 3300035691 Bacteria 4507
1554 Ga0373935_0075157 3300035692 Bacteria 2186
1555 Ga0373927_0010446 3300035695 Bacteria 6189
1556 Ga0373947_0050105 3300035725 Bacteria 2510
1557 Ga0373947_0081588 3300035725 Bacteria 2003
1558 Ga0373937_0001410 3300036401 Bacteria 20068
1559 Ga0373937_0013107 3300036401 Bacteria 7301
1560 Ga0373937_0016373 3300036401 Bacteria 6583
1561 Ga0373937_0036620 3300036401 Bacteria 4472
1562 Ga0373937_0101140 3300036401 Bacteria 2675
1563 Ga0316582_0008055 3300036647 Bacteria 5638
1564 Ga0316582_0024555 3300036647 Bacteria 3608
1565 Ga0316582_0025225 3300036647 Unclassified 3568
1566 Ga0316584_0007714 3300036712 Bacteria 7385
1567 Ga0373925_0000022 3300037068 Bacteria 160046
1568 Ga0373925_0002686 3300037068 Bacteria 14113
1569 Ga0373925_0008219 3300037068 Bacteria 7596
1570 Ga0373925_0014856 3300037068 Bacteria 5628
1571 Ga0373925_0028714 3300037068 Bacteria 4077
1572 Ga0373925_0100556 3300037068 Bacteria 2222
1573 Ga0373925_0106014 3300037068 Bacteria 2166
1574 Ga0395899_0000061 3300037312 Bacteria 212002
1575 Ga0395899_0000070 3300037312 Bacteria 189668
1576 Ga0395899_0000213 3300037312 Bacteria 83403
1577 Ga0395899_0000917 3300037312 Bacteria 27698
1578 Ga0395899_0001149 3300037312 Bacteria 23403
1579 Ga0395899_0003516 3300037312 Bacteria 12421
1580 Ga0395899_0013910 3300037312 Bacteria 6145
1581 Ga0395899_0041393 3300037312 Bacteria 3442
1582 Ga0395899_0081077 3300037312 Bacteria 2361
1583 Ga0395900_0000010 3300037418 Bacteria 461364
1584 Ga0395900_0000031 3300037418 Bacteria 262393
1585 Ga0395900_0000121 3300037418 Bacteria 135026
1586 Ga0395900_0021706 3300037418 Bacteria 6564
1587 Ga0395900_0023857 3300037418 Bacteria 6259
1588 Ga0395900_0024127 3300037418 Bacteria 6226
1589 Ga0395900_0063179 3300037418 Bacteria 3806
1590 Ga0395900_0076204 3300037418 Bacteria 3448
1591 Ga0395900_0085738 3300037418 Bacteria 3236
1592 Ga0395900_0087147 3300037418 Bacteria 3209
1593 Ga0395900_0134131 3300037418 Bacteria 2536
1594 Ga0395900_0211878 3300037418 Bacteria 1956
1595 Ga0395900_0294227 3300037418 Bacteria 1611
1596 Ga0395898_0000247 3300037466 Bacteria 135026
1597 Ga0395898_0010689 3300037466 Bacteria 9589
1598 Ga0395898_0017969 3300037466 Bacteria 7215
1599 Ga0395898_0048422 3300037466 Bacteria 4168
1600 Ga0395898_0061522 3300037466 Bacteria 3647
1601 Ga0395898_0189287 3300037466 Bacteria 1966
1602 Ga0395898_0195927 3300037466 Bacteria 1930
1603 Ga0395905_0000112 3300037471 Bacteria 135010
1604 Ga0395905_0014250 3300037471 Bacteria 7596
1605 Ga0395905_0018050 3300037471 Bacteria 6698
1606 Ga0395905_0039527 3300037471 Bacteria 4426
1607 Ga0395905_0068235 3300037471 Bacteria 3331
1608 Ga0395905_0091442 3300037471 Bacteria 2853
1609 Ga0395905_0098147 3300037471 Bacteria 2751
1610 Ga0395905_0160703 3300037471 Bacteria 2111
1611 Ga0436364_0049821 3300037853 Bacteria 6096
1612 Ga0436364_0758380 3300037853 Bacteria 4877
1613 Ga0436364_1018828 3300037853 Bacteria 24754
1614 Ga0436364_1053921 3300037853 Bacteria 7381
1615 Ga0436364_1159605 3300037853 Bacteria 24237
1616 Ga0395901_0000007 3300038443 Bacteria 497408
1617 Ga0395901_0000035 3300038443 Bacteria 223888
1618 Ga0395901_0000078 3300038443 Bacteria 135026
1619 Ga0395901_0049699 3300038443 Bacteria 4357
1620 Ga0395901_0093729 3300038443 Bacteria 3144
1621 Ga0395901_0104955 3300038443 Bacteria 2966
1622 Ga0395901_0137839 3300038443 Bacteria 2564
1623 Ga0395901_0168317 3300038443 Bacteria 2300
1624 Ga0395901_0238826 3300038443 Bacteria 1895
1625 Ga0400483_003978 3300039062 Bacteria 11844
1626 Ga0400483_026829 3300039062 Bacteria 15363
1627 Ga0400483_228511 3300039062 Bacteria 12397
1628 Ga0400489_44610 3300039093 Bacteria 146572
1629 Ga0436365_0122238 3300039437 Bacteria 4011
1630 Ga0436365_0412218 3300039437 Bacteria 12178
1631 Ga0436365_0508484 3300039437 Bacteria 190091
1632 Ga0436365_0568889 3300039437 Bacteria 1858
1633 Ga0436365_0782166 3300039437 Bacteria 1731
1634 Ga0436365_0897023 3300039437 Bacteria 25354
1635 Ga0436365_1256092 3300039437 Bacteria 2562
1636 Ga0436365_1365308 3300039437 Bacteria 3961
1637 Ga0436365_1432258 3300039437 Bacteria 23620
1638 Ga0436360_0064975 3300039438 Bacteria 3609
1639 Ga0436360_0458576 3300039438 Bacteria 5516
1640 Ga0436360_0753919 3300039438 Bacteria 3717
1641 Ga0436360_0827262 3300039438 Bacteria 5743
1642 Ga0436361_0184626 3300039447 Bacteria 1928
1643 Ga0436361_0187518 3300039447 Bacteria 7805
1644 Ga0436361_0304900 3300039447 Bacteria 6218
1645 Ga0436361_0308037 3300039447 Bacteria 2767
1646 Ga0436361_0568771 3300039447 Bacteria 57667
1647 Ga0436363_0094623 3300039450 Bacteria 3474
1648 Ga0436363_0364437 3300039450 Bacteria 4989
1649 Ga0436363_0709676 3300039450 Bacteria 2082
1650 Ga0436363_1685560 3300039450 Bacteria 1682
1651 Ga0436362_0106862 3300039453 Bacteria 2845
1652 Ga0436362_1046623 3300039453 Bacteria 2065
1653 Ga0439461_0013046 3300041410 Bacteria 1563
1654 Ga0439443_002251 3300042003 Bacteria 2286
1655 Ga0439448_0000258 3300042005 Bacteria 11459
1656 Ga0439449_0036938 3300042007 Bacteria 1817
1657 Ga0450920_001542 3300042122 Bacteria 3830
1658 Ga0450923_004341 3300042125 Bacteria 2224
1659 Ga0450894_001057 3300042131 Bacteria 4180
1660 Ga0450896_000289 3300042133 Bacteria 4710
1661 Ga0450896_000423 3300042133 Bacteria 4297
1662 Ga0450906_004541 3300042145 Bacteria 2899
1663 Ga0439435_0000614 3300042436 Bacteria 5820
1664 Ga0439435_0002251 3300042436 Bacteria 3787
1665 Ga0439460_0010195 3300042461 Bacteria 2400
1666 Ga0451577_0000293 3300042876 Bacteria 97174
1667 Ga0451577_0000353 3300042876 Bacteria 85621
1668 Ga0451577_0001566 3300042876 Bacteria 29973
1669 Ga0451577_0001605 3300042876 Bacteria 29428
1670 Ga0451577_0003065 3300042876 Bacteria 18937
1671 Ga0451577_0038865 3300042876 Bacteria 4279
1672 Ga0451577_0053794 3300042876 Bacteria 3594
1673 Ga0451577_0139319 3300042876 Bacteria 2179
1674 Ga0451577_0191578 3300042876 Bacteria 1844
1675 Ga0466972_0017001 3300044658 Bacteria 3638
1676 Ga0466972_0018223 3300044658 Bacteria 3511
1677 Ga0453683_0000005 3300044673 Bacteria 741657
1678 Ga0453683_0000251 3300044673 Bacteria 70994
1679 Ga0453683_0000379 3300044673 Bacteria 53272
1680 Ga0453683_0020630 3300044673 Bacteria 4211
1681 Ga0453683_0021758 3300044673 Bacteria 4091
1682 Ga0466966_0000007 3300044684 Bacteria 155702
1683 Ga0466961_0011786 3300044693 Bacteria 5587
1684 Ga0466961_0132196 3300044693 Bacteria 1564
1685 Ga0466963_0005485 3300044694 Bacteria 7428
1686 Ga0453684_0000467 3300044712 Bacteria 161003
1687 Ga0453684_0000761 3300044712 Bacteria 111934
1688 Ga0453684_0000925 3300044712 Bacteria 97174
1689 Ga0453684_0001092 3300044712 Bacteria 85621
1690 Ga0453684_0001278 3300044712 Bacteria 75250
1691 Ga0453684_0002325 3300044712 Bacteria 46597
1692 Ga0453684_0008138 3300044712 Bacteria 18929
1693 Ga0453684_0010499 3300044712 Bacteria 15822
1694 Ga0453684_0025669 3300044712 Bacteria 8545
1695 Ga0453684_0026694 3300044712 Bacteria 8325
1696 Ga0453684_0054917 3300044712 Bacteria 5183
1697 Ga0453684_0062533 3300044712 Bacteria 4768
1698 Ga0453684_0064827 3300044712 Bacteria 4663
1699 Ga0453684_0077994 3300044712 Bacteria 4148
1700 Ga0453684_0099720 3300044712 Bacteria 3557
1701 Ga0453684_0212861 3300044712 Bacteria 2245
1702 Ga0466960_0031328 3300044901 Bacteria 2453
1703 Ga0466960_0033141 3300044901 Bacteria 2399
1704 Ga0466960_0033984 3300044901 Bacteria 2373
1705 Ga0466959_0066218 3300045049 Bacteria 2620
1706 Ga0466959_0165451 3300045049 Bacteria 1553
1707 Ga0451576_0000127 3300045051 Bacteria 192727
1708 Ga0451576_0000341 3300045051 Bacteria 112360
1709 Ga0451576_0000786 3300045051 Bacteria 62393
1710 Ga0451576_0005815 3300045051 Bacteria 15339
1711 Ga0451576_0009327 3300045051 Bacteria 11393
1712 Ga0451576_0053402 3300045051 Bacteria 4233
1713 Ga0451576_0070742 3300045051 Bacteria 3631
1714 Ga0451576_0091202 3300045051 Bacteria 3170
1715 Ga0451576_0146691 3300045051 Bacteria 2460
1716 Ga0466958_0034009 3300045836 Bacteria 3039
1717 Ga0466967_0067612 3300045976 Bacteria 3188
1718 Ga0466967_0224474 3300045976 Bacteria 1786
1719 Ga0495592_0056209 3300046454 Bacteria 2909
1720 Ga0495629_0011843 3300046459 Bacteria 6325
1721 Ga0495629_0035081 3300046459 Bacteria 3546
1722 Ga0495638_0000179 3300046460 Bacteria 97078
1723 Ga0495638_0000299 3300046460 Bacteria 63971
1724 Ga0495638_0023408 3300046460 Bacteria 4039
1725 Ga0495641_0030873 3300046461 Bacteria 2565
1726 Ga0495650_0000758 3300046471 Bacteria 40363
1727 Ga0495582_0029199 3300046473 Bacteria 3027
1728 Ga0495582_0040354 3300046473 Bacteria 2571
1729 Ga0495605_0001136 3300046474 Bacteria 17664
1730 Ga0495639_0000768 3300046475 Bacteria 14600
1731 Ga0495662_0006940 3300046476 Bacteria 5627
1732 Ga0495584_0080194 3300046491 Bacteria 1642
1733 Ga0495585_0004756 3300046492 Bacteria 8740
1734 Ga0495585_0010585 3300046492 Bacteria 5485
1735 Ga0495583_0000500 3300046506 Bacteria 56753
1736 Ga0495583_0000755 3300046506 Bacteria 41123
1737 Ga0495583_0011497 3300046506 Bacteria 5077
1738 Ga0495583_0020180 3300046506 Bacteria 3459
1739 Ga0495583_0025705 3300046506 Bacteria 2936
1740 Ga0495606_0001113 3300046507 Bacteria 38409
1741 Ga0495606_0002862 3300046507 Bacteria 19095
1742 Ga0495606_0036695 3300046507 Bacteria 3336
1743 Ga0495606_0080314 3300046507 Bacteria 2029
1744 Ga0495610_0002818 3300046512 Bacteria 14175
1745 Ga0495628_0054904 3300046516 Bacteria 3139
1746 Ga0495628_0055912 3300046516 Bacteria 3108
1747 Ga0495628_0085893 3300046516 Bacteria 2440
1748 Ga0495630_0072343 3300046517 Bacteria 2595
1749 Ga0495631_0002646 3300046518 Bacteria 9994
1750 Ga0495631_0021442 3300046518 Bacteria 3009
1751 Ga0495637_0045654 3300046520 Bacteria 1857
1752 Ga0495643_0002421 3300046522 Bacteria 14836
1753 Ga0495643_0010265 3300046522 Bacteria 5768
1754 Ga0495643_0015330 3300046522 Bacteria 4531
1755 Ga0495643_0025855 3300046522 Bacteria 3318
1756 Ga0495643_0054154 3300046522 Bacteria 2149
1757 Ga0495643_0063026 3300046522 Bacteria 1961
1758 Ga0495648_0000256 3300046524 Bacteria 60519
1759 Ga0495663_0003014 3300046525 Bacteria 4944
1760 Ga0495666_0000958 3300046526 Bacteria 13596
1761 Ga0495652_0046615 3300046529 Bacteria 3720
1762 Ga0495654_0000194 3300046530 Bacteria 59637
1763 Ga0495654_0000530 3300046530 Bacteria 30917
1764 Ga0495665_0009709 3300046531 Bacteria 5210
1765 Ga0495640_0024712 3300046533 Bacteria 4366
1766 Ga0495586_0000262 3300046535 Bacteria 34525
1767 Ga0495586_0043226 3300046535 Bacteria 2427
1768 Ga0495587_0073585 3300046536 Bacteria 1985
1769 Ga0495621_0000010 3300046539 Bacteria 39172
1770 Ga0495645_0003894 3300046543 Bacteria 10172
1771 Ga0495622_0004054 3300046557 Bacteria 6837
1772 Ga0495622_0017473 3300046557 Bacteria 3339
1773 Ga0495633_0000991 3300046558 Bacteria 23310
1774 Ga0495633_0001711 3300046558 Bacteria 16447
1775 Ga0495633_0004725 3300046558 Bacteria 8557
1776 Ga0495656_0004890 3300046615 Bacteria 4612
1777 Ga0495656_0026685 3300046615 Bacteria 2302
1778 Ga0495668_0000024 3300046616 Bacteria 359469
1779 Ga0495668_0000163 3300046616 Bacteria 99607
1780 Ga0495668_0025192 3300046616 Bacteria 3382
1781 Ga0495668_0101301 3300046616 Bacteria 1575
1782 Ga0495611_0051105 3300046648 Bacteria 1863
1783 Ga0495625_0000196 3300046660 Bacteria 96006
1784 Ga0495625_0000424 3300046660 Bacteria 63593
1785 Ga0495625_0003388 3300046660 Bacteria 15968
1786 Ga0495625_0023798 3300046660 Bacteria 4674
1787 Ga0495625_0059944 3300046660 Bacteria 2698
1788 Ga0495625_0061779 3300046660 Bacteria 2650
1789 Ga0495625_0110757 3300046660 Bacteria 1877
1790 Ga0495661_0087442 3300046665 Bacteria 1782
1791 Ga0495588_0004349 3300046674 Bacteria 6255
1792 Ga0495599_0069720 3300046678 Bacteria 2194
1793 Ga0495599_0101809 3300046678 Bacteria 1790
1794 Ga0495647_0025411 3300046681 Bacteria 2164
1795 Ga0495658_0004034 3300046683 Bacteria 7236
1796 Ga0495669_0000470 3300046684 Bacteria 18780
1797 Ga0495669_0000933 3300046684 Bacteria 12245
1798 Ga0495669_0007716 3300046684 Bacteria 4516
1799 Ga0495669_0022999 3300046684 Bacteria 2710
1800 Ga0495669_0030435 3300046684 Bacteria 2369
1801 Ga0495613_0000415 3300046689 Bacteria 36573
1802 Ga0495613_0007657 3300046689 Bacteria 8038
1803 Ga0495613_0085725 3300046689 Bacteria 2285
1804 Ga0495670_0003534 3300046691 Bacteria 7672
1805 Ga0495649_0000672 3300046694 Bacteria 27900
1806 Ga0495589_0014972 3300046794 Bacteria 3990
1807 Ga0495600_0000268 3300046809 Bacteria 28333
1808 Ga0495600_0091306 3300046809 Bacteria 1986
1809 Ga0495660_0087652 3300046810 Bacteria 1623
1810 Ga0495604_0018836 3300047317 Bacteria 5528
1811 Ga0495672_0003825 3300047320 Bacteria 12668
1812 Ga0495672_0010812 3300047320 Bacteria 6476
1813 Ga0495672_0032081 3300047320 Bacteria 3272
1814 Ga0495676_0001605 3300047321 Bacteria 19639
1815 Ga0495683_0006287 3300047323 Bacteria 6498
1816 Ga0495687_000447 3300047443 Bacteria 50911
1817 Ga0495687_000557 3300047443 Bacteria 43965
1818 Ga0495687_021816 3300047443 Bacteria 3087
1819 Ga0495677_0002397 3300047445 Bacteria 7364
1820 Ga0495677_0005374 3300047445 Bacteria 4860
1821 Ga0495681_0002519 3300047470 Bacteria 13048
1822 Ga0495681_0002944 3300047470 Bacteria 12026
1823 Ga0495684_0000356 3300047471 Bacteria 36996
1824 Ga0495684_0052020 3300047471 Bacteria 3125
1825 Ga0495686_0000023 3300047472 Bacteria 400457
1826 Ga0495686_0000119 3300047472 Bacteria 165244
1827 Ga0495686_0000645 3300047472 Bacteria 48009
1828 Ga0495686_0000688 3300047472 Bacteria 45757
1829 Ga0495686_0009423 3300047472 Bacteria 7033
1830 Ga0495686_0009480 3300047472 Bacteria 7006
1831 Ga0495626_0002970 3300048091 Bacteria 11251
1832 Ga0496100_0007042 3300048903 Bacteria 6170
1833 Ga0496100_0008856 3300048903 Bacteria 5630
1834 Ga0496100_0012373 3300048903 Bacteria 4890
1835 Ga0496100_0070581 3300048903 Bacteria 2330
1836 Ga0496101_0001619 3300048904 Bacteria 13525
1837 Ga0496101_0047395 3300048904 Bacteria 3085
1838 Ga0496101_0087465 3300048904 Bacteria 2313
1839 Ga0496102_0000162 3300048905 Bacteria 89746
1840 Ga0496102_0015020 3300048905 Bacteria 6739
1841 Ga0496102_0016003 3300048905 Bacteria 6547
1842 Ga0496102_0021225 3300048905 Bacteria 5743
1843 Ga0496102_0053604 3300048905 Bacteria 3676
1844 Ga0496102_0084802 3300048905 Bacteria 2924
1845 Ga0496102_0103128 3300048905 Bacteria 2653
1846 Ga0496102_0175105 3300048905 Bacteria 2020
1847 Ga0496103_0000190 3300048906 Bacteria 61731
1848 Ga0496103_0001725 3300048906 Bacteria 14279
1849 Ga0496103_0003094 3300048906 Bacteria 10223
1850 Ga0496103_0012361 3300048906 Bacteria 5064
1851 Ga0496103_0037921 3300048906 Bacteria 2955
1852 Ga0496103_0041306 3300048906 Bacteria 2835
1853 Ga0496104_0000022 3300048907 Bacteria 237390
1854 Ga0496104_0000481 3300048907 Bacteria 34386
1855 Ga0496104_0000783 3300048907 Bacteria 27190
1856 Ga0496104_0004696 3300048907 Bacteria 11898
1857 Ga0496104_0006579 3300048907 Bacteria 10223
1858 Ga0496104_0009040 3300048907 Bacteria 8859
1859 Ga0496104_0023690 3300048907 Bacteria 5646
1860 Ga0496104_0048166 3300048907 Bacteria 4018
1861 Ga0496104_0081449 3300048907 Bacteria 3087
1862 Ga0496104_0119076 3300048907 Bacteria 2535
1863 Ga0496104_0187158 3300048907 Bacteria 1981
1864 Ga0496105_0000028 3300048908 Bacteria 145917
1865 Ga0496105_0000089 3300048908 Bacteria 63427
1866 Ga0496105_0000395 3300048908 Bacteria 28676
1867 Ga0496105_0000952 3300048908 Bacteria 19809
1868 Ga0496105_0014554 3300048908 Bacteria 6264
1869 Ga0496105_0018451 3300048908 Bacteria 5608
1870 Ga0496105_0031174 3300048908 Bacteria 4370
1871 Ga0496105_0044540 3300048908 Bacteria 3660
1872 Ga0496105_0059146 3300048908 Bacteria 3162
1873 Ga0496106_0000259 3300048909 Bacteria 37115
1874 Ga0496106_0000587 3300048909 Bacteria 25963
1875 Ga0496106_0006157 3300048909 Bacteria 8870
1876 Ga0496106_0056180 3300048909 Bacteria 2976
1877 Ga0496106_0057213 3300048909 Bacteria 2948
1878 Ga0496107_0001028 3300048910 Bacteria 16666
1879 Ga0496107_0005386 3300048910 Bacteria 8755
1880 Ga0496107_0052460 3300048910 Bacteria 2941
1881 Ga0496107_0057035 3300048910 Bacteria 2823
1882 Ga0496107_0122832 3300048910 Bacteria 1913
1883 Ga0496107_0138958 3300048910 Bacteria 1795
1884 Ga0496107_0139678 3300048910 Bacteria 1791
1885 Ga0496108_0000350 3300048911 Bacteria 38965
1886 Ga0496108_0000484 3300048911 Bacteria 31912
1887 Ga0496108_0000517 3300048911 Bacteria 30206
1888 Ga0496108_0014853 3300048911 Bacteria 6353
1889 Ga0496108_0025654 3300048911 Bacteria 4859
1890 Ga0496108_0032628 3300048911 Bacteria 4326
1891 Ga0496108_0054649 3300048911 Bacteria 3351
1892 Ga0496108_0067123 3300048911 Bacteria 3025
1893 Ga0496108_0093415 3300048911 Bacteria 2559
1894 Ga0496108_0094713 3300048911 Bacteria 2542
1895 Ga0496108_0119559 3300048911 Bacteria 2259
1896 Ga0496108_0130923 3300048911 Bacteria 2156
1897 Ga0496108_0135219 3300048911 Bacteria 2120
1898 Ga0496109_0000814 3300048912 Bacteria 26012
1899 Ga0496109_0001345 3300048912 Bacteria 20325
1900 Ga0496109_0001923 3300048912 Bacteria 17255
1901 Ga0496109_0006885 3300048912 Bacteria 9587
1902 Ga0496109_0029644 3300048912 Bacteria 4902
1903 Ga0496109_0044035 3300048912 Bacteria 4047
1904 Ga0496109_0069800 3300048912 Bacteria 3223
1905 Ga0496109_0221472 3300048912 Bacteria 1779
1906 Ga0496110_0002592 3300048913 Bacteria 13602
1907 Ga0496110_0002741 3300048913 Bacteria 13302
1908 Ga0496110_0010881 3300048913 Bacteria 7417
1909 Ga0496110_0037533 3300048913 Bacteria 4211
1910 Ga0496110_0039275 3300048913 Bacteria 4121
1911 Ga0496110_0053842 3300048913 Bacteria 3538
1912 Ga0496110_0069182 3300048913 Bacteria 3126
1913 Ga0496110_0077118 3300048913 Bacteria 2964
1914 Ga0496110_0130369 3300048913 Bacteria 2270
1915 Ga0496110_0133254 3300048913 Bacteria 2244
1916 Ga0496110_0171198 3300048913 Bacteria 1970
1917 Ga0496111_0001221 3300048914 Bacteria 14360
1918 Ga0496111_0010172 3300048914 Bacteria 6299
1919 Ga0496111_0017527 3300048914 Bacteria 4951
1920 Ga0496111_0050990 3300048914 Bacteria 2987
1921 Ga0496111_0150219 3300048914 Bacteria 1728
1922 Ga0496112_0001179 3300048915 Bacteria 19594
1923 Ga0496112_0004390 3300048915 Bacteria 11933
1924 Ga0496112_0009839 3300048915 Bacteria 8638
1925 Ga0496112_0032679 3300048915 Bacteria 5052
1926 Ga0496112_0038766 3300048915 Bacteria 4655
1927 Ga0496112_0070639 3300048915 Bacteria 3451
1928 Ga0496112_0088997 3300048915 Bacteria 3055
1929 Ga0496112_0146298 3300048915 Bacteria 2331
1930 Ga0496112_0157449 3300048915 Bacteria 2238
1931 Ga0496112_0168337 3300048915 Bacteria 2157
1932 Ga0496113_0000233 3300048916 Bacteria 26178
1933 Ga0496113_0000943 3300048916 Bacteria 15457
1934 Ga0496113_0001045 3300048916 Bacteria 14921
1935 Ga0496113_0008144 3300048916 Bacteria 6806
1936 Ga0496113_0019710 3300048916 Bacteria 4726
1937 Ga0496113_0089986 3300048916 Bacteria 2363
1938 Ga0496114_0007511 3300048917 Bacteria 8621
1939 Ga0496114_0011846 3300048917 Bacteria 6977
1940 Ga0496115_0000731 3300048918 Bacteria 24280
1941 Ga0496115_0002083 3300048918 Bacteria 14328
1942 Ga0496115_0003035 3300048918 Bacteria 12056
1943 Ga0496115_0056005 3300048918 Bacteria 3168
1944 Ga0496115_0063056 3300048918 Bacteria 2990
1945 Ga0496115_0087853 3300048918 Bacteria 2537
1946 Ga0496115_0194627 3300048918 Bacteria 1675
1947 Ga0496115_0201854 3300048918 Bacteria 1642
1948 Ga0496116_0000035 3300048919 Bacteria 402424
1949 Ga0496116_0000080 3300048919 Bacteria 224530
1950 Ga0496116_0001010 3300048919 Bacteria 34302
1951 Ga0496116_0028558 3300048919 Bacteria 4037
1952 Ga0496116_0034669 3300048919 Bacteria 3557
1953 Ga0496116_0035353 3300048919 Bacteria 3510
1954 Ga0496116_0044893 3300048919 Bacteria 2996
1955 Ga0496117_0000002 3300048920 Bacteria 2483758
1956 Ga0496117_0000323 3300048920 Bacteria 83916
1957 Ga0496117_0001766 3300048920 Bacteria 29764
1958 Ga0496117_0025476 3300048920 Bacteria 4650
1959 Ga0496117_0066118 3300048920 Bacteria 2454
1960 Ga0496117_0070138 3300048920 Bacteria 2356
1961 Ga0496118_0000233 3300048921 Bacteria 97731
1962 Ga0496118_0000361 3300048921 Bacteria 76982
1963 Ga0496118_0000525 3300048921 Bacteria 62968
1964 Ga0496118_0001902 3300048921 Bacteria 29748
1965 Ga0496118_0003389 3300048921 Bacteria 20144
1966 Ga0496118_0028580 3300048921 Bacteria 4693
1967 Ga0496118_0033485 3300048921 Bacteria 4214
1968 Ga0496118_0036820 3300048921 Bacteria 3949
1969 Ga0496119_0001161 3300048922 Bacteria 32992
1970 Ga0496119_0002208 3300048922 Bacteria 21743
1971 Ga0496119_0006263 3300048922 Bacteria 11104
1972 Ga0496119_0006901 3300048922 Bacteria 10366
1973 Ga0496119_0013258 3300048922 Bacteria 6588
1974 Ga0496119_0030915 3300048922 Bacteria 3601
1975 Ga0496119_0033395 3300048922 Bacteria 3411
1976 Ga0496119_0044664 3300048922 Bacteria 2787
1977 Ga0496119_0070562 3300048922 Bacteria 2048
1978 Ga0496119_0107015 3300048922 Bacteria 1560
1979 Ga0496120_0000021 3300048923 Bacteria 250966
1980 Ga0496120_0007965 3300048923 Bacteria 7801
1981 Ga0496120_0014812 3300048923 Bacteria 5173
1982 Ga0496121_0000001 3300048924 Bacteria 1830318
1983 Ga0496121_0002564 3300048924 Bacteria 27512
1984 Ga0496121_0006257 3300048924 Bacteria 14897
1985 Ga0496121_0008423 3300048924 Bacteria 12134
1986 Ga0496121_0008494 3300048924 Bacteria 12052
1987 Ga0496121_0009527 3300048924 Bacteria 11132
1988 Ga0496121_0012302 3300048924 Bacteria 9361
1989 Ga0496121_0016282 3300048924 Bacteria 7690
1990 Ga0496121_0064056 3300048924 Bacteria 2999
1991 Ga0496122_0000001 3300048925 Bacteria 1827766
1992 Ga0496122_0000009 3300048925 Bacteria 584024
1993 Ga0496122_0000507 3300048925 Bacteria 80433
1994 Ga0496122_0001682 3300048925 Bacteria 34269
1995 Ga0496122_0002251 3300048925 Bacteria 27964
1996 Ga0496122_0005224 3300048925 Bacteria 15577
1997 Ga0496122_0012063 3300048925 Bacteria 8662
1998 Ga0496122_0059130 3300048925 Bacteria 2831
1999 Ga0496123_0000001 3300048926 Bacteria 1831497
2000 Ga0496123_0000020 3300048926 Bacteria 388748
2001 Ga0496123_0000484 3300048926 Bacteria 69108
2002 Ga0496123_0001169 3300048926 Bacteria 38781
2003 Ga0496123_0001927 3300048926 Bacteria 27057
2004 Ga0496123_0002216 3300048926 Bacteria 24673
2005 Ga0496123_0002605 3300048926 Bacteria 21912
2006 Ga0496123_0005632 3300048926 Bacteria 12506
2007 Ga0496123_0045092 3300048926 Bacteria 3007
2008 Ga0496124_0000063 3300048927 Bacteria 229705
2009 Ga0496124_0001562 3300048927 Bacteria 33102
2010 Ga0496124_0003117 3300048927 Bacteria 20575
2011 Ga0496124_0004006 3300048927 Bacteria 17528
2012 Ga0496124_0004328 3300048927 Bacteria 16639
2013 Ga0496124_0006765 3300048927 Bacteria 12390
2014 Ga0496124_0056914 3300048927 Bacteria 3296
2015 Ga0496124_0099478 3300048927 Bacteria 2358
2016 Ga0496124_0168793 3300048927 Bacteria 1697
2017 Ga0496125_0000001 3300048928 Bacteria 1766138
2018 Ga0496125_0001001 3300048928 Bacteria 44072
2019 Ga0496125_0002077 3300048928 Bacteria 27023
2020 Ga0496125_0002192 3300048928 Bacteria 26081
2021 Ga0496125_0011912 3300048928 Bacteria 8663
2022 Ga0496125_0057447 3300048928 Bacteria 3151
2023 Ga0496125_0065638 3300048928 Bacteria 2873
2024 Ga0496126_0000044 3300048929 Bacteria 335904
2025 Ga0496126_0000084 3300048929 Bacteria 217111
2026 Ga0496126_0000094 3300048929 Bacteria 208184
2027 Ga0496126_0001464 3300048929 Bacteria 36818
2028 Ga0496126_0001557 3300048929 Bacteria 35204
2029 Ga0496126_0001925 3300048929 Bacteria 29687
2030 Ga0496126_0022855 3300048929 Bacteria 6071
2031 Ga0496126_0038693 3300048929 Bacteria 4434
2032 Ga0496126_0059481 3300048929 Bacteria 3441
2033 Ga0496126_0085321 3300048929 Bacteria 2784
2034 Ga0495678_013743 3300049459 Bacteria 3789
2035 Ga0501031_0000014 3300049568 Bacteria 127199
2036 Ga0501031_0000424 3300049568 Bacteria 24266
2037 Ga0501031_0000663 3300049568 Bacteria 20435
2038 Ga0501031_0014117 3300049568 Bacteria 5198
2039 Ga0501031_0017609 3300049568 Bacteria 4644
2040 Ga0501031_0032480 3300049568 Bacteria 3404
2041 Ga0501031_0038448 3300049568 Bacteria 3123
2042 Ga0501032_0000014 3300049569 Bacteria 182017
2043 Ga0501032_0000015 3300049569 Bacteria 176755
2044 Ga0501032_0000033 3300049569 Bacteria 120909
2045 Ga0501032_0007820 3300049569 Bacteria 7790
2046 Ga0501032_0010323 3300049569 Bacteria 6737
2047 Ga0501032_0015269 3300049569 Bacteria 5422
2048 Ga0501032_0016219 3300049569 Bacteria 5240
2049 Ga0501032_0020874 3300049569 Bacteria 4556
2050 Ga0501032_0062983 3300049569 Bacteria 2484
2051 Ga0501032_0136993 3300049569 Bacteria 1613
2052 Ga0501033_0000005 3300049570 Bacteria 379089
2053 Ga0501033_0000023 3300049570 Bacteria 176725
2054 Ga0501033_0001595 3300049570 Bacteria 19935
2055 Ga0501033_0007234 3300049570 Bacteria 8660
2056 Ga0501033_0008354 3300049570 Bacteria 8017
2057 Ga0501033_0013660 3300049570 Bacteria 6178
2058 Ga0501033_0014098 3300049570 Bacteria 6078
2059 Ga0501033_0016245 3300049570 Bacteria 5638
2060 Ga0501033_0021866 3300049570 Bacteria 4827
2061 Ga0501033_0022999 3300049570 Bacteria 4699
2062 Ga0501033_0026562 3300049570 Bacteria 4357
2063 Ga0501033_0030937 3300049570 Bacteria 4023
2064 Ga0501033_0039284 3300049570 Bacteria 3534
2065 Ga0501033_0041990 3300049570 Bacteria 3411
2066 Ga0501033_0056886 3300049570 Bacteria 2890
2067 Ga0501033_0063239 3300049570 Bacteria 2724
2068 Ga0501034_0000001 3300049571 Bacteria 2184493
2069 Ga0501034_0000073 3300049571 Bacteria 176737
2070 Ga0501034_0000133 3300049571 Bacteria 137816
2071 Ga0501034_0000222 3300049571 Bacteria 108857
2072 Ga0501034_0000392 3300049571 Bacteria 74503
2073 Ga0501034_0000537 3300049571 Bacteria 60263
2074 Ga0501034_0003230 3300049571 Bacteria 18666
2075 Ga0501034_0005123 3300049571 Bacteria 14376
2076 Ga0501034_0007526 3300049571 Bacteria 11587
2077 Ga0501034_0009896 3300049571 Bacteria 9967
2078 Ga0501034_0012280 3300049571 Bacteria 8851
2079 Ga0501034_0015038 3300049571 Bacteria 7957
2080 Ga0501034_0026179 3300049571 Bacteria 5939
2081 Ga0501034_0027313 3300049571 Bacteria 5806
2082 Ga0501034_0036555 3300049571 Bacteria 4974
2083 Ga0501034_0037486 3300049571 Bacteria 4910
2084 Ga0501034_0049582 3300049571 Bacteria 4236
2085 Ga0501034_0051670 3300049571 Bacteria 4144
2086 Ga0501034_0053892 3300049571 Bacteria 4049
2087 Ga0501034_0077117 3300049571 Bacteria 3338
2088 Ga0501034_0121086 3300049571 Bacteria 2603
2089 Ga0501034_0127438 3300049571 Bacteria 2530
2090 Ga0501034_0171630 3300049571 Bacteria 2135
2091 Ga0501034_0178559 3300049571 Bacteria 2089
2092 Ga0501034_0276804 3300049571 Bacteria 1618
2093 Ga0501036_0000002 3300049572 Bacteria 293106
2094 Ga0501036_0000589 3300049572 Bacteria 26321
2095 Ga0501036_0000763 3300049572 Bacteria 23861
2096 Ga0501036_0001473 3300049572 Bacteria 18118
2097 Ga0501036_0002584 3300049572 Bacteria 14243
2098 Ga0501036_0012053 3300049572 Bacteria 7163
2099 Ga0501036_0014138 3300049572 Bacteria 6638
2100 Ga0501036_0024506 3300049572 Bacteria 5088
2101 Ga0501036_0045474 3300049572 Bacteria 3719
2102 Ga0501036_0053162 3300049572 Bacteria 3431
2103 Ga0501036_0053171 3300049572 Bacteria 3430
2104 Ga0501036_0058084 3300049572 Bacteria 3277
2105 Ga0501036_0063955 3300049572 Bacteria 3115
2106 Ga0501036_0122132 3300049572 Bacteria 2199
2107 Ga0501037_0000067 3300049573 Bacteria 96388
2108 Ga0501037_0000158 3300049573 Bacteria 63431
2109 Ga0501037_0000285 3300049573 Bacteria 42890
2110 Ga0501037_0000301 3300049573 Bacteria 41854
2111 Ga0501037_0001081 3300049573 Bacteria 20219
2112 Ga0501037_0006220 3300049573 Bacteria 8730
2113 Ga0501037_0007891 3300049573 Bacteria 7798
2114 Ga0501037_0023708 3300049573 Bacteria 4536
2115 Ga0501037_0031015 3300049573 Bacteria 3947
2116 Ga0501037_0031626 3300049573 Bacteria 3908
2117 Ga0501037_0035292 3300049573 Bacteria 3688
2118 Ga0501037_0037027 3300049573 Bacteria 3596
2119 Ga0501037_0067630 3300049573 Bacteria 2601
2120 Ga0501037_0073885 3300049573 Bacteria 2478
2121 Ga0501037_0085059 3300049573 Bacteria 2290
2122 Ga0501038_0000002 3300049574 Bacteria 330446
2123 Ga0501038_0000013 3300049574 Bacteria 167219
2124 Ga0501038_0000258 3300049574 Bacteria 44669
2125 Ga0501038_0010046 3300049574 Bacteria 8666
2126 Ga0501038_0019873 3300049574 Bacteria 6045
2127 Ga0501038_0020175 3300049574 Bacteria 5996
2128 Ga0501038_0023850 3300049574 Bacteria 5462
2129 Ga0501038_0025378 3300049574 Bacteria 5284
2130 Ga0501038_0035024 3300049574 Bacteria 4411
2131 Ga0501038_0047718 3300049574 Bacteria 3709
2132 Ga0501038_0050915 3300049574 Bacteria 3577
2133 Ga0501038_0110210 3300049574 Bacteria 2281
2134 Ga0501038_0132081 3300049574 Bacteria 2049
2135 Ga0501039_0000002 3300049575 Bacteria 375152
2136 Ga0501039_0000010 3300049575 Bacteria 247832
2137 Ga0501039_0000016 3300049575 Bacteria 211521
2138 Ga0501039_0002242 3300049575 Bacteria 14322
2139 Ga0501039_0003344 3300049575 Bacteria 11979
2140 Ga0501039_0005222 3300049575 Bacteria 9835
2141 Ga0501039_0017708 3300049575 Bacteria 5465
2142 Ga0501039_0018297 3300049575 Bacteria 5377
2143 Ga0501039_0052537 3300049575 Bacteria 3153
2144 Ga0501039_0065604 3300049575 Bacteria 2816
2145 Ga0501039_0090186 3300049575 Bacteria 2389
2146 Ga0501039_0182841 3300049575 Bacteria 1648
2147 Ga0501040_0001853 3300049576 Bacteria 13561
2148 Ga0501040_0003278 3300049576 Bacteria 10461
2149 Ga0501040_0008574 3300049576 Bacteria 6634
2150 Ga0501040_0013115 3300049576 Bacteria 5450
2151 Ga0501040_0051560 3300049576 Bacteria 2815
2152 Ga0501040_0204772 3300049576 Bacteria 1401
2153 Ga0501041_0004439 3300049577 Bacteria 8120
2154 Ga0501041_0026653 3300049577 Bacteria 3477
2155 Ga0501041_0042402 3300049577 Bacteria 2766
2156 Ga0501042_0000070 3300049578 Bacteria 37570
2157 Ga0501042_0009856 3300049578 Bacteria 6382
2158 Ga0501042_0021419 3300049578 Bacteria 4505
2159 Ga0501042_0095488 3300049578 Bacteria 2136
2160 Ga0501042_0123923 3300049578 Bacteria 1861
2161 Ga0501042_0167141 3300049578 Bacteria 1587
2162 Ga0501043_0000039 3300049579 Bacteria 119155
2163 Ga0501043_0000056 3300049579 Bacteria 104302
2164 Ga0501043_0003385 3300049579 Bacteria 13134
2165 Ga0501043_0003469 3300049579 Bacteria 12947
2166 Ga0501043_0003974 3300049579 Bacteria 12109
2167 Ga0501043_0008417 3300049579 Bacteria 8123
2168 Ga0501043_0021542 3300049579 Bacteria 5055
2169 Ga0501043_0040222 3300049579 Bacteria 3675
2170 Ga0501043_0053957 3300049579 Bacteria 3156
2171 Ga0501043_0057358 3300049579 Bacteria 3058
2172 Ga0501043_0075832 3300049579 Bacteria 2641
2173 Ga0501043_0096341 3300049579 Bacteria 2325
2174 Ga0501046_0002960 3300049580 Bacteria 15707
2175 Ga0501046_0003709 3300049580 Bacteria 13985
2176 Ga0501046_0004133 3300049580 Bacteria 13227
2177 Ga0501046_0004358 3300049580 Bacteria 12883
2178 Ga0501046_0004595 3300049580 Bacteria 12465
2179 Ga0501046_0011972 3300049580 Bacteria 7401
2180 Ga0501046_0023163 3300049580 Bacteria 5112
2181 Ga0501046_0027532 3300049580 Bacteria 4636
2182 Ga0501046_0029505 3300049580 Bacteria 4459
2183 Ga0501046_0034748 3300049580 Bacteria 4066
2184 Ga0501046_0034921 3300049580 Bacteria 4055
2185 Ga0501046_0039484 3300049580 Bacteria 3779
2186 Ga0501046_0056015 3300049580 Bacteria 3096
2187 Ga0501046_0060138 3300049580 Bacteria 2974
2188 Ga0501046_0116186 3300049580 Bacteria 2040
2189 Ga0501046_0217302 3300049580 Bacteria 1417
2190 Ga0501047_0000167 3300049581 Bacteria 80734
2191 Ga0501047_0000525 3300049581 Bacteria 41419
2192 Ga0501047_0004054 3300049581 Bacteria 13771
2193 Ga0501047_0004950 3300049581 Bacteria 12511
2194 Ga0501047_0005645 3300049581 Bacteria 11782
2195 Ga0501047_0008046 3300049581 Bacteria 9948
2196 Ga0501047_0008516 3300049581 Bacteria 9674
2197 Ga0501047_0008673 3300049581 Bacteria 9600
2198 Ga0501047_0010420 3300049581 Bacteria 8795
2199 Ga0501047_0010875 3300049581 Bacteria 8603
2200 Ga0501047_0012519 3300049581 Bacteria 8035
2201 Ga0501047_0029791 3300049581 Bacteria 5260
2202 Ga0501047_0030757 3300049581 Bacteria 5174
2203 Ga0501047_0037153 3300049581 Bacteria 4709
2204 Ga0501047_0061522 3300049581 Bacteria 3623
2205 Ga0501047_0076179 3300049581 Bacteria 3228
2206 Ga0501047_0078745 3300049581 Bacteria 3169
2207 Ga0501047_0113992 3300049581 Bacteria 2585
2208 Ga0501047_0117937 3300049581 Bacteria 2536
2209 Ga0501047_0126633 3300049581 Bacteria 2434
2210 Ga0501047_0150695 3300049581 Bacteria 2202
2211 Ga0501047_0154984 3300049581 Bacteria 2165
2212 Ga0501047_0176691 3300049581 Bacteria 2003
2213 Ga0501047_0188677 3300049581 Bacteria 1926
2214 Ga0501047_0275858 3300049581 Bacteria 1527
2215 Ga0501048_0000023 3300049582 Bacteria 68242
2216 Ga0501048_0001156 3300049582 Bacteria 19854
2217 Ga0501048_0003824 3300049582 Bacteria 11483
2218 Ga0501048_0011133 3300049582 Bacteria 6707
2219 Ga0501048_0014377 3300049582 Bacteria 5862
2220 Ga0501048_0022887 3300049582 Bacteria 4568
2221 Ga0501048_0041844 3300049582 Bacteria 3282
2222 Ga0501048_0046672 3300049582 Bacteria 3092
2223 Ga0501048_0069395 3300049582 Bacteria 2489
2224 Ga0501048_0151527 3300049582 Bacteria 1640
2225 Ga0501048_0200034 3300049582 Bacteria 1416
2226 Ga0501067_0000095 3300049583 Bacteria 51128
2227 Ga0501067_0000459 3300049583 Bacteria 22346
2228 Ga0501067_0001334 3300049583 Bacteria 13375
2229 Ga0501067_0002006 3300049583 Bacteria 11215
2230 Ga0501067_0006056 3300049583 Bacteria 6705
2231 Ga0501067_0020041 3300049583 Bacteria 3701
2232 Ga0501067_0024837 3300049583 Bacteria 3323
2233 Ga0501067_0046304 3300049583 Bacteria 2414
2234 Ga0501068_0004696 3300049584 Bacteria 7438
2235 Ga0501068_0018246 3300049584 Bacteria 4065
2236 Ga0501068_0028145 3300049584 Bacteria 3322
2237 Ga0501068_0041764 3300049584 Bacteria 2757
2238 Ga0501068_0042123 3300049584 Bacteria 2746
2239 Ga0501068_0042479 3300049584 Bacteria 2734
2240 Ga0501068_0064610 3300049584 Bacteria 2227
2241 Ga0501069_0000022 3300049585 Bacteria 119155
2242 Ga0501069_0001383 3300049585 Bacteria 11914
2243 Ga0501069_0006947 3300049585 Bacteria 5918
2244 Ga0501069_0028942 3300049585 Bacteria 3038
2245 Ga0501070_0000416 3300049586 Bacteria 38782
2246 Ga0501070_0000487 3300049586 Bacteria 36109
2247 Ga0501070_0006154 3300049586 Bacteria 10232
2248 Ga0501070_0008807 3300049586 Bacteria 8531
2249 Ga0501070_0009452 3300049586 Bacteria 8240
2250 Ga0501070_0010989 3300049586 Bacteria 7642
2251 Ga0501070_0013398 3300049586 Bacteria 6914
2252 Ga0501070_0026515 3300049586 Bacteria 4860
2253 Ga0501070_0049262 3300049586 Bacteria 3498
2254 Ga0501070_0049559 3300049586 Bacteria 3487
2255 Ga0501070_0093784 3300049586 Bacteria 2484
2256 Ga0501070_0112904 3300049586 Bacteria 2246
2257 Ga0501070_0113655 3300049586 Bacteria 2237
2258 Ga0501070_0146288 3300049586 Bacteria 1950
2259 Ga0501071_0002624 3300049587 Bacteria 10997
2260 Ga0501071_0003791 3300049587 Bacteria 9500
2261 Ga0501071_0020366 3300049587 Bacteria 4608
2262 Ga0501071_0033683 3300049587 Bacteria 3640
2263 Ga0501071_0037674 3300049587 Bacteria 3453
2264 Ga0501071_0070857 3300049587 Bacteria 2540
2265 Ga0501071_0095864 3300049587 Bacteria 2183
2266 Ga0501072_0002941 3300049588 Bacteria 12815
2267 Ga0501072_0003957 3300049588 Bacteria 11210
2268 Ga0501072_0007891 3300049588 Bacteria 8081
2269 Ga0501072_0011085 3300049588 Bacteria 6879
2270 Ga0501072_0017400 3300049588 Bacteria 5523
2271 Ga0501072_0044078 3300049588 Bacteria 3508
2272 Ga0501072_0049053 3300049588 Bacteria 3323
2273 Ga0501072_0054429 3300049588 Bacteria 3152
2274 Ga0501072_0132754 3300049588 Bacteria 1985
2275 Ga0501073_0005642 3300049589 Bacteria 9364
2276 Ga0501073_0006393 3300049589 Bacteria 8770
2277 Ga0501073_0013255 3300049589 Bacteria 6007
2278 Ga0501073_0018910 3300049589 Bacteria 4978
2279 Ga0501073_0034849 3300049589 Bacteria 3580
2280 Ga0501073_0041445 3300049589 Bacteria 3253
2281 Ga0501073_0068165 3300049589 Bacteria 2480
2282 Ga0501073_0110452 3300049589 Bacteria 1907
2283 Ga0501073_0115928 3300049589 Bacteria 1856
2284 Ga0501074_0000240 3300049590 Bacteria 30667
2285 Ga0501074_0003793 3300049590 Bacteria 10741
2286 Ga0501074_0004249 3300049590 Bacteria 10228
2287 Ga0501074_0005267 3300049590 Bacteria 9310
2288 Ga0501074_0009854 3300049590 Bacteria 6939
2289 Ga0501074_0010549 3300049590 Bacteria 6704
2290 Ga0501074_0011786 3300049590 Bacteria 6356
2291 Ga0501074_0013667 3300049590 Bacteria 5902
2292 Ga0501074_0023109 3300049590 Bacteria 4521
2293 Ga0501074_0036952 3300049590 Bacteria 3539
2294 Ga0501074_0085147 3300049590 Bacteria 2265
2295 Ga0501074_0103633 3300049590 Bacteria 2037
2296 Ga0501075_0001867 3300049591 Bacteria 13879
2297 Ga0501075_0002632 3300049591 Bacteria 11992
2298 Ga0501075_0006576 3300049591 Bacteria 8005
2299 Ga0501075_0011120 3300049591 Bacteria 6358
2300 Ga0501075_0025188 3300049591 Bacteria 4371
2301 Ga0501075_0033336 3300049591 Bacteria 3831
2302 Ga0501075_0035849 3300049591 Bacteria 3700
2303 Ga0501075_0036118 3300049591 Bacteria 3688
2304 Ga0501075_0059625 3300049591 Bacteria 2875
2305 Ga0501075_0059888 3300049591 Bacteria 2869
2306 Ga0501075_0098633 3300049591 Bacteria 2218
2307 Ga0501075_0180562 3300049591 Bacteria 1610
2308 Ga0501076_0000111 3300049592 Bacteria 44777
2309 Ga0501076_0001783 3300049592 Bacteria 14587
2310 Ga0501076_0020875 3300049592 Bacteria 5015
2311 Ga0501076_0030873 3300049592 Bacteria 4175
2312 Ga0501076_0037091 3300049592 Bacteria 3821
2313 Ga0501076_0046057 3300049592 Bacteria 3445
2314 Ga0501076_0129223 3300049592 Bacteria 2048
2315 Ga0501076_0162121 3300049592 Bacteria 1822
2316 Ga0501076_0209581 3300049592 Bacteria 1592
2317 Ga0501077_0000362 3300049593 Bacteria 27016
2318 Ga0501077_0010233 3300049593 Bacteria 5841
2319 Ga0501077_0079048 3300049593 Bacteria 2084
2320 Ga0501077_0093651 3300049593 Bacteria 1904
2321 Ga0501198_000010 3300049649 Bacteria 119733
2322 Ga0501217_017043 3300049661 Bacteria 1671
2323 Ga0501222_000009 3300049662 Bacteria 118560
2324 Ga0501224_000012 3300049664 Bacteria 92585
2325 Ga0501257_000521 3300049686 Bacteria 7637
2326 Ga0501225_0000019 3300049705 Bacteria 59374
2327 Ga0501079_0000571 3300049741 Bacteria 24303
2328 Ga0501079_0003034 3300049741 Bacteria 12289
2329 Ga0501079_0007621 3300049741 Bacteria 8197
2330 Ga0501079_0017789 3300049741 Bacteria 5431
2331 Ga0501079_0021257 3300049741 Bacteria 4963
2332 Ga0501079_0022469 3300049741 Bacteria 4837
2333 Ga0501079_0023159 3300049741 Bacteria 4768
2334 Ga0501079_0025085 3300049741 Bacteria 4573
2335 Ga0501079_0038569 3300049741 Bacteria 3684
2336 Ga0501079_0068392 3300049741 Bacteria 2741
2337 Ga0501079_0081380 3300049741 Bacteria 2504
2338 Ga0501079_0160012 3300049741 Bacteria 1756
2339 Ga0501080_0000009 3300049742 Bacteria 131770
2340 Ga0501080_0001694 3300049742 Bacteria 18799
2341 Ga0501080_0001796 3300049742 Bacteria 18381
2342 Ga0501080_0002232 3300049742 Bacteria 16841
2343 Ga0501080_0008960 3300049742 Bacteria 9101
2344 Ga0501080_0011203 3300049742 Bacteria 8207
2345 Ga0501080_0023378 3300049742 Bacteria 5729
2346 Ga0501080_0023849 3300049742 Bacteria 5670
2347 Ga0501080_0046127 3300049742 Bacteria 4059
2348 Ga0501080_0053972 3300049742 Bacteria 3742
2349 Ga0501080_0072024 3300049742 Bacteria 3215
2350 Ga0501080_0073349 3300049742 Bacteria 3184
2351 Ga0501080_0089698 3300049742 Bacteria 2856
2352 Ga0501080_0101452 3300049742 Bacteria 2670
2353 Ga0501080_0103906 3300049742 Bacteria 2635
2354 Ga0501080_0106590 3300049742 Bacteria 2597
2355 Ga0501080_0143597 3300049742 Bacteria 2206
2356 Ga0501081_0000781 3300049743 Bacteria 18650
2357 Ga0501081_0001100 3300049743 Bacteria 16217
2358 Ga0501081_0005158 3300049743 Bacteria 8413
2359 Ga0501081_0014344 3300049743 Bacteria 5225
2360 Ga0501081_0024938 3300049743 Bacteria 4020
2361 Ga0501081_0035730 3300049743 Bacteria 3384
2362 Ga0501081_0044543 3300049743 Bacteria 3046
2363 Ga0501083_0004086 3300049744 Bacteria 10271
2364 Ga0501083_0004197 3300049744 Bacteria 10144
2365 Ga0501083_0008456 3300049744 Bacteria 7273
2366 Ga0501083_0014691 3300049744 Bacteria 5474
2367 Ga0501083_0015783 3300049744 Bacteria 5287
2368 Ga0501083_0041890 3300049744 Bacteria 3105
2369 Ga0501083_0044680 3300049744 Bacteria 2998
2370 Ga0501083_0046306 3300049744 Bacteria 2941
2371 Ga0501083_0064748 3300049744 Bacteria 2436
2372 Ga0501083_0068271 3300049744 Bacteria 2365
2373 Ga0501083_0125799 3300049744 Bacteria 1680
2374 Ga0501083_0128889 3300049744 Bacteria 1658
2375 Ga0501035_0000010 3300049822 Bacteria 309349
2376 Ga0501035_0000022 3300049822 Bacteria 208622
2377 Ga0501035_0000063 3300049822 Bacteria 131515
2378 Ga0501035_0000691 3300049822 Bacteria 36833
2379 Ga0501035_0000795 3300049822 Bacteria 33546
2380 Ga0501035_0002565 3300049822 Bacteria 17749
2381 Ga0501035_0003351 3300049822 Bacteria 15358
2382 Ga0501035_0008192 3300049822 Bacteria 9740
2383 Ga0501035_0017114 3300049822 Bacteria 6680
2384 Ga0501035_0023989 3300049822 Bacteria 5597
2385 Ga0501035_0025199 3300049822 Bacteria 5453
2386 Ga0501035_0027106 3300049822 Bacteria 5238
2387 Ga0501035_0028472 3300049822 Bacteria 5098
2388 Ga0501035_0031603 3300049822 Bacteria 4821
2389 Ga0501035_0036030 3300049822 Bacteria 4487
2390 Ga0501035_0053015 3300049822 Bacteria 3628
2391 Ga0501035_0081518 3300049822 Bacteria 2855
2392 Ga0501035_0101753 3300049822 Bacteria 2521
2393 Ga0501035_0106681 3300049822 Bacteria 2456
2394 Ga0501035_0126645 3300049822 Bacteria 2229
2395 Ga0501035_0152020 3300049822 Bacteria 2008
2396 Ga0501035_0158523 3300049822 Bacteria 1960
2397 Ga0501035_0170228 3300049822 Bacteria 1882
2398 Ga0501044_0000002 3300049823 Bacteria 375152
2399 Ga0501044_0000006 3300049823 Bacteria 291413
2400 Ga0501044_0000147 3300049823 Bacteria 86591
2401 Ga0501044_0001339 3300049823 Bacteria 28968
2402 Ga0501044_0001727 3300049823 Bacteria 25577
2403 Ga0501044_0002955 3300049823 Bacteria 19340
2404 Ga0501044_0003091 3300049823 Bacteria 18844
2405 Ga0501044_0003999 3300049823 Bacteria 16512
2406 Ga0501044_0008464 3300049823 Bacteria 11271
2407 Ga0501044_0010973 3300049823 Bacteria 9835
2408 Ga0501044_0012081 3300049823 Bacteria 9354
2409 Ga0501044_0013456 3300049823 Bacteria 8849
2410 Ga0501044_0017885 3300049823 Bacteria 7604
2411 Ga0501044_0022854 3300049823 Bacteria 6661
2412 Ga0501044_0037891 3300049823 Bacteria 5038
2413 Ga0501044_0056573 3300049823 Bacteria 4027
2414 Ga0501044_0057549 3300049823 Bacteria 3989
2415 Ga0501044_0066535 3300049823 Bacteria 3674
2416 Ga0501044_0082600 3300049823 Bacteria 3251
2417 Ga0501044_0087717 3300049823 Bacteria 3142
2418 Ga0501044_0089076 3300049823 Bacteria 3115
2419 Ga0501044_0097191 3300049823 Bacteria 2966
2420 Ga0501044_0102855 3300049823 Bacteria 2871
2421 Ga0501044_0134404 3300049823 Bacteria 2465
2422 Ga0501044_0146629 3300049823 Bacteria 2345
2423 Ga0501045_0000117 3300049824 Bacteria 40734
2424 Ga0501045_0004296 3300049824 Bacteria 9825
2425 Ga0501045_0005785 3300049824 Bacteria 8554
2426 Ga0501045_0014111 3300049824 Bacteria 5658
2427 Ga0501045_0024599 3300049824 Bacteria 4324
2428 Ga0501045_0033205 3300049824 Bacteria 3742
2429 Ga0501045_0037159 3300049824 Bacteria 3539
2430 Ga0501045_0037800 3300049824 Bacteria 3510
2431 Ga0501045_0045242 3300049824 Bacteria 3205
2432 Ga0501045_0054602 3300049824 Bacteria 2920
2433 Ga0501226_000199 3300049853 Bacteria 9399
2434 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
2435 nmdc:mga03683_15003_c2 3300050489 Bacteria 2576
2436 nmdc:mga03683_16707_c1 3300050489 Bacteria 2762
2437 nmdc:mga03683_289_c1 3300050489 Bacteria 14995
2438 nmdc:mga03683_4043_c1 3300050489 Bacteria 4815
2439 nmdc:mga03n38_31351_c1 3300050490 Bacteria 2243
2440 nmdc:mga00v17_110898_c1 3300050491 Bacteria 1740
2441 nmdc:mga00v17_22945_c1 3300050491 Bacteria 3606
2442 nmdc:mga00v17_23570_c1 3300050491 Bacteria 3561
2443 nmdc:mga00v17_436_c1 3300050491 Bacteria 23432
2444 nmdc:mga00v17_5894_c1 3300050491 Bacteria 6475
2445 nmdc:mga00v17_65645_c1 3300050491 Bacteria 2240
2446 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
2447 nmdc:mga0yw44_3205_c1 3300050492 Bacteria 7203
2448 nmdc:mga0yw44_3798_c1 3300050492 Bacteria 6779
2449 nmdc:mga0yw44_6417_c1 3300050492 Bacteria 5681
2450 nmdc:mga0k408_30749_c1 3300050493 Bacteria 3063
2451 nmdc:mga0k408_39006_c1 3300050493 Bacteria 2727
2452 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
2453 nmdc:mga0k408_9071_c1 3300050493 Bacteria 5354
2454 nmdc:mga06z11_57364_c1 3300050494 Bacteria 2017
2455 nmdc:mga06z11_573_c1 3300050494 Bacteria 13457
2456 nmdc:mga06z11_7537_c1 3300050494 Bacteria 4486
2457 nmdc:mga07m45_102897_c1 3300050496 Bacteria 1641
2458 nmdc:mga07m45_33075_c1 3300050496 Bacteria 2871
2459 nmdc:mga07m45_340_c1 3300050496 Bacteria 18991
2460 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
2461 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
2462 nmdc:mga05p37_21426_c1 3300050507 Bacteria 7829
2463 nmdc:mga05p37_23015_c1 3300050507 Bacteria 7558
2464 nmdc:mga05p37_239377_c1 3300050507 Bacteria 2183
2465 nmdc:mga05p37_2954_c1 3300050507 Bacteria 19738
2466 nmdc:mga05p37_297708_c1 3300050507 Bacteria 1918
2467 nmdc:mga05p37_33674_c1 3300050507 Bacteria 6276
2468 nmdc:mga05p37_34442_c1 3300050507 Bacteria 6203
2469 nmdc:mga05p37_369_c2 3300050507 Bacteria 27862
2470 nmdc:mga05p37_37469_c1 3300050507 Bacteria 5945
2471 nmdc:mga05p37_420235_c1 3300050507 Bacteria 1556
2472 nmdc:mga05p37_43150_c1 3300050507 Bacteria 5546
2473 nmdc:mga05p37_50935_c1 3300050507 Bacteria 5092
2474 nmdc:mga05p37_5606_c1 3300050507 Bacteria 14753
2475 nmdc:mga05p37_731_c1 3300050507 Bacteria 27405
2476 nmdc:mga05p37_78270_c1 3300050507 Bacteria 4071
2477 nmdc:mga05p37_88140_c1 3300050507 Bacteria 3825
2478 nmdc:mga05p37_89906_c1 3300050507 Bacteria 3784
2479 nmdc:mga09592_123239_c1 3300050508 Bacteria 2227
2480 nmdc:mga09592_34060_c1 3300050508 Bacteria 4257
2481 nmdc:mga09592_8006_c1 3300050508 Bacteria 8594
2482 nmdc:mga09592_9024_c1 3300050508 Bacteria 8107
2483 nmdc:mga0qj67_12872_c1 3300050509 Bacteria 6313
2484 nmdc:mga0qj67_18644_c1 3300050509 Bacteria 5290
2485 nmdc:mga0qj67_1964_c1 3300050509 Bacteria 14640
2486 nmdc:mga0qj67_34742_c1 3300050509 Bacteria 3940
2487 nmdc:mga0qj67_5030_c1 3300050509 Bacteria 9607
2488 nmdc:mga0qj67_58097_c1 3300050509 Bacteria 3067
2489 nmdc:mga0qj67_8597_c1 3300050509 Bacteria 7575
2490 nmdc:mga06r32_10388_c1 3300050510 Bacteria 8399
2491 nmdc:mga06r32_15713_c1 3300050510 Bacteria 6879
2492 nmdc:mga06r32_244015_c1 3300050510 Bacteria 1784
2493 nmdc:mga06r32_316488_c1 3300050510 Bacteria 1546
2494 nmdc:mga06r32_43901_c1 3300050510 Bacteria 4255
2495 nmdc:mga08y16_112153_c1 3300050511 Bacteria 2839
2496 nmdc:mga08y16_121327_c1 3300050511 Bacteria 2720
2497 nmdc:mga08y16_1262_c1 3300050511 Bacteria 25130
2498 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
2499 nmdc:mga08y16_131757_c1 3300050511 Bacteria 2600
2500 nmdc:mga08y16_146635_c1 3300050511 Bacteria 2454
2501 nmdc:mga08y16_15124_c1 3300050511 Bacteria 8111
2502 nmdc:mga08y16_16970_c1 3300050511 Bacteria 7667
2503 nmdc:mga08y16_220987_c1 3300050511 Bacteria 1961
2504 nmdc:mga08y16_24932_c1 3300050511 Bacteria 6309
2505 nmdc:mga08y16_256516_c1 3300050511 Bacteria 1806
2506 nmdc:mga08y16_2846_c1 3300050511 Bacteria 17786
2507 nmdc:mga08y16_302551_c1 3300050511 Bacteria 1648
2508 nmdc:mga08y16_41828_c1 3300050511 Bacteria 4800
2509 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
2510 nmdc:mga08y16_64252_c1 3300050511 Bacteria 3833
2511 nmdc:mga08y16_86979_c1 3300050511 Bacteria 3256
2512 nmdc:mga08y16_9444_c1 3300050511 Bacteria 10232
2513 nmdc:mga0n895_131659_c1 3300050512 Bacteria 2526
2514 nmdc:mga0n895_190799_c1 3300050512 Bacteria 2080
2515 nmdc:mga0n895_39201_c1 3300050512 Bacteria 4595
2516 nmdc:mga0n895_6856_c1 3300050512 Bacteria 9726
2517 nmdc:mga0n895_83_c1 3300050512 Bacteria 54380
2518 nmdc:mga0rr50_21363_c1 3300050513 Bacteria 3432
2519 nmdc:mga0rr50_2281_c1 3300050513 Bacteria 10756
2520 nmdc:mga0rr50_84432_c1 3300050513 Bacteria 2458
2521 nmdc:mga08x19_31463_c1 3300050514 Bacteria 3338
2522 nmdc:mga08x19_338_c1 3300050514 Bacteria 33871
2523 nmdc:mga08x19_3836_c1 3300050514 Bacteria 8943
2524 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
2525 nmdc:mga0a205_113677_c1 3300050515 Bacteria 2606
2526 nmdc:mga0a205_135260_c1 3300050515 Bacteria 2365
2527 nmdc:mga0a205_27869_c1 3300050515 Bacteria 5397
2528 nmdc:mga0a205_6425_c1 3300050515 Bacteria 9582
2529 nmdc:mga0a205_77693_c1 3300050515 Bacteria 3207
2530 nmdc:mga0sz30_15265_c1 3300050516 Bacteria 3033
2531 nmdc:mga0sz30_1731_c2 3300050516 Bacteria 4263
2532 nmdc:mga0sz30_4510_c1 3300050516 Bacteria 5038
2533 Ga0495601_0026658 3300053077 Bacteria 3570
2534 Ga0500610_0000536 3300053079 Bacteria 11667
2535 Ga0500635_0016211 3300053080 Bacteria 2212
2536 Ga0495619_0001504 3300053085 Bacteria 15362
2537 Ga0495619_0007461 3300053085 Bacteria 6928
2538 Ga0495619_0056017 3300053085 Bacteria 2613
2539 Ga0500643_000014 3300053087 Bacteria 318249
2540 Ga0500643_019880 3300053087 Bacteria 2205
2541 Ga0500643_024660 3300053087 Bacteria 1906
2542 Ga0500644_0001468 3300053088 Bacteria 6209
2543 Ga0500646_0008749 3300053090 Bacteria 2594
2544 Ga0500651_0056396 3300053093 Bacteria 2460
2545 Ga0500566_0054658 3300053094 Bacteria 2276
2546 Ga0500641_0000318 3300053096 Bacteria 17857
2547 Ga0500641_0002274 3300053096 Bacteria 6810
2548 Ga0500555_000206 3300053103 Bacteria 27499
2549 Ga0500555_002397 3300053103 Bacteria 5446
2550 Ga0500555_002766 3300053103 Bacteria 5037
2551 Ga0500555_004900 3300053103 Bacteria 3798
2552 Ga0500555_018829 3300053103 Bacteria 1990
2553 Ga0500555_020945 3300053103 Bacteria 1884
2554 Ga0500555_024282 3300053103 Bacteria 1737
2555 Ga0500556_0000139 3300053104 Bacteria 60701
2556 Ga0500556_0000516 3300053104 Bacteria 26405
2557 Ga0500562_000079 3300053108 Bacteria 43830
2558 Ga0500562_000674 3300053108 Bacteria 8303
2559 Ga0500569_013973 3300053109 Bacteria 1978
2560 Ga0500572_000252 3300053111 Bacteria 19253
2561 Ga0500592_000074 3300053116 Bacteria 25290
2562 Ga0500592_000423 3300053116 Bacteria 7070
2563 Ga0500592_004686 3300053116 Bacteria 2173
2564 Ga0500593_010530 3300053117 Bacteria 3885
2565 Ga0500595_002118 3300053119 Bacteria 10116
2566 Ga0500595_010066 3300053119 Bacteria 3778
2567 Ga0500595_013747 3300053119 Bacteria 3095
2568 Ga0500607_000048 3300053121 Bacteria 82363
2569 Ga0500617_065643 3300053124 Bacteria 1599
2570 Ga0500618_000046 3300053125 Bacteria 109891
2571 Ga0500618_000151 3300053125 Bacteria 57092
2572 Ga0500642_0000011 3300053130 Bacteria 215963
2573 Ga0500652_000793 3300053131 Bacteria 10609
2574 Ga0500658_0000106 3300053134 Bacteria 38868
2575 Ga0500658_0004109 3300053134 Bacteria 5472
2576 Ga0500559_0000118 3300053136 Bacteria 62436
2577 Ga0500559_0001340 3300053136 Bacteria 14123
2578 Ga0500568_0000608 3300053139 Bacteria 25965
2579 Ga0500568_0001043 3300053139 Bacteria 18919
2580 Ga0500568_0001762 3300053139 Bacteria 13363
2581 Ga0500573_0000004 3300053140 Bacteria 341236
2582 Ga0500588_0000924 3300053146 Bacteria 5193
2583 Ga0500590_005613 3300053148 Bacteria 6048
2584 Ga0500603_000163 3300053150 Bacteria 16654
2585 Ga0500604_0000004 3300053151 Bacteria 146374
2586 Ga0500616_0000195 3300053153 Bacteria 99188
2587 Ga0500616_0000321 3300053153 Bacteria 68888
2588 Ga0500616_0002540 3300053153 Bacteria 15067
2589 Ga0500616_0006086 3300053153 Bacteria 7991
2590 Ga0500616_0010040 3300053153 Bacteria 5689
2591 Ga0500616_0044396 3300053153 Bacteria 2371
2592 Ga0500616_0086420 3300053153 Bacteria 1564
2593 Ga0500620_000504 3300053155 Bacteria 6847
2594 Ga0500624_000037 3300053157 Bacteria 94634
2595 Ga0500624_000043 3300053157 Bacteria 90095
2596 Ga0500627_0000014 3300053158 Bacteria 135404
2597 Ga0500627_0000423 3300053158 Bacteria 11458
2598 Ga0500630_034264 3300053159 Bacteria 2490
2599 Ga0500634_0000008 3300053161 Bacteria 152203
2600 Ga0500634_0001572 3300053161 Bacteria 8981
2601 Ga0500636_0000010 3300053177 Bacteria 145932
2602 Ga0500636_0007386 3300053177 Bacteria 6356
2603 Ga0500637_0000178 3300053178 Bacteria 23661
2604 Ga0500645_000067 3300053730 Bacteria 81846
2605 Ga0500645_000170 3300053730 Bacteria 51134
2606 Ga0500645_000795 3300053730 Bacteria 18914
2607 Ga0500645_004767 3300053730 Bacteria 5133
2608 Ga0500645_009149 3300053730 Bacteria 3342
2609 Ga0500645_009951 3300053730 Bacteria 3170
2610 Ga0500645_018022 3300053730 Bacteria 2208
2611 Ga0500552_000241 3300053733 Bacteria 4996
2612 Ga0501084_0000147 3300054114 Bacteria 53278
2613 Ga0501084_0001411 3300054114 Bacteria 19018
2614 Ga0501084_0002307 3300054114 Bacteria 15310
2615 Ga0501084_0014119 3300054114 Bacteria 6615
2616 Ga0501084_0015474 3300054114 Bacteria 6326
2617 Ga0501084_0020947 3300054114 Bacteria 5453
2618 Ga0501084_0042387 3300054114 Bacteria 3807
2619 Ga0501084_0050769 3300054114 Bacteria 3470
2620 Ga0501084_0107055 3300054114 Bacteria 2349
2621 Ga0501084_0108939 3300054114 Bacteria 2327
2622 Ga0590071_000244 3300059421 Bacteria 15907
2623 Ga0590071_009446 3300059421 Bacteria 2291
2624 Ga0590074_001600 3300059423 Bacteria 3672
2625 Ga0590075_002263 3300059424 Bacteria 4626
2626 Ga0590077_001842 3300059426 Bacteria 4711
2627 Ga0587088_005933 3300059508 Bacteria 1627
2628 Ga0587090_005706 3300059510 Bacteria 1572
2629 Ga0501082_0000207 3300060353 Bacteria 51462
2630 Ga0501082_0000818 3300060353 Bacteria 27377
2631 Ga0501082_0000994 3300060353 Bacteria 25035
2632 Ga0501082_0008755 3300060353 Bacteria 8725
2633 Ga0501082_0016995 3300060353 Bacteria 6264
2634 Ga0501082_0018225 3300060353 Bacteria 6044
2635 Ga0501082_0024954 3300060353 Bacteria 5150
2636 Ga0501082_0026833 3300060353 Bacteria 4963
2637 Ga0501082_0029466 3300060353 Bacteria 4729
2638 Ga0501082_0035484 3300060353 Bacteria 4298
2639 Ga0501082_0041986 3300060353 Bacteria 3943
2640 Ga0501082_0053938 3300060353 Bacteria 3465
2641 Ga0501082_0069930 3300060353 Bacteria 3023
2642 Ga0501082_0072626 3300060353 Bacteria 2964
2643 Ga0501082_0147498 3300060353 Bacteria 2042
2644 Ga0530510_0000318 3300061734 Bacteria 31006
2645 Ga0530510_0000795 3300061734 Bacteria 20579
2646 Ga0530510_0040029 3300061734 Bacteria 3382
2647 Ga0530510_0107481 3300061734 Bacteria 2042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0200034 Ga0501048_0200034_115_1395 395
2 3300035172 Ga0373955_0141624 Ga0373955_0141624_16_1323 408
3 3300049661 Ga0501217_017043 Ga0501217_017043_16_1326 425
4 3300050510 nmdc:mga06r32_316488_c1 nmdc:mga06r32_316488_c1_216_1529 425
5 3300026142 Ga0207698_10190102 Ga0207698_101901022 430
6 3300035171 Ga0373946_0013824 Ga0373946_0013824_1210_2526 431
7 3300044673 Ga0453683_0020630 Ga0453683_0020630_106_1422 435
8 3300042007 Ga0439449_0036938 Ga0439449_0036938_12_1358 437
9 3300042122 Ga0450920_001542 Ga0450920_001542_2451_3797 437
10 3300049575 Ga0501039_0017708 Ga0501039_0017708_4079_5425 437
11 3300049576 Ga0501040_0204772 Ga0501040_0204772_11_1357 437
12 3300049580 Ga0501046_0217302 Ga0501046_0217302_24_1370 437
13 3300049824 Ga0501045_0024599 Ga0501045_0024599_14_1360 437
14 3300042876 Ga0451577_0053794 Ga0451577_0053794_2205_3527 438
15 3300048918 Ga0496115_0201854 Ga0496115_0201854_292_1629 438
16 3300050496 nmdc:mga07m45_340_c1 nmdc:mga07m45_340_c1_17583_18980 440
17 3300035170 Ga0373943_0117997 Ga0373943_0117997_30_1388 441
18 3300046461 Ga0495641_0030873 Ga0495641_0030873_451_1980 443
19 3300046694 Ga0495649_0000672 Ga0495649_0000672_20395_21855 444
20 3300049568 Ga0501031_0000424 Ga0501031_0000424_13997_15421 444
21 3300049569 Ga0501032_0136993 Ga0501032_0136993_127_1551 444
22 3300049572 Ga0501036_0012053 Ga0501036_0012053_5351_6775 444
23 3300049576 Ga0501040_0003278 Ga0501040_0003278_5142_6566 444
24 3300049578 Ga0501042_0000070 Ga0501042_0000070_7435_8859 444
25 3300049588 Ga0501072_0002941 Ga0501072_0002941_5669_7093 444
26 3300049590 Ga0501074_0003793 Ga0501074_0003793_7100_8524 444
27 3300049591 Ga0501075_0001867 Ga0501075_0001867_10336_11760 444
28 3300049592 Ga0501076_0001783 Ga0501076_0001783_8022_9446 444
29 3300049593 Ga0501077_0000362 Ga0501077_0000362_7171_8595 444
30 3300049741 Ga0501079_0000571 Ga0501079_0000571_16369_17793 444
31 3300049742 Ga0501080_0046127 Ga0501080_0046127_585_2009 444
32 3300049744 Ga0501083_0046306 Ga0501083_0046306_1429_2853 444
33 3300049822 Ga0501035_0017114 Ga0501035_0017114_3834_5258 444
34 3300060353 Ga0501082_0000207 Ga0501082_0000207_14635_16059 444
35 3300061734 Ga0530510_0000318 Ga0530510_0000318_2195_3619 444
36 3300031901 Ga0307406_10002833 Ga0307406_100028335 445
37 3300006871 Ga0075434_100015056 Ga0075434_1000150563 446
38 3300007076 Ga0075435_100200777 Ga0075435_1002007771 446
39 3300031911 Ga0307412_10015389 Ga0307412_100153895 446
40 3300048919 Ga0496116_0034669 Ga0496116_0034669_1451_2908 446
41 3300048928 Ga0496125_0002077 Ga0496125_0002077_12210_13667 446
42 3300050507 nmdc:mga05p37_420235_c1 nmdc:mga05p37_420235_c1_43_1416 446
43 3300050511 nmdc:mga08y16_302551_c1 nmdc:mga08y16_302551_c1_12_1535 446
44 3300003781 Ga0055536_1001284 Ga0055536_10012849 447
45 3300003794 Ga0055531_10027937 Ga0055531_100279372 447
46 3300005564 Ga0070664_100022528 Ga0070664_1000225284 447
47 3300006847 Ga0075431_100268569 Ga0075431_1002685691 447
48 3300009148 Ga0105243_10073161 Ga0105243_100731612 447
49 3300025292 Ga0209676_1000046 Ga0209676_1000046292 447
50 3300025298 Ga0209050_1009835 Ga0209050_10098355 447
51 3300025304 Ga0209257_1000191 Ga0209257_10001918 447
52 3300049569 Ga0501032_0015269 Ga0501032_0015269_2764_4245 447
53 3300049571 Ga0501034_0027313 Ga0501034_0027313_2271_3752 447
54 3300049574 Ga0501038_0047718 Ga0501038_0047718_58_1539 447
55 3300049582 Ga0501048_0069395 Ga0501048_0069395_293_1723 447
56 3300049589 Ga0501073_0034849 Ga0501073_0034849_420_1901 447
57 3300053088 Ga0500644_0001468 Ga0500644_0001468_1731_3188 447
58 3300005331 Ga0070670_100010259 Ga0070670_1000102593 448
59 3300005340 Ga0070689_100007699 Ga0070689_1000076993 448
60 3300005364 Ga0070673_100103183 Ga0070673_1001031832 448
61 3300005444 Ga0070694_100075141 Ga0070694_1000751412 448
62 3300005457 Ga0070662_100119057 Ga0070662_1001190572 448
63 3300005459 Ga0068867_100016854 Ga0068867_1000168544 448
64 3300005543 Ga0070672_100018311 Ga0070672_1000183112 448
65 3300005549 Ga0070704_100001042 Ga0070704_1000010428 448
66 3300005564 Ga0070664_100001771 Ga0070664_1000017715 448
67 3300005577 Ga0068857_100060920 Ga0068857_1000609203 448
68 3300005577 Ga0068857_100189150 Ga0068857_1001891502 448
69 3300005617 Ga0068859_100008942 Ga0068859_1000089425 448
70 3300005617 Ga0068859_100014908 Ga0068859_1000149086 448
71 3300005840 Ga0068870_10011891 Ga0068870_100118912 448
72 3300005843 Ga0068860_100002485 Ga0068860_1000024856 448
73 3300005844 Ga0068862_100000802 Ga0068862_10000080210 448
74 3300006358 Ga0068871_100160669 Ga0068871_1001606692 448
75 3300006931 Ga0097620_100008942 Ga0097620_1000089423 448
76 3300006931 Ga0097620_100014908 Ga0097620_1000149086 448
77 3300025908 Ga0207643_10012145 Ga0207643_100121453 448
78 3300025923 Ga0207681_10001396 Ga0207681_100013962 448
79 3300025925 Ga0207650_10001681 Ga0207650_100016817 448
80 3300025926 Ga0207659_10004333 Ga0207659_100043332 448
81 3300025936 Ga0207670_10017741 Ga0207670_100177413 448
82 3300025940 Ga0207691_10020717 Ga0207691_100207172 448
83 3300025942 Ga0207689_10161543 Ga0207689_101615431 448
84 3300025945 Ga0207679_10002830 Ga0207679_100028305 448
85 3300025961 Ga0207712_10031021 Ga0207712_100310212 448
86 3300025972 Ga0207668_10036200 Ga0207668_100362002 448
87 3300026075 Ga0207708_10055127 Ga0207708_100551272 448
88 3300026089 Ga0207648_10020965 Ga0207648_100209654 448
89 3300026116 Ga0207674_10019262 Ga0207674_100192622 448
90 3300026116 Ga0207674_10039452 Ga0207674_100394524 448
91 3300027907 Ga0207428_10004109 Ga0207428_100041095 448
92 3300028380 Ga0268265_10000611 Ga0268265_1000061116 448
93 3300036647 Ga0316582_0024555 Ga0316582_0024555_1747_3249 448
94 3300005436 Ga0070713_100003849 Ga0070713_1000038492 449
95 3300009094 Ga0111539_10261232 Ga0111539_102612322 449
96 3300009147 Ga0114129_10017842 Ga0114129_100178428 449
97 3300025960 Ga0207651_10008026 Ga0207651_100080263 449
98 3300026088 Ga0207641_10174737 Ga0207641_101747372 449
99 3300050512 nmdc:mga0n895_131659_c1 nmdc:mga0n895_131659_c1_81_1604 449
100 3300053093 Ga0500651_0056396 Ga0500651_0056396_681_2141 449
101 3300003215 JGI25153J46596_10003191 JGI25153J46596_100031917 450
102 3300025297 Ga0209758_1000036 Ga0209758_1000036105 450
103 3300049570 Ga0501033_0041990 Ga0501033_0041990_907_2367 450
104 3300049573 Ga0501037_0085059 Ga0501037_0085059_66_1526 450
105 3300049823 Ga0501044_0008464 Ga0501044_0008464_8126_9586 450
106 3300059421 Ga0590071_009446 Ga0590071_009446_125_1648 450
107 3300059424 Ga0590075_002263 Ga0590075_002263_2574_4097 450
108 3300039453 Ga0436362_1046623 Ga0436362_1046623_354_1844 451
109 3300046459 Ga0495629_0035081 Ga0495629_0035081_1377_2903 451
110 3300005439 Ga0070711_100020619 Ga0070711_1000206194 452
111 3300005445 Ga0070708_100117337 Ga0070708_1001173373 452
112 3300009147 Ga0114129_10219035 Ga0114129_102190352 452
113 3300025916 Ga0207663_10013918 Ga0207663_100139186 452
114 3300031241 Ga0265325_10010903 Ga0265325_100109034 452
115 3300031241 Ga0265325_10058748 Ga0265325_100587481 452
116 3300031247 Ga0265340_10011282 Ga0265340_100112823 452
117 3300031247 Ga0265340_10035956 Ga0265340_100359561 452
118 3300031249 Ga0265339_10099829 Ga0265339_100998291 452
119 3300031250 Ga0265331_10049431 Ga0265331_100494312 452
120 3300031344 Ga0265316_10037488 Ga0265316_100374882 452
121 3300031595 Ga0265313_10004928 Ga0265313_100049288 452
122 3300031595 Ga0265313_10007221 Ga0265313_100072211 452
123 3300031852 Ga0307410_10001366 Ga0307410_100013666 452
124 3300032004 Ga0307414_10038329 Ga0307414_100383292 452
125 3300035118 Ga0373954_0036358 Ga0373954_0036358_454_1908 452
126 3300048923 Ga0496120_0007965 Ga0496120_0007965_4250_5893 452
127 3300048924 Ga0496121_0000001 Ga0496121_0000001_459897_461540 452
128 3300048927 Ga0496124_0099478 Ga0496124_0099478_90_1733 452
129 3300048928 Ga0496125_0000001 Ga0496125_0000001_571950_573593 452
130 3300053124 Ga0500617_065643 Ga0500617_065643_191_1564 452
131 3300053153 Ga0500616_0086420 Ga0500616_0086420_49_1449 452
132 3300005985 Ga0081539_10003038 Ga0081539_1000303817 453
133 3300049569 Ga0501032_0020874 Ga0501032_0020874_193_1722 453
134 3300049571 Ga0501034_0000392 Ga0501034_0000392_55556_57085 453
135 3300049572 Ga0501036_0053171 Ga0501036_0053171_798_2327 453
136 3300049573 Ga0501037_0001081 Ga0501037_0001081_7389_8918 453
137 3300049574 Ga0501038_0020175 Ga0501038_0020175_1225_2754 453
138 3300049575 Ga0501039_0018297 Ga0501039_0018297_841_2370 453
139 3300049579 Ga0501043_0003469 Ga0501043_0003469_5225_6754 453
140 3300049581 Ga0501047_0126633 Ga0501047_0126633_545_2074 453
141 3300049823 Ga0501044_0082600 Ga0501044_0082600_360_1889 453
142 3300049824 Ga0501045_0000117 Ga0501045_0000117_20394_21923 453
143 3300037471 Ga0395905_0098147 Ga0395905_0098147_1362_2729 454
144 3300053094 Ga0500566_0054658 Ga0500566_0054658_37_1497 454
145 3300009147 Ga0114129_10006133 Ga0114129_100061333 455
146 3300048907 Ga0496104_0006579 Ga0496104_0006579_390_1874 455
147 3300048908 Ga0496105_0014554 Ga0496105_0014554_537_2021 455
148 3300048911 Ga0496108_0119559 Ga0496108_0119559_669_2153 455
149 3300048914 Ga0496111_0150219 Ga0496111_0150219_89_1573 455
150 3300048915 Ga0496112_0070639 Ga0496112_0070639_856_2340 455
151 3300005719 Ga0068861_100025349 Ga0068861_1000253496 456
152 3300006844 Ga0075428_100018421 Ga0075428_1000184213 457
153 3300006846 Ga0075430_100041590 Ga0075430_1000415902 457
154 3300006880 Ga0075429_100022206 Ga0075429_1000222062 457
155 3300049570 Ga0501033_0000005 Ga0501033_0000005_22145_23674 457
156 3300047472 Ga0495686_0009423 Ga0495686_0009423_3656_5113 458
157 3300049578 Ga0501042_0167141 Ga0501042_0167141_29_1447 458
158 3300049581 Ga0501047_0029791 Ga0501047_0029791_1766_3229 458
159 3300003791 Ga0055530_10002772 Ga0055530_100027722 459
160 3300003794 Ga0055531_10004694 Ga0055531_100046945 459
161 3300005262 Ga0065165_1000238 Ga0065165_100023873 459
162 3300025297 Ga0209758_1000670 Ga0209758_100067010 459
163 3300025298 Ga0209050_1000031 Ga0209050_100003131 459
164 3300025304 Ga0209257_1000489 Ga0209257_100048938 459
165 3300031852 Ga0307410_10044736 Ga0307410_100447363 459
166 3300048928 Ga0496125_0057447 Ga0496125_0057447_1224_2696 459
167 3300050507 nmdc:mga05p37_50935_c1 nmdc:mga05p37_50935_c1_2310_3734 459
168 3300053157 Ga0500624_000037 Ga0500624_000037_2938_4395 459
169 3300005354 Ga0070675_100026079 Ga0070675_1000260792 460
170 3300005364 Ga0070673_100009454 Ga0070673_1000094544 460
171 3300006042 Ga0075368_10012090 Ga0075368_100120902 460
172 3300006051 Ga0075364_10000257 Ga0075364_1000025723 460
173 3300006178 Ga0075367_10002842 Ga0075367_100028423 460
174 3300025250 Ga0209026_1001810 Ga0209026_10018108 460
175 3300025304 Ga0209257_1000907 Ga0209257_100090717 460
176 3300025924 Ga0207694_10000725 Ga0207694_100007252 460
177 3300025949 Ga0207667_10144559 Ga0207667_101445592 460
178 3300032002 Ga0307416_100142159 Ga0307416_1001421591 460
179 3300037312 Ga0395899_0001149 Ga0395899_0001149_18857_20317 460
180 3300037418 Ga0395900_0000010 Ga0395900_0000010_96414_97874 460
181 3300037466 Ga0395898_0017969 Ga0395898_0017969_5413_6873 460
182 3300037471 Ga0395905_0018050 Ga0395905_0018050_761_2221 460
183 3300038443 Ga0395901_0000007 Ga0395901_0000007_180776_182236 460
184 3300044712 Ga0453684_0026694 Ga0453684_0026694_5029_6501 460
185 3300046615 Ga0495656_0004890 Ga0495656_0004890_39_1562 460
186 3300048918 Ga0496115_0000731 Ga0496115_0000731_3900_5360 460
187 3300049570 Ga0501033_0056886 Ga0501033_0056886_917_2419 460
188 3300049581 Ga0501047_0113992 Ga0501047_0113992_474_1901 460
189 3300049591 Ga0501075_0180562 Ga0501075_0180562_167_1582 460
190 3300050491 nmdc:mga00v17_436_c1 nmdc:mga00v17_436_c1_17212_18672 460
191 3300053090 Ga0500646_0008749 Ga0500646_0008749_364_1827 460
192 iso_pu_bacteria 2838675328 2838677205 460
193 iso_pu_bacteria 2838724970 2838726845 460
194 iso_pu_bacteria 2841846520 2841847041 460
195 iso_pu_bacteria 2841859092 2841860430 460
196 iso_pu_bacteria 2842124991 2842126930 460
197 iso_pu_bacteria 2842130223 2842132098 460
198 iso_pu_bacteria 2842152218 2842152733 460
199 iso_pu_bacteria 2842175837 2842176352 460
200 iso_pu_bacteria 2899792073 2899792495 460
201 3300005367 Ga0070667_100000231 Ga0070667_10000023155 461
202 3300005548 Ga0070665_100001079 Ga0070665_10000107924 461
203 3300005843 Ga0068860_100000151 Ga0068860_10000015177 461
204 3300005843 Ga0068860_100000303 Ga0068860_10000030330 461
205 3300006881 Ga0068865_100000650 Ga0068865_1000006505 461
206 3300009098 Ga0105245_10026408 Ga0105245_100264085 461
207 3300009101 Ga0105247_10022841 Ga0105247_100228414 461
208 3300009177 Ga0105248_10035417 Ga0105248_100354173 461
209 3300009553 Ga0105249_10030891 Ga0105249_100308913 461
210 3300025900 Ga0207710_10016185 Ga0207710_100161851 461
211 3300025938 Ga0207704_10007220 Ga0207704_100072203 461
212 3300025986 Ga0207658_10002711 Ga0207658_100027113 461
213 3300027378 Ga0209981_1000348 Ga0209981_10003482 461
214 3300028379 Ga0268266_10007931 Ga0268266_100079313 461
215 3300028380 Ga0268265_10001389 Ga0268265_1000138915 461
216 3300028380 Ga0268265_10069422 Ga0268265_100694222 461
217 3300028381 Ga0268264_10000059 Ga0268264_1000005939 461
218 3300028381 Ga0268264_10000399 Ga0268264_1000039920 461
219 3300031251 Ga0265327_10004119 Ga0265327_1000411914 461
220 3300039447 Ga0436361_0187518 Ga0436361_0187518_3496_4959 461
221 3300041410 Ga0439461_0013046 Ga0439461_0013046_156_1541 461
222 3300046660 Ga0495625_0061779 Ga0495625_0061779_1191_2633 461
223 3300046684 Ga0495669_0007716 Ga0495669_0007716_2771_4231 461
224 3300053087 Ga0500643_019880 Ga0500643_019880_559_2019 461
225 3300005347 Ga0070668_100109185 Ga0070668_1001091851 462
226 3300005366 Ga0070659_100004771 Ga0070659_1000047713 462
227 3300005548 Ga0070665_100000166 Ga0070665_10000016633 462
228 3300009093 Ga0105240_10038279 Ga0105240_100382794 462
229 3300009553 Ga0105249_10206461 Ga0105249_102064612 462
230 3300010375 Ga0105239_10113734 Ga0105239_101137342 462
231 3300025913 Ga0207695_10032559 Ga0207695_100325596 462
232 3300025921 Ga0207652_10226693 Ga0207652_102266931 462
233 3300025932 Ga0207690_10000110 Ga0207690_1000011028 462
234 3300026078 Ga0207702_10173365 Ga0207702_101733651 462
235 3300028379 Ga0268266_10000005 Ga0268266_100000051352 462
236 3300035111 Ga0373923_0007440 Ga0373923_0007440_1067_2539 462
237 3300035172 Ga0373955_0002868 Ga0373955_0002868_4088_5560 462
238 3300036401 Ga0373937_0001410 Ga0373937_0001410_9599_11071 462
239 3300048918 Ga0496115_0002083 Ga0496115_0002083_8409_9869 462
240 3300049581 Ga0501047_0004054 Ga0501047_0004054_11775_13232 462
241 3300049686 Ga0501257_000521 Ga0501257_000521_5699_7162 462
242 3300053111 Ga0500572_000252 Ga0500572_000252_10518_11981 462
243 3300003791 Ga0055530_10014674 Ga0055530_100146742 463
244 3300005331 Ga0070670_100155562 Ga0070670_1001555622 463
245 3300005617 Ga0068859_100045143 Ga0068859_1000451434 463
246 3300005844 Ga0068862_100002760 Ga0068862_10000276016 463
247 3300006844 Ga0075428_100000582 Ga0075428_10000058229 463
248 3300006931 Ga0097620_100045143 Ga0097620_1000451432 463
249 3300009147 Ga0114129_10092903 Ga0114129_100929032 463
250 3300025298 Ga0209050_1000929 Ga0209050_100092925 463
251 3300025986 Ga0207658_10042754 Ga0207658_100427541 463
252 3300026035 Ga0207703_10043742 Ga0207703_100437423 463
253 3300026067 Ga0207678_10069201 Ga0207678_100692013 463
254 3300028380 Ga0268265_10002755 Ga0268265_100027556 463
255 3300031730 Ga0307516_10000042 Ga0307516_1000004281 463
256 3300035695 Ga0373927_0010446 Ga0373927_0010446_3733_5226 463
257 3300037068 Ga0373925_0008219 Ga0373925_0008219_2649_4142 463
258 3300037471 Ga0395905_0014250 Ga0395905_0014250_3096_4556 463
259 3300038443 Ga0395901_0238826 Ga0395901_0238826_179_1711 463
260 3300045049 Ga0466959_0165451 Ga0466959_0165451_109_1515 463
261 3300046473 Ga0495582_0029199 Ga0495582_0029199_139_1632 463
262 3300046507 Ga0495606_0036695 Ga0495606_0036695_1211_2680 463
263 3300046512 Ga0495610_0002818 Ga0495610_0002818_10728_12197 463
264 3300046681 Ga0495647_0025411 Ga0495647_0025411_563_2056 463
265 3300047472 Ga0495686_0000023 Ga0495686_0000023_172290_173786 463
266 3300048091 Ga0495626_0002970 Ga0495626_0002970_7965_9434 463
267 3300048911 Ga0496108_0000350 Ga0496108_0000350_37525_38949 463
268 3300048919 Ga0496116_0000035 Ga0496116_0000035_127230_128699 463
269 3300048924 Ga0496121_0016282 Ga0496121_0016282_3341_4810 463
270 3300048925 Ga0496122_0005224 Ga0496122_0005224_11013_12482 463
271 3300048926 Ga0496123_0001169 Ga0496123_0001169_22458_23927 463
272 3300048927 Ga0496124_0003117 Ga0496124_0003117_3085_4554 463
273 3300048928 Ga0496125_0065638 Ga0496125_0065638_1200_2669 463
274 3300048929 Ga0496126_0000084 Ga0496126_0000084_105358_106827 463
275 3300049578 Ga0501042_0095488 Ga0501042_0095488_716_2119 463
276 3300049744 Ga0501083_0125799 Ga0501083_0125799_17_1423 463
277 3300050507 nmdc:mga05p37_43150_c1 nmdc:mga05p37_43150_c1_225_1748 463
278 3300050510 nmdc:mga06r32_244015_c1 nmdc:mga06r32_244015_c1_345_1769 463
279 3300053119 Ga0500595_013747 Ga0500595_013747_755_2230 463
280 3300053134 Ga0500658_0004109 Ga0500658_0004109_4052_5452 463
281 3300005355 Ga0070671_100135678 Ga0070671_1001356781 464
282 3300005843 Ga0068860_100117599 Ga0068860_1001175992 464
283 3300026088 Ga0207641_10062714 Ga0207641_100627142 464
284 3300037312 Ga0395899_0000070 Ga0395899_0000070_106491_107954 464
285 3300048914 Ga0496111_0017527 Ga0496111_0017527_35_1429 464
286 3300049570 Ga0501033_0014098 Ga0501033_0014098_1678_3090 464
287 3300049573 Ga0501037_0031015 Ga0501037_0031015_969_2429 464
288 3300049576 Ga0501040_0008574 Ga0501040_0008574_4155_5636 464
289 3300049581 Ga0501047_0012519 Ga0501047_0012519_867_2279 464
290 3300049581 Ga0501047_0188677 Ga0501047_0188677_20_1438 464
291 3300049584 Ga0501068_0018246 Ga0501068_0018246_1648_3129 464
292 3300049588 Ga0501072_0017400 Ga0501072_0017400_2562_4043 464
293 3300049590 Ga0501074_0005267 Ga0501074_0005267_6062_7543 464
294 3300049591 Ga0501075_0011120 Ga0501075_0011120_4336_5817 464
295 3300049592 Ga0501076_0037091 Ga0501076_0037091_2291_3772 464
296 3300049741 Ga0501079_0017789 Ga0501079_0017789_1435_2916 464
297 3300049743 Ga0501081_0001100 Ga0501081_0001100_8263_9744 464
298 3300049822 Ga0501035_0170228 Ga0501035_0170228_107_1519 464
299 3300049823 Ga0501044_0013456 Ga0501044_0013456_6969_8381 464
300 3300050494 nmdc:mga06z11_57364_c1 nmdc:mga06z11_57364_c1_523_1944 464
301 3300050496 nmdc:mga07m45_33075_c1 nmdc:mga07m45_33075_c1_1438_2859 464
302 3300053096 Ga0500641_0002274 Ga0500641_0002274_1748_3214 464
303 3300054114 Ga0501084_0002307 Ga0501084_0002307_11496_12977 464
304 3300005347 Ga0070668_100019099 Ga0070668_1000190994 465
305 3300005548 Ga0070665_100033391 Ga0070665_1000333914 465
306 3300005844 Ga0068862_100229498 Ga0068862_1002294981 465
307 3300009093 Ga0105240_10002106 Ga0105240_1000210629 465
308 3300021384 Ga0213876_10000683 Ga0213876_1000068318 465
309 3300025910 Ga0207684_10041021 Ga0207684_100410213 465
310 3300025913 Ga0207695_10002784 Ga0207695_1000278424 465
311 3300025920 Ga0207649_10000085 Ga0207649_1000008548 465
312 3300025925 Ga0207650_10017278 Ga0207650_100172782 465
313 3300025945 Ga0207679_10016161 Ga0207679_100161612 465
314 3300025972 Ga0207668_10000046 Ga0207668_1000004697 465
315 3300025986 Ga0207658_10019792 Ga0207658_100197922 465
316 3300026035 Ga0207703_10161525 Ga0207703_101615251 465
317 3300026088 Ga0207641_10028994 Ga0207641_100289944 465
318 3300026095 Ga0207676_10093330 Ga0207676_100933302 465
319 3300028379 Ga0268266_10001771 Ga0268266_1000177121 465
320 3300028380 Ga0268265_10060525 Ga0268265_100605251 465
321 3300031616 Ga0307508_10027860 Ga0307508_100278605 465
322 3300037853 Ga0436364_1053921 Ga0436364_1053921_2846_4303 465
323 3300037853 Ga0436364_1159605 Ga0436364_1159605_22540_23997 465
324 3300039437 Ga0436365_0897023 Ga0436365_0897023_23859_25316 465
325 3300039437 Ga0436365_1432258 Ga0436365_1432258_21923_23380 465
326 3300047472 Ga0495686_0009480 Ga0495686_0009480_5326_6726 465
327 3300048903 Ga0496100_0007042 Ga0496100_0007042_4046_5464 465
328 3300048918 Ga0496115_0194627 Ga0496115_0194627_173_1633 465
329 3300048922 Ga0496119_0006901 Ga0496119_0006901_8944_10344 465
330 3300053108 Ga0500562_000674 Ga0500562_000674_3480_4943 465
331 3300005329 Ga0070683_100281893 Ga0070683_1002818931 466
332 3300009177 Ga0105248_10000594 Ga0105248_100005944 466
333 3300025295 Ga0209564_1001578 Ga0209564_100157811 466
334 3300025913 Ga0207695_10000549 Ga0207695_1000054918 466
335 3300025941 Ga0207711_10001901 Ga0207711_100019018 466
336 3300035171 Ga0373946_0019587 Ga0373946_0019587_541_2088 466
337 3300037068 Ga0373925_0000022 Ga0373925_0000022_54913_56460 466
338 3300037312 Ga0395899_0000061 Ga0395899_0000061_125302_126780 466
339 3300037418 Ga0395900_0076204 Ga0395900_0076204_1264_2742 466
340 3300049571 Ga0501034_0000222 Ga0501034_0000222_16274_17776 466
341 3300049571 Ga0501034_0015038 Ga0501034_0015038_4712_6169 466
342 3300049572 Ga0501036_0024506 Ga0501036_0024506_15_1472 466
343 3300049579 Ga0501043_0021542 Ga0501043_0021542_1056_2513 466
344 3300049580 Ga0501046_0034921 Ga0501046_0034921_103_1560 466
345 3300049581 Ga0501047_0008516 Ga0501047_0008516_4457_5914 466
346 3300049584 Ga0501068_0042123 Ga0501068_0042123_1073_2530 466
347 3300049586 Ga0501070_0013398 Ga0501070_0013398_4403_5860 466
348 3300049590 Ga0501074_0036952 Ga0501074_0036952_787_2244 466
349 3300049742 Ga0501080_0023378 Ga0501080_0023378_3417_4874 466
350 3300053131 Ga0500652_000793 Ga0500652_000793_4125_5591 466
351 3300001989 JGI24739J22299_10003492 JGI24739J22299_100034922 467
352 3300003215 JGI25153J46596_10001872 JGI25153J46596_100018722 467
353 3300003215 JGI25153J46596_10002613 JGI25153J46596_100026133 467
354 3300003215 JGI25153J46596_10002759 JGI25153J46596_100027596 467
355 3300003794 Ga0055531_10003612 Ga0055531_1000361211 467
356 3300021361 Ga0213872_10007941 Ga0213872_100079414 467
357 3300021384 Ga0213876_10014028 Ga0213876_100140285 467
358 3300025292 Ga0209676_1000026 Ga0209676_1000026106 467
359 3300025297 Ga0209758_1000140 Ga0209758_100014059 467
360 3300025297 Ga0209758_1000321 Ga0209758_100032166 467
361 3300025302 Ga0207426_1000278 Ga0207426_100027867 467
362 3300025304 Ga0209257_1000522 Ga0209257_100052238 467
363 3300025913 Ga0207695_10013530 Ga0207695_100135304 467
364 3300031733 Ga0316577_10010466 Ga0316577_100104662 467
365 3300035725 Ga0373947_0050105 Ga0373947_0050105_38_1480 467
366 3300039062 Ga0400483_003978 Ga0400483_003978_9977_11434 467
367 3300039447 Ga0436361_0304900 Ga0436361_0304900_3500_4963 467
368 3300044712 Ga0453684_0025669 Ga0453684_0025669_2892_4361 467
369 3300046491 Ga0495584_0080194 Ga0495584_0080194_107_1570 467
370 3300046557 Ga0495622_0017473 Ga0495622_0017473_1028_2521 467
371 3300046616 Ga0495668_0025192 Ga0495668_0025192_122_1585 467
372 3300050512 nmdc:mga0n895_6856_c1 nmdc:mga0n895_6856_c1_8188_9672 467
373 3300050516 nmdc:mga0sz30_4510_c1 nmdc:mga0sz30_4510_c1_1330_2820 467
374 3300005331 Ga0070670_100000039 Ga0070670_100000039140 468
375 3300005331 Ga0070670_100070437 Ga0070670_1000704371 468
376 3300005339 Ga0070660_100000177 Ga0070660_10000017730 468
377 3300005347 Ga0070668_100000155 Ga0070668_1000001553 468
378 3300005353 Ga0070669_100028620 Ga0070669_1000286203 468
379 3300005354 Ga0070675_100058613 Ga0070675_1000586133 468
380 3300005434 Ga0070709_10032902 Ga0070709_100329022 468
381 3300005435 Ga0070714_100014177 Ga0070714_1000141774 468
382 3300005436 Ga0070713_100014233 Ga0070713_1000142334 468
383 3300005437 Ga0070710_10004631 Ga0070710_100046314 468
384 3300005439 Ga0070711_100002712 Ga0070711_1000027123 468
385 3300005543 Ga0070672_100020245 Ga0070672_1000202455 468
386 3300005617 Ga0068859_100051424 Ga0068859_1000514243 468
387 3300005618 Ga0068864_100000068 Ga0068864_10000006882 468
388 3300005841 Ga0068863_100000758 Ga0068863_10000075812 468
389 3300005842 Ga0068858_100001956 Ga0068858_10000195610 468
390 3300005844 Ga0068862_100005821 Ga0068862_1000058219 468
391 3300005985 Ga0081539_10048123 Ga0081539_100481233 468
392 3300006028 Ga0070717_10028144 Ga0070717_100281443 468
393 3300006163 Ga0070715_10005582 Ga0070715_100055822 468
394 3300006173 Ga0070716_100017583 Ga0070716_1000175831 468
395 3300006175 Ga0070712_100017266 Ga0070712_1000172664 468
396 3300006931 Ga0097620_100051427 Ga0097620_1000514272 468
397 3300009551 Ga0105238_10033409 Ga0105238_100334093 468
398 3300025915 Ga0207693_10015726 Ga0207693_100157262 468
399 3300025916 Ga0207663_10000347 Ga0207663_100003476 468
400 3300025919 Ga0207657_10000082 Ga0207657_1000008213 468
401 3300025923 Ga0207681_10087133 Ga0207681_100871332 468
402 3300025924 Ga0207694_10067952 Ga0207694_100679522 468
403 3300025925 Ga0207650_10000161 Ga0207650_1000016170 468
404 3300025925 Ga0207650_10040605 Ga0207650_100406053 468
405 3300025929 Ga0207664_10029848 Ga0207664_100298482 468
406 3300025940 Ga0207691_10036328 Ga0207691_100363284 468
407 3300025941 Ga0207711_10028549 Ga0207711_100285492 468
408 3300025972 Ga0207668_10000323 Ga0207668_1000032331 468
409 3300026035 Ga0207703_10000968 Ga0207703_1000096824 468
410 3300026088 Ga0207641_10001619 Ga0207641_100016193 468
411 3300026095 Ga0207676_10000685 Ga0207676_1000068526 468
412 3300028380 Ga0268265_10003095 Ga0268265_100030953 468
413 3300031250 Ga0265331_10005449 Ga0265331_100054493 468
414 3300038443 Ga0395901_0137839 Ga0395901_0137839_161_1657 468
415 3300039437 Ga0436365_1365308 Ga0436365_1365308_2249_3700 468
416 3300047320 Ga0495672_0010812 Ga0495672_0010812_4574_6040 468
417 3300049571 Ga0501034_0037486 Ga0501034_0037486_2865_4367 468
418 3300049572 Ga0501036_0045474 Ga0501036_0045474_1911_3425 468
419 3300049575 Ga0501039_0052537 Ga0501039_0052537_211_1725 468
420 3300049587 Ga0501071_0095864 Ga0501071_0095864_339_1853 468
421 3300049591 Ga0501075_0098633 Ga0501075_0098633_295_1809 468
422 3300054114 Ga0501084_0020947 Ga0501084_0020947_1885_3399 468
423 3300060353 Ga0501082_0041986 Ga0501082_0041986_896_2410 468
424 3300006914 Ga0075436_100004211 Ga0075436_1000042117 469
425 3300031901 Ga0307406_10075087 Ga0307406_100750872 469
426 3300031995 Ga0307409_100093824 Ga0307409_1000938243 469
427 3300037418 Ga0395900_0211878 Ga0395900_0211878_28_1539 469
428 3300037466 Ga0395898_0061522 Ga0395898_0061522_2019_3530 469
429 3300046533 Ga0495640_0024712 Ga0495640_0024712_1509_3017 469
430 3300050514 nmdc:mga08x19_4_c2 nmdc:mga08x19_4_c2_153386_154873 469
431 3300053146 Ga0500588_0000924 Ga0500588_0000924_3585_5042 469
432 3300005327 Ga0070658_10202107 Ga0070658_102021071 470
433 3300005458 Ga0070681_10031170 Ga0070681_100311703 470
434 3300005547 Ga0070693_100003111 Ga0070693_1000031112 470
435 3300005564 Ga0070664_100085143 Ga0070664_1000851432 470
436 3300005577 Ga0068857_100154462 Ga0068857_1001544621 470
437 3300005614 Ga0068856_100112510 Ga0068856_1001125102 470
438 3300005937 Ga0081455_10004379 Ga0081455_1000437919 470
439 3300013100 Ga0157373_10002971 Ga0157373_1000297111 470
440 3300025230 Ga0209563_104139 Ga0209563_1041392 470
441 3300025912 Ga0207707_10017795 Ga0207707_100177953 470
442 3300025921 Ga0207652_10150496 Ga0207652_101504962 470
443 3300025945 Ga0207679_10062746 Ga0207679_100627462 470
444 3300026078 Ga0207702_10003186 Ga0207702_1000318611 470
445 3300026116 Ga0207674_10106406 Ga0207674_101064062 470
446 3300031239 Ga0265328_10006063 Ga0265328_100060637 470
447 3300031250 Ga0265331_10000007 Ga0265331_1000000742 470
448 3300033180 Ga0307510_10054892 Ga0307510_100548923 470
449 3300045976 Ga0466967_0224474 Ga0466967_0224474_13_1485 470
450 3300046684 Ga0495669_0000470 Ga0495669_0000470_14278_15741 470
451 3300048915 Ga0496112_0157449 Ga0496112_0157449_515_1987 470
452 3300049573 Ga0501037_0000285 Ga0501037_0000285_25046_26641 470
453 3300049579 Ga0501043_0000039 Ga0501043_0000039_455_2050 470
454 3300049583 Ga0501067_0020041 Ga0501067_0020041_1607_3259 470
455 3300049584 Ga0501068_0042479 Ga0501068_0042479_396_1991 470
456 3300049585 Ga0501069_0000022 Ga0501069_0000022_117106_118701 470
457 3300049587 Ga0501071_0003791 Ga0501071_0003791_7549_9144 470
458 3300049589 Ga0501073_0110452 Ga0501073_0110452_43_1638 470
459 3300049590 Ga0501074_0000240 Ga0501074_0000240_498_2093 470
460 3300049742 Ga0501080_0001796 Ga0501080_0001796_16430_18025 470
461 3300049744 Ga0501083_0004197 Ga0501083_0004197_174_1769 470
462 3300049822 Ga0501035_0000795 Ga0501035_0000795_31497_33092 470
463 3300049823 Ga0501044_0000147 Ga0501044_0000147_455_2050 470
464 3300053103 Ga0500555_004900 Ga0500555_004900_320_1786 470
465 3300053150 Ga0500603_000163 Ga0500603_000163_2149_3657 470
466 3300053178 Ga0500637_0000178 Ga0500637_0000178_7608_9116 470
467 3300060353 Ga0501082_0016995 Ga0501082_0016995_4624_6219 470
468 3300005295 Ga0065707_10015980 Ga0065707_100159801 471
469 3300005366 Ga0070659_100044589 Ga0070659_1000445893 471
470 3300005616 Ga0068852_100000736 Ga0068852_10000073621 471
471 3300006844 Ga0075428_100168452 Ga0075428_1001684522 471
472 3300006847 Ga0075431_100054395 Ga0075431_1000543953 471
473 3300009551 Ga0105238_10006370 Ga0105238_1000637010 471
474 3300013104 Ga0157370_10030524 Ga0157370_100305243 471
475 3300013105 Ga0157369_10000691 Ga0157369_1000069135 471
476 3300025909 Ga0207705_10024429 Ga0207705_100244293 471
477 3300025919 Ga0207657_10028899 Ga0207657_100288991 471
478 3300025924 Ga0207694_10059629 Ga0207694_100596292 471
479 3300025940 Ga0207691_10088768 Ga0207691_100887682 471
480 3300025949 Ga0207667_10051356 Ga0207667_100513562 471
481 3300031251 Ga0265327_10000988 Ga0265327_1000098826 471
482 3300031852 Ga0307410_10069516 Ga0307410_100695162 471
483 3300031995 Ga0307409_100216505 Ga0307409_1002165052 471
484 3300039447 Ga0436361_0568771 Ga0436361_0568771_33920_35383 471
485 3300049571 Ga0501034_0127438 Ga0501034_0127438_157_1650 471
486 3300049593 Ga0501077_0010233 Ga0501077_0010233_1024_2496 471
487 3300050508 nmdc:mga09592_34060_c1 nmdc:mga09592_34060_c1_20_1468 471
488 3300050509 nmdc:mga0qj67_58097_c1 nmdc:mga0qj67_58097_c1_702_2186 471
489 3300050510 nmdc:mga06r32_43901_c1 nmdc:mga06r32_43901_c1_2069_3553 471
490 3300005327 Ga0070658_10016441 Ga0070658_100164413 472
491 3300005356 Ga0070674_100004120 Ga0070674_1000041203 472
492 3300005548 Ga0070665_100150793 Ga0070665_1001507932 472
493 3300005563 Ga0068855_100007701 Ga0068855_1000077019 472
494 3300009093 Ga0105240_10092735 Ga0105240_100927351 472
495 3300013104 Ga0157370_10051519 Ga0157370_100515193 472
496 3300013104 Ga0157370_10099912 Ga0157370_100999122 472
497 3300025909 Ga0207705_10001216 Ga0207705_1000121621 472
498 3300025913 Ga0207695_10022536 Ga0207695_100225364 472
499 3300025919 Ga0207657_10000128 Ga0207657_1000012851 472
500 3300025949 Ga0207667_10011692 Ga0207667_100116924 472
501 3300025949 Ga0207667_10026375 Ga0207667_100263755 472
502 3300026078 Ga0207702_10015795 Ga0207702_100157954 472
503 3300028800 Ga0265338_10014174 Ga0265338_1001417410 472
504 3300030521 Ga0307511_10002855 Ga0307511_100028557 472
505 3300031238 Ga0265332_10037976 Ga0265332_100379762 472
506 3300031241 Ga0265325_10001298 Ga0265325_100012986 472
507 3300031242 Ga0265329_10028088 Ga0265329_100280882 472
508 3300031249 Ga0265339_10000187 Ga0265339_1000018741 472
509 3300031250 Ga0265331_10041807 Ga0265331_100418072 472
510 3300031595 Ga0265313_10005056 Ga0265313_100050567 472
511 3300031712 Ga0265342_10024479 Ga0265342_100244791 472
512 3300032004 Ga0307414_10166565 Ga0307414_101665651 472
513 3300032005 Ga0307411_10019818 Ga0307411_100198182 472
514 3300039447 Ga0436361_0308037 Ga0436361_0308037_926_2416 472
515 3300046689 Ga0495613_0007657 Ga0495613_0007657_3628_5091 472
516 3300048910 Ga0496107_0057035 Ga0496107_0057035_44_1537 472
517 3300048918 Ga0496115_0087853 Ga0496115_0087853_1060_2523 472
518 3300048924 Ga0496121_0002564 Ga0496121_0002564_13625_15118 472
519 3300048929 Ga0496126_0022855 Ga0496126_0022855_1427_2920 472
520 3300049569 Ga0501032_0007820 Ga0501032_0007820_3073_4584 472
521 3300049570 Ga0501033_0026562 Ga0501033_0026562_2370_3872 472
522 3300049571 Ga0501034_0000133 Ga0501034_0000133_25756_27267 472
523 3300049571 Ga0501034_0036555 Ga0501034_0036555_3279_4790 472
524 3300049573 Ga0501037_0000301 Ga0501037_0000301_5399_6910 472
525 3300049574 Ga0501038_0050915 Ga0501038_0050915_214_1725 472
526 3300049575 Ga0501039_0002242 Ga0501039_0002242_3206_4717 472
527 3300049580 Ga0501046_0003709 Ga0501046_0003709_12464_13975 472
528 3300049580 Ga0501046_0004358 Ga0501046_0004358_3841_5352 472
529 3300049581 Ga0501047_0000167 Ga0501047_0000167_77119_78630 472
530 3300049582 Ga0501048_0151527 Ga0501048_0151527_57_1568 472
531 3300049583 Ga0501067_0000459 Ga0501067_0000459_17717_19228 472
532 3300049586 Ga0501070_0010989 Ga0501070_0010989_975_2486 472
533 3300049586 Ga0501070_0112904 Ga0501070_0112904_121_1632 472
534 3300049742 Ga0501080_0000009 Ga0501080_0000009_18204_19715 472
535 3300049822 Ga0501035_0000010 Ga0501035_0000010_24387_25898 472
536 3300049823 Ga0501044_0000006 Ga0501044_0000006_187336_188847 472
537 3300049823 Ga0501044_0022854 Ga0501044_0022854_3080_4591 472
538 3300049823 Ga0501044_0097191 Ga0501044_0097191_192_1700 472
539 3300005335 Ga0070666_10003993 Ga0070666_1000399310 473
540 3300005981 Ga0081538_10044613 Ga0081538_100446133 473
541 3300009177 Ga0105248_10019949 Ga0105248_100199497 473
542 3300028800 Ga0265338_10012084 Ga0265338_100120848 473
543 3300031240 Ga0265320_10000341 Ga0265320_1000034139 473
544 3300031241 Ga0265325_10022202 Ga0265325_100222023 473
545 3300031249 Ga0265339_10042974 Ga0265339_100429742 473
546 3300031251 Ga0265327_10003263 Ga0265327_1000326310 473
547 3300031665 Ga0316575_10019482 Ga0316575_100194822 473
548 3300031711 Ga0265314_10026538 Ga0265314_100265385 473
549 3300031711 Ga0265314_10033399 Ga0265314_100333993 473
550 3300032004 Ga0307414_10067501 Ga0307414_100675013 473
551 3300036401 Ga0373937_0013107 Ga0373937_0013107_4234_5685 473
552 3300036647 Ga0316582_0025225 Ga0316582_0025225_1851_3308 473
553 3300049581 Ga0501047_0037153 Ga0501047_0037153_2996_4507 473
554 3300031250 Ga0265331_10001068 Ga0265331_100010682 474
555 3300031251 Ga0265327_10000430 Ga0265327_1000043029 474
556 3300031711 Ga0265314_10115725 Ga0265314_101157251 474
557 3300033180 Ga0307510_10160945 Ga0307510_101609451 474
558 3300039437 Ga0436365_0782166 Ga0436365_0782166_172_1635 474
559 3300047320 Ga0495672_0032081 Ga0495672_0032081_1630_3111 474
560 3300049591 Ga0501075_0059625 Ga0501075_0059625_488_1960 474
561 3300049592 Ga0501076_0162121 Ga0501076_0162121_334_1806 474
562 3300049593 Ga0501077_0079048 Ga0501077_0079048_455_1927 474
563 3300053136 Ga0500559_0000118 Ga0500559_0000118_10356_11819 474
564 3300053161 Ga0500634_0000008 Ga0500634_0000008_143956_145458 474
565 iso_pu_bacteria 2551306087 2551701775 474
566 3300005339 Ga0070660_100112280 Ga0070660_1001122802 475
567 3300006844 Ga0075428_100051815 Ga0075428_1000518152 475
568 3300006844 Ga0075428_100092910 Ga0075428_1000929102 475
569 3300006847 Ga0075431_100032281 Ga0075431_1000322811 475
570 3300009093 Ga0105240_10001788 Ga0105240_1000178820 475
571 3300009094 Ga0111539_10028816 Ga0111539_100288162 475
572 3300009545 Ga0105237_10036707 Ga0105237_100367073 475
573 3300025913 Ga0207695_10002257 Ga0207695_1000225711 475
574 3300025919 Ga0207657_10013622 Ga0207657_100136222 475
575 3300027907 Ga0207428_10027825 Ga0207428_100278252 475
576 3300028800 Ga0265338_10026942 Ga0265338_100269423 475
577 3300035086 Ga0373934_0004901 Ga0373934_0004901_1852_3336 475
578 3300037068 Ga0373925_0002686 Ga0373925_0002686_3812_5275 475
579 3300046475 Ga0495639_0000768 Ga0495639_0000768_3792_5255 475
580 3300046507 Ga0495606_0002862 Ga0495606_0002862_12049_13509 475
581 3300046526 Ga0495666_0000958 Ga0495666_0000958_6339_7802 475
582 3300046535 Ga0495586_0000262 Ga0495586_0000262_14555_16018 475
583 3300046689 Ga0495613_0085725 Ga0495613_0085725_353_1816 475
584 3300047321 Ga0495676_0001605 Ga0495676_0001605_6300_7763 475
585 3300049649 Ga0501198_000010 Ga0501198_000010_95445_96971 475
586 3300049662 Ga0501222_000009 Ga0501222_000009_21539_23065 475
587 3300049741 Ga0501079_0007621 Ga0501079_0007621_1992_3524 475
588 3300050511 nmdc:mga08y16_16970_c1 nmdc:mga08y16_16970_c1_910_2376 475
589 iso_pu_bacteria 8007371054 8007371799 475
590 3300005340 Ga0070689_100123879 Ga0070689_1001238792 476
591 3300006177 Ga0075362_10000083 Ga0075362_1000008318 476
592 3300006186 Ga0075369_10001615 Ga0075369_100016155 476
593 3300006195 Ga0075366_10002219 Ga0075366_100022199 476
594 3300006353 Ga0075370_10000017 Ga0075370_1000001752 476
595 3300006844 Ga0075428_100145689 Ga0075428_1001456892 476
596 3300026088 Ga0207641_10208902 Ga0207641_102089021 476
597 3300031852 Ga0307410_10006046 Ga0307410_100060466 476
598 3300031903 Ga0307407_10011566 Ga0307407_100115664 476
599 3300032002 Ga0307416_100141448 Ga0307416_1001414482 476
600 3300035691 Ga0373931_0010226 Ga0373931_0010226_2339_3799 476
601 3300044712 Ga0453684_0064827 Ga0453684_0064827_2196_3656 476
602 3300046492 Ga0495585_0010585 Ga0495585_0010585_341_1813 476
603 3300046539 Ga0495621_0000010 Ga0495621_0000010_14211_15683 476
604 3300046558 Ga0495633_0000991 Ga0495633_0000991_3712_5184 476
605 3300046684 Ga0495669_0022999 Ga0495669_0022999_306_1778 476
606 3300046691 Ga0495670_0003534 Ga0495670_0003534_2858_4330 476
607 3300047445 Ga0495677_0005374 Ga0495677_0005374_3353_4825 476
608 3300050489 nmdc:mga03683_13_c1 nmdc:mga03683_13_c1_19444_20904 476
609 3300050493 nmdc:mga0k408_39006_c1 nmdc:mga0k408_39006_c1_1254_2714 476
610 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_29788_31248 476
611 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_11678_13138 476
612 3300050516 nmdc:mga0sz30_1731_c2 nmdc:mga0sz30_1731_c2_27_1487 476
613 iso_pu_bacteria 2551306092 2551737327 476
614 3300005468 Ga0070707_100009552 Ga0070707_1000095522 477
615 3300005563 Ga0068855_100002239 Ga0068855_10000223917 477
616 3300005843 Ga0068860_100059828 Ga0068860_1000598281 477
617 3300013296 Ga0157374_10016812 Ga0157374_100168125 477
618 3300025922 Ga0207646_10022313 Ga0207646_100223134 477
619 3300025949 Ga0207667_10007689 Ga0207667_1000768910 477
620 3300026121 Ga0207683_10126761 Ga0207683_101267612 477
621 3300028379 Ga0268266_10055798 Ga0268266_100557982 477
622 3300032005 Ga0307411_10039431 Ga0307411_100394313 477
623 3300047471 Ga0495684_0052020 Ga0495684_0052020_1448_2956 477
624 iso_pu_bacteria 2551306089 2551709105 477
625 3300002773 JGI25152J39213_1003296 JGI25152J39213_10032963 478
626 3300003354 JGI25160J50197_1006040 JGI25160J50197_10060402 478
627 3300003762 Ga0055542_1000459 Ga0055542_100045945 478
628 3300003762 Ga0055542_1001485 Ga0055542_10014859 478
629 3300003775 Ga0055524_1010072 Ga0055524_10100723 478
630 3300003790 Ga0055528_1000146 Ga0055528_100014620 478
631 3300005327 Ga0070658_10000218 Ga0070658_1000021828 478
632 3300005466 Ga0070685_10057960 Ga0070685_100579602 478
633 3300005467 Ga0070706_100000386 Ga0070706_10000038647 478
634 3300005536 Ga0070697_100012214 Ga0070697_1000122142 478
635 3300005539 Ga0068853_100023778 Ga0068853_1000237784 478
636 3300005544 Ga0070686_100146429 Ga0070686_1001464291 478
637 3300005616 Ga0068852_100056230 Ga0068852_1000562303 478
638 3300006038 Ga0075365_10001442 Ga0075365_100014424 478
639 3300006178 Ga0075367_10022098 Ga0075367_100220983 478
640 3300009093 Ga0105240_10252354 Ga0105240_102523542 478
641 3300009147 Ga0114129_10013538 Ga0114129_100135388 478
642 3300009177 Ga0105248_10008945 Ga0105248_100089458 478
643 3300009545 Ga0105237_10058537 Ga0105237_100585374 478
644 3300009551 Ga0105238_10013401 Ga0105238_100134017 478
645 3300009553 Ga0105249_10048683 Ga0105249_100486834 478
646 3300010375 Ga0105239_10369584 Ga0105239_103695841 478
647 3300015261 Ga0182006_1019088 Ga0182006_10190883 478
648 3300025254 Ga0209148_1000123 Ga0209148_10001235 478
649 3300025261 Ga0209233_1009557 Ga0209233_10095572 478
650 3300025273 Ga0209673_1000015 Ga0209673_1000015325 478
651 3300025273 Ga0209673_1002894 Ga0209673_10028943 478
652 3300025294 Ga0209025_1006436 Ga0209025_10064366 478
653 3300025295 Ga0209564_1020814 Ga0209564_10208141 478
654 3300025299 Ga0209256_1006061 Ga0209256_10060615 478
655 3300025299 Ga0209256_1015168 Ga0209256_10151682 478
656 3300025302 Ga0207426_1001284 Ga0207426_100128412 478
657 3300025303 Ga0209051_1019005 Ga0209051_10190052 478
658 3300025909 Ga0207705_10001139 Ga0207705_1000113918 478
659 3300025910 Ga0207684_10000062 Ga0207684_1000006245 478
660 3300025913 Ga0207695_10178276 Ga0207695_101782762 478
661 3300025914 Ga0207671_10025590 Ga0207671_100255904 478
662 3300025922 Ga0207646_10004539 Ga0207646_1000453913 478
663 3300026067 Ga0207678_10112004 Ga0207678_101120042 478
664 3300044673 Ga0453683_0000379 Ga0453683_0000379_44511_45971 478
665 3300044712 Ga0453684_0099720 Ga0453684_0099720_1556_3019 478
666 3300048915 Ga0496112_0146298 Ga0496112_0146298_682_2184 478
667 3300048922 Ga0496119_0033395 Ga0496119_0033395_1871_3373 478
668 3300048923 Ga0496120_0014812 Ga0496120_0014812_187_1689 478
669 3300048929 Ga0496126_0059481 Ga0496126_0059481_64_1566 478
670 3300049569 Ga0501032_0062983 Ga0501032_0062983_327_1811 478
671 3300049744 Ga0501083_0068271 Ga0501083_0068271_530_2014 478
672 3300050492 nmdc:mga0yw44_3798_c1 nmdc:mga0yw44_3798_c1_110_1612 478
673 3300050492 nmdc:mga0yw44_6417_c1 nmdc:mga0yw44_6417_c1_4158_5660 478
674 3300050507 nmdc:mga05p37_34442_c1 nmdc:mga05p37_34442_c1_3500_5023 478
675 3300053139 Ga0500568_0000608 Ga0500568_0000608_2283_3785 478
676 3300001990 JGI24737J22298_10000015 JGI24737J22298_1000001514 479
677 3300003214 JGI25165J46597_1000219 JGI25165J46597_100021913 479
678 3300005334 Ga0068869_100080292 Ga0068869_1000802921 479
679 3300005445 Ga0070708_100004356 Ga0070708_1000043562 479
680 3300006852 Ga0075433_10069982 Ga0075433_100699822 479
681 3300006871 Ga0075434_100102768 Ga0075434_1001027682 479
682 3300025261 Ga0209233_1000258 Ga0209233_100025813 479
683 3300025919 Ga0207657_10016244 Ga0207657_100162446 479
684 3300031507 Ga0307509_10001121 Ga0307509_1000112132 479
685 3300031616 Ga0307508_10031277 Ga0307508_100312772 479
686 3300031665 Ga0316575_10053381 Ga0316575_100533812 479
687 3300031691 Ga0316579_10000296 Ga0316579_100002968 479
688 3300031727 Ga0316576_10006360 Ga0316576_100063602 479
689 3300031727 Ga0316576_10061119 Ga0316576_100611193 479
690 3300031727 Ga0316576_10090862 Ga0316576_100908621 479
691 3300033179 Ga0307507_10119157 Ga0307507_101191572 479
692 3300035113 Ga0373936_0000006 Ga0373936_0000006_16825_18285 479
693 3300037418 Ga0395900_0024127 Ga0395900_0024127_1199_2701 479
694 3300037418 Ga0395900_0063179 Ga0395900_0063179_751_2406 479
695 3300037471 Ga0395905_0091442 Ga0395905_0091442_1106_2608 479
696 3300038443 Ga0395901_0093729 Ga0395901_0093729_1186_2649 479
697 3300044658 Ga0466972_0018223 Ga0466972_0018223_179_1681 479
698 3300046522 Ga0495643_0054154 Ga0495643_0054154_367_1869 479
699 3300046616 Ga0495668_0101301 Ga0495668_0101301_28_1506 479
700 3300048909 Ga0496106_0000587 Ga0496106_0000587_13772_15268 479
701 3300048911 Ga0496108_0000517 Ga0496108_0000517_14562_16058 479
702 3300048912 Ga0496109_0000814 Ga0496109_0000814_4073_5569 479
703 3300048913 Ga0496110_0171198 Ga0496110_0171198_208_1704 479
704 3300049568 Ga0501031_0000014 Ga0501031_0000014_31993_33501 479
705 3300049568 Ga0501031_0017609 Ga0501031_0017609_34_1536 479
706 3300049569 Ga0501032_0000015 Ga0501032_0000015_31993_33501 479
707 3300049570 Ga0501033_0000023 Ga0501033_0000023_31993_33501 479
708 3300049571 Ga0501034_0000073 Ga0501034_0000073_143237_144745 479
709 3300049571 Ga0501034_0005123 Ga0501034_0005123_4531_6018 479
710 3300049572 Ga0501036_0000002 Ga0501036_0000002_31993_33501 479
711 3300049572 Ga0501036_0058084 Ga0501036_0058084_728_2230 479
712 3300049573 Ga0501037_0000158 Ga0501037_0000158_29931_31439 479
713 3300049573 Ga0501037_0035292 Ga0501037_0035292_837_2339 479
714 3300049574 Ga0501038_0000002 Ga0501038_0000002_232968_234476 479
715 3300049574 Ga0501038_0110210 Ga0501038_0110210_306_1793 479
716 3300049575 Ga0501039_0000002 Ga0501039_0000002_114037_115545 479
717 3300049575 Ga0501039_0182841 Ga0501039_0182841_89_1591 479
718 3300049579 Ga0501043_0096341 Ga0501043_0096341_728_2230 479
719 3300049580 Ga0501046_0034748 Ga0501046_0034748_1299_2807 479
720 3300049586 Ga0501070_0000487 Ga0501070_0000487_5273_6775 479
721 3300049586 Ga0501070_0049559 Ga0501070_0049559_1505_2968 479
722 3300049586 Ga0501070_0093784 Ga0501070_0093784_360_1862 479
723 3300049586 Ga0501070_0146288 Ga0501070_0146288_454_1917 479
724 3300049589 Ga0501073_0068165 Ga0501073_0068165_474_1976 479
725 3300049822 Ga0501035_0000022 Ga0501035_0000022_152360_153868 479
726 3300049823 Ga0501044_0000002 Ga0501044_0000002_259608_261116 479
727 3300053134 Ga0500658_0000106 Ga0500658_0000106_23856_25334 479
728 3300053155 Ga0500620_000504 Ga0500620_000504_5309_6811 479
729 3300053159 Ga0500630_034264 Ga0500630_034264_374_1834 479
730 iso_pu_bacteria 2551306090 2551722431 479
731 iso_pu_bacteria 2895498888 2895504125 479
732 iso_pu_bacteria 2895511927 2895515479 479
733 iso_pu_bacteria 2895522137 2895525010 479
734 iso_pu_bacteria 2895525241 2895527719 479
735 iso_pu_bacteria 2928972540 2928975535 479
736 iso_pu_bacteria 2941485952 2941487185 479
737 iso_pu_bacteria 2977240413 2977241566 479
738 3300005539 Ga0068853_100024090 Ga0068853_1000240904 480
739 3300005563 Ga0068855_100032128 Ga0068855_1000321287 480
740 3300005578 Ga0068854_100001371 Ga0068854_10000137113 480
741 3300005616 Ga0068852_100002830 Ga0068852_1000028302 480
742 3300006175 Ga0070712_100067873 Ga0070712_1000678732 480
743 3300009093 Ga0105240_10000784 Ga0105240_1000078428 480
744 3300009093 Ga0105240_10004918 Ga0105240_1000491816 480
745 3300025321 Ga0207656_10006505 Ga0207656_100065052 480
746 3300025913 Ga0207695_10012074 Ga0207695_100120745 480
747 3300025913 Ga0207695_10059631 Ga0207695_100596313 480
748 3300025924 Ga0207694_10037068 Ga0207694_100370683 480
749 3300025949 Ga0207667_10025417 Ga0207667_100254177 480
750 3300025981 Ga0207640_10011810 Ga0207640_100118104 480
751 3300026041 Ga0207639_10025979 Ga0207639_100259794 480
752 3300026142 Ga0207698_10004273 Ga0207698_100042734 480
753 3300028653 Ga0265323_10000205 Ga0265323_1000020512 480
754 3300031344 Ga0265316_10002266 Ga0265316_1000226612 480
755 3300031712 Ga0265342_10081696 Ga0265342_100816961 480
756 3300038443 Ga0395901_0168317 Ga0395901_0168317_466_1914 480
757 3300042876 Ga0451577_0000353 Ga0451577_0000353_62348_63814 480
758 3300042876 Ga0451577_0038865 Ga0451577_0038865_535_2004 480
759 3300042876 Ga0451577_0139319 Ga0451577_0139319_664_2133 480
760 3300044712 Ga0453684_0001092 Ga0453684_0001092_21808_23274 480
761 3300044712 Ga0453684_0002325 Ga0453684_0002325_6041_7510 480
762 3300044712 Ga0453684_0008138 Ga0453684_0008138_8820_10352 480
763 3300045051 Ga0451576_0005815 Ga0451576_0005815_4588_6057 480
764 3300049573 Ga0501037_0023708 Ga0501037_0023708_2180_3649 480
765 3300049822 Ga0501035_0101753 Ga0501035_0101753_726_2195 480
766 3300053117 Ga0500593_010530 Ga0500593_010530_1094_2581 480
767 iso_pu_bacteria 2643221574 2643884829 480
768 iso_pu_bacteria 2643221663 2644354302 480
769 iso_pu_bacteria 2643221699 2644547406 480
770 iso_pu_bacteria 2643221699 2644549700 480
771 3300005331 Ga0070670_100161670 Ga0070670_1001616702 481
772 3300005543 Ga0070672_100021535 Ga0070672_1000215352 481
773 3300006051 Ga0075364_10000145 Ga0075364_1000014512 481
774 3300006914 Ga0075436_100014198 Ga0075436_1000141983 481
775 3300007076 Ga0075435_100171080 Ga0075435_1001710802 481
776 3300009093 Ga0105240_10080850 Ga0105240_100808502 481
777 3300009094 Ga0111539_10010548 Ga0111539_100105484 481
778 3300009094 Ga0111539_10066201 Ga0111539_100662012 481
779 3300009545 Ga0105237_10112260 Ga0105237_101122602 481
780 3300025934 Ga0207686_10052905 Ga0207686_100529052 481
781 3300027682 Ga0209971_1011596 Ga0209971_10115962 481
782 3300027907 Ga0207428_10058874 Ga0207428_100588742 481
783 3300031456 Ga0307513_10008076 Ga0307513_1000807611 481
784 3300037853 Ga0436364_1018828 Ga0436364_1018828_21801_23312 481
785 3300042876 Ga0451577_0000293 Ga0451577_0000293_10115_11587 481
786 3300042876 Ga0451577_0001566 Ga0451577_0001566_15905_17380 481
787 3300042876 Ga0451577_0003065 Ga0451577_0003065_7513_8985 481
788 3300044673 Ga0453683_0000005 Ga0453683_0000005_490918_492390 481
789 3300044673 Ga0453683_0000251 Ga0453683_0000251_9338_10810 481
790 3300044673 Ga0453683_0021758 Ga0453683_0021758_1132_2604 481
791 3300044712 Ga0453684_0000467 Ga0453684_0000467_85834_87306 481
792 3300044712 Ga0453684_0000925 Ga0453684_0000925_85588_87060 481
793 3300044712 Ga0453684_0001278 Ga0453684_0001278_8250_9722 481
794 3300044712 Ga0453684_0062533 Ga0453684_0062533_3015_4586 481
795 3300045051 Ga0451576_0000341 Ga0451576_0000341_85588_87060 481
796 3300045051 Ga0451576_0070742 Ga0451576_0070742_640_2112 481
797 3300048911 Ga0496108_0130923 Ga0496108_0130923_309_1766 481
798 3300048912 Ga0496109_0044035 Ga0496109_0044035_1175_2632 481
799 3300048913 Ga0496110_0133254 Ga0496110_0133254_461_1918 481
800 3300048914 Ga0496111_0010172 Ga0496111_0010172_1013_2470 481
801 3300048916 Ga0496113_0089986 Ga0496113_0089986_709_2166 481
802 3300049570 Ga0501033_0008354 Ga0501033_0008354_6370_7842 481
803 3300049742 Ga0501080_0002232 Ga0501080_0002232_11764_13221 481
804 3300049744 Ga0501083_0014691 Ga0501083_0014691_857_2314 481
805 3300050507 nmdc:mga05p37_239377_c1 nmdc:mga05p37_239377_c1_144_1676 481
806 3300050511 nmdc:mga08y16_2846_c1 nmdc:mga08y16_2846_c1_16152_17696 481
807 3300050511 nmdc:mga08y16_64252_c1 nmdc:mga08y16_64252_c1_1625_3154 481
808 3300050515 nmdc:mga0a205_77693_c1 nmdc:mga0a205_77693_c1_477_2009 481
809 3300053103 Ga0500555_000206 Ga0500555_000206_7213_8712 481
810 3300060353 Ga0501082_0018225 Ga0501082_0018225_233_1690 481
811 iso_pu_bacteria 2551306093 2551742908 481
812 iso_pu_bacteria 2599185354 2600200355 481
813 iso_pu_bacteria 2643221563 2643833657 481
814 iso_pu_bacteria 2643221608 2644054584 481
815 iso_pu_bacteria 2738541275 2738709970 481
816 iso_pu_bacteria 2738541301 2738848395 481
817 iso_pu_bacteria 2738541304 2738864124 481
818 iso_pu_bacteria 2738543022 2739296642 481
819 iso_pu_bacteria 2738543033 2739358320 481
820 iso_pu_bacteria 2751185897 2753763833 481
821 iso_pu_bacteria 2818991438 2819552606 481
822 iso_pu_bacteria 2821443989 2821449580 481
823 iso_pu_bacteria 2852680915 2852681883 481
824 iso_pu_bacteria 2883291878 2883295240 481
825 iso_pu_bacteria 2885429604 2885431175 481
826 iso_pu_bacteria 2928100450 2928101669 481
827 iso_pu_bacteria 2928959182 2928959759 481
828 iso_pu_bacteria 2990265787 2990266369 481
829 iso_pu_bacteria 2993693658 2993695838 481
830 iso_pu_bacteria 3000865235 3000865805 481
831 iso_pu_bacteria 8054302542 8054302725 481
832 3300003203 JGI25406J46586_10001405 JGI25406J46586_100014057 482
833 3300005290 Ga0065712_10000298 Ga0065712_100002982 482
834 3300005290 Ga0065712_10001004 Ga0065712_100010045 482
835 3300005293 Ga0065715_10000438 Ga0065715_100004384 482
836 3300005328 Ga0070676_10016112 Ga0070676_100161122 482
837 3300005328 Ga0070676_10064135 Ga0070676_100641351 482
838 3300005330 Ga0070690_100002487 Ga0070690_1000024872 482
839 3300005331 Ga0070670_100030693 Ga0070670_1000306932 482
840 3300005334 Ga0068869_100003515 Ga0068869_1000035156 482
841 3300005334 Ga0068869_100055896 Ga0068869_1000558962 482
842 3300005337 Ga0070682_100015779 Ga0070682_1000157792 482
843 3300005340 Ga0070689_100155739 Ga0070689_1001557392 482
844 3300005345 Ga0070692_10011317 Ga0070692_100113172 482
845 3300005347 Ga0070668_100003153 Ga0070668_1000031536 482
846 3300005354 Ga0070675_100011932 Ga0070675_1000119324 482
847 3300005354 Ga0070675_100020107 Ga0070675_1000201074 482
848 3300005355 Ga0070671_100041923 Ga0070671_1000419232 482
849 3300005356 Ga0070674_100045642 Ga0070674_1000456422 482
850 3300005364 Ga0070673_100008254 Ga0070673_1000082544 482
851 3300005364 Ga0070673_100024021 Ga0070673_1000240213 482
852 3300005365 Ga0070688_100002287 Ga0070688_1000022872 482
853 3300005441 Ga0070700_100014792 Ga0070700_1000147923 482
854 3300005444 Ga0070694_100008760 Ga0070694_1000087604 482
855 3300005456 Ga0070678_100041836 Ga0070678_1000418362 482
856 3300005459 Ga0068867_100000722 Ga0068867_10000072216 482
857 3300005466 Ga0070685_10005780 Ga0070685_100057804 482
858 3300005543 Ga0070672_100111273 Ga0070672_1001112732 482
859 3300005547 Ga0070693_100091426 Ga0070693_1000914261 482
860 3300005548 Ga0070665_100015522 Ga0070665_1000155222 482
861 3300005563 Ga0068855_100115446 Ga0068855_1001154462 482
862 3300005617 Ga0068859_100009706 Ga0068859_1000097066 482
863 3300005617 Ga0068859_100058898 Ga0068859_1000588982 482
864 3300005617 Ga0068859_100082305 Ga0068859_1000823052 482
865 3300005618 Ga0068864_100009005 Ga0068864_1000090053 482
866 3300005719 Ga0068861_100023879 Ga0068861_1000238793 482
867 3300005841 Ga0068863_100200470 Ga0068863_1002004702 482
868 3300005842 Ga0068858_100003325 Ga0068858_1000033256 482
869 3300005843 Ga0068860_100021613 Ga0068860_1000216133 482
870 3300005843 Ga0068860_100208419 Ga0068860_1002084192 482
871 3300005844 Ga0068862_100006309 Ga0068862_1000063092 482
872 3300005985 Ga0081539_10000056 Ga0081539_1000005651 482
873 3300006844 Ga0075428_100059596 Ga0075428_1000595963 482
874 3300006844 Ga0075428_100167925 Ga0075428_1001679251 482
875 3300006846 Ga0075430_100054046 Ga0075430_1000540463 482
876 3300006847 Ga0075431_100021660 Ga0075431_1000216602 482
877 3300006847 Ga0075431_100055281 Ga0075431_1000552814 482
878 3300006852 Ga0075433_10046531 Ga0075433_100465313 482
879 3300006881 Ga0068865_100021957 Ga0068865_1000219571 482
880 3300006881 Ga0068865_100055256 Ga0068865_1000552562 482
881 3300006931 Ga0097620_100009705 Ga0097620_1000097056 482
882 3300006931 Ga0097620_100058896 Ga0097620_1000588962 482
883 3300006931 Ga0097620_100082302 Ga0097620_1000823022 482
884 3300007076 Ga0075435_100122990 Ga0075435_1001229902 482
885 3300009093 Ga0105240_10039019 Ga0105240_100390195 482
886 3300009094 Ga0111539_10006734 Ga0111539_1000673410 482
887 3300009094 Ga0111539_10007181 Ga0111539_100071818 482
888 3300009098 Ga0105245_10054340 Ga0105245_100543403 482
889 3300009147 Ga0114129_10022217 Ga0114129_100222178 482
890 3300009174 Ga0105241_10014442 Ga0105241_100144425 482
891 3300009176 Ga0105242_10000862 Ga0105242_100008625 482
892 3300009177 Ga0105248_10016403 Ga0105248_100164032 482
893 3300009177 Ga0105248_10094454 Ga0105248_100944543 482
894 3300009177 Ga0105248_10226850 Ga0105248_102268501 482
895 3300009551 Ga0105238_10001167 Ga0105238_1000116720 482
896 3300009553 Ga0105249_10069797 Ga0105249_100697972 482
897 3300009553 Ga0105249_10163639 Ga0105249_101636392 482
898 3300013104 Ga0157370_10018302 Ga0157370_100183025 482
899 3300013105 Ga0157369_10000027 Ga0157369_10000027123 482
900 3300013306 Ga0163162_10259034 Ga0163162_102590341 482
901 3300013308 Ga0157375_10000511 Ga0157375_1000051110 482
902 3300013308 Ga0157375_10015839 Ga0157375_100158397 482
903 3300013308 Ga0157375_10027203 Ga0157375_100272033 482
904 3300014325 Ga0163163_10002488 Ga0163163_100024889 482
905 3300014325 Ga0163163_10013430 Ga0163163_100134302 482
906 3300014325 Ga0163163_10194343 Ga0163163_101943431 482
907 3300014968 Ga0157379_10003701 Ga0157379_100037016 482
908 3300014968 Ga0157379_10238544 Ga0157379_102385441 482
909 3300014969 Ga0157376_10004146 Ga0157376_100041462 482
910 3300021388 Ga0213875_10008717 Ga0213875_100087176 482
911 3300025907 Ga0207645_10007509 Ga0207645_100075094 482
912 3300025908 Ga0207643_10056538 Ga0207643_100565383 482
913 3300025914 Ga0207671_10000870 Ga0207671_1000087024 482
914 3300025923 Ga0207681_10003530 Ga0207681_100035306 482
915 3300025923 Ga0207681_10014232 Ga0207681_100142324 482
916 3300025924 Ga0207694_10000733 Ga0207694_1000073322 482
917 3300025925 Ga0207650_10019579 Ga0207650_100195792 482
918 3300025926 Ga0207659_10002905 Ga0207659_100029054 482
919 3300025926 Ga0207659_10011142 Ga0207659_100111425 482
920 3300025926 Ga0207659_10095221 Ga0207659_100952212 482
921 3300025931 Ga0207644_10045675 Ga0207644_100456751 482
922 3300025933 Ga0207706_10092135 Ga0207706_100921352 482
923 3300025934 Ga0207686_10001863 Ga0207686_100018638 482
924 3300025934 Ga0207686_10036101 Ga0207686_100361012 482
925 3300025937 Ga0207669_10045837 Ga0207669_100458372 482
926 3300025938 Ga0207704_10029178 Ga0207704_100291782 482
927 3300025940 Ga0207691_10077578 Ga0207691_100775783 482
928 3300025940 Ga0207691_10159656 Ga0207691_101596562 482
929 3300025941 Ga0207711_10039636 Ga0207711_100396363 482
930 3300025941 Ga0207711_10042870 Ga0207711_100428703 482
931 3300025942 Ga0207689_10001353 Ga0207689_100013532 482
932 3300025942 Ga0207689_10095643 Ga0207689_100956432 482
933 3300025949 Ga0207667_10157185 Ga0207667_101571852 482
934 3300025960 Ga0207651_10006047 Ga0207651_100060472 482
935 3300025961 Ga0207712_10027757 Ga0207712_100277573 482
936 3300025961 Ga0207712_10057955 Ga0207712_100579552 482
937 3300025972 Ga0207668_10001916 Ga0207668_100019167 482
938 3300025981 Ga0207640_10084005 Ga0207640_100840051 482
939 3300026035 Ga0207703_10002031 Ga0207703_100020317 482
940 3300026075 Ga0207708_10023066 Ga0207708_100230662 482
941 3300026088 Ga0207641_10173737 Ga0207641_101737372 482
942 3300026088 Ga0207641_10183534 Ga0207641_101835341 482
943 3300026089 Ga0207648_10000683 Ga0207648_1000068321 482
944 3300026089 Ga0207648_10035170 Ga0207648_100351702 482
945 3300026095 Ga0207676_10107992 Ga0207676_101079923 482
946 3300026118 Ga0207675_100158128 Ga0207675_1001581283 482
947 3300026121 Ga0207683_10071412 Ga0207683_100714123 482
948 3300026142 Ga0207698_10125852 Ga0207698_101258521 482
949 3300027907 Ga0207428_10072998 Ga0207428_100729983 482
950 3300028379 Ga0268266_10014889 Ga0268266_100148894 482
951 3300028380 Ga0268265_10008799 Ga0268265_1000879911 482
952 3300028380 Ga0268265_10036803 Ga0268265_100368032 482
953 3300028381 Ga0268264_10012613 Ga0268264_100126133 482
954 3300031241 Ga0265325_10004252 Ga0265325_100042528 482
955 3300031247 Ga0265340_10003946 Ga0265340_100039461 482
956 3300031249 Ga0265339_10002952 Ga0265339_100029525 482
957 3300031711 Ga0265314_10003818 Ga0265314_100038182 482
958 3300031712 Ga0265342_10003618 Ga0265342_100036183 482
959 3300031903 Ga0307407_10057937 Ga0307407_100579372 482
960 3300032004 Ga0307414_10176580 Ga0307414_101765801 482
961 3300035725 Ga0373947_0081588 Ga0373947_0081588_462_1946 482
962 3300036401 Ga0373937_0101140 Ga0373937_0101140_87_1556 482
963 3300039093 Ga0400489_44610 Ga0400489_44610_144789_146279 482
964 3300042131 Ga0450894_001057 Ga0450894_001057_81_1598 482
965 3300042133 Ga0450896_000289 Ga0450896_000289_3156_4673 482
966 3300042145 Ga0450906_004541 Ga0450906_004541_298_1758 482
967 3300045051 Ga0451576_0091202 Ga0451576_0091202_78_1592 482
968 3300046558 Ga0495633_0001711 Ga0495633_0001711_5522_6979 482
969 3300046683 Ga0495658_0004034 Ga0495658_0004034_4742_6211 482
970 3300046809 Ga0495600_0091306 Ga0495600_0091306_16_1491 482
971 3300047320 Ga0495672_0003825 Ga0495672_0003825_10518_11978 482
972 3300048907 Ga0496104_0000022 Ga0496104_0000022_41492_42961 482
973 3300048907 Ga0496104_0023690 Ga0496104_0023690_317_1834 482
974 3300048907 Ga0496104_0119076 Ga0496104_0119076_779_2296 482
975 3300048908 Ga0496105_0000028 Ga0496105_0000028_34234_35703 482
976 3300048909 Ga0496106_0056180 Ga0496106_0056180_1323_2840 482
977 3300048911 Ga0496108_0032628 Ga0496108_0032628_1596_3080 482
978 3300048911 Ga0496108_0093415 Ga0496108_0093415_106_1623 482
979 3300048912 Ga0496109_0006885 Ga0496109_0006885_4402_5919 482
980 3300048912 Ga0496109_0029644 Ga0496109_0029644_1549_3072 482
981 3300048912 Ga0496109_0221472 Ga0496109_0221472_271_1755 482
982 3300048913 Ga0496110_0010881 Ga0496110_0010881_5677_7194 482
983 3300048913 Ga0496110_0039275 Ga0496110_0039275_1241_2725 482
984 3300048915 Ga0496112_0004390 Ga0496112_0004390_2357_3874 482
985 3300048915 Ga0496112_0038766 Ga0496112_0038766_137_1621 482
986 3300048916 Ga0496113_0008144 Ga0496113_0008144_777_2294 482
987 3300048917 Ga0496114_0007511 Ga0496114_0007511_6836_8353 482
988 3300048922 Ga0496119_0002208 Ga0496119_0002208_16004_17470 482
989 3300048926 Ga0496123_0001927 Ga0496123_0001927_5203_6660 482
990 3300049571 Ga0501034_0077117 Ga0501034_0077117_46_1542 482
991 3300049571 Ga0501034_0178559 Ga0501034_0178559_99_1559 482
992 3300049576 Ga0501040_0051560 Ga0501040_0051560_676_2199 482
993 3300049578 Ga0501042_0009856 Ga0501042_0009856_4773_6299 482
994 3300049580 Ga0501046_0039484 Ga0501046_0039484_1675_3159 482
995 3300049580 Ga0501046_0056015 Ga0501046_0056015_427_1911 482
996 3300049588 Ga0501072_0007891 Ga0501072_0007891_6595_8064 482
997 3300049588 Ga0501072_0054429 Ga0501072_0054429_1148_2671 482
998 3300049590 Ga0501074_0023109 Ga0501074_0023109_1704_3173 482
999 3300049590 Ga0501074_0103633 Ga0501074_0103633_452_1936 482
1000 3300049591 Ga0501075_0006576 Ga0501075_0006576_6349_7875 482
1001 3300049741 Ga0501079_0021257 Ga0501079_0021257_3179_4663 482
1002 3300049741 Ga0501079_0023159 Ga0501079_0023159_2518_4002 482
1003 3300049741 Ga0501079_0025085 Ga0501079_0025085_2563_4089 482
1004 3300049743 Ga0501081_0014344 Ga0501081_0014344_1735_3219 482
1005 3300049743 Ga0501081_0024938 Ga0501081_0024938_1710_3233 482
1006 3300050507 nmdc:mga05p37_297708_c1 nmdc:mga05p37_297708_c1_37_1560 482
1007 3300050507 nmdc:mga05p37_37469_c1 nmdc:mga05p37_37469_c1_990_2474 482
1008 3300050508 nmdc:mga09592_123239_c1 nmdc:mga09592_123239_c1_102_1625 482
1009 3300050509 nmdc:mga0qj67_12872_c1 nmdc:mga0qj67_12872_c1_2011_3534 482
1010 3300050509 nmdc:mga0qj67_18644_c1 nmdc:mga0qj67_18644_c1_1253_2737 482
1011 3300050511 nmdc:mga08y16_15124_c1 nmdc:mga08y16_15124_c1_5547_7070 482
1012 3300050511 nmdc:mga08y16_24932_c1 nmdc:mga08y16_24932_c1_4052_5575 482
1013 3300050513 nmdc:mga0rr50_21363_c1 nmdc:mga0rr50_21363_c1_1619_3103 482
1014 3300050515 nmdc:mga0a205_27869_c1 nmdc:mga0a205_27869_c1_3760_5244 482
1015 3300053085 Ga0495619_0007461 Ga0495619_0007461_1281_2798 482
1016 3300053103 Ga0500555_018829 Ga0500555_018829_495_1955 482
1017 3300053730 Ga0500645_018022 Ga0500645_018022_172_1638 482
1018 3300054114 Ga0501084_0042387 Ga0501084_0042387_1034_2503 482
1019 3300060353 Ga0501082_0008755 Ga0501082_0008755_1649_3118 482
1020 3300060353 Ga0501082_0029466 Ga0501082_0029466_2521_4005 482
1021 iso_pu_bacteria 2511231221 2512033927 482
1022 iso_pu_bacteria 2522572158 2523102431 482
1023 iso_pu_bacteria 2597490356 2599100350 482
1024 iso_pu_bacteria 2842888712 2842890235 482
1025 iso_pu_bacteria 2846952575 2846956422 482
1026 iso_pu_bacteria 2848858292 2848862130 482
1027 iso_pu_bacteria 2897803580 2897809029 482
1028 iso_pu_bacteria 2909399089 2909402139 482
1029 iso_pu_bacteria 641228493 641335757 482
1030 iso_pu_bacteria 643348555 643389573 482
1031 iso_pu_bacteria 8054002106 8054004588 482
1032 3300001991 JGI24743J22301_10009561 JGI24743J22301_100095612 483
1033 3300005290 Ga0065712_10072317 Ga0065712_100723171 483
1034 3300005290 Ga0065712_10112744 Ga0065712_101127442 483
1035 3300005293 Ga0065715_10000949 Ga0065715_100009495 483
1036 3300005293 Ga0065715_10013370 Ga0065715_100133702 483
1037 3300005293 Ga0065715_10098768 Ga0065715_100987681 483
1038 3300005293 Ga0065715_10121271 Ga0065715_101212712 483
1039 3300005293 Ga0065715_10129750 Ga0065715_101297502 483
1040 3300005293 Ga0065715_10134294 Ga0065715_101342942 483
1041 3300005295 Ga0065707_10001241 Ga0065707_100012412 483
1042 3300005295 Ga0065707_10007223 Ga0065707_100072232 483
1043 3300005295 Ga0065707_10099158 Ga0065707_100991582 483
1044 3300005328 Ga0070676_10018310 Ga0070676_100183102 483
1045 3300005328 Ga0070676_10020625 Ga0070676_100206252 483
1046 3300005331 Ga0070670_100018106 Ga0070670_1000181062 483
1047 3300005331 Ga0070670_100029430 Ga0070670_1000294303 483
1048 3300005331 Ga0070670_100033549 Ga0070670_1000335493 483
1049 3300005333 Ga0070677_10001267 Ga0070677_100012673 483
1050 3300005336 Ga0070680_100088160 Ga0070680_1000881602 483
1051 3300005337 Ga0070682_100065811 Ga0070682_1000658112 483
1052 3300005338 Ga0068868_100025826 Ga0068868_1000258263 483
1053 3300005339 Ga0070660_100004861 Ga0070660_1000048614 483
1054 3300005343 Ga0070687_100039978 Ga0070687_1000399781 483
1055 3300005347 Ga0070668_100046576 Ga0070668_1000465762 483
1056 3300005354 Ga0070675_100015671 Ga0070675_1000156712 483
1057 3300005354 Ga0070675_100040588 Ga0070675_1000405883 483
1058 3300005355 Ga0070671_100015470 Ga0070671_1000154703 483
1059 3300005355 Ga0070671_100066017 Ga0070671_1000660171 483
1060 3300005356 Ga0070674_100007969 Ga0070674_1000079692 483
1061 3300005356 Ga0070674_100157478 Ga0070674_1001574781 483
1062 3300005364 Ga0070673_100020749 Ga0070673_1000207492 483
1063 3300005364 Ga0070673_100071624 Ga0070673_1000716242 483
1064 3300005365 Ga0070688_100023190 Ga0070688_1000231902 483
1065 3300005366 Ga0070659_100105594 Ga0070659_1001055942 483
1066 3300005367 Ga0070667_100101945 Ga0070667_1001019452 483
1067 3300005435 Ga0070714_100009700 Ga0070714_1000097007 483
1068 3300005436 Ga0070713_100021449 Ga0070713_1000214492 483
1069 3300005445 Ga0070708_100033165 Ga0070708_1000331652 483
1070 3300005457 Ga0070662_100010659 Ga0070662_1000106593 483
1071 3300005458 Ga0070681_10033013 Ga0070681_100330135 483
1072 3300005458 Ga0070681_10116054 Ga0070681_101160542 483
1073 3300005459 Ga0068867_100018816 Ga0068867_1000188162 483
1074 3300005468 Ga0070707_100054744 Ga0070707_1000547442 483
1075 3300005530 Ga0070679_100066890 Ga0070679_1000668903 483
1076 3300005536 Ga0070697_100004144 Ga0070697_1000041447 483
1077 3300005539 Ga0068853_100133684 Ga0068853_1001336842 483
1078 3300005543 Ga0070672_100021657 Ga0070672_1000216572 483
1079 3300005543 Ga0070672_100029312 Ga0070672_1000293123 483
1080 3300005543 Ga0070672_100082768 Ga0070672_1000827682 483
1081 3300005544 Ga0070686_100005610 Ga0070686_1000056102 483
1082 3300005544 Ga0070686_100035868 Ga0070686_1000358682 483
1083 3300005545 Ga0070695_100001320 Ga0070695_10000132011 483
1084 3300005546 Ga0070696_100118718 Ga0070696_1001187181 483
1085 3300005547 Ga0070693_100066108 Ga0070693_1000661082 483
1086 3300005548 Ga0070665_100001799 Ga0070665_1000017999 483
1087 3300005548 Ga0070665_100022890 Ga0070665_1000228905 483
1088 3300005549 Ga0070704_100004648 Ga0070704_1000046484 483
1089 3300005563 Ga0068855_100134704 Ga0068855_1001347042 483
1090 3300005564 Ga0070664_100001087 Ga0070664_1000010878 483
1091 3300005578 Ga0068854_100001233 Ga0068854_10000123311 483
1092 3300005578 Ga0068854_100102709 Ga0068854_1001027091 483
1093 3300005617 Ga0068859_100003336 Ga0068859_1000033366 483
1094 3300005617 Ga0068859_100049484 Ga0068859_1000494842 483
1095 3300005618 Ga0068864_100134610 Ga0068864_1001346102 483
1096 3300005718 Ga0068866_10010834 Ga0068866_100108343 483
1097 3300005719 Ga0068861_100002930 Ga0068861_10000293011 483
1098 3300005719 Ga0068861_100158452 Ga0068861_1001584522 483
1099 3300005841 Ga0068863_100056065 Ga0068863_1000560651 483
1100 3300005842 Ga0068858_100007049 Ga0068858_1000070492 483
1101 3300005842 Ga0068858_100034063 Ga0068858_1000340633 483
1102 3300005843 Ga0068860_100063042 Ga0068860_1000630422 483
1103 3300005843 Ga0068860_100090704 Ga0068860_1000907042 483
1104 3300005844 Ga0068862_100005273 Ga0068862_1000052735 483
1105 3300005844 Ga0068862_100121314 Ga0068862_1001213142 483
1106 3300005985 Ga0081539_10015017 Ga0081539_100150172 483
1107 3300006038 Ga0075365_10025392 Ga0075365_100253922 483
1108 3300006051 Ga0075364_10010285 Ga0075364_100102852 483
1109 3300006051 Ga0075364_10072680 Ga0075364_100726802 483
1110 3300006177 Ga0075362_10006581 Ga0075362_100065811 483
1111 3300006178 Ga0075367_10057251 Ga0075367_100572512 483
1112 3300006178 Ga0075367_10066356 Ga0075367_100663562 483
1113 3300006195 Ga0075366_10001961 Ga0075366_100019614 483
1114 3300006195 Ga0075366_10010067 Ga0075366_100100672 483
1115 3300006237 Ga0097621_100000312 Ga0097621_10000031227 483
1116 3300006353 Ga0075370_10052255 Ga0075370_100522551 483
1117 3300006358 Ga0068871_100176020 Ga0068871_1001760201 483
1118 3300006844 Ga0075428_100000011 Ga0075428_100000011181 483
1119 3300006844 Ga0075428_100001156 Ga0075428_1000011565 483
1120 3300006844 Ga0075428_100004959 Ga0075428_1000049591 483
1121 3300006844 Ga0075428_100016561 Ga0075428_1000165614 483
1122 3300006844 Ga0075428_100023468 Ga0075428_1000234683 483
1123 3300006844 Ga0075428_100042819 Ga0075428_1000428193 483
1124 3300006844 Ga0075428_100236391 Ga0075428_1002363912 483
1125 3300006846 Ga0075430_100000936 Ga0075430_10000093615 483
1126 3300006846 Ga0075430_100061942 Ga0075430_1000619422 483
1127 3300006847 Ga0075431_100013998 Ga0075431_1000139985 483
1128 3300006847 Ga0075431_100028747 Ga0075431_1000287476 483
1129 3300006847 Ga0075431_100030928 Ga0075431_1000309283 483
1130 3300006847 Ga0075431_100069251 Ga0075431_1000692513 483
1131 3300006852 Ga0075433_10000535 Ga0075433_100005357 483
1132 3300006880 Ga0075429_100013075 Ga0075429_1000130752 483
1133 3300006880 Ga0075429_100014627 Ga0075429_1000146272 483
1134 3300006880 Ga0075429_100040790 Ga0075429_1000407902 483
1135 3300006914 Ga0075436_100010651 Ga0075436_1000106515 483
1136 3300006914 Ga0075436_100037912 Ga0075436_1000379124 483
1137 3300006931 Ga0097620_100003336 Ga0097620_1000033366 483
1138 3300006931 Ga0097620_100049483 Ga0097620_1000494832 483
1139 3300007076 Ga0075435_100003221 Ga0075435_1000032211 483
1140 3300009093 Ga0105240_10089737 Ga0105240_100897372 483
1141 3300009094 Ga0111539_10000011 Ga0111539_1000001114 483
1142 3300009094 Ga0111539_10001118 Ga0111539_100011187 483
1143 3300009094 Ga0111539_10001539 Ga0111539_1000153917 483
1144 3300009094 Ga0111539_10004333 Ga0111539_100043332 483
1145 3300009094 Ga0111539_10008266 Ga0111539_100082666 483
1146 3300009094 Ga0111539_10093960 Ga0111539_100939602 483
1147 3300009094 Ga0111539_10151504 Ga0111539_101515041 483
1148 3300009094 Ga0111539_10201842 Ga0111539_102018421 483
1149 3300009094 Ga0111539_10259072 Ga0111539_102590722 483
1150 3300009098 Ga0105245_10003848 Ga0105245_1000384810 483
1151 3300009098 Ga0105245_10043582 Ga0105245_100435821 483
1152 3300009098 Ga0105245_10159062 Ga0105245_101590622 483
1153 3300009101 Ga0105247_10003542 Ga0105247_100035422 483
1154 3300009147 Ga0114129_10000186 Ga0114129_1000018644 483
1155 3300009147 Ga0114129_10000540 Ga0114129_1000054038 483
1156 3300009147 Ga0114129_10001097 Ga0114129_100010977 483
1157 3300009147 Ga0114129_10010140 Ga0114129_100101406 483
1158 3300009147 Ga0114129_10015936 Ga0114129_100159367 483
1159 3300009147 Ga0114129_10018606 Ga0114129_100186062 483
1160 3300009147 Ga0114129_10028588 Ga0114129_100285885 483
1161 3300009147 Ga0114129_10037573 Ga0114129_100375733 483
1162 3300009147 Ga0114129_10045078 Ga0114129_100450785 483
1163 3300009147 Ga0114129_10060185 Ga0114129_100601852 483
1164 3300009147 Ga0114129_10327724 Ga0114129_103277243 483
1165 3300009176 Ga0105242_10010587 Ga0105242_100105875 483
1166 3300009177 Ga0105248_10007672 Ga0105248_100076722 483
1167 3300009177 Ga0105248_10014742 Ga0105248_100147423 483
1168 3300009177 Ga0105248_10015047 Ga0105248_100150472 483
1169 3300009177 Ga0105248_10035567 Ga0105248_100355675 483
1170 3300009177 Ga0105248_10090227 Ga0105248_100902272 483
1171 3300009553 Ga0105249_10013149 Ga0105249_100131496 483
1172 3300009553 Ga0105249_10046066 Ga0105249_100460663 483
1173 3300013100 Ga0157373_10019604 Ga0157373_100196044 483
1174 3300013104 Ga0157370_10146438 Ga0157370_101464382 483
1175 3300013296 Ga0157374_10037002 Ga0157374_100370025 483
1176 3300013297 Ga0157378_10087305 Ga0157378_100873052 483
1177 3300013307 Ga0157372_10019961 Ga0157372_100199613 483
1178 3300013308 Ga0157375_10159955 Ga0157375_101599552 483
1179 3300014325 Ga0163163_10000019 Ga0163163_1000001924 483
1180 3300014325 Ga0163163_10010614 Ga0163163_100106146 483
1181 3300014325 Ga0163163_10065133 Ga0163163_100651332 483
1182 3300014325 Ga0163163_10105693 Ga0163163_101056933 483
1183 3300014326 Ga0157380_10157256 Ga0157380_101572561 483
1184 3300014968 Ga0157379_10009525 Ga0157379_100095254 483
1185 3300014969 Ga0157376_10028578 Ga0157376_100285782 483
1186 3300017792 Ga0163161_10116130 Ga0163161_101161301 483
1187 3300021377 Ga0213874_10025780 Ga0213874_100257801 483
1188 3300021384 Ga0213876_10008649 Ga0213876_100086495 483
1189 3300025261 Ga0209233_1008343 Ga0209233_10083432 483
1190 3300025315 Ga0207697_10009901 Ga0207697_100099014 483
1191 3300025321 Ga0207656_10045028 Ga0207656_100450281 483
1192 3300025893 Ga0207682_10000861 Ga0207682_1000086117 483
1193 3300025899 Ga0207642_10040011 Ga0207642_100400112 483
1194 3300025901 Ga0207688_10014451 Ga0207688_100144513 483
1195 3300025907 Ga0207645_10000533 Ga0207645_1000053316 483
1196 3300025907 Ga0207645_10096244 Ga0207645_100962442 483
1197 3300025912 Ga0207707_10056177 Ga0207707_100561772 483
1198 3300025912 Ga0207707_10116077 Ga0207707_101160771 483
1199 3300025913 Ga0207695_10178572 Ga0207695_101785721 483
1200 3300025915 Ga0207693_10040113 Ga0207693_100401132 483
1201 3300025918 Ga0207662_10017045 Ga0207662_100170451 483
1202 3300025918 Ga0207662_10047470 Ga0207662_100474702 483
1203 3300025919 Ga0207657_10008726 Ga0207657_100087267 483
1204 3300025921 Ga0207652_10034988 Ga0207652_100349884 483
1205 3300025922 Ga0207646_10034227 Ga0207646_100342273 483
1206 3300025922 Ga0207646_10036028 Ga0207646_100360282 483
1207 3300025923 Ga0207681_10028518 Ga0207681_100285183 483
1208 3300025923 Ga0207681_10030631 Ga0207681_100306314 483
1209 3300025925 Ga0207650_10022332 Ga0207650_100223322 483
1210 3300025927 Ga0207687_10036850 Ga0207687_100368502 483
1211 3300025928 Ga0207700_10044321 Ga0207700_100443212 483
1212 3300025932 Ga0207690_10020058 Ga0207690_100200583 483
1213 3300025933 Ga0207706_10000203 Ga0207706_1000020347 483
1214 3300025934 Ga0207686_10014186 Ga0207686_100141862 483
1215 3300025936 Ga0207670_10065215 Ga0207670_100652152 483
1216 3300025937 Ga0207669_10009330 Ga0207669_100093302 483
1217 3300025938 Ga0207704_10006858 Ga0207704_100068584 483
1218 3300025938 Ga0207704_10074847 Ga0207704_100748472 483
1219 3300025939 Ga0207665_10038392 Ga0207665_100383923 483
1220 3300025940 Ga0207691_10001512 Ga0207691_1000151222 483
1221 3300025940 Ga0207691_10018012 Ga0207691_100180122 483
1222 3300025940 Ga0207691_10144905 Ga0207691_101449052 483
1223 3300025941 Ga0207711_10024032 Ga0207711_100240323 483
1224 3300025941 Ga0207711_10071621 Ga0207711_100716211 483
1225 3300025941 Ga0207711_10095844 Ga0207711_100958443 483
1226 3300025942 Ga0207689_10107170 Ga0207689_101071702 483
1227 3300025944 Ga0207661_10049776 Ga0207661_100497762 483
1228 3300025945 Ga0207679_10001178 Ga0207679_1000117811 483
1229 3300025945 Ga0207679_10032052 Ga0207679_100320523 483
1230 3300025949 Ga0207667_10165499 Ga0207667_101654992 483
1231 3300025960 Ga0207651_10049238 Ga0207651_100492382 483
1232 3300025960 Ga0207651_10132231 Ga0207651_101322311 483
1233 3300025961 Ga0207712_10002493 Ga0207712_100024936 483
1234 3300025986 Ga0207658_10033569 Ga0207658_100335692 483
1235 3300025986 Ga0207658_10123592 Ga0207658_101235921 483
1236 3300026035 Ga0207703_10011972 Ga0207703_100119724 483
1237 3300026088 Ga0207641_10008651 Ga0207641_100086517 483
1238 3300026088 Ga0207641_10224143 Ga0207641_102241431 483
1239 3300026089 Ga0207648_10000465 Ga0207648_1000046523 483
1240 3300026116 Ga0207674_10033232 Ga0207674_100332324 483
1241 3300026118 Ga0207675_100001532 Ga0207675_10000153216 483
1242 3300026118 Ga0207675_100146875 Ga0207675_1001468752 483
1243 3300026121 Ga0207683_10121483 Ga0207683_101214832 483
1244 3300026121 Ga0207683_10122056 Ga0207683_101220562 483
1245 3300026142 Ga0207698_10036537 Ga0207698_100365372 483
1246 3300027717 Ga0209998_10001089 Ga0209998_100010893 483
1247 3300027876 Ga0209974_10000723 Ga0209974_1000072310 483
1248 3300027907 Ga0207428_10000212 Ga0207428_1000021215 483
1249 3300027907 Ga0207428_10002530 Ga0207428_1000253010 483
1250 3300027907 Ga0207428_10068549 Ga0207428_100685492 483
1251 3300027907 Ga0207428_10069369 Ga0207428_100693692 483
1252 3300027907 Ga0207428_10104652 Ga0207428_101046521 483
1253 3300028379 Ga0268266_10001066 Ga0268266_100010666 483
1254 3300028379 Ga0268266_10099932 Ga0268266_100999322 483
1255 3300028379 Ga0268266_10116859 Ga0268266_101168592 483
1256 3300028379 Ga0268266_10145828 Ga0268266_101458282 483
1257 3300028380 Ga0268265_10073569 Ga0268265_100735692 483
1258 3300028380 Ga0268265_10082452 Ga0268265_100824522 483
1259 3300028380 Ga0268265_10102437 Ga0268265_101024372 483
1260 3300028381 Ga0268264_10056007 Ga0268264_100560072 483
1261 3300028381 Ga0268264_10067122 Ga0268264_100671222 483
1262 3300028381 Ga0268264_10147506 Ga0268264_101475062 483
1263 3300028381 Ga0268264_10157781 Ga0268264_101577811 483
1264 3300028558 Ga0265326_10008735 Ga0265326_100087352 483
1265 3300031239 Ga0265328_10008673 Ga0265328_100086732 483
1266 3300031250 Ga0265331_10002691 Ga0265331_100026913 483
1267 3300031250 Ga0265331_10041898 Ga0265331_100418981 483
1268 3300031727 Ga0316576_10030591 Ga0316576_100305912 483
1269 3300031911 Ga0307412_10117974 Ga0307412_101179742 483
1270 3300031995 Ga0307409_100036320 Ga0307409_1000363203 483
1271 3300031995 Ga0307409_100136837 Ga0307409_1001368371 483
1272 3300032002 Ga0307416_100047900 Ga0307416_1000479004 483
1273 3300032002 Ga0307416_100133634 Ga0307416_1001336342 483
1274 3300032002 Ga0307416_100165532 Ga0307416_1001655322 483
1275 3300032004 Ga0307414_10204208 Ga0307414_102042081 483
1276 3300035086 Ga0373934_0016076 Ga0373934_0016076_234_1763 483
1277 3300035088 Ga0373940_0001759 Ga0373940_0001759_1236_2765 483
1278 3300035090 Ga0373949_0000739 Ga0373949_0000739_6748_8277 483
1279 3300035112 Ga0373932_0000959 Ga0373932_0000959_6532_8061 483
1280 3300035114 Ga0373939_0001496 Ga0373939_0001496_3840_5369 483
1281 3300035115 Ga0373941_0006418 Ga0373941_0006418_430_1980 483
1282 3300035115 Ga0373941_0012732 Ga0373941_0012732_18_1547 483
1283 3300035170 Ga0373943_0002067 Ga0373943_0002067_6692_8221 483
1284 3300035207 Ga0373942_0002277 Ga0373942_0002277_1203_2732 483
1285 3300035241 Ga0373961_0001481 Ga0373961_0001481_500_2029 483
1286 3300035242 Ga0373962_0001940 Ga0373962_0001940_1675_3204 483
1287 3300035398 Ga0316574_0046904 Ga0316574_0046904_132_1610 483
1288 3300035398 Ga0316574_0107567 Ga0316574_0107567_166_1653 483
1289 3300035410 Ga0373924_0003051 Ga0373924_0003051_864_2393 483
1290 3300036401 Ga0373937_0016373 Ga0373937_0016373_2584_4110 483
1291 3300036401 Ga0373937_0036620 Ga0373937_0036620_1357_2880 483
1292 3300036712 Ga0316584_0007714 Ga0316584_0007714_1521_3008 483
1293 3300037068 Ga0373925_0014856 Ga0373925_0014856_3755_5281 483
1294 3300037068 Ga0373925_0106014 Ga0373925_0106014_105_1634 483
1295 3300037418 Ga0395900_0023857 Ga0395900_0023857_4411_5907 483
1296 3300037471 Ga0395905_0068235 Ga0395905_0068235_1391_2884 483
1297 3300039062 Ga0400483_026829 Ga0400483_026829_11132_12592 483
1298 3300039062 Ga0400483_228511 Ga0400483_228511_2961_4421 483
1299 3300039437 Ga0436365_0122238 Ga0436365_0122238_1987_3450 483
1300 3300039437 Ga0436365_0412218 Ga0436365_0412218_9303_10784 483
1301 3300039437 Ga0436365_0568889 Ga0436365_0568889_237_1724 483
1302 3300039438 Ga0436360_0827262 Ga0436360_0827262_3983_5482 483
1303 3300039447 Ga0436361_0184626 Ga0436361_0184626_385_1884 483
1304 3300039450 Ga0436363_0709676 Ga0436363_0709676_474_1958 483
1305 3300039450 Ga0436363_1685560 Ga0436363_1685560_64_1533 483
1306 3300042125 Ga0450923_004341 Ga0450923_004341_14_1555 483
1307 3300042133 Ga0450896_000423 Ga0450896_000423_1702_3243 483
1308 3300042436 Ga0439435_0002251 Ga0439435_0002251_936_2462 483
1309 3300042461 Ga0439460_0010195 Ga0439460_0010195_243_1793 483
1310 3300042876 Ga0451577_0001605 Ga0451577_0001605_27632_29116 483
1311 3300042876 Ga0451577_0191578 Ga0451577_0191578_280_1806 483
1312 3300044712 Ga0453684_0000761 Ga0453684_0000761_64459_65943 483
1313 3300044712 Ga0453684_0212861 Ga0453684_0212861_165_1637 483
1314 3300044901 Ga0466960_0033141 Ga0466960_0033141_115_1608 483
1315 3300045051 Ga0451576_0000127 Ga0451576_0000127_46020_47504 483
1316 3300045051 Ga0451576_0146691 Ga0451576_0146691_846_2375 483
1317 3300046454 Ga0495592_0056209 Ga0495592_0056209_1247_2776 483
1318 3300046473 Ga0495582_0040354 Ga0495582_0040354_33_1562 483
1319 3300046516 Ga0495628_0055912 Ga0495628_0055912_297_1814 483
1320 3300046516 Ga0495628_0085893 Ga0495628_0085893_548_2077 483
1321 3300046517 Ga0495630_0072343 Ga0495630_0072343_697_2226 483
1322 3300046529 Ga0495652_0046615 Ga0495652_0046615_2113_3642 483
1323 3300046536 Ga0495587_0073585 Ga0495587_0073585_284_1840 483
1324 3300046615 Ga0495656_0026685 Ga0495656_0026685_268_1833 483
1325 3300046678 Ga0495599_0069720 Ga0495599_0069720_404_1933 483
1326 3300046678 Ga0495599_0101809 Ga0495599_0101809_127_1650 483
1327 3300046684 Ga0495669_0030435 Ga0495669_0030435_822_2351 483
1328 3300046689 Ga0495613_0000415 Ga0495613_0000415_20689_22218 483
1329 3300047471 Ga0495684_0000356 Ga0495684_0000356_5522_7051 483
1330 3300048905 Ga0496102_0016003 Ga0496102_0016003_1046_2572 483
1331 3300048907 Ga0496104_0000481 Ga0496104_0000481_9609_11162 483
1332 3300048907 Ga0496104_0081449 Ga0496104_0081449_443_1981 483
1333 3300048908 Ga0496105_0018451 Ga0496105_0018451_1317_2870 483
1334 3300048910 Ga0496107_0139678 Ga0496107_0139678_240_1739 483
1335 3300048911 Ga0496108_0067123 Ga0496108_0067123_1007_2533 483
1336 3300048911 Ga0496108_0094713 Ga0496108_0094713_551_2074 483
1337 3300048912 Ga0496109_0001345 Ga0496109_0001345_2428_3981 483
1338 3300048913 Ga0496110_0002741 Ga0496110_0002741_6876_8429 483
1339 3300048913 Ga0496110_0069182 Ga0496110_0069182_19_1545 483
1340 3300048913 Ga0496110_0077118 Ga0496110_0077118_958_2484 483
1341 3300048915 Ga0496112_0001179 Ga0496112_0001179_14622_16175 483
1342 3300048915 Ga0496112_0009839 Ga0496112_0009839_1001_2539 483
1343 3300048915 Ga0496112_0088997 Ga0496112_0088997_1124_2650 483
1344 3300048915 Ga0496112_0168337 Ga0496112_0168337_78_1607 483
1345 3300048920 Ga0496117_0066118 Ga0496117_0066118_368_1828 483
1346 3300048921 Ga0496118_0000361 Ga0496118_0000361_25750_27210 483
1347 3300049568 Ga0501031_0014117 Ga0501031_0014117_1859_3346 483
1348 3300049569 Ga0501032_0010323 Ga0501032_0010323_2922_4409 483
1349 3300049570 Ga0501033_0013660 Ga0501033_0013660_364_1851 483
1350 3300049570 Ga0501033_0063239 Ga0501033_0063239_1056_2555 483
1351 3300049571 Ga0501034_0003230 Ga0501034_0003230_11488_12975 483
1352 3300049571 Ga0501034_0007526 Ga0501034_0007526_5072_6598 483
1353 3300049571 Ga0501034_0012280 Ga0501034_0012280_160_1689 483
1354 3300049571 Ga0501034_0051670 Ga0501034_0051670_1545_3041 483
1355 3300049572 Ga0501036_0002584 Ga0501036_0002584_12354_13841 483
1356 3300049572 Ga0501036_0063955 Ga0501036_0063955_163_1689 483
1357 3300049573 Ga0501037_0006220 Ga0501037_0006220_1628_3094 483
1358 3300049574 Ga0501038_0010046 Ga0501038_0010046_4723_6210 483
1359 3300049574 Ga0501038_0019873 Ga0501038_0019873_2288_3757 483
1360 3300049575 Ga0501039_0003344 Ga0501039_0003344_8647_10179 483
1361 3300049575 Ga0501039_0065604 Ga0501039_0065604_1080_2549 483
1362 3300049575 Ga0501039_0090186 Ga0501039_0090186_549_2075 483
1363 3300049576 Ga0501040_0001853 Ga0501040_0001853_6813_8345 483
1364 3300049576 Ga0501040_0013115 Ga0501040_0013115_3863_5332 483
1365 3300049577 Ga0501041_0004439 Ga0501041_0004439_1008_2477 483
1366 3300049577 Ga0501041_0026653 Ga0501041_0026653_1554_3086 483
1367 3300049577 Ga0501041_0042402 Ga0501041_0042402_530_2056 483
1368 3300049578 Ga0501042_0021419 Ga0501042_0021419_182_1669 483
1369 3300049579 Ga0501043_0008417 Ga0501043_0008417_4952_6439 483
1370 3300049580 Ga0501046_0004595 Ga0501046_0004595_3065_4552 483
1371 3300049580 Ga0501046_0011972 Ga0501046_0011972_965_2464 483
1372 3300049580 Ga0501046_0023163 Ga0501046_0023163_1775_3244 483
1373 3300049580 Ga0501046_0027532 Ga0501046_0027532_513_2045 483
1374 3300049581 Ga0501047_0004950 Ga0501047_0004950_10720_12207 483
1375 3300049581 Ga0501047_0010420 Ga0501047_0010420_4982_6481 483
1376 3300049581 Ga0501047_0010875 Ga0501047_0010875_1980_3509 483
1377 3300049582 Ga0501048_0003824 Ga0501048_0003824_7564_9051 483
1378 3300049582 Ga0501048_0011133 Ga0501048_0011133_284_1810 483
1379 3300049582 Ga0501048_0041844 Ga0501048_0041844_1587_3128 483
1380 3300049583 Ga0501067_0001334 Ga0501067_0001334_403_1890 483
1381 3300049584 Ga0501068_0041764 Ga0501068_0041764_1235_2704 483
1382 3300049584 Ga0501068_0064610 Ga0501068_0064610_579_2048 483
1383 3300049585 Ga0501069_0006947 Ga0501069_0006947_3736_5223 483
1384 3300049586 Ga0501070_0008807 Ga0501070_0008807_4044_5531 483
1385 3300049587 Ga0501071_0020366 Ga0501071_0020366_1842_3374 483
1386 3300049587 Ga0501071_0037674 Ga0501071_0037674_1662_3131 483
1387 3300049587 Ga0501071_0070857 Ga0501071_0070857_44_1513 483
1388 3300049588 Ga0501072_0011085 Ga0501072_0011085_5189_6739 483
1389 3300049588 Ga0501072_0044078 Ga0501072_0044078_685_2217 483
1390 3300049588 Ga0501072_0049053 Ga0501072_0049053_945_2477 483
1391 3300049588 Ga0501072_0132754 Ga0501072_0132754_131_1663 483
1392 3300049589 Ga0501073_0005642 Ga0501073_0005642_7471_8958 483
1393 3300049590 Ga0501074_0010549 Ga0501074_0010549_4952_6439 483
1394 3300049591 Ga0501075_0002632 Ga0501075_0002632_7703_9235 483
1395 3300049591 Ga0501075_0025188 Ga0501075_0025188_71_1612 483
1396 3300049591 Ga0501075_0033336 Ga0501075_0033336_2249_3718 483
1397 3300049591 Ga0501075_0035849 Ga0501075_0035849_2005_3474 483
1398 3300049591 Ga0501075_0036118 Ga0501075_0036118_739_2271 483
1399 3300049591 Ga0501075_0059888 Ga0501075_0059888_1050_2576 483
1400 3300049592 Ga0501076_0000111 Ga0501076_0000111_12725_14257 483
1401 3300049592 Ga0501076_0020875 Ga0501076_0020875_934_2403 483
1402 3300049592 Ga0501076_0030873 Ga0501076_0030873_2639_4165 483
1403 3300049592 Ga0501076_0046057 Ga0501076_0046057_889_2439 483
1404 3300049592 Ga0501076_0129223 Ga0501076_0129223_321_1790 483
1405 3300049592 Ga0501076_0209581 Ga0501076_0209581_38_1564 483
1406 3300049593 Ga0501077_0093651 Ga0501077_0093651_333_1859 483
1407 3300049741 Ga0501079_0003034 Ga0501079_0003034_6177_7664 483
1408 3300049741 Ga0501079_0022469 Ga0501079_0022469_322_1791 483
1409 3300049741 Ga0501079_0038569 Ga0501079_0038569_1652_3178 483
1410 3300049741 Ga0501079_0068392 Ga0501079_0068392_182_1651 483
1411 3300049741 Ga0501079_0160012 Ga0501079_0160012_34_1560 483
1412 3300049742 Ga0501080_0011203 Ga0501080_0011203_157_1644 483
1413 3300049742 Ga0501080_0023849 Ga0501080_0023849_2007_3476 483
1414 3300049742 Ga0501080_0101452 Ga0501080_0101452_166_1638 483
1415 3300049742 Ga0501080_0106590 Ga0501080_0106590_1053_2522 483
1416 3300049743 Ga0501081_0000781 Ga0501081_0000781_3852_5384 483
1417 3300049743 Ga0501081_0005158 Ga0501081_0005158_2464_3933 483
1418 3300049743 Ga0501081_0035730 Ga0501081_0035730_106_1575 483
1419 3300049743 Ga0501081_0044543 Ga0501081_0044543_243_1793 483
1420 3300049744 Ga0501083_0008456 Ga0501083_0008456_2976_4463 483
1421 3300049822 Ga0501035_0028472 Ga0501035_0028472_782_2269 483
1422 3300049822 Ga0501035_0106681 Ga0501035_0106681_66_1598 483
1423 3300049822 Ga0501035_0152020 Ga0501035_0152020_426_1922 483
1424 3300049822 Ga0501035_0158523 Ga0501035_0158523_322_1791 483
1425 3300049823 Ga0501044_0003091 Ga0501044_0003091_14852_16381 483
1426 3300049823 Ga0501044_0102855 Ga0501044_0102855_1374_2861 483
1427 3300049823 Ga0501044_0134404 Ga0501044_0134404_844_2343 483
1428 3300049824 Ga0501045_0004296 Ga0501045_0004296_1057_2589 483
1429 3300049824 Ga0501045_0005785 Ga0501045_0005785_5667_7136 483
1430 3300049824 Ga0501045_0014111 Ga0501045_0014111_1475_3025 483
1431 3300049824 Ga0501045_0033205 Ga0501045_0033205_483_2024 483
1432 3300049824 Ga0501045_0037159 Ga0501045_0037159_79_1548 483
1433 3300049824 Ga0501045_0037800 Ga0501045_0037800_1362_2849 483
1434 3300049824 Ga0501045_0045242 Ga0501045_0045242_1656_3188 483
1435 3300050489 nmdc:mga03683_15003_c2 nmdc:mga03683_15003_c2_89_1615 483
1436 3300050491 nmdc:mga00v17_110898_c1 nmdc:mga00v17_110898_c1_181_1707 483
1437 3300050491 nmdc:mga00v17_5894_c1 nmdc:mga00v17_5894_c1_838_2364 483
1438 3300050491 nmdc:mga00v17_65645_c1 nmdc:mga00v17_65645_c1_267_1793 483
1439 3300050493 nmdc:mga0k408_9071_c1 nmdc:mga0k408_9071_c1_3680_5206 483
1440 3300050494 nmdc:mga06z11_7537_c1 nmdc:mga06z11_7537_c1_1873_3399 483
1441 3300050507 nmdc:mga05p37_21426_c1 nmdc:mga05p37_21426_c1_3201_4772 483
1442 3300050507 nmdc:mga05p37_23015_c1 nmdc:mga05p37_23015_c1_2801_4366 483
1443 3300050507 nmdc:mga05p37_2954_c1 nmdc:mga05p37_2954_c1_13449_14975 483
1444 3300050507 nmdc:mga05p37_33674_c1 nmdc:mga05p37_33674_c1_616_2193 483
1445 3300050507 nmdc:mga05p37_369_c2 nmdc:mga05p37_369_c2_11748_13301 483
1446 3300050507 nmdc:mga05p37_5606_c1 nmdc:mga05p37_5606_c1_7462_8985 483
1447 3300050507 nmdc:mga05p37_731_c1 nmdc:mga05p37_731_c1_10814_12340 483
1448 3300050507 nmdc:mga05p37_78270_c1 nmdc:mga05p37_78270_c1_1416_2966 483
1449 3300050507 nmdc:mga05p37_88140_c1 nmdc:mga05p37_88140_c1_1007_2494 483
1450 3300050507 nmdc:mga05p37_89906_c1 nmdc:mga05p37_89906_c1_1926_3452 483
1451 3300050508 nmdc:mga09592_8006_c1 nmdc:mga09592_8006_c1_6468_7994 483
1452 3300050508 nmdc:mga09592_9024_c1 nmdc:mga09592_9024_c1_1719_3245 483
1453 3300050509 nmdc:mga0qj67_1964_c1 nmdc:mga0qj67_1964_c1_8520_10046 483
1454 3300050509 nmdc:mga0qj67_34742_c1 nmdc:mga0qj67_34742_c1_132_1658 483
1455 3300050509 nmdc:mga0qj67_5030_c1 nmdc:mga0qj67_5030_c1_4662_6188 483
1456 3300050509 nmdc:mga0qj67_8597_c1 nmdc:mga0qj67_8597_c1_886_2355 483
1457 3300050510 nmdc:mga06r32_10388_c1 nmdc:mga06r32_10388_c1_1788_3314 483
1458 3300050510 nmdc:mga06r32_15713_c1 nmdc:mga06r32_15713_c1_192_1718 483
1459 3300050511 nmdc:mga08y16_112153_c1 nmdc:mga08y16_112153_c1_380_1849 483
1460 3300050511 nmdc:mga08y16_121327_c1 nmdc:mga08y16_121327_c1_720_2246 483
1461 3300050511 nmdc:mga08y16_1262_c1 nmdc:mga08y16_1262_c1_15918_17444 483
1462 3300050511 nmdc:mga08y16_12_c1 nmdc:mga08y16_12_c1_12889_14445 483
1463 3300050511 nmdc:mga08y16_131757_c1 nmdc:mga08y16_131757_c1_313_1839 483
1464 3300050511 nmdc:mga08y16_146635_c1 nmdc:mga08y16_146635_c1_599_2125 483
1465 3300050511 nmdc:mga08y16_256516_c1 nmdc:mga08y16_256516_c1_221_1747 483
1466 3300050511 nmdc:mga08y16_41828_c1 nmdc:mga08y16_41828_c1_1622_3175 483
1467 3300050511 nmdc:mga08y16_9444_c1 nmdc:mga08y16_9444_c1_1474_2991 483
1468 3300050512 nmdc:mga0n895_190799_c1 nmdc:mga0n895_190799_c1_536_2062 483
1469 3300050512 nmdc:mga0n895_39201_c1 nmdc:mga0n895_39201_c1_708_2234 483
1470 3300050512 nmdc:mga0n895_83_c1 nmdc:mga0n895_83_c1_38995_40518 483
1471 3300050513 nmdc:mga0rr50_2281_c1 nmdc:mga0rr50_2281_c1_130_1656 483
1472 3300050513 nmdc:mga0rr50_84432_c1 nmdc:mga0rr50_84432_c1_766_2343 483
1473 3300050514 nmdc:mga08x19_31463_c1 nmdc:mga08x19_31463_c1_230_1759 483
1474 3300050514 nmdc:mga08x19_338_c1 nmdc:mga08x19_338_c1_10879_12402 483
1475 3300050514 nmdc:mga08x19_3836_c1 nmdc:mga08x19_3836_c1_4087_5610 483
1476 3300050515 nmdc:mga0a205_113677_c1 nmdc:mga0a205_113677_c1_553_2076 483
1477 3300050515 nmdc:mga0a205_135260_c1 nmdc:mga0a205_135260_c1_338_1885 483
1478 3300050515 nmdc:mga0a205_6425_c1 nmdc:mga0a205_6425_c1_107_1633 483
1479 3300053077 Ga0495601_0026658 Ga0495601_0026658_1254_2780 483
1480 3300053085 Ga0495619_0001504 Ga0495619_0001504_11273_12802 483
1481 3300053085 Ga0495619_0056017 Ga0495619_0056017_425_1966 483
1482 3300053096 Ga0500641_0000318 Ga0500641_0000318_57_1517 483
1483 3300053103 Ga0500555_020945 Ga0500555_020945_294_1778 483
1484 3300053104 Ga0500556_0000516 Ga0500556_0000516_23837_25345 483
1485 3300053108 Ga0500562_000079 Ga0500562_000079_2043_3518 483
1486 3300053139 Ga0500568_0001762 Ga0500568_0001762_8548_10056 483
1487 3300053153 Ga0500616_0000321 Ga0500616_0000321_43652_45187 483
1488 3300053730 Ga0500645_000067 Ga0500645_000067_34322_35857 483
1489 3300054114 Ga0501084_0001411 Ga0501084_0001411_6121_7608 483
1490 3300054114 Ga0501084_0014119 Ga0501084_0014119_430_1962 483
1491 3300054114 Ga0501084_0050769 Ga0501084_0050769_1656_3125 483
1492 3300059421 Ga0590071_000244 Ga0590071_000244_807_2333 483
1493 3300059423 Ga0590074_001600 Ga0590074_001600_223_1749 483
1494 3300059426 Ga0590077_001842 Ga0590077_001842_839_2365 483
1495 3300060353 Ga0501082_0000818 Ga0501082_0000818_24811_26343 483
1496 3300060353 Ga0501082_0026833 Ga0501082_0026833_119_1588 483
1497 3300060353 Ga0501082_0035484 Ga0501082_0035484_1018_2487 483
1498 3300060353 Ga0501082_0072626 Ga0501082_0072626_891_2432 483
1499 3300061734 Ga0530510_0000795 Ga0530510_0000795_2334_3866 483
1500 3300061734 Ga0530510_0040029 Ga0530510_0040029_1033_2502 483
1501 iso_pu_bacteria 2508501050 2508733103 483
1502 iso_pu_bacteria 2508501114 2509075401 483
1503 iso_pu_bacteria 2513237144 2513910409 483
1504 iso_pu_bacteria 2595698237 2596372309 483
1505 iso_pu_bacteria 2773857925 2774868515 483
1506 iso_pu_bacteria 2775506901 2776260314 483
1507 iso_pu_bacteria 2835312727 2835316854 483
1508 iso_pu_bacteria 2882456835 2882460496 483
1509 iso_pu_bacteria 2882806704 2882807415 483
1510 iso_pu_bacteria 2884298095 2884300246 483
1511 iso_pu_bacteria 2889306138 2889310925 483
1512 iso_pu_bacteria 2894232714 2894241423 483
1513 iso_pu_bacteria 2902330777 2902336743 483
1514 iso_pu_bacteria 2902405164 2902406169 483
1515 iso_pu_bacteria 2906427513 2906433600 483
1516 iso_pu_bacteria 2916007675 2916008976 483
1517 iso_pu_bacteria 2928125067 2928126832 483
1518 iso_pu_bacteria 8002060224 8002060579 483
1519 3300001979 JGI24740J21852_10003721 JGI24740J21852_100037215 484
1520 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002386 484
1521 3300002705 JGI25156J39149_1000094 JGI25156J39149_100009429 484
1522 3300002737 JGI25162J39368_1000177 JGI25162J39368_10001771 484
1523 3300002737 JGI25162J39368_1000803 JGI25162J39368_100080321 484
1524 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006787 484
1525 3300002739 JGI25158J39367_1000091 JGI25158J39367_10000919 484
1526 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004341 484
1527 3300002773 JGI25152J39213_1001312 JGI25152J39213_10013127 484
1528 3300002773 JGI25152J39213_1004814 JGI25152J39213_10048145 484
1529 3300002774 JGI25150J39212_1000012 JGI25150J39212_1000012178 484
1530 3300002774 JGI25150J39212_1004137 JGI25150J39212_10041373 484
1531 3300002987 JGI25159J45721_1000279 JGI25159J45721_10002796 484
1532 3300002987 JGI25159J45721_1000452 JGI25159J45721_10004529 484
1533 3300003187 JGI25151J46595_10000025 JGI25151J46595_10000025218 484
1534 3300003187 JGI25151J46595_10000250 JGI25151J46595_1000025028 484
1535 3300003187 JGI25151J46595_10003372 JGI25151J46595_100033725 484
1536 3300003214 JGI25165J46597_1000046 JGI25165J46597_100004673 484
1537 3300003214 JGI25165J46597_1000415 JGI25165J46597_10004151 484
1538 3300003214 JGI25165J46597_1001749 JGI25165J46597_100174910 484
1539 3300003215 JGI25153J46596_10000232 JGI25153J46596_100002327 484
1540 3300003215 JGI25153J46596_10000740 JGI25153J46596_1000074014 484
1541 3300003215 JGI25153J46596_10003437 JGI25153J46596_100034379 484
1542 3300003215 JGI25153J46596_10010628 JGI25153J46596_100106285 484
1543 3300003215 JGI25153J46596_10012063 JGI25153J46596_100120634 484
1544 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004675 484
1545 3300003354 JGI25160J50197_1001887 JGI25160J50197_10018879 484
1546 3300003354 JGI25160J50197_1005755 JGI25160J50197_10057551 484
1547 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003175 484
1548 3300003374 JGI25161J50226_1000074 JGI25161J50226_100007457 484
1549 3300003374 JGI25161J50226_1001359 JGI25161J50226_10013595 484
1550 3300003578 Ga0006562J51391_1019531 Ga0006562J51391_10195311 484
1551 3300003771 Ga0055526_1000495 Ga0055526_100049531 484
1552 3300003771 Ga0055526_1002214 Ga0055526_100221415 484
1553 3300003771 Ga0055526_1005759 Ga0055526_10057595 484
1554 3300003775 Ga0055524_1000136 Ga0055524_100013661 484
1555 3300003775 Ga0055524_1009780 Ga0055524_10097804 484
1556 3300003790 Ga0055528_1002867 Ga0055528_10028673 484
1557 3300003790 Ga0055528_1003099 Ga0055528_10030997 484
1558 3300003790 Ga0055528_1006186 Ga0055528_10061866 484
1559 3300003790 Ga0055528_1011059 Ga0055528_10110593 484
1560 3300003792 Ga0055540_1000111 Ga0055540_100011153 484
1561 3300003792 Ga0055540_1009887 Ga0055540_10098873 484
1562 3300004625 Ga0055543_1000008 Ga0055543_1000008174 484
1563 3300004625 Ga0055543_1000188 Ga0055543_100018830 484
1564 3300004625 Ga0055543_1002371 Ga0055543_10023715 484
1565 3300005262 Ga0065165_1000336 Ga0065165_100033647 484
1566 3300005262 Ga0065165_1013029 Ga0065165_10130293 484
1567 3300005262 Ga0065165_1014251 Ga0065165_10142513 484
1568 3300005327 Ga0070658_10014360 Ga0070658_100143605 484
1569 3300005335 Ga0070666_10056531 Ga0070666_100565312 484
1570 3300005336 Ga0070680_100014926 Ga0070680_1000149261 484
1571 3300005337 Ga0070682_100034035 Ga0070682_1000340352 484
1572 3300005435 Ga0070714_100013422 Ga0070714_1000134224 484
1573 3300005440 Ga0070705_100016501 Ga0070705_1000165013 484
1574 3300005455 Ga0070663_100004063 Ga0070663_1000040637 484
1575 3300005456 Ga0070678_100039171 Ga0070678_1000391712 484
1576 3300005458 Ga0070681_10020487 Ga0070681_100204875 484
1577 3300005471 Ga0070698_100010315 Ga0070698_10001031513 484
1578 3300005530 Ga0070679_100023127 Ga0070679_1000231276 484
1579 3300005539 Ga0068853_100020943 Ga0068853_1000209433 484
1580 3300005546 Ga0070696_100006660 Ga0070696_1000066603 484
1581 3300005547 Ga0070693_100077457 Ga0070693_1000774572 484
1582 3300005548 Ga0070665_100007375 Ga0070665_1000073756 484
1583 3300005548 Ga0070665_100018572 Ga0070665_1000185726 484
1584 3300005548 Ga0070665_100116629 Ga0070665_1001166291 484
1585 3300005841 Ga0068863_100115094 Ga0068863_1001150943 484
1586 3300005842 Ga0068858_100024077 Ga0068858_1000240772 484
1587 3300005843 Ga0068860_100115336 Ga0068860_1001153363 484
1588 3300005985 Ga0081539_10006821 Ga0081539_100068219 484
1589 3300006038 Ga0075365_10001131 Ga0075365_1000113110 484
1590 3300006038 Ga0075365_10037277 Ga0075365_100372772 484
1591 3300006177 Ga0075362_10036398 Ga0075362_100363982 484
1592 3300006186 Ga0075369_10007922 Ga0075369_100079222 484
1593 3300006195 Ga0075366_10002989 Ga0075366_100029895 484
1594 3300006237 Ga0097621_100000035 Ga0097621_10000003557 484
1595 3300006353 Ga0075370_10001381 Ga0075370_100013817 484
1596 3300006358 Ga0068871_100000287 Ga0068871_10000028726 484
1597 3300006358 Ga0068871_100005425 Ga0068871_1000054257 484
1598 3300006880 Ga0075429_100040699 Ga0075429_1000406994 484
1599 3300006881 Ga0068865_100012687 Ga0068865_1000126872 484
1600 3300009093 Ga0105240_10000278 Ga0105240_1000027863 484
1601 3300009093 Ga0105240_10135817 Ga0105240_101358172 484
1602 3300009098 Ga0105245_10060032 Ga0105245_100600323 484
1603 3300009147 Ga0114129_10074076 Ga0114129_100740762 484
1604 3300009176 Ga0105242_10009883 Ga0105242_100098836 484
1605 3300009177 Ga0105248_10154289 Ga0105248_101542891 484
1606 3300009545 Ga0105237_10000434 Ga0105237_1000043450 484
1607 3300009545 Ga0105237_10014258 Ga0105237_100142586 484
1608 3300009551 Ga0105238_10013292 Ga0105238_100132926 484
1609 3300009551 Ga0105238_10040503 Ga0105238_100405036 484
1610 3300009553 Ga0105249_10001350 Ga0105249_100013504 484
1611 3300009765 Ga0123341_1000175 Ga0123341_100017522 484
1612 3300010375 Ga0105239_10109529 Ga0105239_101095293 484
1613 3300010375 Ga0105239_10158602 Ga0105239_101586022 484
1614 3300013104 Ga0157370_10001488 Ga0157370_100014886 484
1615 3300013104 Ga0157370_10019342 Ga0157370_100193422 484
1616 3300013105 Ga0157369_10043077 Ga0157369_100430771 484
1617 3300013306 Ga0163162_10017589 Ga0163162_100175898 484
1618 3300013306 Ga0163162_10047442 Ga0163162_100474423 484
1619 3300014325 Ga0163163_10000007 Ga0163163_10000007195 484
1620 3300014325 Ga0163163_10001418 Ga0163163_1000141814 484
1621 3300014968 Ga0157379_10000463 Ga0157379_1000046322 484
1622 3300014968 Ga0157379_10014999 Ga0157379_100149993 484
1623 3300017792 Ga0163161_10025910 Ga0163161_100259102 484
1624 3300021384 Ga0213876_10062674 Ga0213876_100626742 484
1625 3300025206 Ga0209435_100011 Ga0209435_100011289 484
1626 3300025233 Ga0209437_100036 Ga0209437_10003665 484
1627 3300025233 Ga0209437_100086 Ga0209437_100086184 484
1628 3300025245 Ga0207425_1000012 Ga0207425_1000012380 484
1629 3300025245 Ga0207425_1000840 Ga0207425_100084013 484
1630 3300025245 Ga0207425_1003029 Ga0207425_10030296 484
1631 3300025245 Ga0207425_1007051 Ga0207425_10070514 484
1632 3300025245 Ga0207425_1008265 Ga0207425_10082652 484
1633 3300025246 Ga0209646_1000024 Ga0209646_1000024122 484
1634 3300025250 Ga0209026_1000030 Ga0209026_1000030122 484
1635 3300025253 Ga0209677_101617 Ga0209677_1016177 484
1636 3300025256 Ga0209759_1000011 Ga0209759_1000011289 484
1637 3300025258 Ga0209129_1000086 Ga0209129_1000086161 484
1638 3300025258 Ga0209129_1000123 Ga0209129_100012390 484
1639 3300025258 Ga0209129_1000316 Ga0209129_100031640 484
1640 3300025258 Ga0209129_1000563 Ga0209129_100056311 484
1641 3300025258 Ga0209129_1001248 Ga0209129_100124811 484
1642 3300025258 Ga0209129_1004270 Ga0209129_10042704 484
1643 3300025258 Ga0209129_1006734 Ga0209129_10067344 484
1644 3300025261 Ga0209233_1000013 Ga0209233_1000013140 484
1645 3300025261 Ga0209233_1000110 Ga0209233_100011063 484
1646 3300025261 Ga0209233_1000166 Ga0209233_100016665 484
1647 3300025261 Ga0209233_1000350 Ga0209233_100035045 484
1648 3300025273 Ga0209673_1000091 Ga0209673_1000091188 484
1649 3300025273 Ga0209673_1000919 Ga0209673_10009196 484
1650 3300025273 Ga0209673_1003122 Ga0209673_10031224 484
1651 3300025273 Ga0209673_1003237 Ga0209673_10032379 484
1652 3300025273 Ga0209673_1004304 Ga0209673_10043042 484
1653 3300025273 Ga0209673_1007565 Ga0209673_10075652 484
1654 3300025284 Ga0209130_1000002 Ga0209130_100000224 484
1655 3300025284 Ga0209130_1000088 Ga0209130_100008821 484
1656 3300025291 Ga0209675_1002087 Ga0209675_10020871 484
1657 3300025294 Ga0209025_1000024 Ga0209025_1000024380 484
1658 3300025294 Ga0209025_1000407 Ga0209025_100040741 484
1659 3300025294 Ga0209025_1001595 Ga0209025_100159520 484
1660 3300025294 Ga0209025_1003038 Ga0209025_10030389 484
1661 3300025294 Ga0209025_1012456 Ga0209025_10124564 484
1662 3300025294 Ga0209025_1018409 Ga0209025_10184092 484
1663 3300025294 Ga0209025_1027582 Ga0209025_10275821 484
1664 3300025295 Ga0209564_1000077 Ga0209564_100007744 484
1665 3300025295 Ga0209564_1000845 Ga0209564_100084510 484
1666 3300025295 Ga0209564_1001820 Ga0209564_100182018 484
1667 3300025297 Ga0209758_1000046 Ga0209758_1000046161 484
1668 3300025297 Ga0209758_1000336 Ga0209758_100033647 484
1669 3300025297 Ga0209758_1000877 Ga0209758_100087740 484
1670 3300025297 Ga0209758_1001026 Ga0209758_100102632 484
1671 3300025297 Ga0209758_1001612 Ga0209758_100161225 484
1672 3300025297 Ga0209758_1001968 Ga0209758_100196814 484
1673 3300025297 Ga0209758_1002567 Ga0209758_100256711 484
1674 3300025298 Ga0209050_1004231 Ga0209050_100423110 484
1675 3300025299 Ga0209256_1000057 Ga0209256_100005744 484
1676 3300025299 Ga0209256_1002068 Ga0209256_100206810 484
1677 3300025299 Ga0209256_1004851 Ga0209256_10048516 484
1678 3300025299 Ga0209256_1007494 Ga0209256_10074944 484
1679 3300025299 Ga0209256_1010951 Ga0209256_10109512 484
1680 3300025302 Ga0207426_1000012 Ga0207426_100001276 484
1681 3300025302 Ga0207426_1000013 Ga0207426_100001324 484
1682 3300025302 Ga0207426_1000063 Ga0207426_1000063160 484
1683 3300025302 Ga0207426_1000172 Ga0207426_1000172144 484
1684 3300025303 Ga0209051_1000084 Ga0209051_100008482 484
1685 3300025303 Ga0209051_1001391 Ga0209051_10013916 484
1686 3300025303 Ga0209051_1026806 Ga0209051_10268062 484
1687 3300025304 Ga0209257_1005200 Ga0209257_10052005 484
1688 3300025903 Ga0207680_10063877 Ga0207680_100638772 484
1689 3300025904 Ga0207647_10017108 Ga0207647_100171084 484
1690 3300025909 Ga0207705_10036046 Ga0207705_100360462 484
1691 3300025913 Ga0207695_10000376 Ga0207695_1000037663 484
1692 3300025914 Ga0207671_10000732 Ga0207671_1000073224 484
1693 3300025914 Ga0207671_10084860 Ga0207671_100848603 484
1694 3300025917 Ga0207660_10026246 Ga0207660_100262463 484
1695 3300025917 Ga0207660_10114801 Ga0207660_101148012 484
1696 3300025919 Ga0207657_10047741 Ga0207657_100477413 484
1697 3300025921 Ga0207652_10060055 Ga0207652_100600552 484
1698 3300025924 Ga0207694_10044342 Ga0207694_100443422 484
1699 3300025924 Ga0207694_10073634 Ga0207694_100736343 484
1700 3300025934 Ga0207686_10021670 Ga0207686_100216704 484
1701 3300025941 Ga0207711_10047847 Ga0207711_100478471 484
1702 3300025941 Ga0207711_10095956 Ga0207711_100959562 484
1703 3300025949 Ga0207667_10113916 Ga0207667_101139162 484
1704 3300026035 Ga0207703_10062481 Ga0207703_100624813 484
1705 3300026035 Ga0207703_10187356 Ga0207703_101873562 484
1706 3300026067 Ga0207678_10002995 Ga0207678_100029956 484
1707 3300026067 Ga0207678_10022801 Ga0207678_100228014 484
1708 3300026078 Ga0207702_10138114 Ga0207702_101381142 484
1709 3300026088 Ga0207641_10010320 Ga0207641_100103202 484
1710 3300026116 Ga0207674_10014318 Ga0207674_100143187 484
1711 3300026121 Ga0207683_10063991 Ga0207683_100639913 484
1712 3300027312 Ga0209371_1000853 Ga0209371_10008531 484
1713 3300028379 Ga0268266_10084451 Ga0268266_100844512 484
1714 3300028379 Ga0268266_10131212 Ga0268266_101312121 484
1715 3300028381 Ga0268264_10032326 Ga0268264_100323262 484
1716 3300028381 Ga0268264_10105159 Ga0268264_101051593 484
1717 3300028577 Ga0265318_10007162 Ga0265318_100071623 484
1718 3300028666 Ga0265336_10015103 Ga0265336_100151033 484
1719 3300028794 Ga0307515_10018100 Ga0307515_100181006 484
1720 3300028800 Ga0265338_10003950 Ga0265338_1000395017 484
1721 3300030500 Ga0268256_1015416 Ga0268256_10154162 484
1722 3300031239 Ga0265328_10000013 Ga0265328_1000001362 484
1723 3300031239 Ga0265328_10002663 Ga0265328_100026635 484
1724 3300031241 Ga0265325_10007437 Ga0265325_100074373 484
1725 3300031249 Ga0265339_10007637 Ga0265339_100076372 484
1726 3300031250 Ga0265331_10033495 Ga0265331_100334952 484
1727 3300031344 Ga0265316_10033002 Ga0265316_100330023 484
1728 3300031456 Ga0307513_10022694 Ga0307513_100226943 484
1729 3300031595 Ga0265313_10000225 Ga0265313_1000022554 484
1730 3300031595 Ga0265313_10003110 Ga0265313_100031109 484
1731 3300031595 Ga0265313_10008225 Ga0265313_100082251 484
1732 3300031711 Ga0265314_10012052 Ga0265314_100120522 484
1733 3300031711 Ga0265314_10019788 Ga0265314_100197882 484
1734 3300031711 Ga0265314_10033132 Ga0265314_100331322 484
1735 3300031711 Ga0265314_10080792 Ga0265314_100807921 484
1736 3300031712 Ga0265342_10002601 Ga0265342_1000260111 484
1737 3300031712 Ga0265342_10033245 Ga0265342_100332452 484
1738 3300031730 Ga0307516_10118374 Ga0307516_101183742 484
1739 3300031731 Ga0307405_10000238 Ga0307405_1000023817 484
1740 3300031731 Ga0307405_10051962 Ga0307405_100519622 484
1741 3300031901 Ga0307406_10039579 Ga0307406_100395791 484
1742 3300031911 Ga0307412_10022458 Ga0307412_100224582 484
1743 3300032002 Ga0307416_100062106 Ga0307416_1000621062 484
1744 3300037068 Ga0373925_0028714 Ga0373925_0028714_1687_3186 484
1745 3300037068 Ga0373925_0100556 Ga0373925_0100556_330_1829 484
1746 3300037466 Ga0395898_0010689 Ga0395898_0010689_1791_3269 484
1747 3300037853 Ga0436364_0049821 Ga0436364_0049821_3994_5523 484
1748 3300037853 Ga0436364_0758380 Ga0436364_0758380_1626_3167 484
1749 3300038443 Ga0395901_0049699 Ga0395901_0049699_2774_4237 484
1750 3300039438 Ga0436360_0064975 Ga0436360_0064975_205_1665 484
1751 3300039450 Ga0436363_0094623 Ga0436363_0094623_1663_3150 484
1752 3300042003 Ga0439443_002251 Ga0439443_002251_185_1660 484
1753 3300044693 Ga0466961_0132196 Ga0466961_0132196_43_1530 484
1754 3300044694 Ga0466963_0005485 Ga0466963_0005485_2536_3999 484
1755 3300044712 Ga0453684_0010499 Ga0453684_0010499_4336_5823 484
1756 3300044712 Ga0453684_0054917 Ga0453684_0054917_513_1973 484
1757 3300044712 Ga0453684_0077994 Ga0453684_0077994_1546_3006 484
1758 3300045051 Ga0451576_0000786 Ga0451576_0000786_54993_56453 484
1759 3300046460 Ga0495638_0000299 Ga0495638_0000299_19493_20977 484
1760 3300046474 Ga0495605_0001136 Ga0495605_0001136_8556_10040 484
1761 3300046492 Ga0495585_0004756 Ga0495585_0004756_1599_3083 484
1762 3300046506 Ga0495583_0011497 Ga0495583_0011497_2185_3669 484
1763 3300046518 Ga0495631_0002646 Ga0495631_0002646_7127_8611 484
1764 3300046522 Ga0495643_0063026 Ga0495643_0063026_53_1537 484
1765 3300046660 Ga0495625_0003388 Ga0495625_0003388_805_2289 484
1766 3300046660 Ga0495625_0110757 Ga0495625_0110757_136_1623 484
1767 3300046665 Ga0495661_0087442 Ga0495661_0087442_228_1712 484
1768 3300046810 Ga0495660_0087652 Ga0495660_0087652_105_1598 484
1769 3300047472 Ga0495686_0000688 Ga0495686_0000688_6345_7844 484
1770 3300048903 Ga0496100_0012373 Ga0496100_0012373_2503_4017 484
1771 3300048903 Ga0496100_0070581 Ga0496100_0070581_642_2135 484
1772 3300048904 Ga0496101_0001619 Ga0496101_0001619_11138_12637 484
1773 3300048904 Ga0496101_0087465 Ga0496101_0087465_290_1789 484
1774 3300048905 Ga0496102_0021225 Ga0496102_0021225_2475_3974 484
1775 3300048905 Ga0496102_0053604 Ga0496102_0053604_1822_3321 484
1776 3300048905 Ga0496102_0103128 Ga0496102_0103128_176_1690 484
1777 3300048906 Ga0496103_0003094 Ga0496103_0003094_1170_2684 484
1778 3300048906 Ga0496103_0037921 Ga0496103_0037921_615_2114 484
1779 3300048907 Ga0496104_0000783 Ga0496104_0000783_6601_8100 484
1780 3300048907 Ga0496104_0009040 Ga0496104_0009040_4444_5943 484
1781 3300048907 Ga0496104_0048166 Ga0496104_0048166_2427_3923 484
1782 3300048907 Ga0496104_0187158 Ga0496104_0187158_433_1947 484
1783 3300048908 Ga0496105_0000089 Ga0496105_0000089_24831_26357 484
1784 3300048908 Ga0496105_0000952 Ga0496105_0000952_16576_18075 484
1785 3300048908 Ga0496105_0031174 Ga0496105_0031174_1702_3201 484
1786 3300048908 Ga0496105_0044540 Ga0496105_0044540_598_2106 484
1787 3300048909 Ga0496106_0000259 Ga0496106_0000259_13980_15464 484
1788 3300048909 Ga0496106_0006157 Ga0496106_0006157_7005_8519 484
1789 3300048910 Ga0496107_0005386 Ga0496107_0005386_6448_7962 484
1790 3300048910 Ga0496107_0052460 Ga0496107_0052460_616_2115 484
1791 3300048911 Ga0496108_0000484 Ga0496108_0000484_28679_30178 484
1792 3300048911 Ga0496108_0025654 Ga0496108_0025654_2382_3881 484
1793 3300048911 Ga0496108_0054649 Ga0496108_0054649_108_1604 484
1794 3300048912 Ga0496109_0001923 Ga0496109_0001923_9241_10740 484
1795 3300048912 Ga0496109_0069800 Ga0496109_0069800_1361_2860 484
1796 3300048913 Ga0496110_0002592 Ga0496110_0002592_5460_6959 484
1797 3300048913 Ga0496110_0053842 Ga0496110_0053842_980_2479 484
1798 3300048913 Ga0496110_0130369 Ga0496110_0130369_441_1934 484
1799 3300048914 Ga0496111_0001221 Ga0496111_0001221_11127_12626 484
1800 3300048914 Ga0496111_0050990 Ga0496111_0050990_1249_2748 484
1801 3300048915 Ga0496112_0032679 Ga0496112_0032679_3249_4748 484
1802 3300048916 Ga0496113_0001045 Ga0496113_0001045_5390_6889 484
1803 3300048917 Ga0496114_0011846 Ga0496114_0011846_970_2469 484
1804 3300048918 Ga0496115_0003035 Ga0496115_0003035_192_1691 484
1805 3300048918 Ga0496115_0056005 Ga0496115_0056005_284_1783 484
1806 3300048919 Ga0496116_0001010 Ga0496116_0001010_11606_13090 484
1807 3300048919 Ga0496116_0028558 Ga0496116_0028558_657_2141 484
1808 3300048920 Ga0496117_0070138 Ga0496117_0070138_513_2006 484
1809 3300048922 Ga0496119_0001161 Ga0496119_0001161_28382_29878 484
1810 3300048924 Ga0496121_0008494 Ga0496121_0008494_10509_11993 484
1811 3300048925 Ga0496122_0001682 Ga0496122_0001682_2615_4099 484
1812 3300048926 Ga0496123_0045092 Ga0496123_0045092_1370_2854 484
1813 3300048927 Ga0496124_0006765 Ga0496124_0006765_1912_3396 484
1814 3300048927 Ga0496124_0168793 Ga0496124_0168793_154_1638 484
1815 3300048928 Ga0496125_0002192 Ga0496125_0002192_24448_25932 484
1816 3300048929 Ga0496126_0038693 Ga0496126_0038693_2770_4254 484
1817 3300048929 Ga0496126_0085321 Ga0496126_0085321_111_1604 484
1818 3300049459 Ga0495678_013743 Ga0495678_013743_587_2071 484
1819 3300049568 Ga0501031_0000663 Ga0501031_0000663_7996_9519 484
1820 3300049570 Ga0501033_0016245 Ga0501033_0016245_1948_3597 484
1821 3300049570 Ga0501033_0030937 Ga0501033_0030937_470_1957 484
1822 3300049570 Ga0501033_0039284 Ga0501033_0039284_848_2371 484
1823 3300049571 Ga0501034_0049582 Ga0501034_0049582_1356_2837 484
1824 3300049571 Ga0501034_0053892 Ga0501034_0053892_1554_3047 484
1825 3300049571 Ga0501034_0121086 Ga0501034_0121086_682_2181 484
1826 3300049571 Ga0501034_0276804 Ga0501034_0276804_21_1502 484
1827 3300049572 Ga0501036_0000589 Ga0501036_0000589_13337_14860 484
1828 3300049572 Ga0501036_0122132 Ga0501036_0122132_18_1505 484
1829 3300049573 Ga0501037_0007891 Ga0501037_0007891_5468_6991 484
1830 3300049573 Ga0501037_0067630 Ga0501037_0067630_630_2117 484
1831 3300049574 Ga0501038_0000258 Ga0501038_0000258_30986_32509 484
1832 3300049574 Ga0501038_0025378 Ga0501038_0025378_2153_3802 484
1833 3300049575 Ga0501039_0005222 Ga0501039_0005222_4252_5775 484
1834 3300049579 Ga0501043_0003974 Ga0501043_0003974_46_1569 484
1835 3300049579 Ga0501043_0040222 Ga0501043_0040222_1322_2809 484
1836 3300049580 Ga0501046_0002960 Ga0501046_0002960_848_2371 484
1837 3300049580 Ga0501046_0004133 Ga0501046_0004133_4377_5876 484
1838 3300049580 Ga0501046_0116186 Ga0501046_0116186_359_1840 484
1839 3300049581 Ga0501047_0000525 Ga0501047_0000525_8911_10434 484
1840 3300049581 Ga0501047_0005645 Ga0501047_0005645_2149_3636 484
1841 3300049581 Ga0501047_0008046 Ga0501047_0008046_3261_4742 484
1842 3300049581 Ga0501047_0061522 Ga0501047_0061522_1855_3345 484
1843 3300049581 Ga0501047_0150695 Ga0501047_0150695_158_1618 484
1844 3300049581 Ga0501047_0275858 Ga0501047_0275858_27_1508 484
1845 3300049582 Ga0501048_0000023 Ga0501048_0000023_7328_8842 484
1846 3300049582 Ga0501048_0001156 Ga0501048_0001156_10218_11741 484
1847 3300049583 Ga0501067_0002006 Ga0501067_0002006_3866_5347 484
1848 3300049583 Ga0501067_0006056 Ga0501067_0006056_2305_3816 484
1849 3300049583 Ga0501067_0024837 Ga0501067_0024837_671_2152 484
1850 3300049584 Ga0501068_0004696 Ga0501068_0004696_46_1569 484
1851 3300049585 Ga0501069_0001383 Ga0501069_0001383_2146_3669 484
1852 3300049586 Ga0501070_0006154 Ga0501070_0006154_1358_2881 484
1853 3300049586 Ga0501070_0049262 Ga0501070_0049262_1880_3370 484
1854 3300049587 Ga0501071_0002624 Ga0501071_0002624_2627_4150 484
1855 3300049589 Ga0501073_0006393 Ga0501073_0006393_5837_7360 484
1856 3300049590 Ga0501074_0004249 Ga0501074_0004249_5837_7360 484
1857 3300049590 Ga0501074_0013667 Ga0501074_0013667_3601_5082 484
1858 3300049741 Ga0501079_0081380 Ga0501079_0081380_539_2020 484
1859 3300049742 Ga0501080_0073349 Ga0501080_0073349_356_1837 484
1860 3300049742 Ga0501080_0103906 Ga0501080_0103906_292_1773 484
1861 3300049742 Ga0501080_0143597 Ga0501080_0143597_712_2193 484
1862 3300049744 Ga0501083_0004086 Ga0501083_0004086_3942_5423 484
1863 3300049744 Ga0501083_0015783 Ga0501083_0015783_1058_2539 484
1864 3300049744 Ga0501083_0041890 Ga0501083_0041890_346_1833 484
1865 3300049744 Ga0501083_0064748 Ga0501083_0064748_276_1757 484
1866 3300049744 Ga0501083_0128889 Ga0501083_0128889_114_1595 484
1867 3300049822 Ga0501035_0003351 Ga0501035_0003351_495_2018 484
1868 3300049822 Ga0501035_0027106 Ga0501035_0027106_16_1500 484
1869 3300049822 Ga0501035_0036030 Ga0501035_0036030_266_1915 484
1870 3300049823 Ga0501044_0003999 Ga0501044_0003999_10947_12437 484
1871 3300049823 Ga0501044_0057549 Ga0501044_0057549_2417_3904 484
1872 3300049823 Ga0501044_0089076 Ga0501044_0089076_100_1749 484
1873 3300049823 Ga0501044_0146629 Ga0501044_0146629_291_1772 484
1874 3300050493 nmdc:mga0k408_30749_c1 nmdc:mga0k408_30749_c1_740_2239 484
1875 3300050516 nmdc:mga0sz30_15265_c1 nmdc:mga0sz30_15265_c1_989_2473 484
1876 3300053080 Ga0500635_0016211 Ga0500635_0016211_669_2156 484
1877 3300053087 Ga0500643_000014 Ga0500643_000014_85560_87047 484
1878 3300053087 Ga0500643_024660 Ga0500643_024660_58_1527 484
1879 3300053103 Ga0500555_024282 Ga0500555_024282_77_1564 484
1880 3300053109 Ga0500569_013973 Ga0500569_013973_31_1515 484
1881 3300053139 Ga0500568_0001043 Ga0500568_0001043_12664_14148 484
1882 3300053140 Ga0500573_0000004 Ga0500573_0000004_133536_135023 484
1883 3300053151 Ga0500604_0000004 Ga0500604_0000004_68307_69767 484
1884 3300053153 Ga0500616_0000195 Ga0500616_0000195_69071_70531 484
1885 3300053153 Ga0500616_0002540 Ga0500616_0002540_11745_13229 484
1886 3300053153 Ga0500616_0044396 Ga0500616_0044396_624_2108 484
1887 3300053177 Ga0500636_0007386 Ga0500636_0007386_2091_3668 484
1888 3300054114 Ga0501084_0107055 Ga0501084_0107055_528_2009 484
1889 3300059508 Ga0587088_005933 Ga0587088_005933_71_1555 484
1890 3300060353 Ga0501082_0000994 Ga0501082_0000994_8692_10215 484
1891 3300060353 Ga0501082_0024954 Ga0501082_0024954_3010_4491 484
1892 3300060353 Ga0501082_0053938 Ga0501082_0053938_1112_2593 484
1893 3300060353 Ga0501082_0069930 Ga0501082_0069930_1101_2600 484
1894 iso_pu_bacteria 2509276021 2509388367 484
1895 iso_pu_bacteria 2509276033 2509443931 484
1896 iso_pu_bacteria 2510065019 2510131525 484
1897 iso_pu_bacteria 2510461076 2510897827 484
1898 iso_pu_bacteria 2510917022 2511136244 484
1899 iso_pu_bacteria 2510917028 2511185645 484
1900 iso_pu_bacteria 2510917030 2511196784 484
1901 iso_pu_bacteria 2513237084 2513571111 484
1902 iso_pu_bacteria 2513237085 2513579343 484
1903 iso_pu_bacteria 2513237088 2513596769 484
1904 iso_pu_bacteria 2513237093 2513632198 484
1905 iso_pu_bacteria 2513237103 2513713308 484
1906 iso_pu_bacteria 2513237138 2513871626 484
1907 iso_pu_bacteria 2513237146 2513928360 484
1908 iso_pu_bacteria 2513237162 2514020966 484
1909 iso_pu_bacteria 2515075009 2515110455 484
1910 iso_pu_bacteria 2515154113 2515636943 484
1911 iso_pu_bacteria 2515154114 2515642884 484
1912 iso_pu_bacteria 2515154116 2515659560 484
1913 iso_pu_bacteria 2515154134 2515743033 484
1914 iso_pu_bacteria 2516653077 2517039148 484
1915 iso_pu_bacteria 2516653085 2517079402 484
1916 iso_pu_bacteria 2517093000 2517093345 484
1917 iso_pu_bacteria 2517287029 2517409574 484
1918 iso_pu_bacteria 2524023209 2524457552 484
1919 iso_pu_bacteria 2524023250 2524610258 484
1920 iso_pu_bacteria 2529292951 2530647749 484
1921 iso_pu_bacteria 2534681796 2535515135 484
1922 iso_pu_bacteria 2582581294 2585203717 484
1923 iso_pu_bacteria 2582581298 2585227109 484
1924 iso_pu_bacteria 2582581299 2585229028 484
1925 iso_pu_bacteria 2582581304 2585259533 484
1926 iso_pu_bacteria 2582581307 2585275407 484
1927 iso_pu_bacteria 2582581308 2585282263 484
1928 iso_pu_bacteria 2582581315 2585325944 484
1929 iso_pu_bacteria 2582581316 2585330112 484
1930 iso_pu_bacteria 2582581867 2585398509 484
1931 iso_pu_bacteria 2585427526 2585528359 484
1932 iso_pu_bacteria 2585427527 2585536539 484
1933 iso_pu_bacteria 2585427528 2585539747 484
1934 iso_pu_bacteria 2585427529 2585550466 484
1935 iso_pu_bacteria 2585427530 2585557017 484
1936 iso_pu_bacteria 2585427531 2585560150 484
1937 iso_pu_bacteria 2585427590 2585819344 484
1938 iso_pu_bacteria 2585427593 2585837732 484
1939 iso_pu_bacteria 2585427594 2585844610 484
1940 iso_pu_bacteria 2585427608 2585901578 484
1941 iso_pu_bacteria 2585427609 2585905669 484
1942 iso_pu_bacteria 2585428125 2587979215 484
1943 iso_pu_bacteria 2599185170 2599419126 484
1944 iso_pu_bacteria 2600254933 2600374765 484
1945 iso_pu_bacteria 2615840624 2616295725 484
1946 iso_pu_bacteria 2615840626 2616306287 484
1947 iso_pu_bacteria 2615840698 2616553447 484
1948 iso_pu_bacteria 2617270742 2617383702 484
1949 iso_pu_bacteria 2643221599 2644007392 484
1950 iso_pu_bacteria 2643221634 2644190642 484
1951 iso_pu_bacteria 2643221643 2644241505 484
1952 iso_pu_bacteria 2643221734 2644735652 484
1953 iso_pu_bacteria 2667528174 2671112404 484
1954 iso_pu_bacteria 2718217882 2719179626 484
1955 iso_pu_bacteria 2718217927 2719384233 484
1956 iso_pu_bacteria 2718217997 2719663970 484
1957 iso_pu_bacteria 2718218009 2719730296 484
1958 iso_pu_bacteria 2718218199 2720490389 484
1959 iso_pu_bacteria 2718218232 2720611767 484
1960 iso_pu_bacteria 2718218233 2720618624 484
1961 iso_pu_bacteria 2718218235 2720630023 484
1962 iso_pu_bacteria 2718218269 2720773718 484
1963 iso_pu_bacteria 2718218363 2721145719 484
1964 iso_pu_bacteria 2718218365 2721157251 484
1965 iso_pu_bacteria 2718218366 2721162598 484
1966 iso_pu_bacteria 2718218423 2721397947 484
1967 iso_pu_bacteria 2721755514 2722838768 484
1968 iso_pu_bacteria 2721755556 2723025388 484
1969 iso_pu_bacteria 2721755684 2723558971 484
1970 iso_pu_bacteria 2721755685 2723565578 484
1971 iso_pu_bacteria 2721755809 2724036757 484
1972 iso_pu_bacteria 2721755810 2724043052 484
1973 iso_pu_bacteria 2721755819 2724088325 484
1974 iso_pu_bacteria 2721755822 2724102843 484
1975 iso_pu_bacteria 2721755823 2724108710 484
1976 iso_pu_bacteria 2724679232 2725950192 484
1977 iso_pu_bacteria 2728369352 2730106324 484
1978 iso_pu_bacteria 2728369365 2730162863 484
1979 iso_pu_bacteria 2728369397 2730296883 484
1980 iso_pu_bacteria 2738541293 2738803791 484
1981 iso_pu_bacteria 2738541333 2739034608 484
1982 iso_pu_bacteria 2765235942 2766065647 484
1983 iso_pu_bacteria 2775507266 2778174206 484
1984 iso_pu_bacteria 2791355256 2793295160 484
1985 iso_pu_bacteria 2791355259 2793315373 484
1986 iso_pu_bacteria 2791355260 2793320232 484
1987 iso_pu_bacteria 2791355261 2793326099 484
1988 iso_pu_bacteria 2791355262 2793332486 484
1989 iso_pu_bacteria 2791355263 2793341749 484
1990 iso_pu_bacteria 2791355264 2793350799 484
1991 iso_pu_bacteria 2791355265 2793353324 484
1992 iso_pu_bacteria 2791355266 2793362717 484
1993 iso_pu_bacteria 2791355267 2793364729 484
1994 iso_pu_bacteria 2802429605 2805927529 484
1995 iso_pu_bacteria 2802429606 2805932314 484
1996 iso_pu_bacteria 2802429633 2806043905 484
1997 iso_pu_bacteria 2802429634 2806052277 484
1998 iso_pu_bacteria 2802429635 2806058578 484
1999 iso_pu_bacteria 2802429636 2806067075 484
2000 iso_pu_bacteria 2802429637 2806074819 484
2001 iso_pu_bacteria 2818991448 2819608369 484
2002 iso_pu_bacteria 2818991453 2819643551 484
2003 iso_pu_bacteria 2828305725 2828308185 484
2004 iso_pu_bacteria 2838016132 2838022177 484
2005 iso_pu_bacteria 2838022645 2838024588 484
2006 iso_pu_bacteria 2838029111 2838029259 484
2007 iso_pu_bacteria 2838035591 2838037187 484
2008 iso_pu_bacteria 2838042994 2838044362 484
2009 iso_pu_bacteria 2838048938 2838051420 484
2010 iso_pu_bacteria 2838061910 2838066635 484
2011 iso_pu_bacteria 2838068647 2838073688 484
2012 iso_pu_bacteria 2838661181 2838663623 484
2013 iso_pu_bacteria 2838668709 2838672338 484
2014 iso_pu_bacteria 2838680041 2838680640 484
2015 iso_pu_bacteria 2838686498 2838692695 484
2016 iso_pu_bacteria 2838694306 2838695327 484
2017 iso_pu_bacteria 2838701080 2838703919 484
2018 iso_pu_bacteria 2838707686 2838708703 484
2019 iso_pu_bacteria 2838729681 2838732767 484
2020 iso_pu_bacteria 2838742623 2838745662 484
2021 iso_pu_bacteria 2841760612 2841761925 484
2022 iso_pu_bacteria 2841851746 2841855305 484
2023 iso_pu_bacteria 2841864319 2841866757 484
2024 iso_pu_bacteria 2841911363 2841913562 484
2025 iso_pu_bacteria 2841917233 2841919309 484
2026 iso_pu_bacteria 2842077413 2842080062 484
2027 iso_pu_bacteria 2842110456 2842112261 484
2028 iso_pu_bacteria 2842118031 2842120682 484
2029 iso_pu_bacteria 2842146304 2842148289 484
2030 iso_pu_bacteria 2842156927 2842161664 484
2031 iso_pu_bacteria 2842163707 2842170068 484
2032 iso_pu_bacteria 2842180545 2842185281 484
2033 iso_pu_bacteria 2842192696 2842192959 484
2034 iso_pu_bacteria 2842198810 2842200307 484
2035 iso_pu_bacteria 2842205361 2842206873 484
2036 iso_pu_bacteria 2842217011 2842218737 484
2037 iso_pu_bacteria 2842229732 2842233220 484
2038 iso_pu_bacteria 2842237096 2842238115 484
2039 iso_pu_bacteria 2842243621 2842248777 484
2040 iso_pu_bacteria 2842250916 2842253354 484
2041 iso_pu_bacteria 2842257432 2842261920 484
2042 iso_pu_bacteria 2842264693 2842267386 484
2043 iso_pu_bacteria 2842271015 2842277016 484
2044 iso_pu_bacteria 2842278818 2842280434 484
2045 iso_pu_bacteria 2842285085 2842289381 484
2046 iso_pu_bacteria 2842291075 2842293722 484
2047 iso_pu_bacteria 2842298080 2842300833 484
2048 iso_pu_bacteria 2842304105 2842306428 484
2049 iso_pu_bacteria 2842311132 2842312568 484
2050 iso_pu_bacteria 2842317721 2842322601 484
2051 iso_pu_bacteria 2842341865 2842343021 484
2052 iso_pu_bacteria 2842357229 2842358047 484
2053 iso_pu_bacteria 2842363717 2842367256 484
2054 iso_pu_bacteria 2842370503 2842371103 484
2055 iso_pu_bacteria 2842377471 2842380119 484
2056 iso_pu_bacteria 2842384541 2842387190 484
2057 iso_pu_bacteria 2842395702 2842401219 484
2058 iso_pu_bacteria 2842402390 2842406729 484
2059 iso_pu_bacteria 2842409023 2842413775 484
2060 iso_pu_bacteria 2842415677 2842420263 484
2061 iso_pu_bacteria 2842422224 2842427136 484
2062 iso_pu_bacteria 2842428310 2842431362 484
2063 iso_pu_bacteria 2842434925 2842437697 484
2064 iso_pu_bacteria 2842441272 2842444512 484
2065 iso_pu_bacteria 2842447887 2842450258 484
2066 iso_pu_bacteria 2842462802 2842465660 484
2067 iso_pu_bacteria 2842469257 2842472470 484
2068 iso_pu_bacteria 2842475841 2842476311 484
2069 iso_pu_bacteria 2842482326 2842482388 484
2070 iso_pu_bacteria 2842489311 2842492404 484
2071 iso_pu_bacteria 2842495871 2842501963 484
2072 iso_pu_bacteria 2842502639 2842502787 484
2073 iso_pu_bacteria 2842509118 2842509243 484
2074 iso_pu_bacteria 2842775625 2842780107 484
2075 iso_pu_bacteria 2844104063 2844104950 484
2076 iso_pu_bacteria 2844454524 2844455921 484
2077 iso_pu_bacteria 2851246043 2851247938 484
2078 iso_pu_bacteria 2852387548 2852388520 484
2079 iso_pu_bacteria 2857516855 2857522143 484
2080 iso_pu_bacteria 2919100787 2919101296 484
2081 iso_pu_bacteria 2919408235 2919408838 484
2082 iso_pu_bacteria 2923556063 2923557237 484
2083 iso_pu_bacteria 2933016740 2933019052 484
2084 iso_pu_bacteria 2933570622 2933573497 484
2085 iso_pu_bacteria 2933586486 2933587590 484
2086 iso_pu_bacteria 2933599457 2933604116 484
2087 iso_pu_bacteria 2935894831 2935895850 484
2088 iso_pu_bacteria 2935901341 2935907707 484
2089 iso_pu_bacteria 2936367885 2936368870 484
2090 iso_pu_bacteria 2936375103 2936377050 484
2091 iso_pu_bacteria 2936381700 2936383797 484
2092 iso_pu_bacteria 2939669807 2939671237 484
2093 iso_pu_bacteria 2996887358 2996892140 484
2094 iso_pu_bacteria 2996893221 2996893513 484
2095 iso_pu_bacteria 3005409236 3005411270 484
2096 iso_pu_bacteria 3005416602 3005422774 484
2097 iso_pu_bacteria 3005445848 3005446223 484
2098 iso_pu_bacteria 3005452660 3005452878 484
2099 iso_pu_bacteria 639633055 639646728 484
2100 iso_pu_bacteria 8005258706 8005263533 484
2101 iso_pu_bacteria 8005275841 8005278947 484
2102 iso_pu_bacteria 8005282627 8005283636 484
2103 iso_pu_bacteria 8005289223 8005291024 484
2104 iso_pu_bacteria 8005301065 8005303901 484
2105 iso_pu_bacteria 8005307578 8005308720 484
2106 iso_pu_bacteria 8005314921 8005321690 484
2107 iso_pu_bacteria 8005321885 8005326667 484
2108 iso_pu_bacteria 8005376324 8005377377 484
2109 iso_pu_bacteria 8005382845 8005387236 484
2110 iso_pu_bacteria 8005395548 8005401995 484
2111 iso_pu_bacteria 8005430974 8005432988 484
2112 iso_pu_bacteria 8005460587 8005461094 484
2113 iso_pu_bacteria 8005484373 8005486104 484
2114 iso_pu_bacteria 8005497431 8005498712 484
2115 iso_pu_bacteria 8005542996 8005543810 484
2116 iso_pu_bacteria 8005556819 8005560688 484
2117 iso_pu_bacteria 8005563573 8005569670 484
2118 iso_pu_bacteria 8005570704 8005576983 484
2119 iso_pu_bacteria 8005619151 8005619907 484
2120 iso_pu_bacteria 8005626139 8005628504 484
2121 iso_pu_bacteria 8005645114 8005650184 484
2122 iso_pu_bacteria 8005668836 8005670123 484
2123 iso_pu_bacteria 8005682033 8005685081 484
2124 iso_pu_bacteria 8005688590 8005690329 484
2125 iso_pu_bacteria 8005695170 8005700323 484
2126 iso_pu_bacteria 8018127388 8018133186 484
2127 iso_pu_bacteria 8018163183 8018167842 484
2128 iso_pu_bacteria 8018176218 8018182074 484
2129 iso_pu_bacteria 8023680758 8023684158 484
2130 iso_pu_bacteria 8024479707 8024480344 484
2131 iso_pu_bacteria 8024501048 8024503621 484
2132 iso_pu_bacteria 8046767195 8046769908 484
2133 iso_pu_bacteria 8054563764 8054566821 484
2134 iso_pu_bacteria 8056375014 8056375686 484
2135 iso_pu_bacteria 8056382006 8056386011 484
2136 iso_pu_bacteria 8057575449 8057579904 484
2137 iso_pu_bacteria 8057874678 8057880982 484
2138 3300000549 LJQas_1002908 LJQas_10029081 485
2139 3300001976 JGI24752J21851_1000025 JGI24752J21851_100002511 485
2140 3300001976 JGI24752J21851_1002699 JGI24752J21851_10026992 485
2141 3300001979 JGI24740J21852_10004434 JGI24740J21852_100044345 485
2142 3300001990 JGI24737J22298_10000174 JGI24737J22298_1000017416 485
2143 3300001990 JGI24737J22298_10001075 JGI24737J22298_100010757 485
2144 3300001990 JGI24737J22298_10002253 JGI24737J22298_100022532 485
2145 3300001990 JGI24737J22298_10008038 JGI24737J22298_100080383 485
2146 3300001991 JGI24743J22301_10010265 JGI24743J22301_100102651 485
2147 3300002067 JGI24735J21928_10001091 JGI24735J21928_100010912 485
2148 3300002070 JGI24750J21931_1000901 JGI24750J21931_10009013 485
2149 3300002074 JGI24748J21848_1000032 JGI24748J21848_100003268 485
2150 3300002075 JGI24738J21930_10000590 JGI24738J21930_100005904 485
2151 3300002075 JGI24738J21930_10005517 JGI24738J21930_100055172 485
2152 3300002076 JGI24749J21850_1001131 JGI24749J21850_10011312 485
2153 3300002239 JGI24034J26672_10000022 JGI24034J26672_10000022109 485
2154 3300002741 JGI25157J39369_1000053 JGI25157J39369_100005394 485
2155 3300002987 JGI25159J45721_1000016 JGI25159J45721_1000016104 485
2156 3300003187 JGI25151J46595_10023198 JGI25151J46595_100231982 485
2157 3300003214 JGI25165J46597_1000050 JGI25165J46597_100005080 485
2158 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006399 485
2159 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002431 485
2160 3300003374 JGI25161J50226_1004730 JGI25161J50226_10047301 485
2161 3300003578 Ga0006562J51391_1020014 Ga0006562J51391_10200141 485
2162 3300003759 Ga0055525_1000040 Ga0055525_1000040235 485
2163 3300003762 Ga0055542_1000046 Ga0055542_1000046137 485
2164 3300003763 Ga0055529_1000007 Ga0055529_100000792 485
2165 3300003771 Ga0055526_1000207 Ga0055526_100020721 485
2166 3300003781 Ga0055536_1000122 Ga0055536_10001227 485
2167 3300003792 Ga0055540_1003680 Ga0055540_10036808 485
2168 3300003794 Ga0055531_10000400 Ga0055531_1000040021 485
2169 3300003794 Ga0055531_10007389 Ga0055531_100073892 485
2170 3300003856 Ga0058692_1009615 Ga0058692_10096151 485
2171 3300004625 Ga0055543_1000022 Ga0055543_1000022117 485
2172 3300005262 Ga0065165_1000058 Ga0065165_100005857 485
2173 3300005289 Ga0065704_10000280 Ga0065704_1000028015 485
2174 3300005295 Ga0065707_10081716 Ga0065707_1008171625 485
2175 3300005327 Ga0070658_10000001 Ga0070658_10000001328 485
2176 3300005327 Ga0070658_10000085 Ga0070658_1000008567 485
2177 3300005327 Ga0070658_10000105 Ga0070658_1000010529 485
2178 3300005327 Ga0070658_10006056 Ga0070658_100060563 485
2179 3300005327 Ga0070658_10008340 Ga0070658_100083402 485
2180 3300005327 Ga0070658_10013578 Ga0070658_100135786 485
2181 3300005327 Ga0070658_10024885 Ga0070658_100248854 485
2182 3300005327 Ga0070658_10027152 Ga0070658_100271525 485
2183 3300005328 Ga0070676_10009069 Ga0070676_100090692 485
2184 3300005329 Ga0070683_100119767 Ga0070683_1001197673 485
2185 3300005330 Ga0070690_100000056 Ga0070690_1000000566 485
2186 3300005331 Ga0070670_100000173 Ga0070670_10000017329 485
2187 3300005331 Ga0070670_100001683 Ga0070670_1000016832 485
2188 3300005331 Ga0070670_100153174 Ga0070670_1001531741 485
2189 3300005334 Ga0068869_100000968 Ga0068869_1000009685 485
2190 3300005335 Ga0070666_10000002 Ga0070666_1000000211 485
2191 3300005335 Ga0070666_10000589 Ga0070666_1000058915 485
2192 3300005338 Ga0068868_100000116 Ga0068868_10000011639 485
2193 3300005338 Ga0068868_100000117 Ga0068868_1000001179 485
2194 3300005339 Ga0070660_100000235 Ga0070660_10000023537 485
2195 3300005339 Ga0070660_100000411 Ga0070660_10000041120 485
2196 3300005339 Ga0070660_100003809 Ga0070660_1000038096 485
2197 3300005339 Ga0070660_100007715 Ga0070660_1000077155 485
2198 3300005339 Ga0070660_100022640 Ga0070660_1000226404 485
2199 3300005339 Ga0070660_100039577 Ga0070660_1000395772 485
2200 3300005340 Ga0070689_100038724 Ga0070689_1000387242 485
2201 3300005344 Ga0070661_100010394 Ga0070661_1000103947 485
2202 3300005347 Ga0070668_100017323 Ga0070668_1000173234 485
2203 3300005347 Ga0070668_100097735 Ga0070668_1000977352 485
2204 3300005353 Ga0070669_100000042 Ga0070669_10000004220 485
2205 3300005353 Ga0070669_100000170 Ga0070669_10000017010 485
2206 3300005353 Ga0070669_100000471 Ga0070669_10000047125 485
2207 3300005353 Ga0070669_100000661 Ga0070669_10000066115 485
2208 3300005354 Ga0070675_100051012 Ga0070675_1000510123 485
2209 3300005354 Ga0070675_100059099 Ga0070675_1000590992 485
2210 3300005355 Ga0070671_100000010 Ga0070671_10000001027 485
2211 3300005355 Ga0070671_100000050 Ga0070671_10000005034 485
2212 3300005355 Ga0070671_100001477 Ga0070671_1000014776 485
2213 3300005355 Ga0070671_100007392 Ga0070671_1000073925 485
2214 3300005355 Ga0070671_100060673 Ga0070671_1000606733 485
2215 3300005355 Ga0070671_100167660 Ga0070671_1001676602 485
2216 3300005356 Ga0070674_100012755 Ga0070674_1000127552 485
2217 3300005364 Ga0070673_100000007 Ga0070673_10000000777 485
2218 3300005366 Ga0070659_100000001 Ga0070659_100000001466 485
2219 3300005366 Ga0070659_100002929 Ga0070659_1000029297 485
2220 3300005366 Ga0070659_100005736 Ga0070659_1000057364 485
2221 3300005366 Ga0070659_100050538 Ga0070659_1000505382 485
2222 3300005367 Ga0070667_100000664 Ga0070667_10000066428 485
2223 3300005367 Ga0070667_100007388 Ga0070667_1000073885 485
2224 3300005367 Ga0070667_100008470 Ga0070667_1000084706 485
2225 3300005367 Ga0070667_100015251 Ga0070667_1000152513 485
2226 3300005367 Ga0070667_100097259 Ga0070667_1000972592 485
2227 3300005367 Ga0070667_100154637 Ga0070667_1001546372 485
2228 3300005435 Ga0070714_100002221 Ga0070714_1000022214 485
2229 3300005440 Ga0070705_100053586 Ga0070705_1000535861 485
2230 3300005455 Ga0070663_100000441 Ga0070663_1000004413 485
2231 3300005455 Ga0070663_100029063 Ga0070663_1000290632 485
2232 3300005455 Ga0070663_100032274 Ga0070663_1000322744 485
2233 3300005457 Ga0070662_100000592 Ga0070662_10000059221 485
2234 3300005457 Ga0070662_100011067 Ga0070662_1000110674 485
2235 3300005457 Ga0070662_100019891 Ga0070662_1000198914 485
2236 3300005457 Ga0070662_100052356 Ga0070662_1000523562 485
2237 3300005458 Ga0070681_10000005 Ga0070681_10000005140 485
2238 3300005459 Ga0068867_100000010 Ga0068867_10000001077 485
2239 3300005466 Ga0070685_10002211 Ga0070685_100022114 485
2240 3300005530 Ga0070679_100006956 Ga0070679_1000069566 485
2241 3300005539 Ga0068853_100002364 Ga0068853_1000023642 485
2242 3300005539 Ga0068853_100087985 Ga0068853_1000879852 485
2243 3300005544 Ga0070686_100000335 Ga0070686_10000033511 485
2244 3300005544 Ga0070686_100000364 Ga0070686_10000036412 485
2245 3300005546 Ga0070696_100082301 Ga0070696_1000823012 485
2246 3300005548 Ga0070665_100000036 Ga0070665_100000036330 485
2247 3300005548 Ga0070665_100000075 Ga0070665_10000007528 485
2248 3300005548 Ga0070665_100000086 Ga0070665_10000008640 485
2249 3300005548 Ga0070665_100000634 Ga0070665_10000063419 485
2250 3300005548 Ga0070665_100011778 Ga0070665_1000117784 485
2251 3300005548 Ga0070665_100028006 Ga0070665_1000280064 485
2252 3300005548 Ga0070665_100093762 Ga0070665_1000937622 485
2253 3300005563 Ga0068855_100000034 Ga0068855_100000034114 485
2254 3300005563 Ga0068855_100000586 Ga0068855_10000058635 485
2255 3300005563 Ga0068855_100010744 Ga0068855_1000107446 485
2256 3300005563 Ga0068855_100024375 Ga0068855_1000243753 485
2257 3300005563 Ga0068855_100034025 Ga0068855_1000340252 485
2258 3300005563 Ga0068855_100083523 Ga0068855_1000835233 485
2259 3300005563 Ga0068855_100085382 Ga0068855_1000853822 485
2260 3300005563 Ga0068855_100158218 Ga0068855_1001582182 485
2261 3300005577 Ga0068857_100053521 Ga0068857_1000535213 485
2262 3300005577 Ga0068857_100087206 Ga0068857_1000872062 485
2263 3300005614 Ga0068856_100001292 Ga0068856_10000129222 485
2264 3300005614 Ga0068856_100047071 Ga0068856_1000470715 485
2265 3300005614 Ga0068856_100089957 Ga0068856_1000899572 485
2266 3300005614 Ga0068856_100136923 Ga0068856_1001369232 485
2267 3300005616 Ga0068852_100000075 Ga0068852_10000007518 485
2268 3300005616 Ga0068852_100000283 Ga0068852_10000028319 485
2269 3300005616 Ga0068852_100026259 Ga0068852_1000262593 485
2270 3300005616 Ga0068852_100036825 Ga0068852_1000368253 485
2271 3300005616 Ga0068852_100077269 Ga0068852_1000772692 485
2272 3300005616 Ga0068852_100170709 Ga0068852_1001707092 485
2273 3300005616 Ga0068852_100184212 Ga0068852_1001842122 485
2274 3300005617 Ga0068859_100002741 Ga0068859_10000274116 485
2275 3300005617 Ga0068859_100014962 Ga0068859_1000149626 485
2276 3300005617 Ga0068859_100074478 Ga0068859_1000744782 485
2277 3300005618 Ga0068864_100000188 Ga0068864_10000018820 485
2278 3300005618 Ga0068864_100001352 Ga0068864_1000013524 485
2279 3300005618 Ga0068864_100035092 Ga0068864_1000350922 485
2280 3300005719 Ga0068861_100022249 Ga0068861_1000222492 485
2281 3300005719 Ga0068861_100025806 Ga0068861_1000258064 485
2282 3300005834 Ga0068851_10014873 Ga0068851_100148733 485
2283 3300005834 Ga0068851_10027033 Ga0068851_100270332 485
2284 3300005841 Ga0068863_100000095 Ga0068863_10000009588 485
2285 3300005841 Ga0068863_100002834 Ga0068863_1000028345 485
2286 3300005841 Ga0068863_100005294 Ga0068863_10000529410 485
2287 3300005841 Ga0068863_100020162 Ga0068863_1000201622 485
2288 3300005841 Ga0068863_100116209 Ga0068863_1001162092 485
2289 3300005842 Ga0068858_100000688 Ga0068858_10000068829 485
2290 3300005842 Ga0068858_100001148 Ga0068858_10000114814 485
2291 3300005842 Ga0068858_100002740 Ga0068858_10000274015 485
2292 3300005843 Ga0068860_100000001 Ga0068860_10000000111 485
2293 3300005843 Ga0068860_100002747 Ga0068860_1000027477 485
2294 3300005843 Ga0068860_100004218 Ga0068860_1000042185 485
2295 3300005843 Ga0068860_100005984 Ga0068860_1000059847 485
2296 3300005843 Ga0068860_100028014 Ga0068860_1000280144 485
2297 3300005843 Ga0068860_100028188 Ga0068860_1000281886 485
2298 3300005843 Ga0068860_100065246 Ga0068860_1000652463 485
2299 3300005844 Ga0068862_100000092 Ga0068862_10000009246 485
2300 3300005844 Ga0068862_100000350 Ga0068862_10000035038 485
2301 3300005844 Ga0068862_100000620 Ga0068862_10000062026 485
2302 3300005844 Ga0068862_100006038 Ga0068862_1000060384 485
2303 3300005844 Ga0068862_100007884 Ga0068862_1000078846 485
2304 3300005937 Ga0081455_10000255 Ga0081455_100002557 485
2305 3300005981 Ga0081538_10024493 Ga0081538_100244933 485
2306 3300005983 Ga0081540_1032916 Ga0081540_10329161 485
2307 3300005985 Ga0081539_10000305 Ga0081539_100003052 485
2308 3300005985 Ga0081539_10001435 Ga0081539_1000143528 485
2309 3300006038 Ga0075365_10013682 Ga0075365_100136825 485
2310 3300006042 Ga0075368_10000597 Ga0075368_100005978 485
2311 3300006177 Ga0075362_10000203 Ga0075362_1000020316 485
2312 3300006177 Ga0075362_10002222 Ga0075362_100022224 485
2313 3300006195 Ga0075366_10035402 Ga0075366_100354023 485
2314 3300006353 Ga0075370_10015624 Ga0075370_100156242 485
2315 3300006881 Ga0068865_100000008 Ga0068865_10000000884 485
2316 3300006931 Ga0097620_100002741 Ga0097620_1000027415 485
2317 3300006931 Ga0097620_100014961 Ga0097620_1000149613 485
2318 3300006931 Ga0097620_100074480 Ga0097620_1000744802 485
2319 3300006946 Ga0079104_1000069 Ga0079104_100006976 485
2320 3300006946 Ga0079104_1006348 Ga0079104_10063483 485
2321 3300006946 Ga0079104_1009848 Ga0079104_10098482 485
2322 3300006948 Ga0099826_10003316 Ga0099826_100033161 485
2323 3300006948 Ga0099826_10010012 Ga0099826_100100128 485
2324 3300009011 Ga0105251_10032869 Ga0105251_100328692 485
2325 3300009092 Ga0105250_10008875 Ga0105250_100088752 485
2326 3300009093 Ga0105240_10002316 Ga0105240_100023166 485
2327 3300009093 Ga0105240_10008098 Ga0105240_100080988 485
2328 3300009093 Ga0105240_10018168 Ga0105240_100181684 485
2329 3300009093 Ga0105240_10018510 Ga0105240_100185102 485
2330 3300009093 Ga0105240_10044256 Ga0105240_100442562 485
2331 3300009093 Ga0105240_10251575 Ga0105240_102515752 485
2332 3300009094 Ga0111539_10000100 Ga0111539_1000010022 485
2333 3300009094 Ga0111539_10014411 Ga0111539_100144117 485
2334 3300009098 Ga0105245_10000146 Ga0105245_1000014629 485
2335 3300009098 Ga0105245_10012964 Ga0105245_100129648 485
2336 3300009101 Ga0105247_10006552 Ga0105247_100065527 485
2337 3300009101 Ga0105247_10017670 Ga0105247_100176704 485
2338 3300009101 Ga0105247_10040303 Ga0105247_100403033 485
2339 3300009148 Ga0105243_10000080 Ga0105243_1000008065 485
2340 3300009148 Ga0105243_10057312 Ga0105243_100573123 485
2341 3300009174 Ga0105241_10069686 Ga0105241_100696863 485
2342 3300009176 Ga0105242_10005594 Ga0105242_100055948 485
2343 3300009177 Ga0105248_10009214 Ga0105248_100092146 485
2344 3300009177 Ga0105248_10032489 Ga0105248_100324896 485
2345 3300009177 Ga0105248_10089636 Ga0105248_100896363 485
2346 3300009177 Ga0105248_10148758 Ga0105248_101487582 485
2347 3300009177 Ga0105248_10253539 Ga0105248_102535391 485
2348 3300009545 Ga0105237_10001177 Ga0105237_1000117713 485
2349 3300009551 Ga0105238_10006836 Ga0105238_100068366 485
2350 3300009551 Ga0105238_10013041 Ga0105238_100130412 485
2351 3300009551 Ga0105238_10060407 Ga0105238_100604072 485
2352 3300009553 Ga0105249_10000026 Ga0105249_1000002610 485
2353 3300009553 Ga0105249_10000100 Ga0105249_1000010046 485
2354 3300009553 Ga0105249_10013245 Ga0105249_100132454 485
2355 3300009553 Ga0105249_10159280 Ga0105249_101592802 485
2356 3300010375 Ga0105239_10002965 Ga0105239_100029657 485
2357 3300010375 Ga0105239_10008930 Ga0105239_100089307 485
2358 3300010375 Ga0105239_10023326 Ga0105239_100233262 485
2359 3300010375 Ga0105239_10157905 Ga0105239_101579052 485
2360 3300010375 Ga0105239_10198996 Ga0105239_101989962 485
2361 3300010375 Ga0105239_10247019 Ga0105239_102470192 485
2362 3300011119 Ga0105246_10003798 Ga0105246_100037984 485
2363 3300013100 Ga0157373_10026508 Ga0157373_100265084 485
2364 3300013100 Ga0157373_10031637 Ga0157373_100316372 485
2365 3300013100 Ga0157373_10057516 Ga0157373_100575162 485
2366 3300013100 Ga0157373_10112184 Ga0157373_101121842 485
2367 3300013102 Ga0157371_10000058 Ga0157371_1000005825 485
2368 3300013102 Ga0157371_10000097 Ga0157371_1000009745 485
2369 3300013102 Ga0157371_10017089 Ga0157371_100170896 485
2370 3300013102 Ga0157371_10056865 Ga0157371_100568652 485
2371 3300013104 Ga0157370_10000063 Ga0157370_1000006377 485
2372 3300013104 Ga0157370_10000792 Ga0157370_1000079214 485
2373 3300013104 Ga0157370_10005670 Ga0157370_100056708 485
2374 3300013104 Ga0157370_10033624 Ga0157370_100336244 485
2375 3300013104 Ga0157370_10111004 Ga0157370_101110042 485
2376 3300013104 Ga0157370_10121246 Ga0157370_101212462 485
2377 3300013104 Ga0157370_10170154 Ga0157370_101701542 485
2378 3300013105 Ga0157369_10000833 Ga0157369_1000083337 485
2379 3300013105 Ga0157369_10008366 Ga0157369_100083668 485
2380 3300013105 Ga0157369_10008708 Ga0157369_100087083 485
2381 3300013105 Ga0157369_10164886 Ga0157369_101648862 485
2382 3300013105 Ga0157369_10311775 Ga0157369_103117751 485
2383 3300013249 Ga0171463_1001 Ga0171463_1001644 485
2384 3300013296 Ga0157374_10000464 Ga0157374_1000046422 485
2385 3300013297 Ga0157378_10005791 Ga0157378_100057918 485
2386 3300013306 Ga0163162_10028890 Ga0163162_100288903 485
2387 3300013306 Ga0163162_10031618 Ga0163162_100316184 485
2388 3300013306 Ga0163162_10082127 Ga0163162_100821272 485
2389 3300013307 Ga0157372_10004166 Ga0157372_1000416611 485
2390 3300013307 Ga0157372_10036244 Ga0157372_100362445 485
2391 3300013307 Ga0157372_10404708 Ga0157372_104047081 485
2392 3300013308 Ga0157375_10008007 Ga0157375_100080072 485
2393 3300014325 Ga0163163_10035523 Ga0163163_100355235 485
2394 3300014325 Ga0163163_10035620 Ga0163163_100356202 485
2395 3300014325 Ga0163163_10057658 Ga0163163_100576582 485
2396 3300014326 Ga0157380_10001740 Ga0157380_100017402 485
2397 3300014326 Ga0157380_10001897 Ga0157380_1000189711 485
2398 3300014326 Ga0157380_10027699 Ga0157380_100276994 485
2399 3300014968 Ga0157379_10005617 Ga0157379_100056173 485
2400 3300014969 Ga0157376_10000087 Ga0157376_1000008723 485
2401 3300015690 Ga0183363_1147 Ga0183363_11474 485
2402 3300017792 Ga0163161_10000008 Ga0163161_10000008297 485
2403 3300017792 Ga0163161_10050700 Ga0163161_100507002 485
2404 3300021320 Ga0214544_1000008 Ga0214544_1000008304 485
2405 3300021321 Ga0214542_1000011 Ga0214542_1000011217 485
2406 3300021321 Ga0214542_1022817 Ga0214542_10228172 485
2407 3300021327 Ga0214543_1000003 Ga0214543_100000383 485
2408 3300021327 Ga0214543_1000004 Ga0214543_1000004283 485
2409 3300021384 Ga0213876_10045815 Ga0213876_100458152 485
2410 3300022739 Ga0228711_1001272 Ga0228711_100127230 485
2411 3300022740 Ga0228710_1001367 Ga0228710_100136730 485
2412 3300025208 Ga0209436_100516 Ga0209436_1005163 485
2413 3300025223 Ga0207672_1000406 Ga0207672_10004065 485
2414 3300025230 Ga0209563_100019 Ga0209563_10001943 485
2415 3300025231 Ga0207427_100512 Ga0207427_1005122 485
2416 3300025250 Ga0209026_1000002 Ga0209026_1000002894 485
2417 3300025250 Ga0209026_1000658 Ga0209026_10006585 485
2418 3300025254 Ga0209148_1000026 Ga0209148_1000026293 485
2419 3300025254 Ga0209148_1000116 Ga0209148_10001164 485
2420 3300025256 Ga0209759_1000156 Ga0209759_1000156105 485
2421 3300025261 Ga0209233_1000041 Ga0209233_1000041257 485
2422 3300025261 Ga0209233_1000066 Ga0209233_100006679 485
2423 3300025272 Ga0209455_1000005 Ga0209455_10000051040 485
2424 3300025272 Ga0209455_1000513 Ga0209455_100051319 485
2425 3300025284 Ga0209130_1000008 Ga0209130_1000008113 485
2426 3300025292 Ga0209676_1000045 Ga0209676_100004578 485
2427 3300025292 Ga0209676_1000972 Ga0209676_100097225 485
2428 3300025292 Ga0209676_1005324 Ga0209676_10053242 485
2429 3300025294 Ga0209025_1001129 Ga0209025_100112929 485
2430 3300025294 Ga0209025_1003170 Ga0209025_100317019 485
2431 3300025295 Ga0209564_1000091 Ga0209564_1000091120 485
2432 3300025297 Ga0209758_1000001 Ga0209758_10000011430 485
2433 3300025297 Ga0209758_1000602 Ga0209758_100060234 485
2434 3300025298 Ga0209050_1002819 Ga0209050_100281914 485
2435 3300025299 Ga0209256_1000180 Ga0209256_100018010 485
2436 3300025302 Ga0207426_1000016 Ga0207426_1000016448 485
2437 3300025303 Ga0209051_1009000 Ga0209051_10090004 485
2438 3300025304 Ga0209257_1000404 Ga0209257_100040422 485
2439 3300025304 Ga0209257_1002244 Ga0209257_10022447 485
2440 3300025304 Ga0209257_1007156 Ga0209257_10071563 485
2441 3300025315 Ga0207697_10000004 Ga0207697_1000000425 485
2442 3300025900 Ga0207710_10008854 Ga0207710_100088542 485
2443 3300025900 Ga0207710_10023833 Ga0207710_100238333 485
2444 3300025903 Ga0207680_10000004 Ga0207680_10000004849 485
2445 3300025903 Ga0207680_10000126 Ga0207680_1000012633 485
2446 3300025904 Ga0207647_10000352 Ga0207647_100003525 485
2447 3300025904 Ga0207647_10003168 Ga0207647_100031688 485
2448 3300025904 Ga0207647_10007669 Ga0207647_100076692 485
2449 3300025904 Ga0207647_10073249 Ga0207647_100732492 485
2450 3300025907 Ga0207645_10000726 Ga0207645_100007268 485
2451 3300025909 Ga0207705_10000002 Ga0207705_100000021552 485
2452 3300025909 Ga0207705_10000022 Ga0207705_1000002268 485
2453 3300025909 Ga0207705_10000075 Ga0207705_1000007588 485
2454 3300025909 Ga0207705_10000116 Ga0207705_1000011666 485
2455 3300025909 Ga0207705_10002147 Ga0207705_100021474 485
2456 3300025909 Ga0207705_10003226 Ga0207705_100032264 485
2457 3300025909 Ga0207705_10003824 Ga0207705_100038248 485
2458 3300025909 Ga0207705_10031317 Ga0207705_100313173 485
2459 3300025909 Ga0207705_10086619 Ga0207705_100866192 485
2460 3300025911 Ga0207654_10001444 Ga0207654_100014447 485
2461 3300025911 Ga0207654_10031154 Ga0207654_100311542 485
2462 3300025912 Ga0207707_10000005 Ga0207707_10000005297 485
2463 3300025912 Ga0207707_10060609 Ga0207707_100606092 485
2464 3300025913 Ga0207695_10000004 Ga0207695_100000041094 485
2465 3300025913 Ga0207695_10001723 Ga0207695_100017236 485
2466 3300025913 Ga0207695_10006568 Ga0207695_1000656811 485
2467 3300025913 Ga0207695_10008535 Ga0207695_100085358 485
2468 3300025913 Ga0207695_10009927 Ga0207695_100099275 485
2469 3300025913 Ga0207695_10036124 Ga0207695_100361245 485
2470 3300025913 Ga0207695_10038104 Ga0207695_100381042 485
2471 3300025913 Ga0207695_10040048 Ga0207695_100400482 485
2472 3300025913 Ga0207695_10042212 Ga0207695_100422122 485
2473 3300025913 Ga0207695_10076426 Ga0207695_100764262 485
2474 3300025914 Ga0207671_10001968 Ga0207671_1000196813 485
2475 3300025914 Ga0207671_10003257 Ga0207671_1000325714 485
2476 3300025914 Ga0207671_10041806 Ga0207671_100418062 485
2477 3300025917 Ga0207660_10088272 Ga0207660_100882721 485
2478 3300025919 Ga0207657_10000551 Ga0207657_100005517 485
2479 3300025919 Ga0207657_10001403 Ga0207657_100014034 485
2480 3300025919 Ga0207657_10001933 Ga0207657_1000193310 485
2481 3300025919 Ga0207657_10003250 Ga0207657_100032506 485
2482 3300025919 Ga0207657_10004163 Ga0207657_100041638 485
2483 3300025919 Ga0207657_10005142 Ga0207657_100051426 485
2484 3300025919 Ga0207657_10006930 Ga0207657_1000693012 485
2485 3300025919 Ga0207657_10010077 Ga0207657_100100775 485
2486 3300025919 Ga0207657_10015864 Ga0207657_100158645 485
2487 3300025920 Ga0207649_10000874 Ga0207649_100008742 485
2488 3300025920 Ga0207649_10001955 Ga0207649_1000195511 485
2489 3300025921 Ga0207652_10000320 Ga0207652_1000032052 485
2490 3300025923 Ga0207681_10000002 Ga0207681_10000002339 485
2491 3300025923 Ga0207681_10000090 Ga0207681_1000009046 485
2492 3300025923 Ga0207681_10000297 Ga0207681_1000029725 485
2493 3300025924 Ga0207694_10000010 Ga0207694_10000010125 485
2494 3300025924 Ga0207694_10001459 Ga0207694_100014599 485
2495 3300025924 Ga0207694_10055399 Ga0207694_100553992 485
2496 3300025925 Ga0207650_10000899 Ga0207650_1000089912 485
2497 3300025925 Ga0207650_10000969 Ga0207650_1000096912 485
2498 3300025926 Ga0207659_10087522 Ga0207659_100875222 485
2499 3300025927 Ga0207687_10003057 Ga0207687_100030578 485
2500 3300025927 Ga0207687_10015031 Ga0207687_100150312 485
2501 3300025929 Ga0207664_10003349 Ga0207664_1000334912 485
2502 3300025931 Ga0207644_10000002 Ga0207644_10000002337 485
2503 3300025931 Ga0207644_10000003 Ga0207644_1000000334 485
2504 3300025931 Ga0207644_10000456 Ga0207644_100004564 485
2505 3300025931 Ga0207644_10000755 Ga0207644_100007556 485
2506 3300025931 Ga0207644_10001492 Ga0207644_100014923 485
2507 3300025931 Ga0207644_10004790 Ga0207644_100047906 485
2508 3300025931 Ga0207644_10097261 Ga0207644_100972612 485
2509 3300025932 Ga0207690_10000001 Ga0207690_1000000180 485
2510 3300025932 Ga0207690_10000002 Ga0207690_1000000280 485
2511 3300025932 Ga0207690_10000003 Ga0207690_1000000380 485
2512 3300025932 Ga0207690_10000004 Ga0207690_1000000480 485
2513 3300025932 Ga0207690_10001051 Ga0207690_100010517 485
2514 3300025932 Ga0207690_10008820 Ga0207690_100088205 485
2515 3300025932 Ga0207690_10015486 Ga0207690_100154864 485
2516 3300025932 Ga0207690_10023474 Ga0207690_100234742 485
2517 3300025933 Ga0207706_10002860 Ga0207706_1000286011 485
2518 3300025933 Ga0207706_10009244 Ga0207706_100092443 485
2519 3300025933 Ga0207706_10025725 Ga0207706_100257252 485
2520 3300025933 Ga0207706_10031480 Ga0207706_100314804 485
2521 3300025935 Ga0207709_10001194 Ga0207709_100011941 485
2522 3300025936 Ga0207670_10020316 Ga0207670_100203162 485
2523 3300025937 Ga0207669_10004102 Ga0207669_100041023 485
2524 3300025938 Ga0207704_10000013 Ga0207704_1000001379 485
2525 3300025940 Ga0207691_10007445 Ga0207691_100074457 485
2526 3300025940 Ga0207691_10062215 Ga0207691_100622151 485
2527 3300025941 Ga0207711_10006319 Ga0207711_100063195 485
2528 3300025941 Ga0207711_10025053 Ga0207711_100250534 485
2529 3300025941 Ga0207711_10078688 Ga0207711_100786882 485
2530 3300025942 Ga0207689_10000114 Ga0207689_100001147 485
2531 3300025945 Ga0207679_10132087 Ga0207679_101320872 485
2532 3300025949 Ga0207667_10000010 Ga0207667_10000010292 485
2533 3300025949 Ga0207667_10000065 Ga0207667_1000006596 485
2534 3300025949 Ga0207667_10000113 Ga0207667_1000011384 485
2535 3300025949 Ga0207667_10008421 Ga0207667_100084216 485
2536 3300025949 Ga0207667_10016606 Ga0207667_100166065 485
2537 3300025949 Ga0207667_10082540 Ga0207667_100825402 485
2538 3300025949 Ga0207667_10091959 Ga0207667_100919592 485
2539 3300025949 Ga0207667_10095021 Ga0207667_100950212 485
2540 3300025949 Ga0207667_10098499 Ga0207667_100984992 485
2541 3300025949 Ga0207667_10129302 Ga0207667_101293022 485
2542 3300025949 Ga0207667_10234630 Ga0207667_102346302 485
2543 3300025960 Ga0207651_10000013 Ga0207651_1000001377 485
2544 3300025961 Ga0207712_10000001 Ga0207712_10000001723 485
2545 3300025961 Ga0207712_10000008 Ga0207712_1000000886 485
2546 3300025961 Ga0207712_10104128 Ga0207712_101041282 485
2547 3300025972 Ga0207668_10000489 Ga0207668_1000048914 485
2548 3300025972 Ga0207668_10000769 Ga0207668_100007691 485
2549 3300025981 Ga0207640_10000532 Ga0207640_1000053214 485
2550 3300025981 Ga0207640_10000777 Ga0207640_100007778 485
2551 3300025986 Ga0207658_10000381 Ga0207658_1000038118 485
2552 3300025986 Ga0207658_10002567 Ga0207658_1000256711 485
2553 3300025986 Ga0207658_10006709 Ga0207658_100067095 485
2554 3300025986 Ga0207658_10023280 Ga0207658_100232802 485
2555 3300025986 Ga0207658_10081886 Ga0207658_100818862 485
2556 3300025986 Ga0207658_10121860 Ga0207658_101218602 485
2557 3300026023 Ga0207677_10000599 Ga0207677_1000059920 485
2558 3300026035 Ga0207703_10000717 Ga0207703_100007177 485
2559 3300026035 Ga0207703_10002383 Ga0207703_1000238315 485
2560 3300026035 Ga0207703_10009335 Ga0207703_100093357 485
2561 3300026035 Ga0207703_10026921 Ga0207703_100269212 485
2562 3300026041 Ga0207639_10000649 Ga0207639_1000064916 485
2563 3300026041 Ga0207639_10001013 Ga0207639_100010134 485
2564 3300026041 Ga0207639_10070342 Ga0207639_100703422 485
2565 3300026041 Ga0207639_10169024 Ga0207639_101690241 485
2566 3300026067 Ga0207678_10002809 Ga0207678_100028099 485
2567 3300026067 Ga0207678_10007971 Ga0207678_100079712 485
2568 3300026067 Ga0207678_10013198 Ga0207678_100131984 485
2569 3300026067 Ga0207678_10024755 Ga0207678_100247556 485
2570 3300026067 Ga0207678_10030637 Ga0207678_100306374 485
2571 3300026078 Ga0207702_10000335 Ga0207702_1000033526 485
2572 3300026078 Ga0207702_10007158 Ga0207702_100071582 485
2573 3300026078 Ga0207702_10012460 Ga0207702_100124606 485
2574 3300026078 Ga0207702_10013342 Ga0207702_100133424 485
2575 3300026078 Ga0207702_10015105 Ga0207702_100151053 485
2576 3300026078 Ga0207702_10036350 Ga0207702_100363503 485
2577 3300026078 Ga0207702_10055860 Ga0207702_100558603 485
2578 3300026078 Ga0207702_10059377 Ga0207702_100593772 485
2579 3300026078 Ga0207702_10122186 Ga0207702_101221861 485
2580 3300026078 Ga0207702_10155075 Ga0207702_101550751 485
2581 3300026078 Ga0207702_10208947 Ga0207702_102089472 485
2582 3300026088 Ga0207641_10000148 Ga0207641_1000014887 485
2583 3300026088 Ga0207641_10002980 Ga0207641_1000298012 485
2584 3300026088 Ga0207641_10014132 Ga0207641_100141326 485
2585 3300026088 Ga0207641_10016139 Ga0207641_100161392 485
2586 3300026088 Ga0207641_10022686 Ga0207641_100226862 485
2587 3300026088 Ga0207641_10024712 Ga0207641_100247123 485
2588 3300026089 Ga0207648_10000025 Ga0207648_1000002541 485
2589 3300026095 Ga0207676_10000184 Ga0207676_1000018432 485
2590 3300026095 Ga0207676_10001987 Ga0207676_1000198710 485
2591 3300026095 Ga0207676_10008536 Ga0207676_100085364 485
2592 3300026116 Ga0207674_10001996 Ga0207674_100019967 485
2593 3300026116 Ga0207674_10005358 Ga0207674_100053587 485
2594 3300026116 Ga0207674_10007306 Ga0207674_100073062 485
2595 3300026116 Ga0207674_10009274 Ga0207674_100092749 485
2596 3300026116 Ga0207674_10149210 Ga0207674_101492102 485
2597 3300026116 Ga0207674_10149627 Ga0207674_101496271 485
2598 3300026118 Ga0207675_100001093 Ga0207675_10000109310 485
2599 3300026118 Ga0207675_100001590 Ga0207675_1000015902 485
2600 3300026121 Ga0207683_10128714 Ga0207683_101287142 485
2601 3300026142 Ga0207698_10000005 Ga0207698_10000005158 485
2602 3300026142 Ga0207698_10000396 Ga0207698_100003967 485
2603 3300026142 Ga0207698_10003038 Ga0207698_100030384 485
2604 3300026142 Ga0207698_10128562 Ga0207698_101285621 485
2605 3300026142 Ga0207698_10152504 Ga0207698_101525042 485
2606 3300027111 Ga0209281_1000192 Ga0209281_100019240 485
2607 3300027111 Ga0209281_1000629 Ga0209281_100062932 485
2608 3300027111 Ga0209281_1000665 Ga0209281_10006655 485
2609 3300027312 Ga0209371_1000009 Ga0209371_1000009418 485
2610 3300027312 Ga0209371_1013153 Ga0209371_10131531 485
2611 3300027666 Ga0209282_1000172 Ga0209282_100017230 485
2612 3300027666 Ga0209282_1000224 Ga0209282_100022422 485
2613 3300027666 Ga0209282_1006939 Ga0209282_10069398 485
2614 3300027907 Ga0207428_10003169 Ga0207428_1000316915 485
2615 3300027907 Ga0207428_10114145 Ga0207428_101141452 485
2616 3300028379 Ga0268266_10000002 Ga0268266_100000022519 485
2617 3300028379 Ga0268266_10000042 Ga0268266_1000004211 485
2618 3300028379 Ga0268266_10000215 Ga0268266_1000021529 485
2619 3300028379 Ga0268266_10000468 Ga0268266_1000046830 485
2620 3300028379 Ga0268266_10002087 Ga0268266_100020878 485
2621 3300028379 Ga0268266_10011822 Ga0268266_100118225 485
2622 3300028379 Ga0268266_10051731 Ga0268266_100517312 485
2623 3300028379 Ga0268266_10084200 Ga0268266_100842002 485
2624 3300028380 Ga0268265_10000091 Ga0268265_1000009161 485
2625 3300028380 Ga0268265_10000260 Ga0268265_1000026048 485
2626 3300028380 Ga0268265_10000481 Ga0268265_100004812 485
2627 3300028380 Ga0268265_10025497 Ga0268265_100254973 485
2628 3300028380 Ga0268265_10108204 Ga0268265_101082041 485
2629 3300028381 Ga0268264_10000006 Ga0268264_10000006849 485
2630 3300028381 Ga0268264_10000010 Ga0268264_10000010553 485
2631 3300028381 Ga0268264_10010227 Ga0268264_100102272 485
2632 3300028381 Ga0268264_10013574 Ga0268264_100135746 485
2633 3300028381 Ga0268264_10031932 Ga0268264_100319323 485
2634 3300028556 Ga0265337_1006668 Ga0265337_10066684 485
2635 3300028573 Ga0265334_10003958 Ga0265334_100039587 485
2636 3300028577 Ga0265318_10001720 Ga0265318_100017209 485
2637 3300030500 Ga0268256_1000010 Ga0268256_1000010417 485
2638 3300030500 Ga0268256_1009008 Ga0268256_10090083 485
2639 3300031247 Ga0265340_10011382 Ga0265340_100113825 485
2640 3300031344 Ga0265316_10061511 Ga0265316_100615112 485
2641 3300031548 Ga0307408_100113550 Ga0307408_1001135502 485
2642 3300031595 Ga0265313_10008351 Ga0265313_100083514 485
2643 3300031595 Ga0265313_10037235 Ga0265313_100372352 485
2644 3300031730 Ga0307516_10014368 Ga0307516_100143682 485
2645 3300031731 Ga0307405_10033021 Ga0307405_100330212 485
2646 3300031731 Ga0307405_10050186 Ga0307405_100501862 485
2647 3300031824 Ga0307413_10015559 Ga0307413_100155591 485
2648 3300031901 Ga0307406_10060474 Ga0307406_100604742 485
2649 3300031903 Ga0307407_10053110 Ga0307407_100531102 485
2650 3300031911 Ga0307412_10024225 Ga0307412_100242252 485
2651 3300031967 Ga0315914_1001342 Ga0315914_100134230 485
2652 3300032002 Ga0307416_100019280 Ga0307416_1000192803 485
2653 3300032002 Ga0307416_100067065 Ga0307416_1000670651 485
2654 3300032004 Ga0307414_10000446 Ga0307414_100004469 485
2655 3300032004 Ga0307414_10001003 Ga0307414_100010033 485
2656 3300032005 Ga0307411_10005091 Ga0307411_100050912 485
2657 3300032126 Ga0307415_100026994 Ga0307415_1000269944 485
2658 3300033180 Ga0307510_10003707 Ga0307510_100037078 485
2659 3300033430 Ga0315913_1000452 Ga0315913_10004524 485
2660 3300033464 Ga0315915_1000691 Ga0315915_100069131 485
2661 3300035692 Ga0373935_0075157 Ga0373935_0075157_345_1805 485
2662 3300036647 Ga0316582_0008055 Ga0316582_0008055_3138_4604 485
2663 3300037312 Ga0395899_0000213 Ga0395899_0000213_21423_22925 485
2664 3300037312 Ga0395899_0000917 Ga0395899_0000917_5973_7451 485
2665 3300037312 Ga0395899_0003516 Ga0395899_0003516_6882_8342 485
2666 3300037312 Ga0395899_0013910 Ga0395899_0013910_2622_4100 485
2667 3300037312 Ga0395899_0041393 Ga0395899_0041393_1677_3155 485
2668 3300037312 Ga0395899_0081077 Ga0395899_0081077_190_1668 485
2669 3300037418 Ga0395900_0000031 Ga0395900_0000031_139817_141295 485
2670 3300037418 Ga0395900_0000121 Ga0395900_0000121_73046_74548 485
2671 3300037418 Ga0395900_0021706 Ga0395900_0021706_1431_2909 485
2672 3300037418 Ga0395900_0085738 Ga0395900_0085738_1745_3223 485
2673 3300037418 Ga0395900_0087147 Ga0395900_0087147_1596_3086 485
2674 3300037418 Ga0395900_0134131 Ga0395900_0134131_863_2341 485
2675 3300037418 Ga0395900_0294227 Ga0395900_0294227_66_1544 485
2676 3300037466 Ga0395898_0000247 Ga0395898_0000247_60479_61981 485
2677 3300037466 Ga0395898_0048422 Ga0395898_0048422_1578_3056 485
2678 3300037466 Ga0395898_0189287 Ga0395898_0189287_385_1848 485
2679 3300037466 Ga0395898_0195927 Ga0395898_0195927_35_1513 485
2680 3300037471 Ga0395905_0000112 Ga0395905_0000112_60463_61965 485
2681 3300037471 Ga0395905_0039527 Ga0395905_0039527_667_2127 485
2682 3300037471 Ga0395905_0160703 Ga0395905_0160703_530_2008 485
2683 3300038443 Ga0395901_0000035 Ga0395901_0000035_144617_146095 485
2684 3300038443 Ga0395901_0000078 Ga0395901_0000078_73046_74548 485
2685 3300038443 Ga0395901_0104955 Ga0395901_0104955_1207_2667 485
2686 3300039437 Ga0436365_0508484 Ga0436365_0508484_101622_103121 485
2687 3300039437 Ga0436365_1256092 Ga0436365_1256092_586_2049 485
2688 3300039438 Ga0436360_0458576 Ga0436360_0458576_468_1955 485
2689 3300039438 Ga0436360_0753919 Ga0436360_0753919_1489_2976 485
2690 3300039450 Ga0436363_0364437 Ga0436363_0364437_228_1685 485
2691 3300039453 Ga0436362_0106862 Ga0436362_0106862_1180_2667 485
2692 3300042005 Ga0439448_0000258 Ga0439448_0000258_3131_4591 485
2693 3300042436 Ga0439435_0000614 Ga0439435_0000614_2718_4220 485
2694 3300044658 Ga0466972_0017001 Ga0466972_0017001_1887_3347 485
2695 3300044684 Ga0466966_0000007 Ga0466966_0000007_60246_61724 485
2696 3300044693 Ga0466961_0011786 Ga0466961_0011786_2590_4050 485
2697 3300044901 Ga0466960_0031328 Ga0466960_0031328_128_1588 485
2698 3300044901 Ga0466960_0033984 Ga0466960_0033984_416_1909 485
2699 3300045049 Ga0466959_0066218 Ga0466959_0066218_158_1618 485
2700 3300045051 Ga0451576_0009327 Ga0451576_0009327_4986_6488 485
2701 3300045051 Ga0451576_0053402 Ga0451576_0053402_2230_3690 485
2702 3300045836 Ga0466958_0034009 Ga0466958_0034009_650_2110 485
2703 3300045976 Ga0466967_0067612 Ga0466967_0067612_719_2179 485
2704 3300046459 Ga0495629_0011843 Ga0495629_0011843_2914_4434 485
2705 3300046460 Ga0495638_0000179 Ga0495638_0000179_71223_72680 485
2706 3300046460 Ga0495638_0023408 Ga0495638_0023408_159_1658 485
2707 3300046471 Ga0495650_0000758 Ga0495650_0000758_11167_12624 485
2708 3300046476 Ga0495662_0006940 Ga0495662_0006940_1898_3418 485
2709 3300046506 Ga0495583_0000500 Ga0495583_0000500_22436_23896 485
2710 3300046506 Ga0495583_0000755 Ga0495583_0000755_28389_29846 485
2711 3300046506 Ga0495583_0020180 Ga0495583_0020180_810_2267 485
2712 3300046506 Ga0495583_0025705 Ga0495583_0025705_438_1895 485
2713 3300046507 Ga0495606_0001113 Ga0495606_0001113_21836_23293 485
2714 3300046507 Ga0495606_0080314 Ga0495606_0080314_491_1948 485
2715 3300046516 Ga0495628_0054904 Ga0495628_0054904_533_2023 485
2716 3300046518 Ga0495631_0021442 Ga0495631_0021442_85_1542 485
2717 3300046520 Ga0495637_0045654 Ga0495637_0045654_91_1548 485
2718 3300046522 Ga0495643_0002421 Ga0495643_0002421_25_1482 485
2719 3300046522 Ga0495643_0010265 Ga0495643_0010265_2635_4092 485
2720 3300046522 Ga0495643_0015330 Ga0495643_0015330_1826_3283 485
2721 3300046522 Ga0495643_0025855 Ga0495643_0025855_1842_3299 485
2722 3300046524 Ga0495648_0000256 Ga0495648_0000256_57199_58656 485
2723 3300046525 Ga0495663_0003014 Ga0495663_0003014_1888_3345 485
2724 3300046530 Ga0495654_0000194 Ga0495654_0000194_47490_48947 485
2725 3300046530 Ga0495654_0000530 Ga0495654_0000530_18745_20319 485
2726 3300046531 Ga0495665_0009709 Ga0495665_0009709_1391_2860 485
2727 3300046535 Ga0495586_0043226 Ga0495586_0043226_232_1701 485
2728 3300046543 Ga0495645_0003894 Ga0495645_0003894_803_2293 485
2729 3300046557 Ga0495622_0004054 Ga0495622_0004054_2289_3809 485
2730 3300046558 Ga0495633_0004725 Ga0495633_0004725_2096_3553 485
2731 3300046616 Ga0495668_0000024 Ga0495668_0000024_253969_255426 485
2732 3300046616 Ga0495668_0000163 Ga0495668_0000163_26615_28072 485
2733 3300046648 Ga0495611_0051105 Ga0495611_0051105_91_1548 485
2734 3300046660 Ga0495625_0000196 Ga0495625_0000196_63049_64506 485
2735 3300046660 Ga0495625_0000424 Ga0495625_0000424_56993_58450 485
2736 3300046660 Ga0495625_0023798 Ga0495625_0023798_1844_3301 485
2737 3300046660 Ga0495625_0059944 Ga0495625_0059944_913_2370 485
2738 3300046674 Ga0495588_0004349 Ga0495588_0004349_1522_3027 485
2739 3300046684 Ga0495669_0000933 Ga0495669_0000933_3252_4709 485
2740 3300046794 Ga0495589_0014972 Ga0495589_0014972_277_1734 485
2741 3300046809 Ga0495600_0000268 Ga0495600_0000268_11854_13311 485
2742 3300047317 Ga0495604_0018836 Ga0495604_0018836_3852_5372 485
2743 3300047323 Ga0495683_0006287 Ga0495683_0006287_5004_6461 485
2744 3300047443 Ga0495687_000447 Ga0495687_000447_7148_8605 485
2745 3300047443 Ga0495687_000557 Ga0495687_000557_7437_8894 485
2746 3300047443 Ga0495687_021816 Ga0495687_021816_652_2112 485
2747 3300047445 Ga0495677_0002397 Ga0495677_0002397_4010_5467 485
2748 3300047470 Ga0495681_0002519 Ga0495681_0002519_9777_11234 485
2749 3300047470 Ga0495681_0002944 Ga0495681_0002944_1629_3134 485
2750 3300047472 Ga0495686_0000119 Ga0495686_0000119_53114_54574 485
2751 3300047472 Ga0495686_0000645 Ga0495686_0000645_25946_27403 485
2752 3300048903 Ga0496100_0008856 Ga0496100_0008856_3921_5387 485
2753 3300048904 Ga0496101_0047395 Ga0496101_0047395_793_2259 485
2754 3300048905 Ga0496102_0000162 Ga0496102_0000162_75623_77080 485
2755 3300048905 Ga0496102_0015020 Ga0496102_0015020_1247_2704 485
2756 3300048905 Ga0496102_0084802 Ga0496102_0084802_187_1644 485
2757 3300048905 Ga0496102_0175105 Ga0496102_0175105_499_1965 485
2758 3300048906 Ga0496103_0000190 Ga0496103_0000190_40378_41835 485
2759 3300048906 Ga0496103_0001725 Ga0496103_0001725_2332_3789 485
2760 3300048906 Ga0496103_0012361 Ga0496103_0012361_1185_2651 485
2761 3300048906 Ga0496103_0041306 Ga0496103_0041306_1337_2794 485
2762 3300048907 Ga0496104_0004696 Ga0496104_0004696_2515_3972 485
2763 3300048908 Ga0496105_0000395 Ga0496105_0000395_26509_27966 485
2764 3300048908 Ga0496105_0059146 Ga0496105_0059146_1366_2823 485
2765 3300048909 Ga0496106_0057213 Ga0496106_0057213_1245_2711 485
2766 3300048910 Ga0496107_0001028 Ga0496107_0001028_3597_5063 485
2767 3300048910 Ga0496107_0122832 Ga0496107_0122832_330_1808 485
2768 3300048910 Ga0496107_0138958 Ga0496107_0138958_269_1726 485
2769 3300048911 Ga0496108_0014853 Ga0496108_0014853_1930_3408 485
2770 3300048911 Ga0496108_0135219 Ga0496108_0135219_177_1643 485
2771 3300048913 Ga0496110_0037533 Ga0496110_0037533_634_2100 485
2772 3300048916 Ga0496113_0000233 Ga0496113_0000233_6667_8124 485
2773 3300048916 Ga0496113_0000943 Ga0496113_0000943_3513_4979 485
2774 3300048916 Ga0496113_0019710 Ga0496113_0019710_1528_3033 485
2775 3300048918 Ga0496115_0063056 Ga0496115_0063056_183_1640 485
2776 3300048919 Ga0496116_0000080 Ga0496116_0000080_35746_37251 485
2777 3300048919 Ga0496116_0035353 Ga0496116_0035353_1832_3289 485
2778 3300048919 Ga0496116_0044893 Ga0496116_0044893_1280_2737 485
2779 3300048920 Ga0496117_0000002 Ga0496117_0000002_1942543_1944048 485
2780 3300048920 Ga0496117_0000323 Ga0496117_0000323_68849_70306 485
2781 3300048920 Ga0496117_0001766 Ga0496117_0001766_204_1661 485
2782 3300048920 Ga0496117_0025476 Ga0496117_0025476_2390_3847 485
2783 3300048921 Ga0496118_0000233 Ga0496118_0000233_66056_67561 485
2784 3300048921 Ga0496118_0000525 Ga0496118_0000525_51210_52667 485
2785 3300048921 Ga0496118_0001902 Ga0496118_0001902_28113_29570 485
2786 3300048921 Ga0496118_0003389 Ga0496118_0003389_5637_7094 485
2787 3300048921 Ga0496118_0028580 Ga0496118_0028580_681_2213 485
2788 3300048921 Ga0496118_0033485 Ga0496118_0033485_426_1883 485
2789 3300048921 Ga0496118_0036820 Ga0496118_0036820_1597_3054 485
2790 3300048922 Ga0496119_0006263 Ga0496119_0006263_5187_6692 485
2791 3300048922 Ga0496119_0013258 Ga0496119_0013258_4234_5727 485
2792 3300048922 Ga0496119_0030915 Ga0496119_0030915_400_1869 485
2793 3300048922 Ga0496119_0044664 Ga0496119_0044664_191_1693 485
2794 3300048922 Ga0496119_0070562 Ga0496119_0070562_185_1690 485
2795 3300048922 Ga0496119_0107015 Ga0496119_0107015_49_1506 485
2796 3300048923 Ga0496120_0000021 Ga0496120_0000021_122527_124032 485
2797 3300048924 Ga0496121_0006257 Ga0496121_0006257_10457_11926 485
2798 3300048924 Ga0496121_0008423 Ga0496121_0008423_583_2040 485
2799 3300048924 Ga0496121_0009527 Ga0496121_0009527_9524_11017 485
2800 3300048924 Ga0496121_0012302 Ga0496121_0012302_4732_6192 485
2801 3300048924 Ga0496121_0064056 Ga0496121_0064056_1377_2834 485
2802 3300048925 Ga0496122_0000001 Ga0496122_0000001_1313333_1314838 485
2803 3300048925 Ga0496122_0000009 Ga0496122_0000009_467140_468633 485
2804 3300048925 Ga0496122_0000507 Ga0496122_0000507_64087_65544 485
2805 3300048925 Ga0496122_0002251 Ga0496122_0002251_6668_8125 485
2806 3300048925 Ga0496122_0012063 Ga0496122_0012063_5648_7141 485
2807 3300048925 Ga0496122_0059130 Ga0496122_0059130_1122_2582 485
2808 3300048926 Ga0496123_0000001 Ga0496123_0000001_1317064_1318569 485
2809 3300048926 Ga0496123_0000020 Ga0496123_0000020_271698_273191 485
2810 3300048926 Ga0496123_0000484 Ga0496123_0000484_14862_16319 485
2811 3300048926 Ga0496123_0002216 Ga0496123_0002216_4722_6182 485
2812 3300048926 Ga0496123_0002605 Ga0496123_0002605_17941_19398 485
2813 3300048926 Ga0496123_0005632 Ga0496123_0005632_4817_6310 485
2814 3300048927 Ga0496124_0000063 Ga0496124_0000063_77835_79340 485
2815 3300048927 Ga0496124_0001562 Ga0496124_0001562_183_1640 485
2816 3300048927 Ga0496124_0004006 Ga0496124_0004006_13682_15187 485
2817 3300048927 Ga0496124_0004328 Ga0496124_0004328_8417_9874 485
2818 3300048927 Ga0496124_0056914 Ga0496124_0056914_1676_3169 485
2819 3300048928 Ga0496125_0001001 Ga0496125_0001001_15148_16641 485
2820 3300048928 Ga0496125_0011912 Ga0496125_0011912_62_1567 485
2821 3300048929 Ga0496126_0000044 Ga0496126_0000044_107071_108528 485
2822 3300048929 Ga0496126_0000094 Ga0496126_0000094_16279_17784 485
2823 3300048929 Ga0496126_0001464 Ga0496126_0001464_11120_12586 485
2824 3300048929 Ga0496126_0001557 Ga0496126_0001557_5944_7419 485
2825 3300048929 Ga0496126_0001925 Ga0496126_0001925_168_1625 485
2826 3300049568 Ga0501031_0032480 Ga0501031_0032480_929_2401 485
2827 3300049568 Ga0501031_0038448 Ga0501031_0038448_942_2450 485
2828 3300049569 Ga0501032_0000014 Ga0501032_0000014_120991_122496 485
2829 3300049569 Ga0501032_0000033 Ga0501032_0000033_19416_20924 485
2830 3300049569 Ga0501032_0016219 Ga0501032_0016219_2201_3664 485
2831 3300049570 Ga0501033_0001595 Ga0501033_0001595_14809_16311 485
2832 3300049570 Ga0501033_0007234 Ga0501033_0007234_6428_7939 485
2833 3300049570 Ga0501033_0021866 Ga0501033_0021866_1847_3349 485
2834 3300049570 Ga0501033_0022999 Ga0501033_0022999_2894_4378 485
2835 3300049571 Ga0501034_0000001 Ga0501034_0000001_269672_271177 485
2836 3300049571 Ga0501034_0000537 Ga0501034_0000537_39340_40848 485
2837 3300049571 Ga0501034_0009896 Ga0501034_0009896_1180_2637 485
2838 3300049571 Ga0501034_0026179 Ga0501034_0026179_1297_2799 485
2839 3300049571 Ga0501034_0171630 Ga0501034_0171630_263_1765 485
2840 3300049572 Ga0501036_0000763 Ga0501036_0000763_10529_12037 485
2841 3300049572 Ga0501036_0001473 Ga0501036_0001473_7924_9429 485
2842 3300049572 Ga0501036_0014138 Ga0501036_0014138_4964_6490 485
2843 3300049572 Ga0501036_0053162 Ga0501036_0053162_39_1502 485
2844 3300049573 Ga0501037_0000067 Ga0501037_0000067_39157_40665 485
2845 3300049573 Ga0501037_0031626 Ga0501037_0031626_1735_3198 485
2846 3300049573 Ga0501037_0037027 Ga0501037_0037027_1472_2983 485
2847 3300049573 Ga0501037_0073885 Ga0501037_0073885_280_1806 485
2848 3300049574 Ga0501038_0000013 Ga0501038_0000013_122597_124105 485
2849 3300049574 Ga0501038_0023850 Ga0501038_0023850_2013_3476 485
2850 3300049574 Ga0501038_0035024 Ga0501038_0035024_1018_2544 485
2851 3300049574 Ga0501038_0132081 Ga0501038_0132081_527_2029 485
2852 3300049575 Ga0501039_0000010 Ga0501039_0000010_184400_185908 485
2853 3300049575 Ga0501039_0000016 Ga0501039_0000016_112762_114267 485
2854 3300049578 Ga0501042_0123923 Ga0501042_0123923_44_1570 485
2855 3300049579 Ga0501043_0000056 Ga0501043_0000056_45224_46732 485
2856 3300049579 Ga0501043_0003385 Ga0501043_0003385_198_1700 485
2857 3300049579 Ga0501043_0053957 Ga0501043_0053957_14_1516 485
2858 3300049579 Ga0501043_0057358 Ga0501043_0057358_1357_2820 485
2859 3300049579 Ga0501043_0075832 Ga0501043_0075832_86_1588 485
2860 3300049580 Ga0501046_0029505 Ga0501046_0029505_1977_3440 485
2861 3300049580 Ga0501046_0060138 Ga0501046_0060138_1257_2759 485
2862 3300049581 Ga0501047_0008673 Ga0501047_0008673_527_2038 485
2863 3300049581 Ga0501047_0030757 Ga0501047_0030757_2140_3639 485
2864 3300049581 Ga0501047_0076179 Ga0501047_0076179_614_2116 485
2865 3300049581 Ga0501047_0078745 Ga0501047_0078745_347_1849 485
2866 3300049581 Ga0501047_0117937 Ga0501047_0117937_660_2162 485
2867 3300049581 Ga0501047_0154984 Ga0501047_0154984_87_1550 485
2868 3300049581 Ga0501047_0176691 Ga0501047_0176691_51_1553 485
2869 3300049582 Ga0501048_0014377 Ga0501048_0014377_2617_4143 485
2870 3300049582 Ga0501048_0022887 Ga0501048_0022887_1837_3363 485
2871 3300049582 Ga0501048_0046672 Ga0501048_0046672_1580_3043 485
2872 3300049583 Ga0501067_0000095 Ga0501067_0000095_38482_39969 485
2873 3300049583 Ga0501067_0046304 Ga0501067_0046304_639_2141 485
2874 3300049584 Ga0501068_0028145 Ga0501068_0028145_1119_2582 485
2875 3300049585 Ga0501069_0028942 Ga0501069_0028942_1088_2614 485
2876 3300049586 Ga0501070_0000416 Ga0501070_0000416_32573_34060 485
2877 3300049586 Ga0501070_0009452 Ga0501070_0009452_5446_7143 485
2878 3300049586 Ga0501070_0026515 Ga0501070_0026515_93_1595 485
2879 3300049586 Ga0501070_0113655 Ga0501070_0113655_276_1778 485
2880 3300049587 Ga0501071_0033683 Ga0501071_0033683_1077_2603 485
2881 3300049588 Ga0501072_0003957 Ga0501072_0003957_1149_2636 485
2882 3300049589 Ga0501073_0013255 Ga0501073_0013255_417_1880 485
2883 3300049589 Ga0501073_0018910 Ga0501073_0018910_2419_3921 485
2884 3300049589 Ga0501073_0041445 Ga0501073_0041445_343_1869 485
2885 3300049589 Ga0501073_0115928 Ga0501073_0115928_96_1583 485
2886 3300049590 Ga0501074_0009854 Ga0501074_0009854_1043_2569 485
2887 3300049590 Ga0501074_0011786 Ga0501074_0011786_1127_2824 485
2888 3300049590 Ga0501074_0085147 Ga0501074_0085147_409_1872 485
2889 3300049664 Ga0501224_000012 Ga0501224_000012_81_1538 485
2890 3300049705 Ga0501225_0000019 Ga0501225_0000019_25_1482 485
2891 3300049742 Ga0501080_0001694 Ga0501080_0001694_1128_2825 485
2892 3300049742 Ga0501080_0008960 Ga0501080_0008960_5051_6538 485
2893 3300049742 Ga0501080_0053972 Ga0501080_0053972_553_2055 485
2894 3300049742 Ga0501080_0072024 Ga0501080_0072024_501_1964 485
2895 3300049742 Ga0501080_0089698 Ga0501080_0089698_121_1623 485
2896 3300049744 Ga0501083_0044680 Ga0501083_0044680_33_1496 485
2897 3300049822 Ga0501035_0000063 Ga0501035_0000063_82226_83734 485
2898 3300049822 Ga0501035_0000691 Ga0501035_0000691_4018_5505 485
2899 3300049822 Ga0501035_0002565 Ga0501035_0002565_482_1984 485
2900 3300049822 Ga0501035_0008192 Ga0501035_0008192_3472_4974 485
2901 3300049822 Ga0501035_0023989 Ga0501035_0023989_1831_3357 485
2902 3300049822 Ga0501035_0025199 Ga0501035_0025199_1785_3269 485
2903 3300049822 Ga0501035_0031603 Ga0501035_0031603_1985_3487 485
2904 3300049822 Ga0501035_0053015 Ga0501035_0053015_2056_3558 485
2905 3300049822 Ga0501035_0081518 Ga0501035_0081518_177_1679 485
2906 3300049822 Ga0501035_0126645 Ga0501035_0126645_489_1952 485
2907 3300049823 Ga0501044_0001339 Ga0501044_0001339_3579_5090 485
2908 3300049823 Ga0501044_0001727 Ga0501044_0001727_127_1614 485
2909 3300049823 Ga0501044_0002955 Ga0501044_0002955_9614_11071 485
2910 3300049823 Ga0501044_0010973 Ga0501044_0010973_7644_9128 485
2911 3300049823 Ga0501044_0012081 Ga0501044_0012081_7786_9288 485
2912 3300049823 Ga0501044_0017885 Ga0501044_0017885_1217_2914 485
2913 3300049823 Ga0501044_0037891 Ga0501044_0037891_440_1942 485
2914 3300049823 Ga0501044_0056573 Ga0501044_0056573_156_1682 485
2915 3300049823 Ga0501044_0066535 Ga0501044_0066535_1292_2794 485
2916 3300049823 Ga0501044_0087717 Ga0501044_0087717_51_1553 485
2917 3300049824 Ga0501045_0054602 Ga0501045_0054602_668_2194 485
2918 3300049853 Ga0501226_000199 Ga0501226_000199_7856_9313 485
2919 3300050489 nmdc:mga03683_16707_c1 nmdc:mga03683_16707_c1_684_2162 485
2920 3300050489 nmdc:mga03683_289_c1 nmdc:mga03683_289_c1_3239_4705 485
2921 3300050489 nmdc:mga03683_4043_c1 nmdc:mga03683_4043_c1_2129_3634 485
2922 3300050490 nmdc:mga03n38_31351_c1 nmdc:mga03n38_31351_c1_649_2154 485
2923 3300050491 nmdc:mga00v17_22945_c1 nmdc:mga00v17_22945_c1_865_2367 485
2924 3300050491 nmdc:mga00v17_23570_c1 nmdc:mga00v17_23570_c1_93_1559 485
2925 3300050491 nmdc:mga00v17_72_c1 nmdc:mga00v17_72_c1_8460_9965 485
2926 3300050492 nmdc:mga0yw44_3205_c1 nmdc:mga0yw44_3205_c1_3959_5464 485
2927 3300050494 nmdc:mga06z11_573_c1 nmdc:mga06z11_573_c1_5271_6737 485
2928 3300050496 nmdc:mga07m45_102897_c1 nmdc:mga07m45_102897_c1_166_1623 485
2929 3300050496 nmdc:mga07m45_38_c1 nmdc:mga07m45_38_c1_9982_11448 485
2930 3300050511 nmdc:mga08y16_220987_c1 nmdc:mga08y16_220987_c1_415_1938 485
2931 3300050511 nmdc:mga08y16_62_c1 nmdc:mga08y16_62_c1_61603_63066 485
2932 3300050511 nmdc:mga08y16_86979_c1 nmdc:mga08y16_86979_c1_623_2092 485
2933 3300053079 Ga0500610_0000536 Ga0500610_0000536_258_1715 485
2934 3300053103 Ga0500555_002397 Ga0500555_002397_2645_4105 485
2935 3300053103 Ga0500555_002766 Ga0500555_002766_3113_4576 485
2936 3300053104 Ga0500556_0000139 Ga0500556_0000139_21593_23050 485
2937 3300053116 Ga0500592_000074 Ga0500592_000074_14792_16249 485
2938 3300053116 Ga0500592_000423 Ga0500592_000423_5029_6486 485
2939 3300053116 Ga0500592_004686 Ga0500592_004686_402_1859 485
2940 3300053119 Ga0500595_002118 Ga0500595_002118_597_2054 485
2941 3300053119 Ga0500595_010066 Ga0500595_010066_213_1730 485
2942 3300053121 Ga0500607_000048 Ga0500607_000048_46251_47708 485
2943 3300053125 Ga0500618_000046 Ga0500618_000046_69876_71369 485
2944 3300053125 Ga0500618_000151 Ga0500618_000151_48333_49898 485
2945 3300053130 Ga0500642_0000011 Ga0500642_0000011_23656_25113 485
2946 3300053136 Ga0500559_0001340 Ga0500559_0001340_9234_10691 485
2947 3300053148 Ga0500590_005613 Ga0500590_005613_1904_3424 485
2948 3300053153 Ga0500616_0006086 Ga0500616_0006086_1020_2480 485
2949 3300053153 Ga0500616_0010040 Ga0500616_0010040_2972_4438 485
2950 3300053157 Ga0500624_000043 Ga0500624_000043_42143_43606 485
2951 3300053158 Ga0500627_0000014 Ga0500627_0000014_52677_54134 485
2952 3300053158 Ga0500627_0000423 Ga0500627_0000423_8122_9579 485
2953 3300053161 Ga0500634_0001572 Ga0500634_0001572_3215_4717 485
2954 3300053177 Ga0500636_0000010 Ga0500636_0000010_73487_74992 485
2955 3300053730 Ga0500645_000170 Ga0500645_000170_23426_24883 485
2956 3300053730 Ga0500645_000795 Ga0500645_000795_6197_7654 485
2957 3300053730 Ga0500645_004767 Ga0500645_004767_226_1683 485
2958 3300053730 Ga0500645_009149 Ga0500645_009149_936_2402 485
2959 3300053730 Ga0500645_009951 Ga0500645_009951_136_1593 485
2960 3300053733 Ga0500552_000241 Ga0500552_000241_3140_4606 485
2961 3300054114 Ga0501084_0000147 Ga0501084_0000147_8328_9815 485
2962 3300054114 Ga0501084_0015474 Ga0501084_0015474_3293_4783 485
2963 3300054114 Ga0501084_0108939 Ga0501084_0108939_725_2188 485
2964 3300059510 Ga0587090_005706 Ga0587090_005706_28_1533 485
2965 3300060353 Ga0501082_0147498 Ga0501082_0147498_184_1647 485
2966 3300061734 Ga0530510_0107481 Ga0530510_0107481_342_1868 485
2967 iso_pu_bacteria 2503198000 2503203025 485
2968 iso_pu_bacteria 2508501122 2509107155 485
2969 iso_pu_bacteria 2508501123 2509114760 485
2970 iso_pu_bacteria 2508501127 2509144375 485
2971 iso_pu_bacteria 2509276018 2509372509 485
2972 iso_pu_bacteria 2509276019 2509374880 485
2973 iso_pu_bacteria 2509276022 2509397499 485
2974 iso_pu_bacteria 2510065057 2510305204 485
2975 iso_pu_bacteria 2510065059 2510319426 485
2976 iso_pu_bacteria 2510461069 2510841761 485
2977 iso_pu_bacteria 2511231027 2511390744 485
2978 iso_pu_bacteria 2511231052 2511500633 485
2979 iso_pu_bacteria 2512047086 2512532060 485
2980 iso_pu_bacteria 2512875016 2512930154 485
2981 iso_pu_bacteria 2512875024 2512957858 485
2982 iso_pu_bacteria 2512875026 2512972610 485
2983 iso_pu_bacteria 2513237086 2513584213 485
2984 iso_pu_bacteria 2513237089 2513606817 485
2985 iso_pu_bacteria 2513237090 2513611761 485
2986 iso_pu_bacteria 2513237091 2513619200 485
2987 iso_pu_bacteria 2513237140 2513880678 485
2988 iso_pu_bacteria 2513237143 2513903391 485
2989 iso_pu_bacteria 2513237156 2513987127 485
2990 iso_pu_bacteria 2513237160 2514008483 485
2991 iso_pu_bacteria 2513237164 2514032972 485
2992 iso_pu_bacteria 2513237305 2514422542 485
2993 iso_pu_bacteria 2513237351 2514588899 485
2994 iso_pu_bacteria 2515154107 2515607772 485
2995 iso_pu_bacteria 2516143018 2516208513 485
2996 iso_pu_bacteria 2516653046 2516891909 485
2997 iso_pu_bacteria 2517487022 2517568724 485
2998 iso_pu_bacteria 2524023207 2524449962 485
2999 iso_pu_bacteria 2534681786 2535486323 485
3000 iso_pu_bacteria 2537561587 2537872849 485
3001 iso_pu_bacteria 2551306084 2551681603 485
3002 iso_pu_bacteria 2551306085 2551689123 485
3003 iso_pu_bacteria 2551306086 2551694107 485
3004 iso_pu_bacteria 2554235003 2554246652 485
3005 iso_pu_bacteria 2558860100 2558863872 485
3006 iso_pu_bacteria 2558860242 2559293880 485
3007 iso_pu_bacteria 2558860983 2561467409 485
3008 iso_pu_bacteria 2585427633 2585994486 485
3009 iso_pu_bacteria 2585427634 2585998933 485
3010 iso_pu_bacteria 2599185156 2599333092 485
3011 iso_pu_bacteria 2599185210 2599605428 485
3012 iso_pu_bacteria 2599185236 2599719511 485
3013 iso_pu_bacteria 2599185301 2599937425 485
3014 iso_pu_bacteria 2599185352 2600191512 485
3015 iso_pu_bacteria 2600255279 2601609148 485
3016 iso_pu_bacteria 2600255308 2601745923 485
3017 iso_pu_bacteria 2643221550 2643771017 485
3018 iso_pu_bacteria 2643221551 2643775419 485
3019 iso_pu_bacteria 2643221555 2643793865 485
3020 iso_pu_bacteria 2643221557 2643807637 485
3021 iso_pu_bacteria 2643221558 2643810499 485
3022 iso_pu_bacteria 2643221564 2643837355 485
3023 iso_pu_bacteria 2643221568 2643856327 485
3024 iso_pu_bacteria 2643221580 2643910100 485
3025 iso_pu_bacteria 2643221582 2643921133 485
3026 iso_pu_bacteria 2643221595 2643986663 485
3027 iso_pu_bacteria 2643221606 2644043447 485
3028 iso_pu_bacteria 2643221610 2644070049 485
3029 iso_pu_bacteria 2643221618 2644103131 485
3030 iso_pu_bacteria 2643221623 2644130208 485
3031 iso_pu_bacteria 2643221626 2644151939 485
3032 iso_pu_bacteria 2643221627 2644157598 485
3033 iso_pu_bacteria 2643221629 2644166681 485
3034 iso_pu_bacteria 2643221637 2644206642 485
3035 iso_pu_bacteria 2643221655 2644306058 485
3036 iso_pu_bacteria 2643221659 2644330366 485
3037 iso_pu_bacteria 2643221662 2644347748 485
3038 iso_pu_bacteria 2643221668 2644381020 485
3039 iso_pu_bacteria 2643221674 2644411192 485
3040 iso_pu_bacteria 2643221675 2644414926 485
3041 iso_pu_bacteria 2643221680 2644448583 485
3042 iso_pu_bacteria 2643221693 2644519206 485
3043 iso_pu_bacteria 2643221698 2644542887 485
3044 iso_pu_bacteria 2643221712 2644618991 485
3045 iso_pu_bacteria 2643221718 2644650289 485
3046 iso_pu_bacteria 2643221723 2644673975 485
3047 iso_pu_bacteria 2643221726 2644689109 485
3048 iso_pu_bacteria 2657244999 2657681950 485
3049 iso_pu_bacteria 2687453392 2688599899 485
3050 iso_pu_bacteria 2693429783 2694633947 485
3051 iso_pu_bacteria 2693429784 2694637626 485
3052 iso_pu_bacteria 2721755686 2723576660 485
3053 iso_pu_bacteria 2738541317 2738945620 485
3054 iso_pu_bacteria 2738543024 2739308760 485
3055 iso_pu_bacteria 2738543031 2739348238 485
3056 iso_pu_bacteria 2751185800 2753357747 485
3057 iso_pu_bacteria 2756170246 2756675528 485
3058 iso_pu_bacteria 2757320392 2757569309 485
3059 iso_pu_bacteria 2758568016 2758640324 485
3060 iso_pu_bacteria 2765235802 2765464432 485
3061 iso_pu_bacteria 2767802442 2770194792 485
3062 iso_pu_bacteria 2775506902 2776272417 485
3063 iso_pu_bacteria 2775506904 2776284357 485
3064 iso_pu_bacteria 2775507049 2776912180 485
3065 iso_pu_bacteria 2791355082 2792583802 485
3066 iso_pu_bacteria 2791355091 2792622404 485
3067 iso_pu_bacteria 2791355092 2792628028 485
3068 iso_pu_bacteria 2791355094 2792638715 485
3069 iso_pu_bacteria 2791355123 2792748876 485
3070 iso_pu_bacteria 2791355253 2793282003 485
3071 iso_pu_bacteria 2802428858 2802721647 485
3072 iso_pu_bacteria 2802428859 2802728460 485
3073 iso_pu_bacteria 2802428860 2802734519 485
3074 iso_pu_bacteria 2802428861 2802735855 485
3075 iso_pu_bacteria 2802428862 2802747266 485
3076 iso_pu_bacteria 2802428863 2802753918 485
3077 iso_pu_bacteria 2802429268 2804750969 485
3078 iso_pu_bacteria 2808606387 2808986344 485
3079 iso_pu_bacteria 2818991439 2819556476 485
3080 iso_pu_bacteria 2818991461 2819684657 485
3081 iso_pu_bacteria 2821123053 2821123686 485
3082 iso_pu_bacteria 2837651117 2837652110 485
3083 iso_pu_bacteria 2837678835 2837680822 485
3084 iso_pu_bacteria 2838074704 2838075417 485
3085 iso_pu_bacteria 2838714209 2838716093 485
3086 iso_pu_bacteria 2838719591 2838720107 485
3087 iso_pu_bacteria 2838736955 2838739283 485
3088 iso_pu_bacteria 2839993093 2839994343 485
3089 iso_pu_bacteria 2840764183 2840769246 485
3090 iso_pu_bacteria 2841734538 2841740831 485
3091 iso_pu_bacteria 2841840854 2841843181 485
3092 iso_pu_bacteria 2842140634 2842142963 485
3093 iso_pu_bacteria 2842170452 2842172338 485
3094 iso_pu_bacteria 2842187318 2842189200 485
3095 iso_pu_bacteria 2842211629 2842213514 485
3096 iso_pu_bacteria 2842224351 2842224868 485
3097 iso_pu_bacteria 2842515876 2842517215 485
3098 iso_pu_bacteria 2842871566 2842873554 485
3099 iso_pu_bacteria 2842922631 2842923395 485
3100 iso_pu_bacteria 2844002411 2844006024 485
3101 iso_pu_bacteria 2844009547 2844015162 485
3102 iso_pu_bacteria 2844163670 2844170699 485
3103 iso_pu_bacteria 2847417321 2847417726 485
3104 iso_pu_bacteria 2847670302 2847671081 485
3105 iso_pu_bacteria 2847686936 2847687239 485
3106 iso_pu_bacteria 2848992105 2848992571 485
3107 iso_pu_bacteria 2850079185 2850080090 485
3108 iso_pu_bacteria 2854896431 2854898337 485
3109 iso_pu_bacteria 2854911287 2854914994 485
3110 iso_pu_bacteria 2854916844 2854919050 485
3111 iso_pu_bacteria 2855825444 2855831828 485
3112 iso_pu_bacteria 2855839649 2855840114 485
3113 iso_pu_bacteria 2855872281 2855873126 485
3114 iso_pu_bacteria 2856314179 2856316577 485
3115 iso_pu_bacteria 2856320880 2856324641 485
3116 iso_pu_bacteria 2856328259 2856333150 485
3117 iso_pu_bacteria 2856334872 2856339123 485
3118 iso_pu_bacteria 2856342000 2856342259 485
3119 iso_pu_bacteria 2856349417 2856354059 485
3120 iso_pu_bacteria 2856356410 2856361868 485
3121 iso_pu_bacteria 2856364286 2856371033 485
3122 iso_pu_bacteria 2857349434 2857355383 485
3123 iso_pu_bacteria 2857531043 2857531248 485
3124 iso_pu_bacteria 2858800743 2858804022 485
3125 iso_pu_bacteria 2869162929 2869165618 485
3126 iso_pu_bacteria 2869169390 2869173467 485
3127 iso_pu_bacteria 2869234852 2869238319 485
3128 iso_pu_bacteria 2869242130 2869243724 485
3129 iso_pu_bacteria 2869249662 2869252640 485
3130 iso_pu_bacteria 2869256925 2869257606 485
3131 iso_pu_bacteria 2869271264 2869274826 485
3132 iso_pu_bacteria 2869278585 2869281364 485
3133 iso_pu_bacteria 2869285874 2869292074 485
3134 iso_pu_bacteria 2871429161 2871435281 485
3135 iso_pu_bacteria 2871451962 2871455726 485
3136 iso_pu_bacteria 2871459585 2871462540 485
3137 iso_pu_bacteria 2871474448 2871481233 485
3138 iso_pu_bacteria 2871481445 2871484604 485
3139 iso_pu_bacteria 2871488783 2871488873 485
3140 iso_pu_bacteria 2871495908 2871496044 485
3141 iso_pu_bacteria 2874109183 2874111803 485
3142 iso_pu_bacteria 2874116593 2874119052 485
3143 iso_pu_bacteria 2874123672 2874131070 485
3144 iso_pu_bacteria 2874139085 2874140970 485
3145 iso_pu_bacteria 2874146452 2874154982 485
3146 iso_pu_bacteria 2874155637 2874161301 485
3147 iso_pu_bacteria 2874162495 2874164660 485
3148 iso_pu_bacteria 2874168670 2874170351 485
3149 iso_pu_bacteria 2876363079 2876366281 485
3150 iso_pu_bacteria 2876369609 2876375013 485
3151 iso_pu_bacteria 2876377896 2876380639 485
3152 iso_pu_bacteria 2876386047 2876388935 485
3153 iso_pu_bacteria 2876392853 2876395458 485
3154 iso_pu_bacteria 2876399893 2876402378 485
3155 iso_pu_bacteria 2876406927 2876411855 485
3156 iso_pu_bacteria 2876413966 2876420438 485
3157 iso_pu_bacteria 2878035449 2878036800 485
3158 iso_pu_bacteria 2878730984 2878733413 485
3159 iso_pu_bacteria 2878738818 2878742750 485
3160 iso_pu_bacteria 2878745973 2878752416 485
3161 iso_pu_bacteria 2878753008 2878753636 485
3162 iso_pu_bacteria 2878760144 2878760277 485
3163 iso_pu_bacteria 2878767105 2878767237 485
3164 iso_pu_bacteria 2878781027 2878784167 485
3165 iso_pu_bacteria 2878788777 2878789230 485
3166 iso_pu_bacteria 2881147464 2881152367 485
3167 iso_pu_bacteria 2881155292 2881156617 485
3168 iso_pu_bacteria 2881161766 2881161995 485
3169 iso_pu_bacteria 2881845957 2881847558 485
3170 iso_pu_bacteria 2881853255 2881860543 485
3171 iso_pu_bacteria 2881861095 2881862586 485
3172 iso_pu_bacteria 2882632389 2882633557 485
3173 iso_pu_bacteria 2885305155 2885310874 485
3174 iso_pu_bacteria 2885312484 2885316651 485
3175 iso_pu_bacteria 2885318864 2885325842 485
3176 iso_pu_bacteria 2885326080 2885331786 485
3177 iso_pu_bacteria 2885342637 2885346969 485
3178 iso_pu_bacteria 2885350715 2885353612 485
3179 iso_pu_bacteria 2888337043 2888341074 485
3180 iso_pu_bacteria 2888343758 2888348253 485
3181 iso_pu_bacteria 2888350351 2888357132 485
3182 iso_pu_bacteria 2889010040 2889012143 485
3183 iso_pu_bacteria 2889016732 2889022926 485
3184 iso_pu_bacteria 2889790730 2889795719 485
3185 iso_pu_bacteria 2889914905 2889918511 485
3186 iso_pu_bacteria 2891048133 2891051245 485
3187 iso_pu_bacteria 2894652903 2894655282 485
3188 iso_pu_bacteria 2894772417 2894776650 485
3189 iso_pu_bacteria 2894817345 2894819345 485
3190 iso_pu_bacteria 2896384573 2896387457 485
3191 iso_pu_bacteria 2899803654 2899804456 485
3192 iso_pu_bacteria 2899845264 2899847915 485
3193 iso_pu_bacteria 2903448605 2903452485 485
3194 iso_pu_bacteria 2903492973 2903495532 485
3195 iso_pu_bacteria 2903492973 2903505411 485
3196 iso_pu_bacteria 2903513507 2903518426 485
3197 iso_pu_bacteria 2903521522 2903524149 485
3198 iso_pu_bacteria 2903528002 2903533668 485
3199 iso_pu_bacteria 2903540706 2903540839 485
3200 iso_pu_bacteria 2904578770 2904578978 485
3201 iso_pu_bacteria 2904659560 2904662088 485
3202 iso_pu_bacteria 2906308376 2906314810 485
3203 iso_pu_bacteria 2906321335 2906327982 485
3204 iso_pu_bacteria 2906328253 2906332747 485
3205 iso_pu_bacteria 2906363423 2906364185 485
3206 iso_pu_bacteria 2906370794 2906374265 485
3207 iso_pu_bacteria 2906378014 2906385735 485
3208 iso_pu_bacteria 2906393657 2906396954 485
3209 iso_pu_bacteria 2906401398 2906402075 485
3210 iso_pu_bacteria 2906408224 2906413835 485
3211 iso_pu_bacteria 2906414383 2906416714 485
3212 iso_pu_bacteria 2913295892 2913297924 485
3213 iso_pu_bacteria 2913308742 2913310701 485
3214 iso_pu_bacteria 2915650412 2915654333 485
3215 iso_pu_bacteria 2915980308 2915984960 485
3216 iso_pu_bacteria 2915986958 2915990829 485
3217 iso_pu_bacteria 2915993759 2915999622 485
3218 iso_pu_bacteria 2916000859 2916007215 485
3219 iso_pu_bacteria 2916014648 2916019771 485
3220 iso_pu_bacteria 2916021584 2916022588 485
3221 iso_pu_bacteria 2916028427 2916029091 485
3222 iso_pu_bacteria 2916035215 2916039839 485
3223 iso_pu_bacteria 2916041962 2916042845 485
3224 iso_pu_bacteria 2916048683 2916051825 485
3225 iso_pu_bacteria 2916055098 2916060131 485
3226 iso_pu_bacteria 2916061851 2916066897 485
3227 iso_pu_bacteria 2916076590 2916080930 485
3228 iso_pu_bacteria 2917554339 2917555464 485
3229 iso_pu_bacteria 2919114240 2919116296 485
3230 iso_pu_bacteria 2919119836 2919122195 485
3231 iso_pu_bacteria 2919166419 2919166906 485
3232 iso_pu_bacteria 2919171160 2919172017 485
3233 iso_pu_bacteria 2920760137 2920763272 485
3234 iso_pu_bacteria 2920822456 2920823429 485
3235 iso_pu_bacteria 2921201388 2921205234 485
3236 iso_pu_bacteria 2921208531 2921214980 485
3237 iso_pu_bacteria 2921237296 2921239942 485
3238 iso_pu_bacteria 2921244191 2921245150 485
3239 iso_pu_bacteria 2921250672 2921255917 485
3240 iso_pu_bacteria 2921257292 2921260253 485
3241 iso_pu_bacteria 2921263974 2921269000 485
3242 iso_pu_bacteria 2921282425 2921286631 485
3243 iso_pu_bacteria 2921289301 2921291890 485
3244 iso_pu_bacteria 2921296804 2921298900 485
3245 iso_pu_bacteria 2922130491 2922134521 485
3246 iso_pu_bacteria 2922151315 2922154369 485
3247 iso_pu_bacteria 2922158528 2922161211 485
3248 iso_pu_bacteria 2922172374 2922175008 485
3249 iso_pu_bacteria 2922185730 2922189957 485
3250 iso_pu_bacteria 2924144063 2924146102 485
3251 iso_pu_bacteria 2924150972 2924153843 485
3252 iso_pu_bacteria 2924158325 2924163560 485
3253 iso_pu_bacteria 2924165586 2924165930 485
3254 iso_pu_bacteria 2924172951 2924178232 485
3255 iso_pu_bacteria 2924179722 2924185625 485
3256 iso_pu_bacteria 2924186466 2924191869 485
3257 iso_pu_bacteria 2924193448 2924194241 485
3258 iso_pu_bacteria 2924200457 2924202488 485
3259 iso_pu_bacteria 2924207177 2924209720 485
3260 iso_pu_bacteria 2924214083 2924215103 485
3261 iso_pu_bacteria 2924221636 2924226431 485
3262 iso_pu_bacteria 2924228884 2924232519 485
3263 iso_pu_bacteria 2924718760 2924724466 485
3264 iso_pu_bacteria 2924726620 2924731642 485
3265 iso_pu_bacteria 2924733363 2924735145 485
3266 iso_pu_bacteria 2924741084 2924742937 485
3267 iso_pu_bacteria 2924748358 2924752866 485
3268 iso_pu_bacteria 2924762789 2924767481 485
3269 iso_pu_bacteria 2924776078 2924780550 485
3270 iso_pu_bacteria 2924784321 2924790044 485
3271 iso_pu_bacteria 2926754445 2926757250 485
3272 iso_pu_bacteria 2926760298 2926761464 485
3273 iso_pu_bacteria 2928521798 2928521879 485
3274 iso_pu_bacteria 2929138655 2929139003 485
3275 iso_pu_bacteria 2932401849 2932403889 485
3276 iso_pu_bacteria 2933006813 2933007378 485
3277 iso_pu_bacteria 2933011516 2933012142 485
3278 iso_pu_bacteria 2933594066 2933594587 485
3279 iso_pu_bacteria 2936996657 2936999753 485
3280 iso_pu_bacteria 2937002841 2937004995 485
3281 iso_pu_bacteria 2937009748 2937011276 485
3282 iso_pu_bacteria 2937016420 2937021030 485
3283 iso_pu_bacteria 2937023124 2937023913 485
3284 iso_pu_bacteria 2937029754 2937034343 485
3285 iso_pu_bacteria 2937036028 2937041116 485
3286 iso_pu_bacteria 2937042894 2937048665 485
3287 iso_pu_bacteria 2937049772 2937053932 485
3288 iso_pu_bacteria 2937056579 2937057645 485
3289 iso_pu_bacteria 2937063883 2937070095 485
3290 iso_pu_bacteria 2937071275 2937071468 485
3291 iso_pu_bacteria 2937078374 2937083213 485
3292 iso_pu_bacteria 2937084907 2937087453 485
3293 iso_pu_bacteria 2937091812 2937097510 485
3294 iso_pu_bacteria 2937098957 2937103382 485
3295 iso_pu_bacteria 2937106411 2937112662 485
3296 iso_pu_bacteria 2937113482 2937114615 485
3297 iso_pu_bacteria 2937119839 2937122535 485
3298 iso_pu_bacteria 2937126314 2937128412 485
3299 iso_pu_bacteria 2937813078 2937821208 485
3300 iso_pu_bacteria 2937822353 2937823705 485
3301 iso_pu_bacteria 2937836603 2937842127 485
3302 iso_pu_bacteria 2937843397 2937846459 485
3303 iso_pu_bacteria 2937848649 2937855206 485
3304 iso_pu_bacteria 2937877337 2937883077 485
3305 iso_pu_bacteria 2937891427 2937893925 485
3306 iso_pu_bacteria 2937972304 2937973830 485
3307 iso_pu_bacteria 2937980651 2937987347 485
3308 iso_pu_bacteria 2937994558 2937994694 485
3309 iso_pu_bacteria 2938014810 2938017278 485
3310 iso_pu_bacteria 2941499720 2941500662 485
3311 iso_pu_bacteria 2954011201 2954014764 485
3312 iso_pu_bacteria 2957375807 2957380430 485
3313 iso_pu_bacteria 2957382221 2957383739 485
3314 iso_pu_bacteria 2957388812 2957394133 485
3315 iso_pu_bacteria 2957395598 2957399465 485
3316 iso_pu_bacteria 2957402308 2957403787 485
3317 iso_pu_bacteria 2957408893 2957410986 485
3318 iso_pu_bacteria 2957415311 2957421625 485
3319 iso_pu_bacteria 2957422303 2957424945 485
3320 iso_pu_bacteria 2957430029 2957435489 485
3321 iso_pu_bacteria 2957437181 2957441999 485
3322 iso_pu_bacteria 2957443900 2957447040 485
3323 iso_pu_bacteria 2957450854 2957457380 485
3324 iso_pu_bacteria 2957457609 2957464350 485
3325 iso_pu_bacteria 2957464669 2957466132 485
3326 iso_pu_bacteria 2957471148 2957473863 485
3327 iso_pu_bacteria 2957478035 2957482934 485
3328 iso_pu_bacteria 2957484790 2957490229 485
3329 iso_pu_bacteria 2957491536 2957496388 485
3330 iso_pu_bacteria 2957498199 2957501967 485
3331 iso_pu_bacteria 2957505466 2957511509 485
3332 iso_pu_bacteria 2958034702 2958037326 485
3333 iso_pu_bacteria 2958041894 2958047038 485
3334 iso_pu_bacteria 2958064165 2958067556 485
3335 iso_pu_bacteria 2958071322 2958076722 485
3336 iso_pu_bacteria 2958084443 2958090203 485
3337 iso_pu_bacteria 2958100919 2958104183 485
3338 iso_pu_bacteria 2958115193 2958117778 485
3339 iso_pu_bacteria 2958122699 2958127635 485
3340 iso_pu_bacteria 2958130278 2958136474 485
3341 iso_pu_bacteria 2958144490 2958148585 485
3342 iso_pu_bacteria 2958158011 2958159364 485
3343 iso_pu_bacteria 2958165035 2958165172 485
3344 iso_pu_bacteria 2958179912 2958185941 485
3345 iso_pu_bacteria 2960584000 2960589103 485
3346 iso_pu_bacteria 2960591022 2960595902 485
3347 iso_pu_bacteria 2960597568 2960599687 485
3348 iso_pu_bacteria 2960603979 2960605493 485
3349 iso_pu_bacteria 2960610863 2960616985 485
3350 iso_pu_bacteria 2960617483 2960621814 485
3351 iso_pu_bacteria 2960624210 2960630271 485
3352 iso_pu_bacteria 2960631154 2960636362 485
3353 iso_pu_bacteria 2960637947 2960644739 485
3354 iso_pu_bacteria 2960645483 2960651793 485
3355 iso_pu_bacteria 2960652885 2960653215 485
3356 iso_pu_bacteria 2960660292 2960660323 485
3357 iso_pu_bacteria 2960667422 2960668374 485
3358 iso_pu_bacteria 2960674078 2960675643 485
3359 iso_pu_bacteria 2960680706 2960685515 485
3360 iso_pu_bacteria 2960687367 2960691955 485
3361 iso_pu_bacteria 2960693952 2960699544 485
3362 iso_pu_bacteria 2961077736 2961084422 485
3363 iso_pu_bacteria 2961114664 2961117242 485
3364 iso_pu_bacteria 2961127735 2961135572 485
3365 iso_pu_bacteria 2961136820 2961140055 485
3366 iso_pu_bacteria 2961163497 2961163633 485
3367 iso_pu_bacteria 2961170736 2961170825 485
3368 iso_pu_bacteria 2963644680 2963649077 485
3369 iso_pu_bacteria 2964607997 2964609426 485
3370 iso_pu_bacteria 2964615318 2964619902 485
3371 iso_pu_bacteria 2964621998 2964627438 485
3372 iso_pu_bacteria 2964628898 2964634385 485
3373 iso_pu_bacteria 2964636051 2964636357 485
3374 iso_pu_bacteria 2964643177 2964648191 485
3375 iso_pu_bacteria 2964649959 2964650397 485
3376 iso_pu_bacteria 2964656573 2964660391 485
3377 iso_pu_bacteria 2964663802 2964665865 485
3378 iso_pu_bacteria 2964678106 2964680672 485
3379 iso_pu_bacteria 2964685014 2964687977 485
3380 iso_pu_bacteria 2964691889 2964692989 485
3381 iso_pu_bacteria 2964705432 2964711286 485
3382 iso_pu_bacteria 2964712639 2964714724 485
3383 iso_pu_bacteria 2964719344 2964719839 485
3384 iso_pu_bacteria 2965018300 2965018435 485
3385 iso_pu_bacteria 2965025482 2965030422 485
3386 iso_pu_bacteria 2965032056 2965037648 485
3387 iso_pu_bacteria 2965062239 2965069732 485
3388 iso_pu_bacteria 2965089291 2965090525 485
3389 iso_pu_bacteria 2967664464 2967670339 485
3390 iso_pu_bacteria 2967671571 2967674286 485
3391 iso_pu_bacteria 2967678726 2967685023 485
3392 iso_pu_bacteria 2967686174 2967691372 485
3393 iso_pu_bacteria 2967693043 2967695136 485
3394 iso_pu_bacteria 2967699805 2967706858 485
3395 iso_pu_bacteria 2967706974 2967712828 485
3396 iso_pu_bacteria 2967714385 2967714728 485
3397 iso_pu_bacteria 2967721400 2967724218 485
3398 iso_pu_bacteria 2967728569 2967733568 485
3399 iso_pu_bacteria 2967735183 2967736265 485
3400 iso_pu_bacteria 2967742019 2967744041 485
3401 iso_pu_bacteria 2967748971 2967751795 485
3402 iso_pu_bacteria 2967755722 2967761391 485
3403 iso_pu_bacteria 2967762386 2967762621 485
3404 iso_pu_bacteria 2967769361 2967771252 485
3405 iso_pu_bacteria 2967775926 2967778339 485
3406 iso_pu_bacteria 2967996073 2968003404 485
3407 iso_pu_bacteria 2968003550 2968004171 485
3408 iso_pu_bacteria 2968016561 2968019854 485
3409 iso_pu_bacteria 2968083720 2968084265 485
3410 iso_pu_bacteria 2968091066 2968096792 485
3411 iso_pu_bacteria 2968097103 2968100071 485
3412 iso_pu_bacteria 2968110612 2968113150 485
3413 iso_pu_bacteria 2968117919 2968123687 485
3414 iso_pu_bacteria 2968128360 2968132957 485
3415 iso_pu_bacteria 2968138860 2968144759 485
3416 iso_pu_bacteria 2968171901 2968172035 485
3417 iso_pu_bacteria 2970019648 2970025646 485
3418 iso_pu_bacteria 2970026789 2970032445 485
3419 iso_pu_bacteria 2970033650 2970033970 485
3420 iso_pu_bacteria 2970040964 2970045555 485
3421 iso_pu_bacteria 2970047711 2970052566 485
3422 iso_pu_bacteria 2970054988 2970057368 485
3423 iso_pu_bacteria 2970061556 2970068062 485
3424 iso_pu_bacteria 2970068827 2970071420 485
3425 iso_pu_bacteria 2970076120 2970080548 485
3426 iso_pu_bacteria 2970082768 2970086068 485
3427 iso_pu_bacteria 2970088815 2970091225 485
3428 iso_pu_bacteria 2970095765 2970101565 485
3429 iso_pu_bacteria 2970102677 2970103459 485
3430 iso_pu_bacteria 2970109326 2970115997 485
3431 iso_pu_bacteria 2970116247 2970118464 485
3432 iso_pu_bacteria 2970122695 2970127539 485
3433 iso_pu_bacteria 2970129317 2970131634 485
3434 iso_pu_bacteria 2970136068 2970136513 485
3435 iso_pu_bacteria 2970143518 2970148465 485
3436 iso_pu_bacteria 2970149975 2970153952 485
3437 iso_pu_bacteria 2970156795 2970162691 485
3438 iso_pu_bacteria 2970164137 2970167657 485
3439 iso_pu_bacteria 2970170962 2970174215 485
3440 iso_pu_bacteria 2970177841 2970181812 485
3441 iso_pu_bacteria 2970184632 2970190515 485
3442 iso_pu_bacteria 2970191845 2970194967 485
3443 iso_pu_bacteria 2970469710 2970473175 485
3444 iso_pu_bacteria 2970489779 2970495312 485
3445 iso_pu_bacteria 2970503327 2970503415 485
3446 iso_pu_bacteria 2970510686 2970514889 485
3447 iso_pu_bacteria 2970524798 2970531402 485
3448 iso_pu_bacteria 2970532167 2970536848 485
3449 iso_pu_bacteria 2970540015 2970540846 485
3450 iso_pu_bacteria 2970547951 2970550547 485
3451 iso_pu_bacteria 2970554993 2970555128 485
3452 iso_pu_bacteria 2970593180 2970595968 485
3453 iso_pu_bacteria 2970619444 2970625609 485
3454 iso_pu_bacteria 2970627176 2970627243 485
3455 iso_pu_bacteria 2977516862 2977518942 485
3456 iso_pu_bacteria 2977523885 2977529072 485
3457 iso_pu_bacteria 2977530762 2977536182 485
3458 iso_pu_bacteria 2977537788 2977540039 485
3459 iso_pu_bacteria 2977544691 2977545132 485
3460 iso_pu_bacteria 2977551784 2977552864 485
3461 iso_pu_bacteria 2977558990 2977559228 485
3462 iso_pu_bacteria 2977565890 2977567572 485
3463 iso_pu_bacteria 2977572785 2977573094 485
3464 iso_pu_bacteria 2977579622 2977580503 485
3465 iso_pu_bacteria 2977821940 2977822852 485
3466 iso_pu_bacteria 2977828996 2977829982 485
3467 iso_pu_bacteria 2977843712 2977849591 485
3468 iso_pu_bacteria 2977851361 2977853105 485
3469 iso_pu_bacteria 2977858184 2977863135 485
3470 iso_pu_bacteria 2977864932 2977871891 485
3471 iso_pu_bacteria 2977872689 2977874361 485
3472 iso_pu_bacteria 2977907340 2977909572 485
3473 iso_pu_bacteria 2977922695 2977926888 485
3474 iso_pu_bacteria 2977935797 2977939321 485
3475 iso_pu_bacteria 2977942078 2977948887 485
3476 iso_pu_bacteria 2977950692 2977951663 485
3477 iso_pu_bacteria 2977971508 2977975380 485
3478 iso_pu_bacteria 2977986579 2977989120 485
3479 iso_pu_bacteria 2978969890 2978973323 485
3480 iso_pu_bacteria 2979089926 2979093248 485
3481 iso_pu_bacteria 2979095461 2979099364 485
3482 iso_pu_bacteria 2979100975 2979105218 485
3483 iso_pu_bacteria 2979779861 2979781542 485
3484 iso_pu_bacteria 2979793036 2979794536 485
3485 iso_pu_bacteria 2979808191 2979815644 485
3486 iso_pu_bacteria 2984509177 2984512926 485
3487 iso_pu_bacteria 2984518228 2984520710 485
3488 iso_pu_bacteria 2984537506 2984540002 485
3489 iso_pu_bacteria 2984587000 2984591604 485
3490 iso_pu_bacteria 2984601300 2984602193 485
3491 iso_pu_bacteria 2987636660 2987640516 485
3492 iso_pu_bacteria 2987645492 2987646942 485
3493 iso_pu_bacteria 2987652177 2987657090 485
3494 iso_pu_bacteria 2987659509 2987659640 485
3495 iso_pu_bacteria 2987666974 2987670151 485
3496 iso_pu_bacteria 2987673487 2987678033 485
3497 iso_pu_bacteria 2995392953 2995396550 485
3498 iso_pu_bacteria 2996310559 2996312229 485
3499 iso_pu_bacteria 2996336353 2996340819 485
3500 iso_pu_bacteria 2996341866 2996348263 485
3501 iso_pu_bacteria 2996348954 2996351721 485
3502 iso_pu_bacteria 2996386984 2996389609 485
3503 iso_pu_bacteria 3000135777 3000138992 485
3504 iso_pu_bacteria 3002141150 3002142768 485
3505 iso_pu_bacteria 3004167301 3004170611 485
3506 iso_pu_bacteria 3004188549 3004188684 485
3507 iso_pu_bacteria 3004195979 3004199818 485
3508 iso_pu_bacteria 3004203850 3004208714 485
3509 iso_pu_bacteria 3004211236 3004214900 485
3510 iso_pu_bacteria 3004218560 3004222509 485
3511 iso_pu_bacteria 3004232784 3004239257 485
3512 iso_pu_bacteria 3004239961 3004245133 485
3513 iso_pu_bacteria 3004248173 3004250643 485
3514 iso_pu_bacteria 3004268573 3004271761 485
3515 iso_pu_bacteria 3004275668 3004278421 485
3516 iso_pu_bacteria 3004334049 3004339699 485
3517 iso_pu_bacteria 637000159 637079937 485
3518 iso_pu_bacteria 643692032 643824585 485
3519 iso_pu_bacteria 648276728 648739422 485
3520 iso_pu_bacteria 649633066 649874378 485
3521 iso_pu_bacteria 650716007 650739071 485
3522 iso_pu_bacteria 8002285264 8002285279 485
3523 iso_pu_bacteria 8003570095 8003572702 485
3524 iso_pu_bacteria 8003992118 8003992526 485
3525 iso_pu_bacteria 8003999396 8003999854 485
3526 iso_pu_bacteria 8004300914 8004305755 485
3527 iso_pu_bacteria 8004312739 8004316329 485
3528 iso_pu_bacteria 8004361976 8004367115 485
3529 iso_pu_bacteria 8004374579 8004375208 485
3530 iso_pu_bacteria 8004387939 8004394946 485
3531 iso_pu_bacteria 8004395343 8004402729 485
3532 iso_pu_bacteria 8004445564 8004446417 485
3533 iso_pu_bacteria 8004633249 8004634939 485
3534 iso_pu_bacteria 8004640170 8004642897 485
3535 iso_pu_bacteria 8004703790 8004711661 485
3536 iso_pu_bacteria 8004714634 8004721071 485
3537 iso_pu_bacteria 8004727605 8004730944 485
3538 iso_pu_bacteria 8018150411 8018152002 485
3539 iso_pu_bacteria 8024486573 8024491383 485
3540 iso_pu_bacteria 8045864390 8045868249 485
3541 iso_pu_bacteria 8049293176 8049293545 485
3542 iso_pu_bacteria 8054460903 8054461334 485
3543 iso_pu_bacteria 8055431914 8055436085 485
3544 iso_pu_bacteria 8055617313 8055622443 485
3545 iso_pu_bacteria 8056875544 8056879184 485

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

78

550

0.99

PF00571

CBS

CBS domain

226

283

0.93

PF00571

CBS

CBS domain

153

221

0.83

PF03060

NMO

Nitronate monooxygenase

271

535

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kcf-assembly1.cif.gz_C-2 structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9781 5 464
6kcf-assembly1.cif.gz_D-2 structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9731 5 464
6kcf-assembly1.cif.gz_B structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9728 5 464
5ahn-assembly1.cif.gz_A imp-bound form of the d199n mutant of impdh from pseudomonas aeruginosa 0.9722 1 461
5urq-assembly1.cif.gz_B crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176 0.972 1 483
ID Description Score Start End Superfamily
6mgrC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9611 1 483 3.20.20.70
5x8oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9594 3 461 3.20.20.70
af_Q2G0Y7_1_488_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9587 4 484 3.20.20.70
6mgrC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9561 1 483 3.20.20.70
af_Q8I2U5_4_508_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9539 5 480 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A348TRI4-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9927 95 217 GO:0003938
GO:0006183
AF-A0A351KUV0-F1-model_v4 IMP dehydrogenase 0.977 3 291 GO:0003938
GO:0006183
AF-A0A4P6FWS6-F1-model_v4 Inosine-5'-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205) 0.9752 1 485 GO:0000166
GO:0003938
GO:0006177
GO:0006183
GO:0046872
AF-A0A3A0V3H2-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9752 164 358 GO:0003938
GO:0006177
GO:0006183
GO:0046872
AF-A0A085F7B9-F1-model_v4 Inosine-5'-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205) 0.9751 6 485 GO:0000166
GO:0003938
GO:0006177
GO:0006183
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.22 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map