F497320

General Info

Members Datasets Scaffolds Average Seq Length
3477 1757 2334 401

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306089|2551712762
Length 394
Sequence FVYDHVRTPRGRGKKDGALHEVPSVRLAAKVLEAVRDRNGLDTSTVDDVIMGCVDPVMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANAWEKGYFKNSVVPVKDQNGLVILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGAAAVLIGSXAMGLKPRARIRAFANIGSDPALMLTGPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYCQAFDIPHDKINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
4 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
5 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
6 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
7 2508501050 Microvirga lupini Lut6 Isolate Nodule
8 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
9 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
10 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
11 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
12 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
13 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
14 2509276019 Ensifer aridi TW10 Isolate Nodule
15 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
16 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
17 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
18 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
19 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
20 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
21 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
22 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
23 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
24 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
25 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
26 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
27 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
28 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
29 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
30 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
31 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
32 2512875024 Mesorhizobium loti R88b Isolate Nodule
33 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
34 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
35 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
36 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
37 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
38 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
39 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
40 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
41 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
42 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
43 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
44 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
45 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
46 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
47 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
48 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
49 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
50 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
51 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
52 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
53 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
54 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
55 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
56 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
57 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
58 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
59 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
60 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
61 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
62 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
63 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
64 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
65 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
66 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
67 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
68 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
69 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
70 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
71 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
72 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
73 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
74 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
75 2516143018 Ensifer sp. BR816 Isolate Nodule
76 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
77 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
78 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
79 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
80 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
81 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
82 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
83 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
84 2519899620 Rhizobium sp. Pop5 Isolate Nodule
85 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
86 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
87 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
88 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
89 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
90 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
91 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
92 2534681786 Brucella suis 92/29 Isolate Unclassified
93 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
94 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
95 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
96 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
97 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
98 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
99 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
100 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
101 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
102 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
103 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
104 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
105 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
106 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
107 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
108 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
109 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
110 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
111 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
112 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
113 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
114 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
115 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
116 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
117 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
118 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
119 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
120 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
121 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
122 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
123 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
124 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
125 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
126 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
127 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
128 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
129 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
130 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
131 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
132 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
133 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
134 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
135 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
136 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
137 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
138 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
139 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
140 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
141 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
142 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
143 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
144 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
145 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
146 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
147 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
148 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
149 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
150 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
151 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
152 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
153 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
154 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
155 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
156 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
157 2643221557 Ensifer sp. Root558 Isolate Unclassified
158 2643221558 Rhizobium sp. Root149 Isolate Unclassified
159 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
160 2643221568 Rhizobium sp. Root564 Isolate Unclassified
161 2643221582 Rhizobium sp. Root651 Isolate Unclassified
162 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
163 2643221599 Rhizobium sp. Root708 Isolate Unclassified
164 2643221607 Rhizobium sp. Root73 Isolate Unclassified
165 2643221610 Ensifer sp. Root74 Isolate Unclassified
166 2643221618 Ensifer sp. Root231 Isolate Unclassified
167 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
168 2643221626 Ensifer sp. Root31 Isolate Unclassified
169 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
170 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
171 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
172 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
173 2643221651 Afipia sp. Root123D2 Isolate Unclassified
174 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
175 2643221655 Ensifer sp. Root1252 Isolate Unclassified
176 2643221659 Ensifer sp. Root127 Isolate Unclassified
177 2643221668 Ensifer sp. Root423 Isolate Unclassified
178 2643221675 Ensifer sp. Root1298 Isolate Unclassified
179 2643221680 Ensifer sp. Root1312 Isolate Unclassified
180 2643221683 Variovorax sp. Root473 Isolate Unclassified
181 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
182 2643221688 Rhizobium sp. Root482 Isolate Unclassified
183 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
184 2643221693 Rhizobium sp. Root491 Isolate Unclassified
185 2643221698 Ensifer sp. Root142 Isolate Unclassified
186 2643221712 Ensifer sp. Root258 Isolate Unclassified
187 2643221718 Rhizobium sp. Root268 Isolate Unclassified
188 2643221719 Rhizobium sp. Root274 Isolate Unclassified
189 2643221723 Ensifer sp. Root278 Isolate Unclassified
190 2643221726 Ensifer sp. Root954 Isolate Unclassified
191 2643221733 Bosea sp. Root381 Isolate Unclassified
192 2643221734 Bosea sp. Root670 Isolate Unclassified
193 2643221736 Bosea sp. Root483D1 Isolate Unclassified
194 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
195 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
196 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
197 2671180195 Frankia sp. CcI49 Isolate Nodule
198 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
199 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
200 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
201 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
202 2718217882 Rhizobium sp. N741 Isolate Nodule
203 2718217927 Rhizobium sp. N324 Isolate Nodule
204 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
205 2718218009 Rhizobium sp. N561 Isolate Nodule
206 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
207 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
208 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
209 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
210 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
211 2718218363 Rhizobium sp. N113 Isolate Nodule
212 2718218365 Rhizobium sp. N731 Isolate Nodule
213 2718218366 Rhizobium sp. N621 Isolate Nodule
214 2718218423 Rhizobium sp. N941 Isolate Nodule
215 2721755514 Rhizobium sp. N6212 Isolate Nodule
216 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
217 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
218 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
219 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
220 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
221 2721755809 Rhizobium sp. N541 Isolate Nodule
222 2721755810 Rhizobium sp. N871 Isolate Nodule
223 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
224 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
225 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
226 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
227 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
228 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
229 2728369365 Rhizobium sp. N1341 Isolate Nodule
230 2728369397 Rhizobium sp. N1314 Isolate Nodule
231 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
232 2738541293 Rhizobium sp. GV031 Isolate Unclassified
233 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
234 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
235 2738543024 Aminobacter sp. AP02 Isolate Unclassified
236 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
237 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
238 2751185800 Brucella pituitosa AA2 Isolate Unclassified
239 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
240 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
241 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
242 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
243 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
244 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
245 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
246 2773857922 Frankia sp. CcI49 Isolate Nodule
247 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
248 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
249 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
250 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
251 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
252 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
253 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
254 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
255 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
256 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
257 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
258 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
259 2791355199
260 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
261 2791355256 Rhizobium sp. M10 Isolate Nodule
262 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
263 2791355260 Rhizobium sp. L9 Isolate Nodule
264 2791355261 Rhizobium sp. J15 Isolate Nodule
265 2791355262 Rhizobium sp. M1 Isolate Nodule
266 2791355263 Rhizobium chutanense C5 Isolate Nodule
267 2791355264 Rhizobium sp. S9 Isolate Nodule
268 2791355265 Rhizobium sp. H4 Isolate Nodule
269 2791355266 Rhizobium sp. L43 Isolate Nodule
270 2791355267 Rhizobium sp. L18 Isolate Nodule
271 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
272 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
273 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
274 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
275 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
276 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
277 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
278 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
279 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
280 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
281 2802429633 Rhizobium anhuiense J3 Isolate Nodule
282 2802429634 Rhizobium anhuiense S10 Isolate Nodule
283 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
284 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
285 2802429637 Rhizobium anhuiense C15 Isolate Nodule
286 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
287 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
288 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
289 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
290 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
291 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
292 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
293 2818991467 Bosea vestrisii 3192 Isolate Unclassified
294 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
295 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
296 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
297 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
298 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
299 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
300 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
301 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
302 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
303 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
304 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
305 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
306 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
307 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
308 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
309 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
310 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
311 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
312 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
313 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
314 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
315 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
316 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
317 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
318 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
319 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
320 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
321 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
322 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
323 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
324 2838048938 Rhizobium pisi 27/80 Isolate Nodule
325 2838061910 Rhizobium phaseoli L15 Isolate Nodule
326 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
327 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
328 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
329 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
330 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
331 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
332 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
333 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
334 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
335 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
336 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
337 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
338 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
339 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
340 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
341 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
342 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
343 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
344 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
345 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
346 2841760612 Bosea sp. Tri-49 Isolate Nodule
347 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
348 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
349 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
350 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
351 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
352 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
353 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
354 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
355 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
356 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
357 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
358 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
359 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
360 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
361 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
362 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
363 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
364 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
365 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
366 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
367 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
368 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
369 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
370 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
371 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
372 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
373 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
374 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
375 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
376 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
377 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
378 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
379 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
380 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
381 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
382 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
383 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
384 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
385 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
386 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
387 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
388 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
389 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
390 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
391 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
392 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
393 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
394 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
395 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
396 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
397 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
398 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
399 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
400 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
401 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
402 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
403 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
404 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
405 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
406 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
407 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
408 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
409 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
410 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
411 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
412 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
413 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
414 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
415 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
416 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
417 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
418 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
419 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
420 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
421 2842694124 Methylopila sp. R-72369 Isolate Unclassified
422 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
423 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
424 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
425 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
426 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
427 2844104063 Bosea sp. Tri-39 Isolate Nodule
428 2844163670 Ensifer sp. 1H6 Isolate Unclassified
429 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
430 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
431 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
432 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
433 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
434 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
435 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
436 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
437 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
438 2851182111 Bosea sp. Tri-44 Isolate Nodule
439 2851246043 Bosea sp. Tri-54 Isolate Nodule
440 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
441 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
442 2854911287 Brucella lupini LUP21 Isolate Unclassified
443 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
444 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
445 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
446 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
447 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
448 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
449 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
450 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
451 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
452 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
453 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
454 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
455 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
456 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
457 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
458 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
459 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
460 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
461 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
462 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
463 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
464 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
465 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
466 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
467 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
468 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
469 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
470 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
471 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
472 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
473 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
474 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
475 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
476 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
477 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
478 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
479 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
480 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
481 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
482 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
483 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
484 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
485 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
486 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
487 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
488 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
489 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
490 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
491 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
492 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
493 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
494 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
495 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
496 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
497 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
498 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
499 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
500 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
501 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
502 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
503 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
504 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
505 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
506 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
507 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
508 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
509 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
510 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
511 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
512 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
513 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
514 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
515 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
516 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
517 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
518 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
519 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
520 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
521 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
522 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
523 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
524 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
525 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
526 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
527 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
528 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
529 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
530 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
531 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
532 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
533 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
534 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
535 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
536 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
537 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
538 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
539 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
540 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
541 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
542 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
543 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
544 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
545 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
546 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
547 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
548 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
549 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
550 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
551 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
552 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
553 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
554 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
555 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
556 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
557 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
558 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
559 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
560 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
561 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
562 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
563 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
564 2902330777 Methylobacterium sp. 2A Isolate Unclassified
565 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
566 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
567 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
568 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
569 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
570 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
571 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
572 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
573 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
574 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
575 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
576 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
577 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
578 2904699407
579 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
580 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
581 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
582 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
583 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
584 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
585 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
586 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
587 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
588 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
589 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
590 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
591 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
592 2906610324
593 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
594 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
595 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
596 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
597 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
598 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
599 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
600 2909042592 Labrys sp. LIt4 Isolate Nodule
601 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
602 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
603 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
604 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
605 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
606 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
607 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
608 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
609 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
610 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
611 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
612 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
613 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
614 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
615 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
616 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
617 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
618 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
619 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
620 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
621 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
622 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
623 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
624 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
625 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
626 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
627 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
628 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
629 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
630 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
631 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
632 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
633 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
634 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
635 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
636 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
637 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
638 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
639 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
640 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
641 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
642 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
643 2922368715
644 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
645 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
646 2922425934
647 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
648 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
649 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
650 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
651 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
652 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
653 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
654 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
655 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
656 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
657 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
658 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
659 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
660 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
661 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
662 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
663 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
664 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
665 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
666 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
667 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
668 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
669 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
670 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
671 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
672 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
673 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
674 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
675 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
676 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
677 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
678 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
679 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
680 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
681 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
682 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
683 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
684 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
685 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
686 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
687 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
688 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
689 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
690 2933599457 Rhizobium phaseoli M3 Isolate Nodule
691 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
692 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
693 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
694 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
695 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
696 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
697 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
698 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
699 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
700 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
701 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
702 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
703 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
704 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
705 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
706 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
707 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
708 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
709 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
710 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
711 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
712 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
713 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
714 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
715 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
716 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
717 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
718 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
719 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
720 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
721 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
722 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
723 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
724 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
725 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
726 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
727 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
728 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
729 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
730 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
731 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
732 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
733 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
734 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
735 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
736 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
737 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
738 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
739 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
740 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
741 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
742 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
743 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
744 2936381700 Rhizobium chutanense C16 Isolate Unclassified
745 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
746 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
747 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
748 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
749 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
750 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
751 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
752 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
753 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
754 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
755 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
756 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
757 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
758 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
759 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
760 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
761 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
762 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
763 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
764 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
765 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
766 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
767 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
768 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
769 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
770 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
771 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
772 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
773 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
774 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
775 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
776 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
777 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
778 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
779 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
780 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
781 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
782 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
783 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
784 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
785 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
786 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
787 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
788 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
789 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
790 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
791 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
792 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
793 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
794 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
795 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
796 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
797 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
798 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
799 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
800 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
801 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
802 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
803 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
804 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
805 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
806 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
807 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
808 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
809 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
810 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
811 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
812 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
813 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
814 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
815 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
816 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
817 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
818 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
819 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
820 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
821 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
822 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
823 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
824 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
825 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
826 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
827 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
828 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
829 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
830 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
831 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
832 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
833 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
834 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
835 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
836 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
837 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
838 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
839 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
840 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
841 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
842 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
843 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
844 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
845 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
846 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
847 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
848 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
849 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
850 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
851 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
852 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
853 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
854 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
855 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
856 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
857 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
858 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
859 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
860 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
861 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
862 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
863 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
864 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
865 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
866 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
867 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
868 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
869 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
870 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
871 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
872 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
873 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
874 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
875 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
876 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
877 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
878 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
879 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
880 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
881 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
882 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
883 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
884 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
885 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
886 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
887 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
888 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
889 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
890 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
891 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
892 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
893 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
894 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
895 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
896 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
897 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
898 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
899 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
900 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
901 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
902 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
903 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
904 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
905 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
906 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
907 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
908 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
909 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
910 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
911 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
912 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
913 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
914 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
915 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
916 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
917 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
918 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
919 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
920 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
921 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
922 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
923 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
924 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
925 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
926 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
927 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
928 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
929 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
930 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
931 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
932 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
933 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
934 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
935 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
936 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
937 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
938 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
939 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
940 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
941 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
942 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
943 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
944 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
945 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
946 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
947 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
948 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
949 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
950 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
951 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
952 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
953 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
954 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
955 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
956 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
957 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
958 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
959 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
960 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
961 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
962 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
963 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
964 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
965 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
966 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
967 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
968 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
969 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
970 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
971 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
972 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
973 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
974 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
975 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
976 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
977 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
978 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
979 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
980 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
981 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
982 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
983 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
984 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
985 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
986 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
987 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
988 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
989 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
990 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
991 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
992 2996887358 Rhizobium sp. R711 Isolate Nodule
993 2996893221 Rhizobium sp. R635 Isolate Nodule
994 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
995 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
996 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
997 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
998 3004167301 Mesorhizobium loti 582 Isolate Unclassified
999 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1000 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1001 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1002 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1003 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1004 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1005 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1006 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1007 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1008 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1009 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1010 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1011 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1012 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1013 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1014 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1015 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
1016 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1017 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
1018 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1019 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
1020 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
1021 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1022 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
1023 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
1024 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
1025 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
1026 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
1027 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
1028 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
1029 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
1030 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
1031 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
1032 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
1033 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
1034 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
1035 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
1036 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
1037 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
1038 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
1039 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
1040 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
1041 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
1042 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
1043 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
1044 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1045 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
1046 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
1047 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
1048 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
1049 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
1050 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
1051 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1052 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
1053 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
1054 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
1055 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
1056 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
1057 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
1058 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
1059 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
1060 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
1061 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
1062 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
1063 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
1064 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
1065 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
1066 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
1067 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
1068 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
1069 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
1070 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
1071 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
1072 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
1073 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
1074 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
1075 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
1076 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
1077 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
1078 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
1079 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
1080 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
1081 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
1082 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
1083 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
1084 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
1085 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
1086 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
1087 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
1088 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
1089 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
1090 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
1091 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
1092 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
1093 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
1094 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
1095 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
1096 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
1097 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
1098 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
1099 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
1100 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
1101 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
1102 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
1103 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
1104 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
1105 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
1106 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
1107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
1108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
1109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
1110 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
1111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
1112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
1113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
1114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
1115 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
1116 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
1117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
1118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
1119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
1120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
1121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
1122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
1123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
1124 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
1125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
1126 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
1127 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
1128 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
1129 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
1130 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
1131 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
1132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
1133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
1134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
1135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
1136 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
1137 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
1138 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1140 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
1141 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
1142 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
1143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
1144 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
1145 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
1146 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
1147 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
1148 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
1149 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
1150 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
1151 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
1152 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
1153 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
1154 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
1155 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
1156 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
1157 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
1158 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
1159 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
1160 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
1161 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
1162 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
1163 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
1164 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
1165 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
1166 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
1167 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
1168 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
1169 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
1170 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
1171 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
1172 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
1173 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
1174 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
1175 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
1176 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
1177 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
1178 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
1179 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
1180 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
1181 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
1182 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
1183 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
1184 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
1185 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
1186 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
1187 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
1188 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
1189 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
1190 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
1191 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
1192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
1193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
1194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
1195 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
1196 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
1197 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
1198 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
1199 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
1200 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
1201 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
1202 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
1203 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1204 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1205 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
1206 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
1207 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1209 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1210 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1211 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
1212 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1213 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
1214 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
1215 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1216 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
1217 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
1218 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
1219 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1220 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1221 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1222 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
1223 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
1224 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1225 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1226 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1227 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1228 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1229 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1230 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1231 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1232 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1233 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1234 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1235 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1236 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1237 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1238 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1239 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
1240 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1241 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1242 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1243 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1244 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1245 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1246 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1247 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1248 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1249 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1250 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1251 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1252 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1253 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1254 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1255 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1256 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1257 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1258 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1259 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1260 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1261 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1262 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1263 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1264 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1265 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1268 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1269 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1270 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1271 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1272 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1273 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1274 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1275 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1276 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1277 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1278 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1279 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1280 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1281 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1282 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1283 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1284 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1285 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1286 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1287 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1288 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1289 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1290 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1291 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1292 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1293 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1294 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1295 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1296 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1297 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1298 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1299 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1300 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1301 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1302 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1303 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1304 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1305 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1306 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1307 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1308 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1309 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1310 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1311 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1312 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1313 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1314 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1315 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1316 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1317 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1318 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1319 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1320 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1321 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
1322 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1323 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1324 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
1325 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1326 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1327 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1328 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1329 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1330 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1331 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1332 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
1333 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
1334 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1335 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1336 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1337 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1338 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1339 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1340 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1341 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1342 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1343 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1344 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1345 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1346 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1347 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1348 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1349 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1350 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1351 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1352 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1353 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1354 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1355 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1356 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1357 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1358 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1359 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1360 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1361 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1362 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1363 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1364 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1365 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1366 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1367 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1368 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1369 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1370 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1371 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
1372 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1373 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1374 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
1375 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1376 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1377 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1378 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1379 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1380 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1381 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1382 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1383 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
1384 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1385 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1386 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1387 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1388 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1389 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1390 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1391 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1392 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1393 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1394 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1395 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1396 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1397 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1398 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1399 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1400 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1401 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1402 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1403 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1404 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1405 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1406 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1407 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1408 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1409 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1410 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1411 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1412 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1413 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1414 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1415 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1416 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1417 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1418 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1419 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1420 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1421 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1422 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1423 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1424 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
1425 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1426 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
1427 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1428 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
1429 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
1430 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
1431 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
1432 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1433 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1434 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1435 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1436 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1437 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1438 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1439 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1440 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1441 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1442 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1443 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1444 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1445 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1446 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1447 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1448 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1449 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1450 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1451 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1452 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1453 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1454 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1455 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1456 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1457 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1458 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1459 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1460 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1461 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1462 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1463 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1464 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1465 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1466 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1467 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1468 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1469 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1470 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1471 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1472 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1473 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1474 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1475 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1476 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1477 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1478 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1479 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1480 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1481 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1482 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1483 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1484 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1485 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1486 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1487 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1488 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1489 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1490 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1491 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1492 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1493 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1494 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1495 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1496 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1497 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1498 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1499 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1500 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1501 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1502 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1503 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1504 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1505 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1506 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1507 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1508 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1509 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1510 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1511 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1512 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1513 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1514 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1515 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1516 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1517 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1518 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1519 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1520 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1521 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1522 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1523 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1524 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1525 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1526 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1527 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1528 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1529 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1530 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1531 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1532 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1533 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1534 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1535 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1536 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1537 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1538 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1539 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1540 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1541 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1542 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1543 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1544 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1545 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1546 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1547 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1548 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1549 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1550 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1551 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1552 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1553 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1554 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1555 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1556 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1557 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1558 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1559 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1560 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1561 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1562 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1563 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1564 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1565 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1566 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1567 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1568 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1569 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1570 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1571 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1572 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
1573 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1574 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1575 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1576 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1577 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1578 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1579 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1580 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1581 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1582 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1583 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1584 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1585 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1586 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1587 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1588 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1589 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1590 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1591 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1592 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1593 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1594 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1595 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1596 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1597 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1598 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1599 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1600 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1601 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1602 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1603 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1604 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1605 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
1606 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1607 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1608 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1609 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1610 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1611 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1612 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1613 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1614 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1615 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1616 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1617 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1618 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1619 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1620 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1621 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1622 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1623 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1624 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1625 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1626 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1627 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1628 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1629 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
1630 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1631 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1632 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1633 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1634 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1635 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1636 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1637 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1638 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1639 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1640 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1641 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1642 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1643 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1644 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1645 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1646 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1647 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1648 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1649 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1650 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1651 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1652 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1653 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1654 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1655 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1656 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1657 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1658 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1659 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1660 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1661 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1662 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1663 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1664 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1665 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1666 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1667 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1668 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1669 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1670 8005258706 Rhizobium sp. R693 Isolate Nodule
1671 8005275841 Rhizobium sp. N4311 Isolate Nodule
1672 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1673 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1674 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1675 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1676 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1677 8005321885 Rhizobium sp. R72 Isolate Nodule
1678 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1679 8005382845 Rhizobium sp. R634 Isolate Nodule
1680 8005395548 Rhizobium sp. R339 Isolate Nodule
1681 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1682 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1683 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1684 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1685 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1686 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1687 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1688 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1689 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1690 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1691 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1692 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1693 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1694 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1695 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1696 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1697 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1698 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1699 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1700 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1701 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1702 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1703 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1704 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1705 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1706 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1707 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1708 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1709 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1710 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1711 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1712 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1713 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1714 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1715 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1716 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1717 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1718 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1719 8018176218 Rhizobium sp. N122 Isolate Nodule
1720 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1721 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1722 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1723 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1724 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1725 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1726 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1727 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1728 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1729 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1730 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1731 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1732 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1733 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1734 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1735 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1736 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1737 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1738 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1739 8024501048 Rhizobium sp. H4 Isolate Nodule
1740 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1741 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1742 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1743 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1744 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1745 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1746 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1747 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1748 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1749 8056382006 Rhizobium croatiense 13T Isolate Nodule
1750 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1751 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1752 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1753 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1754 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1755 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1756 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1757 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.08
Metatranscriptomes 0.14
Isolates 32.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 9.15
Nodule 25.28
Rhizoplane 4.17
Rhizosphere 50.56
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2750580 2162886007 Bacteria 7172
2 SwRhRL2b_contig_3176492 2162886007 Bacteria 88382
3 2214856302 2209111006 Bacteria 8874
4 ARSoilYngRDRAFT_c00110 3300000042 Bacteria 14017
5 ARcpr5yngRDRAFT_c000135 3300000043 Bacteria 11579
6 ARSoilOldRDRAFT_c000118 3300000044 Bacteria 13976
7 ARCol0oldRDRAFT_c00031 3300000045 Bacteria 10735
8 ARCol0yngRDRAFT_1000154 3300000652 Bacteria 12154
9 JGI24739J22299_10037086 3300001989 Bacteria 1643
10 JGI24735J21928_10032585 3300002067 Bacteria 1542
11 JGI24750J21931_1003973 3300002070 Bacteria 1782
12 JGI24748J21848_1000499 3300002074 Bacteria 4324
13 JGI24749J21850_1000004 3300002076 Bacteria 57210
14 JGI24742J22300_10003084 3300002244 Bacteria 2697
15 JGI24751J29686_10000021 3300002459 Bacteria 104690
16 JGI25155J39150_1000013 3300002704 Bacteria 198215
17 JGI25156J39149_1000011 3300002705 Bacteria 198215
18 JGI25162J39368_1000169 3300002737 Bacteria 72114
19 JGI25162J39368_1003036 3300002737 Bacteria 5463
20 JGI25154J39366_1000030 3300002738 Bacteria 191444
21 JGI25158J39367_1003938 3300002739 Bacteria 2252
22 JGI25157J39369_1000013 3300002741 Bacteria 198211
23 JGI25152J39213_1000798 3300002773 Bacteria 15817
24 JGI25152J39213_1001975 3300002773 Bacteria 8118
25 JGI25152J39213_1003710 3300002773 Bacteria 5116
26 JGI25152J39213_1005747 3300002773 Bacteria 3536
27 JGI25150J39212_1000810 3300002774 Bacteria 10584
28 JGI25150J39212_1005834 3300002774 Bacteria 2594
29 JGI25159J45721_1000003 3300002987 Bacteria 274069
30 JGI25159J45721_1000591 3300002987 Bacteria 16244
31 JGI25159J45721_1002704 3300002987 Bacteria 6592
32 JGI25151J46595_10000018 3300003187 Bacteria 238438
33 JGI25151J46595_10000110 3300003187 Bacteria 111972
34 JGI25151J46595_10000681 3300003187 Bacteria 28706
35 JGI25151J46595_10003489 3300003187 Bacteria 8676
36 JGI25151J46595_10009047 3300003187 Bacteria 4747
37 JGI25151J46595_10010820 3300003187 Bacteria 4221
38 JGI25406J46586_10000063 3300003203 Bacteria 49219
39 JGI25406J46586_10030475 3300003203 Bacteria 2029
40 JGI25165J46597_1000019 3300003214 Bacteria 371528
41 JGI25165J46597_1000349 3300003214 Bacteria 52229
42 JGI25165J46597_1000355 3300003214 Bacteria 51475
43 JGI25165J46597_1005721 3300003214 Bacteria 2334
44 JGI25153J46596_10001081 3300003215 Bacteria 16614
45 JGI25153J46596_10002687 3300003215 Bacteria 10145
46 JGI25153J46596_10014754 3300003215 Bacteria 3229
47 JGI25153J46596_10018100 3300003215 Bacteria 2748
48 JGI25153J46596_10020756 3300003215 Bacteria 2473
49 rootH2_10018950 3300003320 Bacteria 32131
50 JGI25160J50197_1000003 3300003354 Bacteria 482719
51 JGI25160J50197_1000041 3300003354 Bacteria 152843
52 JGI25160J50197_1002508 3300003354 Bacteria 8524
53 JGI25160J50197_1004045 3300003354 Bacteria 6396
54 JGI25160J50197_1011256 3300003354 Bacteria 3180
55 JGI25160J50197_1018142 3300003354 Bacteria 2203
56 JGI25161J50226_1000002 3300003374 Bacteria 420324
57 JGI25161J50226_1000122 3300003374 Bacteria 56906
58 JGI25161J50226_1001136 3300003374 Bacteria 8905
59 JGI25161J50226_1007267 3300003374 Bacteria 1882
60 Ga0006562J51391_1013576 3300003578 Bacteria 6010
61 JGI25404J52841_10005199 3300003659 Bacteria 2683
62 JGI25404J52841_10010567 3300003659 Bacteria 1984
63 Ga0055542_1000656 3300003762 Bacteria 28388
64 Ga0055526_1000243 3300003771 Bacteria 46170
65 Ga0055526_1000725 3300003771 Bacteria 24927
66 Ga0055526_1001105 3300003771 Bacteria 19609
67 Ga0055526_1001581 3300003771 Bacteria 16011
68 Ga0055526_1008338 3300003771 Bacteria 5192
69 Ga0055526_1016655 3300003771 Bacteria 2859
70 Ga0055526_1017886 3300003771 Bacteria 2678
71 Ga0055526_1018301 3300003771 Bacteria 2621
72 Ga0055524_1000048 3300003775 Bacteria 149598
73 Ga0055524_1000553 3300003775 Bacteria 28250
74 Ga0055524_1010740 3300003775 Bacteria 3626
75 Ga0055524_1013232 3300003775 Bacteria 3122
76 Ga0055524_1016018 3300003775 Bacteria 2709
77 Ga0055528_1001113 3300003790 Bacteria 17624
78 Ga0055528_1006363 3300003790 Bacteria 5363
79 Ga0055528_1008984 3300003790 Bacteria 4219
80 Ga0055528_1011964 3300003790 Bacteria 3401
81 Ga0055540_1000190 3300003792 Bacteria 59767
82 Ga0055540_1002584 3300003792 Bacteria 9428
83 Ga0055540_1008813 3300003792 Bacteria 3576
84 Ga0055531_10007481 3300003794 Bacteria 5952
85 Ga0055531_10011017 3300003794 Bacteria 4418
86 Ga0058692_1006646 3300003856 Bacteria 3147
87 Ga0058692_1010698 3300003856 Bacteria 2257
88 Ga0058692_1014934 3300003856 Bacteria 1764
89 Ga0055543_1000008 3300004625 Bacteria 202062
90 Ga0055543_1000059 3300004625 Bacteria 100942
91 Ga0055543_1005647 3300004625 Bacteria 3161
92 Ga0055543_1006626 3300004625 Bacteria 2770
93 Ga0065165_1000031 3300005262 Bacteria 216330
94 Ga0065165_1000084 3300005262 Bacteria 154822
95 Ga0065165_1000337 3300005262 Bacteria 76914
96 Ga0065165_1001384 3300005262 Bacteria 26615
97 Ga0065165_1001884 3300005262 Bacteria 20242
98 Ga0065165_1004086 3300005262 Bacteria 9446
99 Ga0065165_1004925 3300005262 Bacteria 7873
100 Ga0065165_1007961 3300005262 Bacteria 5073
101 Ga0065165_1014726 3300005262 Bacteria 3021
102 Ga0065717_1001970 3300005276 Bacteria 4564
103 Ga0065716_1002100 3300005277 Bacteria 2275
104 Ga0065704_10070182 3300005289 Bacteria 120495
105 Ga0065704_10070243 3300005289 Bacteria 50129
106 Ga0065712_10000879 3300005290 Bacteria 11911
107 Ga0065712_10088405 3300005290 Bacteria 2522
108 Ga0065712_10089909 3300005290 Bacteria 2444
109 Ga0065715_10001041 3300005293 Bacteria 11829
110 Ga0065707_10000429 3300005295 Bacteria 96496
111 Ga0065707_10081920 3300005295 Bacteria 29456
112 Ga0070658_10008048 3300005327 Bacteria 8476
113 Ga0070658_10041998 3300005327 Bacteria 3690
114 Ga0070658_10106990 3300005327 Bacteria 2314
115 Ga0070658_10126919 3300005327 Bacteria 2124
116 Ga0070676_10066760 3300005328 Bacteria 2150
117 Ga0070690_100010321 3300005330 Bacteria 5432
118 Ga0070690_100112157 3300005330 Bacteria 1821
119 Ga0070690_100137030 3300005330 Bacteria 1658
120 Ga0070690_100198009 3300005330 Bacteria 1396
121 Ga0070670_100000006 3300005331 Bacteria 319420
122 Ga0070670_100000160 3300005331 Bacteria 61135
123 Ga0070670_100012351 3300005331 Bacteria 7307
124 Ga0070670_100045666 3300005331 Bacteria 3767
125 Ga0070670_100056600 3300005331 Bacteria 3365
126 Ga0070670_100206197 3300005331 Bacteria 1709
127 Ga0068869_100002361 3300005334 Bacteria 11367
128 Ga0068869_100105365 3300005334 Bacteria 2138
129 Ga0068869_100214637 3300005334 Bacteria 1523
130 Ga0070666_10002554 3300005335 Bacteria 11008
131 Ga0070666_10038386 3300005335 Bacteria 3186
132 Ga0070666_10050139 3300005335 Bacteria 2807
133 Ga0070680_100008313 3300005336 Bacteria 7943
134 Ga0070680_100009816 3300005336 Bacteria 7368
135 Ga0070680_100029451 3300005336 Bacteria 4410
136 Ga0070680_100031370 3300005336 Bacteria 4272
137 Ga0070680_100040837 3300005336 Bacteria 3759
138 Ga0070680_100064174 3300005336 Bacteria 3010
139 Ga0070680_100123337 3300005336 Bacteria 2164
140 Ga0070680_100145083 3300005336 Bacteria 1991
141 Ga0070680_100189074 3300005336 Bacteria 1735
142 Ga0070682_100001700 3300005337 Bacteria 12230
143 Ga0070682_100003398 3300005337 Bacteria 8828
144 Ga0070682_100037461 3300005337 Bacteria 2969
145 Ga0070682_100048214 3300005337 Bacteria 2652
146 Ga0070682_100101196 3300005337 Bacteria 1902
147 Ga0070682_100117519 3300005337 Bacteria 1780
148 Ga0068868_100035824 3300005338 Bacteria 3838
149 Ga0070660_100003066 3300005339 Bacteria 11485
150 Ga0070660_100022096 3300005339 Bacteria 4700
151 Ga0070660_100076905 3300005339 Bacteria 2615
152 Ga0070660_100103580 3300005339 Bacteria 2257
153 Ga0070660_100110176 3300005339 Bacteria 2189
154 Ga0070660_100149476 3300005339 Bacteria 1877
155 Ga0070689_100011560 3300005340 Bacteria 6325
156 Ga0070689_100256063 3300005340 Bacteria 1445
157 Ga0070691_10047014 3300005341 Bacteria 2051
158 Ga0070687_100033814 3300005343 Bacteria 2526
159 Ga0070687_100046191 3300005343 Bacteria 2228
160 Ga0070661_100136283 3300005344 Bacteria 1847
161 Ga0070692_10041383 3300005345 Bacteria 2360
162 Ga0070692_10135050 3300005345 Bacteria 1390
163 Ga0070668_100000161 3300005347 Bacteria 42519
164 Ga0070668_100011381 3300005347 Bacteria 6627
165 Ga0070668_100118002 3300005347 Bacteria 2118
166 Ga0070668_100133084 3300005347 Bacteria 1997
167 Ga0070668_100307814 3300005347 Bacteria 1330
168 Ga0070669_100000142 3300005353 Bacteria 64092
169 Ga0070669_100000305 3300005353 Bacteria 38624
170 Ga0070669_100000546 3300005353 Bacteria 27969
171 Ga0070669_100035485 3300005353 Bacteria 3613
172 Ga0070669_100054477 3300005353 Bacteria 2929
173 Ga0070675_100089051 3300005354 Bacteria 2583
174 Ga0070675_100259109 3300005354 Bacteria 1523
175 Ga0070671_100000463 3300005355 Bacteria 28259
176 Ga0070671_100010353 3300005355 Bacteria 7481
177 Ga0070671_100061825 3300005355 Bacteria 3119
178 Ga0070671_100237081 3300005355 Bacteria 1548
179 Ga0070674_100000400 3300005356 Bacteria 21808
180 Ga0070673_100066348 3300005364 Bacteria 2882
181 Ga0070673_100306090 3300005364 Bacteria 1400
182 Ga0070688_100004865 3300005365 Bacteria 7027
183 Ga0070688_100020032 3300005365 Bacteria 3883
184 Ga0070688_100052505 3300005365 Bacteria 2546
185 Ga0070659_100090913 3300005366 Bacteria 2446
186 Ga0070659_100158003 3300005366 Bacteria 1853
187 Ga0070667_100001090 3300005367 Bacteria 24871
188 Ga0070667_100001112 3300005367 Bacteria 24534
189 Ga0070667_100011132 3300005367 Bacteria 7441
190 Ga0070667_100096959 3300005367 Bacteria 2543
191 Ga0070667_100172829 3300005367 Bacteria 1908
192 Ga0070667_100204605 3300005367 Bacteria 1752
193 Ga0070709_10000703 3300005434 Bacteria 19058
194 Ga0070709_10004239 3300005434 Bacteria 7736
195 Ga0070709_10009871 3300005434 Bacteria 5273
196 Ga0070709_10027103 3300005434 Bacteria 3404
197 Ga0070709_10052964 3300005434 Bacteria 2553
198 Ga0070714_100005875 3300005435 Bacteria 9415
199 Ga0070714_100030096 3300005435 Bacteria 4517
200 Ga0070714_100033356 3300005435 Bacteria 4303
201 Ga0070714_100056490 3300005435 Bacteria 3358
202 Ga0070714_100076284 3300005435 Bacteria 2910
203 Ga0070714_100259619 3300005435 Bacteria 1608
204 Ga0070713_100002629 3300005436 Bacteria 11720
205 Ga0070713_100030587 3300005436 Bacteria 4277
206 Ga0070713_100040317 3300005436 Bacteria 3796
207 Ga0070713_100044541 3300005436 Bacteria 3632
208 Ga0070713_100059393 3300005436 Bacteria 3194
209 Ga0070713_100067939 3300005436 Bacteria 3003
210 Ga0070713_100134887 3300005436 Bacteria 2180
211 Ga0070713_100258504 3300005436 Bacteria 1591
212 Ga0070710_10000433 3300005437 Bacteria 19650
213 Ga0070710_10010456 3300005437 Bacteria 4560
214 Ga0070710_10040861 3300005437 Bacteria 2557
215 Ga0070710_10178862 3300005437 Bacteria 1326
216 Ga0070701_10060305 3300005438 Bacteria 1997
217 Ga0070711_100012274 3300005439 Bacteria 5345
218 Ga0070711_100069923 3300005439 Bacteria 2470
219 Ga0070705_100008424 3300005440 Bacteria 5108
220 Ga0070705_100089207 3300005440 Bacteria 1916
221 Ga0070705_100096063 3300005440 Bacteria 1859
222 Ga0070700_100001050 3300005441 Bacteria 13676
223 Ga0070694_100062440 3300005444 Bacteria 2545
224 Ga0070663_100028807 3300005455 Bacteria 3786
225 Ga0070663_100041678 3300005455 Bacteria 3223
226 Ga0070663_100075868 3300005455 Bacteria 2458
227 Ga0070663_100213041 3300005455 Bacteria 1513
228 Ga0070678_100081577 3300005456 Bacteria 2452
229 Ga0070662_100006555 3300005457 Bacteria 7511
230 Ga0070662_100071923 3300005457 Bacteria 2552
231 Ga0070662_100085970 3300005457 Bacteria 2351
232 Ga0070662_100122176 3300005457 Bacteria 1997
233 Ga0070681_10007294 3300005458 Bacteria 10791
234 Ga0070681_10012773 3300005458 Bacteria 8334
235 Ga0070681_10024710 3300005458 Bacteria 6044
236 Ga0070681_10036487 3300005458 Bacteria 4936
237 Ga0070681_10071184 3300005458 Bacteria 3442
238 Ga0070681_10126704 3300005458 Bacteria 2486
239 Ga0070681_10250639 3300005458 Bacteria 1683
240 Ga0070681_10328692 3300005458 Bacteria 1438
241 Ga0068867_100008314 3300005459 Bacteria 7326
242 Ga0068867_100036408 3300005459 Bacteria 3572
243 Ga0070685_10003371 3300005466 Bacteria 8127
244 Ga0070707_100037450 3300005468 Bacteria 4629
245 Ga0070707_100188909 3300005468 Bacteria 2008
246 Ga0070707_100234455 3300005468 Bacteria 1786
247 Ga0070699_100001130 3300005518 Bacteria 24873
248 Ga0070699_100073094 3300005518 Bacteria 2983
249 Ga0070679_100013144 3300005530 Bacteria 7926
250 Ga0070679_100037517 3300005530 Bacteria 4815
251 Ga0070679_100042937 3300005530 Bacteria 4503
252 Ga0070679_100047969 3300005530 Bacteria 4256
253 Ga0070679_100055061 3300005530 Bacteria 3961
254 Ga0070679_100070987 3300005530 Bacteria 3473
255 Ga0070679_100112400 3300005530 Bacteria 2710
256 Ga0070679_100446223 3300005530 Bacteria 1238
257 Ga0070684_100001394 3300005535 Bacteria 17379
258 Ga0070684_100061206 3300005535 Bacteria 3295
259 Ga0070697_100091706 3300005536 Bacteria 2513
260 Ga0068853_100048714 3300005539 Bacteria 3640
261 Ga0068853_100097730 3300005539 Bacteria 2592
262 Ga0070672_100002147 3300005543 Bacteria 12445
263 Ga0070672_100024262 3300005543 Bacteria 4479
264 Ga0070672_100060219 3300005543 Bacteria 2989
265 Ga0070686_100027605 3300005544 Bacteria 3436
266 Ga0070686_100170313 3300005544 Bacteria 1540
267 Ga0070695_100023440 3300005545 Bacteria 3793
268 Ga0070695_100090389 3300005545 Bacteria 2043
269 Ga0070696_100023961 3300005546 Bacteria 4148
270 Ga0070696_100032459 3300005546 Bacteria 3582
271 Ga0070693_100001982 3300005547 Bacteria 9370
272 Ga0070693_100012855 3300005547 Bacteria 4249
273 Ga0070665_100012421 3300005548 Bacteria 8585
274 Ga0070665_100016963 3300005548 Bacteria 7302
275 Ga0070665_100019777 3300005548 Bacteria 6759
276 Ga0070665_100050063 3300005548 Bacteria 4192
277 Ga0070665_100076983 3300005548 Bacteria 3342
278 Ga0070665_100093220 3300005548 Bacteria 3016
279 Ga0070665_100127570 3300005548 Bacteria 2546
280 Ga0070665_100147170 3300005548 Bacteria 2358
281 Ga0070665_100225864 3300005548 Bacteria 1873
282 Ga0070704_100023471 3300005549 Bacteria 4030
283 Ga0070704_100271893 3300005549 Bacteria 1400
284 Ga0068855_100002901 3300005563 Bacteria 20977
285 Ga0068855_100007643 3300005563 Bacteria 13076
286 Ga0068855_100018537 3300005563 Bacteria 8368
287 Ga0068855_100095545 3300005563 Bacteria 3425
288 Ga0068855_100102739 3300005563 Bacteria 3289
289 Ga0068855_100116677 3300005563 Bacteria 3059
290 Ga0068855_100145794 3300005563 Bacteria 2695
291 Ga0068855_100153468 3300005563 Bacteria 2617
292 Ga0068855_100153912 3300005563 Bacteria 2613
293 Ga0070664_100093900 3300005564 Bacteria 2600
294 Ga0070664_100192704 3300005564 Bacteria 1816
295 Ga0068857_100011714 3300005577 Bacteria 7623
296 Ga0068854_100035197 3300005578 Bacteria 3503
297 Ga0068856_100000834 3300005614 Bacteria 33225
298 Ga0068856_100059894 3300005614 Bacteria 3761
299 Ga0068856_100101546 3300005614 Bacteria 2869
300 Ga0068856_100202925 3300005614 Bacteria 1997
301 Ga0068856_100203002 3300005614 Bacteria 1997
302 Ga0070702_100060542 3300005615 Bacteria 2202
303 Ga0070702_100152264 3300005615 Bacteria 1486
304 Ga0068852_100027241 3300005616 Bacteria 4657
305 Ga0068852_100040980 3300005616 Bacteria 3911
306 Ga0068852_100046218 3300005616 Bacteria 3709
307 Ga0068852_100093575 3300005616 Bacteria 2694
308 Ga0068852_100102533 3300005616 Bacteria 2586
309 Ga0068852_100181504 3300005616 Bacteria 1979
310 Ga0068859_100001301 3300005617 Bacteria 25508
311 Ga0068859_100009078 3300005617 Bacteria 10043
312 Ga0068859_100029761 3300005617 Bacteria 5479
313 Ga0068859_100078911 3300005617 Bacteria 3332
314 Ga0068859_100217649 3300005617 Bacteria 1997
315 Ga0068864_100000014 3300005618 Bacteria 308927
316 Ga0068864_100000147 3300005618 Bacteria 67035
317 Ga0068864_100003177 3300005618 Bacteria 13582
318 Ga0068864_100004760 3300005618 Bacteria 11120
319 Ga0068864_100017107 3300005618 Bacteria 6046
320 Ga0068864_100058496 3300005618 Bacteria 3332
321 Ga0068866_10015728 3300005718 Bacteria 3367
322 Ga0068861_100001400 3300005719 Bacteria 15155
323 Ga0068861_100005625 3300005719 Bacteria 8501
324 Ga0068861_100116997 3300005719 Bacteria 2144
325 Ga0068851_10092354 3300005834 Bacteria 1595
326 Ga0068870_10039192 3300005840 Bacteria 2450
327 Ga0068863_100000420 3300005841 Bacteria 42981
328 Ga0068863_100008689 3300005841 Bacteria 9921
329 Ga0068858_100000037 3300005842 Bacteria 137966
330 Ga0068858_100013014 3300005842 Bacteria 7846
331 Ga0068858_100034304 3300005842 Bacteria 4707
332 Ga0068858_100102379 3300005842 Bacteria 2671
333 Ga0068858_100114420 3300005842 Bacteria 2520
334 Ga0068860_100006717 3300005843 Bacteria 11542
335 Ga0068860_100008824 3300005843 Bacteria 10044
336 Ga0068860_100027519 3300005843 Bacteria 5475
337 Ga0068860_100050583 3300005843 Bacteria 3955
338 Ga0068860_100083444 3300005843 Bacteria 3039
339 Ga0068860_100187556 3300005843 Bacteria 2000
340 Ga0068862_100000007 3300005844 Bacteria 313933
341 Ga0068862_100003319 3300005844 Bacteria 13900
342 Ga0068862_100007185 3300005844 Bacteria 9247
343 Ga0068862_100020998 3300005844 Bacteria 5457
344 Ga0068862_100051815 3300005844 Bacteria 3511
345 Ga0081455_10000012 3300005937 Bacteria 201668
346 Ga0081455_10006646 3300005937 Bacteria 12364
347 Ga0081455_10010801 3300005937 Bacteria 9229
348 Ga0081455_10018867 3300005937 Bacteria 6544
349 Ga0081455_10051245 3300005937 Bacteria 3542
350 Ga0081455_10098266 3300005937 Bacteria 2357
351 Ga0081455_10122450 3300005937 Bacteria 2047
352 Ga0081538_10002850 3300005981 Bacteria 16534
353 Ga0081538_10063683 3300005981 Bacteria 2091
354 Ga0081540_1000198 3300005983 Bacteria 62526
355 Ga0081540_1002214 3300005983 Bacteria 16042
356 Ga0081540_1002722 3300005983 Bacteria 14385
357 Ga0081540_1003234 3300005983 Bacteria 12979
358 Ga0081540_1003934 3300005983 Bacteria 11548
359 Ga0081540_1006521 3300005983 Bacteria 8475
360 Ga0081540_1007668 3300005983 Bacteria 7653
361 Ga0081540_1014692 3300005983 Bacteria 5001
362 Ga0081540_1023137 3300005983 Bacteria 3646
363 Ga0081540_1024308 3300005983 Bacteria 3518
364 Ga0081540_1030214 3300005983 Bacteria 3005
365 Ga0081540_1078430 3300005983 Bacteria 1497
366 Ga0081539_10000229 3300005985 Bacteria 131455
367 Ga0081539_10001874 3300005985 Bacteria 33007
368 Ga0081539_10002458 3300005985 Bacteria 26103
369 Ga0081539_10014525 3300005985 Bacteria 5816
370 Ga0081539_10023586 3300005985 Bacteria 4024
371 Ga0081539_10034816 3300005985 Bacteria 3037
372 Ga0070717_10013620 3300006028 Bacteria 6239
373 Ga0070717_10065196 3300006028 Bacteria 3027
374 Ga0070717_10072363 3300006028 Bacteria 2878
375 Ga0075365_10002583 3300006038 Bacteria 8953
376 Ga0075365_10005121 3300006038 Bacteria 7036
377 Ga0075365_10010926 3300006038 Bacteria 5317
378 Ga0075365_10031267 3300006038 Bacteria 3414
379 Ga0075365_10033656 3300006038 Bacteria 3305
380 Ga0075363_100006469 3300006048 Bacteria 5323
381 Ga0075363_100008679 3300006048 Bacteria 4744
382 Ga0075363_100043168 3300006048 Bacteria 2384
383 Ga0075363_100073811 3300006048 Bacteria 1856
384 Ga0075363_100103997 3300006048 Bacteria 1573
385 Ga0075363_100164419 3300006048 Bacteria 1258
386 Ga0075364_10000893 3300006051 Bacteria 15757
387 Ga0075364_10001760 3300006051 Bacteria 11966
388 Ga0075364_10012189 3300006051 Bacteria 5250
389 Ga0075364_10014661 3300006051 Bacteria 4847
390 Ga0075364_10039819 3300006051 Bacteria 3047
391 Ga0070715_10010133 3300006163 Bacteria 3349
392 Ga0070716_100048153 3300006173 Bacteria 2408
393 Ga0070712_100002680 3300006175 Bacteria 10987
394 Ga0070712_100015792 3300006175 Bacteria 4869
395 Ga0070712_100065316 3300006175 Bacteria 2582
396 Ga0075362_10002581 3300006177 Bacteria 6121
397 Ga0075362_10019052 3300006177 Bacteria 2849
398 Ga0075362_10029975 3300006177 Bacteria 2347
399 Ga0075367_10032701 3300006178 Bacteria 2995
400 Ga0075367_10042101 3300006178 Bacteria 2672
401 Ga0075367_10099789 3300006178 Bacteria 1773
402 Ga0075367_10111824 3300006178 Bacteria 1677
403 Ga0075367_10128923 3300006178 Bacteria 1563
404 Ga0075369_10009607 3300006186 Bacteria 3763
405 Ga0075369_10013034 3300006186 Bacteria 3291
406 Ga0075369_10015418 3300006186 Bacteria 3067
407 Ga0075369_10041507 3300006186 Bacteria 1970
408 Ga0075427_10001919 3300006194 Bacteria 2734
409 Ga0075366_10012501 3300006195 Bacteria 4815
410 Ga0075366_10020324 3300006195 Bacteria 3851
411 Ga0075366_10021871 3300006195 Bacteria 3718
412 Ga0075366_10022296 3300006195 Bacteria 3683
413 Ga0075366_10091874 3300006195 Bacteria 1818
414 Ga0097621_100000078 3300006237 Bacteria 50983
415 Ga0097621_100044356 3300006237 Bacteria 3587
416 Ga0097621_100190838 3300006237 Bacteria 1774
417 Ga0075370_10008411 3300006353 Bacteria 5310
418 Ga0075370_10024188 3300006353 Bacteria 3353
419 Ga0075370_10029532 3300006353 Bacteria 3054
420 Ga0075370_10038419 3300006353 Bacteria 2693
421 Ga0075370_10137195 3300006353 Bacteria 1429
422 Ga0068871_100001124 3300006358 Bacteria 17955
423 Ga0068871_100040769 3300006358 Bacteria 3720
424 Ga0068871_100045582 3300006358 Bacteria 3530
425 Ga0068871_100210916 3300006358 Bacteria 1680
426 Ga0075428_100051970 3300006844 Bacteria 4494
427 Ga0075428_100089962 3300006844 Bacteria 3348
428 Ga0075428_100125363 3300006844 Bacteria 2794
429 Ga0075428_100211473 3300006844 Bacteria 2096
430 Ga0075430_100000269 3300006846 Bacteria 36720
431 Ga0075430_100022779 3300006846 Bacteria 5327
432 Ga0075430_100186156 3300006846 Bacteria 1726
433 Ga0075430_100198905 3300006846 Bacteria 1664
434 Ga0075431_100004768 3300006847 Bacteria 13333
435 Ga0075431_100022354 3300006847 Bacteria 6464
436 Ga0075431_100194567 3300006847 Bacteria 2076
437 Ga0075433_10000085 3300006852 Bacteria 42956
438 Ga0075433_10135960 3300006852 Bacteria 2185
439 Ga0075434_100000251 3300006871 Bacteria 37702
440 Ga0075434_100010176 3300006871 Bacteria 8808
441 Ga0075434_100030752 3300006871 Bacteria 5290
442 Ga0075434_100076565 3300006871 Bacteria 3341
443 Ga0075434_100078083 3300006871 Bacteria 3306
444 Ga0075434_100130748 3300006871 Bacteria 2529
445 Ga0075434_100259460 3300006871 Bacteria 1757
446 Ga0075429_100001112 3300006880 Bacteria 21684
447 Ga0068865_100049746 3300006881 Bacteria 2892
448 Ga0075436_100180261 3300006914 Bacteria 1493
449 Ga0097620_100001301 3300006931 Bacteria 25508
450 Ga0097620_100009078 3300006931 Bacteria 10043
451 Ga0097620_100029760 3300006931 Bacteria 5479
452 Ga0097620_100078905 3300006931 Bacteria 3332
453 Ga0097620_100217641 3300006931 Bacteria 1997
454 Ga0099825_1020613 3300006941 Bacteria 4647
455 Ga0099825_1028185 3300006941 Bacteria 2767
456 Ga0099824_1016270 3300006942 Bacteria 6789
457 Ga0099822_1001342 3300006943 Bacteria 28325
458 Ga0099823_1034924 3300006944 Bacteria 3952
459 Ga0079104_1001143 3300006946 Bacteria 19316
460 Ga0079104_1005235 3300006946 Bacteria 5238
461 Ga0079104_1006305 3300006946 Bacteria 4522
462 Ga0099826_10000109 3300006948 Bacteria 38139
463 Ga0099826_10020329 3300006948 Bacteria 4982
464 Ga0075435_100001457 3300007076 Bacteria 15192
465 Ga0075435_100061188 3300007076 Bacteria 3054
466 Ga0099794_10003122 3300007265 Bacteria 6272
467 Ga0099795_10008608 3300007788 Bacteria 2918
468 Ga0099795_10018316 3300007788 Bacteria 2249
469 Ga0105251_10065194 3300009011 Bacteria 1705
470 Ga0105240_10000460 3300009093 Bacteria 74956
471 Ga0105240_10032853 3300009093 Bacteria 6712
472 Ga0105240_10102914 3300009093 Bacteria 3470
473 Ga0111539_10000250 3300009094 Bacteria 64548
474 Ga0111539_10000762 3300009094 Bacteria 41935
475 Ga0111539_10007868 3300009094 Bacteria 13613
476 Ga0111539_10028827 3300009094 Bacteria 6770
477 Ga0111539_10029942 3300009094 Bacteria 6621
478 Ga0111539_10058596 3300009094 Bacteria 4569
479 Ga0111539_10113248 3300009094 Bacteria 3182
480 Ga0111539_10117112 3300009094 Bacteria 3123
481 Ga0111539_10153265 3300009094 Bacteria 2697
482 Ga0111539_10433614 3300009094 Bacteria 1530
483 Ga0105245_10006056 3300009098 Bacteria 10632
484 Ga0105245_10056197 3300009098 Bacteria 3537
485 Ga0105245_10115382 3300009098 Bacteria 2502
486 Ga0105245_10266556 3300009098 Bacteria 1669
487 Ga0105247_10003944 3300009101 Bacteria 9555
488 Ga0105247_10022312 3300009101 Bacteria 3812
489 Ga0105247_10050062 3300009101 Bacteria 2570
490 Ga0114129_10005184 3300009147 Bacteria 18351
491 Ga0114129_10006771 3300009147 Bacteria 16267
492 Ga0114129_10031896 3300009147 Bacteria 7449
493 Ga0114129_10052206 3300009147 Bacteria 5738
494 Ga0114129_10220155 3300009147 Bacteria 2561
495 Ga0114129_10252977 3300009147 Bacteria 2364
496 Ga0105243_10087064 3300009148 Bacteria 2563
497 Ga0105243_10150242 3300009148 Bacteria 1997
498 Ga0105241_10054529 3300009174 Bacteria 3060
499 Ga0105241_10054764 3300009174 Bacteria 3054
500 Ga0105241_10080717 3300009174 Bacteria 2546
501 Ga0105241_10092620 3300009174 Bacteria 2387
502 Ga0105241_10179381 3300009174 Bacteria 1756
503 Ga0105242_10111489 3300009176 Bacteria 2333
504 Ga0105248_10001329 3300009177 Bacteria 27517
505 Ga0105248_10003552 3300009177 Bacteria 17282
506 Ga0105248_10004135 3300009177 Bacteria 16055
507 Ga0105248_10004606 3300009177 Bacteria 15260
508 Ga0105248_10004676 3300009177 Bacteria 15149
509 Ga0105248_10006469 3300009177 Bacteria 12852
510 Ga0105248_10068639 3300009177 Bacteria 3980
511 Ga0105248_10140184 3300009177 Bacteria 2727
512 Ga0105248_10164736 3300009177 Bacteria 2499
513 Ga0105248_10175005 3300009177 Bacteria 2419
514 Ga0105248_10176078 3300009177 Bacteria 2411
515 Ga0105237_10026532 3300009545 Bacteria 5921
516 Ga0105237_10066954 3300009545 Bacteria 3586
517 Ga0105237_10101393 3300009545 Bacteria 2871
518 Ga0105237_10149594 3300009545 Bacteria 2331
519 Ga0105237_10172544 3300009545 Bacteria 2163
520 Ga0105237_10303150 3300009545 Bacteria 1601
521 Ga0105238_10001735 3300009551 Bacteria 21939
522 Ga0105238_10004417 3300009551 Bacteria 13948
523 Ga0105238_10023557 3300009551 Bacteria 6274
524 Ga0105238_10077647 3300009551 Bacteria 3311
525 Ga0105238_10142297 3300009551 Bacteria 2375
526 Ga0105249_10003222 3300009553 Bacteria 14133
527 Ga0105249_10008381 3300009553 Bacteria 9004
528 Ga0105249_10010070 3300009553 Bacteria 8296
529 Ga0105249_10014822 3300009553 Bacteria 6891
530 Ga0105249_10309553 3300009553 Bacteria 1587
531 Ga0123341_1001936 3300009765 Bacteria 16389
532 Ga0123342_1019759 3300009766 Bacteria 5062
533 Ga0105239_10000803 3300010375 Bacteria 44420
534 Ga0105239_10001281 3300010375 Bacteria 33966
535 Ga0105239_10060046 3300010375 Bacteria 4173
536 Ga0105239_10087765 3300010375 Bacteria 3429
537 Ga0105239_10143165 3300010375 Bacteria 2665
538 Ga0105239_10157149 3300010375 Bacteria 2540
539 Ga0105239_10212035 3300010375 Bacteria 2171
540 Ga0105246_10060308 3300011119 Bacteria 2635
541 Ga0157346_1000757 3300012480 Bacteria 1422
542 Ga0157373_10032680 3300013100 Bacteria 3745
543 Ga0157373_10043058 3300013100 Bacteria 3226
544 Ga0157373_10063521 3300013100 Bacteria 2614
545 Ga0157371_10000004 3300013102 Bacteria 512593
546 Ga0157371_10106927 3300013102 Bacteria 1985
547 Ga0157370_10000185 3300013104 Bacteria 78153
548 Ga0157370_10000879 3300013104 Bacteria 38163
549 Ga0157370_10025421 3300013104 Bacteria 5861
550 Ga0157370_10028544 3300013104 Bacteria 5487
551 Ga0157370_10176137 3300013104 Bacteria 1988
552 Ga0157369_10013216 3300013105 Bacteria 9343
553 Ga0157369_10097753 3300013105 Bacteria 3131
554 Ga0157369_10267738 3300013105 Bacteria 1781
555 Ga0171463_1001 3300013249 Bacteria 1406070
556 Ga0171462_1009 3300013250 Bacteria 344993
557 Ga0157374_10142880 3300013296 Bacteria 2324
558 Ga0157378_10004399 3300013297 Bacteria 12404
559 Ga0157378_10024858 3300013297 Bacteria 5275
560 Ga0157378_10207419 3300013297 Bacteria 1857
561 Ga0163162_10002633 3300013306 Bacteria 17021
562 Ga0163162_10004642 3300013306 Bacteria 13243
563 Ga0163162_10021600 3300013306 Bacteria 6341
564 Ga0163162_10089212 3300013306 Bacteria 3163
565 Ga0163162_10124721 3300013306 Bacteria 2681
566 Ga0163162_10340623 3300013306 Bacteria 1632
567 Ga0157372_10008823 3300013307 Bacteria 10708
568 Ga0157372_10029074 3300013307 Bacteria 6031
569 Ga0157372_10043253 3300013307 Bacteria 4986
570 Ga0157372_10249482 3300013307 Bacteria 2060
571 Ga0157375_10125212 3300013308 Bacteria 2684
572 Ga0163163_10017889 3300014325 Bacteria 6619
573 Ga0163163_10118500 3300014325 Bacteria 2680
574 Ga0163163_10122252 3300014325 Bacteria 2638
575 Ga0163163_10217483 3300014325 Bacteria 1959
576 Ga0157380_10000014 3300014326 Bacteria 130737
577 Ga0157380_10002299 3300014326 Bacteria 12838
578 Ga0157380_10033282 3300014326 Bacteria 3969
579 Ga0157380_10073424 3300014326 Bacteria 2773
580 Ga0157380_10088483 3300014326 Bacteria 2549
581 Ga0157380_10326357 3300014326 Bacteria 1425
582 Ga0157379_10006065 3300014968 Bacteria 10409
583 Ga0157379_10030336 3300014968 Bacteria 4812
584 Ga0157379_10058501 3300014968 Bacteria 3446
585 Ga0182007_10024047 3300015262 Bacteria 2136
586 Ga0183365_10236 3300015684 Bacteria 1636
587 Ga0183363_1134 3300015690 Bacteria 18899
588 Ga0163161_10026891 3300017792 Bacteria 4079
589 Ga0163161_10055661 3300017792 Bacteria 2872
590 Ga0163161_10123133 3300017792 Bacteria 1950
591 Ga0214544_1000003 3300021320 Bacteria 643752
592 Ga0214544_1002289 3300021320 Bacteria 40409
593 Ga0214542_1000003 3300021321 Bacteria 435700
594 Ga0214542_1001074 3300021321 Bacteria 54628
595 Ga0214542_1001948 3300021321 Bacteria 42768
596 Ga0214545_1000004 3300021324 Bacteria 453352
597 Ga0214545_1000914 3300021324 Bacteria 51992
598 Ga0214545_1027665 3300021324 Bacteria 2850
599 Ga0214543_1000007 3300021327 Bacteria 414744
600 Ga0214543_1000027 3300021327 Bacteria 215065
601 Ga0214543_1000897 3300021327 Bacteria 54534
602 Ga0214543_1001723 3300021327 Bacteria 42768
603 Ga0214543_1027547 3300021327 Bacteria 2850
604 Ga0213872_10061427 3300021361 Bacteria 1699
605 Ga0213874_10009803 3300021377 Bacteria 2381
606 Ga0213876_10002253 3300021384 Bacteria 11393
607 Ga0213876_10002567 3300021384 Bacteria 10621
608 Ga0213876_10021282 3300021384 Bacteria 3431
609 Ga0213876_10026316 3300021384 Bacteria 3068
610 Ga0213876_10028813 3300021384 Bacteria 2929
611 Ga0213876_10047056 3300021384 Bacteria 2280
612 Ga0213876_10047691 3300021384 Bacteria 2264
613 Ga0213875_10000011 3300021388 Bacteria 332447
614 Ga0213875_10016147 3300021388 Bacteria 3622
615 Ga0213875_10019974 3300021388 Bacteria 3217
616 Ga0213871_10017503 3300021441 Bacteria 1742
617 Ga0213871_10030986 3300021441 Bacteria 1394
618 Ga0224712_10017747 3300022467 Bacteria 2366
619 Ga0228711_1000041 3300022739 Bacteria 86591
620 Ga0228710_1000024 3300022740 Bacteria 106694
621 Ga0247554_100353 3300023547 Bacteria 1256
622 Ga0224572_1012666 3300024225 Bacteria 1606
623 Ga0228598_1000352 3300024227 Bacteria 9102
624 Ga0209435_100026 3300025206 Bacteria 198295
625 Ga0209436_100006 3300025208 Bacteria 150277
626 Ga0209672_104047 3300025228 Bacteria 2828
627 Ga0209437_100056 3300025233 Bacteria 363071
628 Ga0209437_100196 3300025233 Bacteria 121199
629 Ga0209437_104701 3300025233 Bacteria 2379
630 Ga0207425_1000012 3300025245 Bacteria 528324
631 Ga0207425_1000942 3300025245 Bacteria 13860
632 Ga0207425_1005429 3300025245 Bacteria 3634
633 Ga0209646_1000084 3300025246 Bacteria 198295
634 Ga0209646_1005895 3300025246 Bacteria 2100
635 Ga0209026_1000013 3300025250 Bacteria 415633
636 Ga0209026_1000080 3300025250 Bacteria 198295
637 Ga0209677_100296 3300025253 Bacteria 32613
638 Ga0209677_101907 3300025253 Bacteria 8412
639 Ga0209677_102649 3300025253 Bacteria 6494
640 Ga0209148_1000210 3300025254 Bacteria 102885
641 Ga0209148_1002306 3300025254 Bacteria 6841
642 Ga0209759_1000061 3300025256 Bacteria 198295
643 Ga0209129_1000105 3300025258 Bacteria 159104
644 Ga0209129_1000429 3300025258 Bacteria 31758
645 Ga0209129_1001159 3300025258 Bacteria 15203
646 Ga0209129_1002089 3300025258 Bacteria 10245
647 Ga0209233_1000034 3300025261 Bacteria 578898
648 Ga0209233_1000037 3300025261 Bacteria 554620
649 Ga0209233_1000071 3300025261 Bacteria 363290
650 Ga0209233_1000243 3300025261 Bacteria 90170
651 Ga0209233_1002398 3300025261 Bacteria 6921
652 Ga0209233_1010503 3300025261 Bacteria 2771
653 Ga0209455_1000098 3300025272 Bacteria 213890
654 Ga0209455_1006501 3300025272 Bacteria 3440
655 Ga0209673_1000015 3300025273 Bacteria 530618
656 Ga0209673_1000063 3300025273 Bacteria 256709
657 Ga0209673_1001004 3300025273 Bacteria 34285
658 Ga0209673_1004453 3300025273 Bacteria 7497
659 Ga0209673_1006768 3300025273 Bacteria 5448
660 Ga0209673_1012697 3300025273 Bacteria 3377
661 Ga0209130_1000002 3300025284 Bacteria 722648
662 Ga0209130_1000005 3300025284 Bacteria 599620
663 Ga0209130_1000382 3300025284 Bacteria 49448
664 Ga0209130_1000384 3300025284 Bacteria 49337
665 Ga0209675_1001743 3300025291 Bacteria 11962
666 Ga0209025_1000010 3300025294 Bacteria 986612
667 Ga0209025_1000024 3300025294 Bacteria 528324
668 Ga0209025_1000037 3300025294 Bacteria 383429
669 Ga0209025_1000060 3300025294 Bacteria 305017
670 Ga0209025_1000479 3300025294 Bacteria 77489
671 Ga0209025_1000638 3300025294 Bacteria 61892
672 Ga0209025_1001253 3300025294 Bacteria 35139
673 Ga0209025_1002771 3300025294 Bacteria 17695
674 Ga0209025_1007442 3300025294 Bacteria 8163
675 Ga0209025_1008173 3300025294 Bacteria 7579
676 Ga0209025_1022121 3300025294 Bacteria 3389
677 Ga0209025_1025170 3300025294 Bacteria 3039
678 Ga0209564_1000019 3300025295 Bacteria 573686
679 Ga0209564_1000034 3300025295 Bacteria 444284
680 Ga0209564_1000093 3300025295 Bacteria 245793
681 Ga0209564_1000384 3300025295 Bacteria 80490
682 Ga0209564_1000482 3300025295 Bacteria 66363
683 Ga0209564_1001037 3300025295 Bacteria 34032
684 Ga0209564_1006011 3300025295 Bacteria 6702
685 Ga0209564_1006766 3300025295 Bacteria 6076
686 Ga0209564_1007145 3300025295 Bacteria 5825
687 Ga0209564_1016310 3300025295 Bacteria 2966
688 Ga0209564_1029248 3300025295 Bacteria 1739
689 Ga0209758_1000030 3300025297 Bacteria 509217
690 Ga0209758_1000150 3300025297 Bacteria 163494
691 Ga0209758_1000329 3300025297 Bacteria 89451
692 Ga0209758_1000361 3300025297 Bacteria 81006
693 Ga0209758_1000428 3300025297 Bacteria 71178
694 Ga0209758_1000499 3300025297 Bacteria 63732
695 Ga0209758_1000876 3300025297 Bacteria 41358
696 Ga0209758_1000979 3300025297 Bacteria 38423
697 Ga0209758_1001056 3300025297 Bacteria 36006
698 Ga0209758_1002045 3300025297 Bacteria 21630
699 Ga0209758_1004010 3300025297 Bacteria 12729
700 Ga0209758_1004113 3300025297 Bacteria 12464
701 Ga0209758_1004414 3300025297 Bacteria 11726
702 Ga0209758_1004871 3300025297 Bacteria 10811
703 Ga0209758_1008595 3300025297 Bacteria 6566
704 Ga0209758_1018205 3300025297 Bacteria 3456
705 Ga0209050_1006901 3300025298 Bacteria 6573
706 Ga0209050_1015315 3300025298 Bacteria 3228
707 Ga0209256_1000026 3300025299 Bacteria 432835
708 Ga0209256_1000027 3300025299 Bacteria 423283
709 Ga0209256_1000182 3300025299 Bacteria 122471
710 Ga0209256_1000996 3300025299 Bacteria 33661
711 Ga0209256_1001405 3300025299 Bacteria 25040
712 Ga0209256_1003026 3300025299 Bacteria 12425
713 Ga0209256_1004103 3300025299 Bacteria 9435
714 Ga0209256_1013277 3300025299 Bacteria 3068
715 Ga0207426_1000012 3300025302 Bacteria 730942
716 Ga0207426_1000013 3300025302 Bacteria 721897
717 Ga0207426_1000015 3300025302 Bacteria 599316
718 Ga0207426_1000070 3300025302 Bacteria 331559
719 Ga0207426_1000380 3300025302 Bacteria 76046
720 Ga0207426_1001626 3300025302 Bacteria 17681
721 Ga0207426_1004309 3300025302 Bacteria 7014
722 Ga0207426_1005208 3300025302 Bacteria 6037
723 Ga0207426_1012795 3300025302 Bacteria 3137
724 Ga0207426_1019290 3300025302 Bacteria 2387
725 Ga0209051_1000135 3300025303 Bacteria 138142
726 Ga0209051_1017639 3300025303 Bacteria 3184
727 Ga0209257_1001109 3300025304 Bacteria 34989
728 Ga0209257_1001899 3300025304 Bacteria 22595
729 Ga0209257_1003037 3300025304 Bacteria 15155
730 Ga0209257_1017293 3300025304 Bacteria 2852
731 Ga0207697_10000609 3300025315 Bacteria 20337
732 Ga0207697_10072924 3300025315 Bacteria 1440
733 Ga0207656_10005325 3300025321 Bacteria 4540
734 Ga0207696_1000560 3300025711 Bacteria 29472
735 Ga0207653_10013980 3300025885 Bacteria 2516
736 Ga0207682_10000107 3300025893 Bacteria 37788
737 Ga0207682_10008196 3300025893 Bacteria 4144
738 Ga0207692_10000771 3300025898 Bacteria 11382
739 Ga0207692_10057435 3300025898 Bacteria 2001
740 Ga0207642_10005858 3300025899 Bacteria 4045
741 Ga0207710_10003912 3300025900 Bacteria 6581
742 Ga0207710_10012491 3300025900 Bacteria 3573
743 Ga0207710_10021687 3300025900 Bacteria 2754
744 Ga0207710_10043769 3300025900 Bacteria 1992
745 Ga0207710_10047664 3300025900 Bacteria 1916
746 Ga0207688_10009370 3300025901 Bacteria 5333
747 Ga0207688_10059455 3300025901 Bacteria 2153
748 Ga0207680_10001007 3300025903 Bacteria 13289
749 Ga0207680_10009278 3300025903 Bacteria 4874
750 Ga0207647_10031233 3300025904 Bacteria 3428
751 Ga0207647_10067905 3300025904 Bacteria 2159
752 Ga0207647_10100331 3300025904 Bacteria 1718
753 Ga0207685_10000788 3300025905 Bacteria 5843
754 Ga0207685_10008157 3300025905 Bacteria 2965
755 Ga0207699_10000568 3300025906 Bacteria 18195
756 Ga0207699_10006281 3300025906 Bacteria 5741
757 Ga0207699_10018806 3300025906 Bacteria 3669
758 Ga0207699_10032028 3300025906 Bacteria 2959
759 Ga0207699_10051979 3300025906 Bacteria 2423
760 Ga0207699_10057079 3300025906 Bacteria 2330
761 Ga0207645_10010290 3300025907 Bacteria 6425
762 Ga0207645_10036335 3300025907 Bacteria 3163
763 Ga0207645_10081554 3300025907 Bacteria 2074
764 Ga0207645_10100436 3300025907 Bacteria 1866
765 Ga0207645_10115316 3300025907 Bacteria 1742
766 Ga0207645_10125765 3300025907 Bacteria 1666
767 Ga0207643_10000123 3300025908 Bacteria 53091
768 Ga0207643_10060360 3300025908 Bacteria 2165
769 Ga0207705_10000345 3300025909 Bacteria 41860
770 Ga0207705_10037654 3300025909 Bacteria 3461
771 Ga0207684_10051820 3300025910 Bacteria 3482
772 Ga0207707_10000514 3300025912 Bacteria 39723
773 Ga0207707_10000830 3300025912 Bacteria 30314
774 Ga0207707_10001115 3300025912 Bacteria 25507
775 Ga0207707_10003928 3300025912 Bacteria 13203
776 Ga0207707_10004635 3300025912 Bacteria 12071
777 Ga0207707_10007830 3300025912 Bacteria 9292
778 Ga0207707_10045738 3300025912 Bacteria 3814
779 Ga0207707_10231781 3300025912 Bacteria 1606
780 Ga0207707_10270561 3300025912 Bacteria 1472
781 Ga0207695_10000036 3300025913 Bacteria 477897
782 Ga0207695_10000059 3300025913 Bacteria 363920
783 Ga0207695_10120025 3300025913 Bacteria 2598
784 Ga0207671_10002082 3300025914 Bacteria 21889
785 Ga0207671_10008401 3300025914 Bacteria 8765
786 Ga0207671_10008976 3300025914 Bacteria 8410
787 Ga0207671_10156487 3300025914 Bacteria 1763
788 Ga0207693_10004037 3300025915 Bacteria 12474
789 Ga0207693_10004184 3300025915 Bacteria 12232
790 Ga0207693_10005556 3300025915 Bacteria 10490
791 Ga0207693_10019145 3300025915 Bacteria 5448
792 Ga0207693_10025041 3300025915 Bacteria 4734
793 Ga0207693_10044585 3300025915 Bacteria 3486
794 Ga0207693_10047970 3300025915 Bacteria 3355
795 Ga0207693_10074702 3300025915 Bacteria 2654
796 Ga0207693_10134018 3300025915 Bacteria 1947
797 Ga0207663_10000271 3300025916 Bacteria 22490
798 Ga0207663_10073941 3300025916 Bacteria 2207
799 Ga0207660_10002319 3300025917 Bacteria 12534
800 Ga0207660_10002659 3300025917 Bacteria 11722
801 Ga0207660_10006983 3300025917 Bacteria 7313
802 Ga0207660_10050576 3300025917 Bacteria 2952
803 Ga0207660_10053997 3300025917 Bacteria 2866
804 Ga0207660_10080478 3300025917 Bacteria 2392
805 Ga0207660_10135160 3300025917 Bacteria 1881
806 Ga0207660_10231203 3300025917 Bacteria 1454
807 Ga0207660_10277780 3300025917 Bacteria 1328
808 Ga0207662_10039862 3300025918 Bacteria 2758
809 Ga0207662_10088683 3300025918 Bacteria 1900
810 Ga0207657_10000333 3300025919 Bacteria 49989
811 Ga0207657_10001268 3300025919 Bacteria 26929
812 Ga0207657_10003031 3300025919 Bacteria 17986
813 Ga0207657_10070938 3300025919 Bacteria 2951
814 Ga0207657_10071581 3300025919 Bacteria 2936
815 Ga0207657_10103485 3300025919 Bacteria 2360
816 Ga0207649_10001290 3300025920 Bacteria 14954
817 Ga0207649_10045898 3300025920 Bacteria 2681
818 Ga0207649_10056854 3300025920 Bacteria 2444
819 Ga0207652_10001135 3300025921 Bacteria 23975
820 Ga0207652_10001200 3300025921 Bacteria 23314
821 Ga0207652_10006215 3300025921 Bacteria 9645
822 Ga0207652_10010824 3300025921 Bacteria 7349
823 Ga0207652_10048803 3300025921 Bacteria 3621
824 Ga0207652_10083442 3300025921 Bacteria 2798
825 Ga0207652_10117332 3300025921 Bacteria 2365
826 Ga0207652_10142719 3300025921 Bacteria 2142
827 Ga0207652_10156894 3300025921 Bacteria 2039
828 Ga0207652_10348967 3300025921 Bacteria 1335
829 Ga0207646_10074340 3300025922 Bacteria 3036
830 Ga0207646_10261307 3300025922 Bacteria 1564
831 Ga0207681_10000001 3300025923 Bacteria 1105841
832 Ga0207681_10000229 3300025923 Bacteria 44082
833 Ga0207681_10000283 3300025923 Bacteria 37634
834 Ga0207681_10037287 3300025923 Bacteria 3212
835 Ga0207694_10105054 3300025924 Bacteria 2242
836 Ga0207650_10000023 3300025925 Bacteria 308148
837 Ga0207650_10000776 3300025925 Bacteria 24570
838 Ga0207650_10040260 3300025925 Bacteria 3419
839 Ga0207650_10085235 3300025925 Bacteria 2403
840 Ga0207650_10118805 3300025925 Bacteria 2056
841 Ga0207659_10011240 3300025926 Bacteria 5651
842 Ga0207659_10161601 3300025926 Bacteria 1759
843 Ga0207687_10001937 3300025927 Bacteria 14238
844 Ga0207687_10055338 3300025927 Bacteria 2780
845 Ga0207687_10275899 3300025927 Bacteria 1346
846 Ga0207700_10005653 3300025928 Bacteria 7504
847 Ga0207700_10009296 3300025928 Bacteria 6132
848 Ga0207700_10034378 3300025928 Bacteria 3638
849 Ga0207700_10049032 3300025928 Bacteria 3139
850 Ga0207700_10055478 3300025928 Bacteria 2978
851 Ga0207700_10060041 3300025928 Bacteria 2878
852 Ga0207700_10070426 3300025928 Bacteria 2688
853 Ga0207664_10010079 3300025929 Bacteria 6661
854 Ga0207664_10029945 3300025929 Bacteria 4152
855 Ga0207664_10126394 3300025929 Bacteria 2147
856 Ga0207644_10000388 3300025931 Bacteria 28600
857 Ga0207644_10001197 3300025931 Bacteria 16704
858 Ga0207644_10003098 3300025931 Bacteria 10699
859 Ga0207644_10057933 3300025931 Bacteria 2798
860 Ga0207644_10196678 3300025931 Bacteria 1588
861 Ga0207644_10233170 3300025931 Bacteria 1463
862 Ga0207690_10044437 3300025932 Bacteria 2928
863 Ga0207690_10061457 3300025932 Bacteria 2554
864 Ga0207690_10090298 3300025932 Bacteria 2162
865 Ga0207690_10100627 3300025932 Bacteria 2063
866 Ga0207706_10002469 3300025933 Bacteria 18019
867 Ga0207706_10007491 3300025933 Bacteria 10095
868 Ga0207706_10078057 3300025933 Bacteria 2912
869 Ga0207706_10091615 3300025933 Bacteria 2672
870 Ga0207686_10055331 3300025934 Bacteria 2489
871 Ga0207686_10074697 3300025934 Bacteria 2191
872 Ga0207709_10002659 3300025935 Bacteria 11087
873 Ga0207709_10023812 3300025935 Bacteria 3489
874 Ga0207670_10000819 3300025936 Bacteria 16275
875 Ga0207670_10014336 3300025936 Bacteria 4703
876 Ga0207670_10015114 3300025936 Bacteria 4603
877 Ga0207670_10136880 3300025936 Bacteria 1801
878 Ga0207669_10010414 3300025937 Bacteria 4475
879 Ga0207669_10016612 3300025937 Bacteria 3745
880 Ga0207669_10017036 3300025937 Bacteria 3715
881 Ga0207669_10026784 3300025937 Bacteria 3143
882 Ga0207669_10036344 3300025937 Bacteria 2813
883 Ga0207665_10000806 3300025939 Bacteria 21196
884 Ga0207665_10220558 3300025939 Bacteria 1390
885 Ga0207691_10003281 3300025940 Bacteria 15758
886 Ga0207691_10090968 3300025940 Bacteria 2735
887 Ga0207691_10180537 3300025940 Bacteria 1845
888 Ga0207691_10241011 3300025940 Bacteria 1563
889 Ga0207691_10276047 3300025940 Bacteria 1447
890 Ga0207711_10001287 3300025941 Bacteria 23767
891 Ga0207711_10002477 3300025941 Bacteria 16474
892 Ga0207711_10021175 3300025941 Bacteria 5430
893 Ga0207711_10026646 3300025941 Bacteria 4852
894 Ga0207711_10038734 3300025941 Bacteria 4053
895 Ga0207711_10038881 3300025941 Bacteria 4046
896 Ga0207711_10053475 3300025941 Bacteria 3463
897 Ga0207711_10055557 3300025941 Bacteria 3399
898 Ga0207711_10116097 3300025941 Bacteria 2386
899 Ga0207711_10116807 3300025941 Bacteria 2379
900 Ga0207711_10136460 3300025941 Bacteria 2204
901 Ga0207711_10144308 3300025941 Bacteria 2144
902 Ga0207711_10237762 3300025941 Bacteria 1670
903 Ga0207689_10000348 3300025942 Bacteria 43237
904 Ga0207689_10029817 3300025942 Bacteria 4549
905 Ga0207689_10216408 3300025942 Bacteria 1583
906 Ga0207661_10203816 3300025944 Bacteria 1740
907 Ga0207661_10360297 3300025944 Bacteria 1313
908 Ga0207679_10008112 3300025945 Bacteria 6680
909 Ga0207679_10016091 3300025945 Bacteria 4960
910 Ga0207679_10090755 3300025945 Bacteria 2363
911 Ga0207679_10205967 3300025945 Bacteria 1646
912 Ga0207667_10038375 3300025949 Bacteria 5116
913 Ga0207667_10047589 3300025949 Bacteria 4539
914 Ga0207667_10058743 3300025949 Bacteria 4032
915 Ga0207667_10068189 3300025949 Bacteria 3704
916 Ga0207667_10101317 3300025949 Bacteria 2971
917 Ga0207667_10128589 3300025949 Bacteria 2609
918 Ga0207667_10180147 3300025949 Bacteria 2170
919 Ga0207651_10034896 3300025960 Bacteria 3263
920 Ga0207651_10050027 3300025960 Bacteria 2835
921 Ga0207651_10076163 3300025960 Bacteria 2397
922 Ga0207651_10234133 3300025960 Bacteria 1493
923 Ga0207651_10297103 3300025960 Bacteria 1341
924 Ga0207712_10000119 3300025961 Bacteria 84816
925 Ga0207712_10000897 3300025961 Bacteria 21579
926 Ga0207712_10001664 3300025961 Bacteria 14921
927 Ga0207712_10008536 3300025961 Bacteria 6477
928 Ga0207712_10015658 3300025961 Bacteria 4895
929 Ga0207712_10076782 3300025961 Bacteria 2419
930 Ga0207668_10000891 3300025972 Bacteria 18016
931 Ga0207668_10003321 3300025972 Bacteria 9419
932 Ga0207668_10043576 3300025972 Bacteria 3046
933 Ga0207640_10009648 3300025981 Bacteria 5412
934 Ga0207640_10139758 3300025981 Bacteria 1764
935 Ga0207640_10255627 3300025981 Bacteria 1362
936 Ga0207658_10002134 3300025986 Bacteria 14696
937 Ga0207658_10006704 3300025986 Bacteria 7846
938 Ga0207658_10044903 3300025986 Bacteria 3218
939 Ga0207658_10080129 3300025986 Bacteria 2500
940 Ga0207677_10023560 3300026023 Bacteria 3806
941 Ga0207677_10095346 3300026023 Bacteria 2174
942 Ga0207677_10132359 3300026023 Bacteria 1896
943 Ga0207703_10000342 3300026035 Bacteria 50628
944 Ga0207703_10000457 3300026035 Bacteria 42997
945 Ga0207703_10034145 3300026035 Bacteria 4035
946 Ga0207639_10006646 3300026041 Bacteria 7865
947 Ga0207639_10031680 3300026041 Bacteria 3887
948 Ga0207639_10033783 3300026041 Bacteria 3776
949 Ga0207678_10010164 3300026067 Bacteria 8261
950 Ga0207678_10017585 3300026067 Bacteria 6279
951 Ga0207678_10021660 3300026067 Bacteria 5637
952 Ga0207678_10068114 3300026067 Bacteria 3054
953 Ga0207678_10081794 3300026067 Bacteria 2764
954 Ga0207678_10095725 3300026067 Bacteria 2537
955 Ga0207678_10098153 3300026067 Bacteria 2503
956 Ga0207678_10347423 3300026067 Bacteria 1279
957 Ga0207708_10071470 3300026075 Bacteria 2658
958 Ga0207708_10277223 3300026075 Bacteria 1358
959 Ga0207702_10000802 3300026078 Bacteria 33336
960 Ga0207702_10048188 3300026078 Bacteria 3593
961 Ga0207702_10061413 3300026078 Bacteria 3205
962 Ga0207702_10079307 3300026078 Bacteria 2845
963 Ga0207702_10250323 3300026078 Bacteria 1664
964 Ga0207641_10000007 3300026088 Bacteria 441443
965 Ga0207641_10002448 3300026088 Bacteria 17149
966 Ga0207641_10383455 3300026088 Bacteria 1346
967 Ga0207648_10003261 3300026089 Bacteria 17056
968 Ga0207648_10034254 3300026089 Bacteria 4477
969 Ga0207648_10076697 3300026089 Bacteria 2913
970 Ga0207648_10318937 3300026089 Bacteria 1396
971 Ga0207676_10000017 3300026095 Bacteria 308709
972 Ga0207676_10000129 3300026095 Bacteria 66275
973 Ga0207676_10000330 3300026095 Bacteria 40824
974 Ga0207676_10001647 3300026095 Bacteria 16445
975 Ga0207676_10003188 3300026095 Bacteria 11680
976 Ga0207676_10247608 3300026095 Bacteria 1602
977 Ga0207674_10103030 3300026116 Bacteria 2833
978 Ga0207674_10223382 3300026116 Bacteria 1832
979 Ga0207674_10313350 3300026116 Bacteria 1518
980 Ga0207675_100001035 3300026118 Bacteria 27576
981 Ga0207675_100001434 3300026118 Bacteria 23882
982 Ga0207675_100041578 3300026118 Bacteria 4293
983 Ga0207683_10000069 3300026121 Bacteria 78741
984 Ga0207683_10001824 3300026121 Bacteria 18845
985 Ga0207683_10003110 3300026121 Bacteria 14500
986 Ga0207683_10098393 3300026121 Bacteria 2610
987 Ga0207683_10142705 3300026121 Bacteria 2158
988 Ga0207698_10024663 3300026142 Bacteria 4225
989 Ga0207698_10026028 3300026142 Bacteria 4133
990 Ga0209281_1000409 3300027111 Bacteria 65132
991 Ga0209281_1000520 3300027111 Bacteria 49942
992 Ga0209281_1002614 3300027111 Bacteria 6932
993 Ga0209281_1007427 3300027111 Bacteria 2752
994 Ga0209389_1000165 3300027296 Bacteria 54591
995 Ga0209389_1000422 3300027296 Bacteria 25086
996 Ga0209371_1000009 3300027312 Bacteria 963030
997 Ga0209371_1000424 3300027312 Bacteria 43444
998 Ga0209371_1000697 3300027312 Bacteria 28520
999 Ga0209371_1005706 3300027312 Bacteria 4857
1000 Ga0209371_1007824 3300027312 Bacteria 3648
1001 Ga0209589_1000002 3300027357 Bacteria 708598
1002 Ga0209589_1001841 3300027357 Bacteria 35751
1003 Ga0209489_100002 3300027361 Bacteria 708609
1004 Ga0209489_102693 3300027361 Bacteria 35754
1005 Ga0209489_104637 3300027361 Bacteria 25086
1006 Ga0209700_100002 3300027363 Bacteria 708598
1007 Ga0209700_100018 3300027363 Bacteria 238200
1008 Ga0209179_1000847 3300027512 Bacteria 3394
1009 Ga0209179_1009622 3300027512 Bacteria 1664
1010 Ga0209982_1004667 3300027552 Bacteria 1969
1011 Ga0209282_1000090 3300027666 Bacteria 65132
1012 Ga0209282_1006880 3300027666 Bacteria 7095
1013 Ga0209282_1024516 3300027666 Bacteria 3781
1014 Ga0209966_1005197 3300027695 Bacteria 2229
1015 Ga0209998_10001507 3300027717 Bacteria 5601
1016 Ga0209813_10046190 3300027866 Bacteria 1344
1017 Ga0209974_10011468 3300027876 Bacteria 2975
1018 Ga0207428_10000111 3300027907 Bacteria 111333
1019 Ga0207428_10000987 3300027907 Bacteria 31506
1020 Ga0207428_10005328 3300027907 Bacteria 11997
1021 Ga0207428_10007680 3300027907 Bacteria 9815
1022 Ga0207428_10058988 3300027907 Bacteria 3044
1023 Ga0268266_10002477 3300028379 Bacteria 19728
1024 Ga0268266_10010325 3300028379 Bacteria 8169
1025 Ga0268266_10012267 3300028379 Bacteria 7413
1026 Ga0268266_10016104 3300028379 Bacteria 6392
1027 Ga0268266_10016889 3300028379 Bacteria 6237
1028 Ga0268266_10052771 3300028379 Bacteria 3492
1029 Ga0268266_10060689 3300028379 Bacteria 3260
1030 Ga0268266_10271987 3300028379 Bacteria 1573
1031 Ga0268266_10299171 3300028379 Bacteria 1500
1032 Ga0268265_10000002 3300028380 Bacteria 1035381
1033 Ga0268265_10002412 3300028380 Bacteria 14120
1034 Ga0268265_10002909 3300028380 Bacteria 12573
1035 Ga0268265_10008736 3300028380 Bacteria 6849
1036 Ga0268265_10020789 3300028380 Bacteria 4587
1037 Ga0268265_10105325 3300028380 Bacteria 2288
1038 Ga0268265_10115162 3300028380 Bacteria 2203
1039 Ga0268264_10000049 3300028381 Bacteria 329992
1040 Ga0268264_10001053 3300028381 Bacteria 27479
1041 Ga0268264_10006295 3300028381 Bacteria 10008
1042 Ga0268264_10065265 3300028381 Bacteria 3067
1043 Ga0268264_10106429 3300028381 Bacteria 2448
1044 Ga0268264_10212982 3300028381 Bacteria 1775
1045 Ga0265337_1018690 3300028556 Bacteria 2197
1046 Ga0265319_1014361 3300028563 Bacteria 3110
1047 Ga0265334_10001384 3300028573 Bacteria 11697
1048 Ga0265318_10069036 3300028577 Bacteria 1310
1049 Ga0265323_10001829 3300028653 Bacteria 10097
1050 Ga0265336_10000786 3300028666 Bacteria 16776
1051 Ga0307517_10000650 3300028786 Bacteria 59699
1052 Ga0307515_10000674 3300028794 Bacteria 78735
1053 Ga0307515_10001722 3300028794 Bacteria 48683
1054 Ga0265338_10000024 3300028800 Bacteria 297778
1055 Ga0265338_10005729 3300028800 Bacteria 16062
1056 Ga0265324_10005055 3300029957 Bacteria 5782
1057 Ga0268256_1000010 3300030500 Bacteria 963034
1058 Ga0268256_1001848 3300030500 Bacteria 11785
1059 Ga0268256_1008094 3300030500 Bacteria 3647
1060 Ga0268256_1008873 3300030500 Bacteria 3400
1061 Ga0316181_1013580 3300030744 Bacteria 3709
1062 Ga0265760_10013964 3300031090 Bacteria 2298
1063 Ga0265330_10022754 3300031235 Bacteria 2851
1064 Ga0265330_10023244 3300031235 Bacteria 2817
1065 Ga0265330_10051648 3300031235 Bacteria 1802
1066 Ga0265332_10001742 3300031238 Bacteria 11810
1067 Ga0265328_10000072 3300031239 Bacteria 53873
1068 Ga0265328_10000141 3300031239 Bacteria 33940
1069 Ga0265328_10001227 3300031239 Bacteria 11882
1070 Ga0265328_10001795 3300031239 Bacteria 9791
1071 Ga0265328_10002282 3300031239 Bacteria 8626
1072 Ga0265328_10006655 3300031239 Bacteria 4865
1073 Ga0265328_10015108 3300031239 Bacteria 3030
1074 Ga0265328_10040077 3300031239 Bacteria 1727
1075 Ga0265325_10000004 3300031241 Bacteria 347347
1076 Ga0265325_10000637 3300031241 Bacteria 25504
1077 Ga0265325_10014495 3300031241 Bacteria 4452
1078 Ga0265325_10015987 3300031241 Bacteria 4203
1079 Ga0265325_10030159 3300031241 Bacteria 2910
1080 Ga0265325_10035919 3300031241 Bacteria 2628
1081 Ga0265325_10040265 3300031241 Bacteria 2454
1082 Ga0265329_10012851 3300031242 Bacteria 3000
1083 Ga0265329_10022092 3300031242 Bacteria 2132
1084 Ga0265329_10036062 3300031242 Bacteria 1595
1085 Ga0265340_10000546 3300031247 Bacteria 20836
1086 Ga0265340_10005250 3300031247 Bacteria 7189
1087 Ga0265340_10006054 3300031247 Bacteria 6670
1088 Ga0265339_10000420 3300031249 Bacteria 33598
1089 Ga0265339_10020102 3300031249 Bacteria 3906
1090 Ga0265339_10045669 3300031249 Bacteria 2410
1091 Ga0265331_10000058 3300031250 Bacteria 175410
1092 Ga0265331_10000297 3300031250 Bacteria 54201
1093 Ga0265331_10004444 3300031250 Bacteria 8758
1094 Ga0265327_10081666 3300031251 Bacteria 1595
1095 Ga0265316_10000454 3300031344 Bacteria 46483
1096 Ga0265316_10009031 3300031344 Bacteria 9188
1097 Ga0265316_10021215 3300031344 Bacteria 5510
1098 Ga0265316_10024211 3300031344 Bacteria 5093
1099 Ga0265316_10026512 3300031344 Bacteria 4818
1100 Ga0307513_10007088 3300031456 Bacteria 14574
1101 Ga0307513_10032310 3300031456 Bacteria 5903
1102 Ga0307513_10074643 3300031456 Bacteria 3525
1103 Ga0307513_10093408 3300031456 Bacteria 3058
1104 Ga0307509_10212914 3300031507 Bacteria 1755
1105 Ga0307509_10263716 3300031507 Bacteria 1495
1106 Ga0307408_100044103 3300031548 Bacteria 3177
1107 Ga0307408_100086836 3300031548 Bacteria 2352
1108 Ga0307408_100138058 3300031548 Bacteria 1910
1109 Ga0307408_100170857 3300031548 Bacteria 1736
1110 Ga0265313_10000637 3300031595 Bacteria 36099
1111 Ga0265313_10001864 3300031595 Bacteria 19177
1112 Ga0265313_10064597 3300031595 Bacteria 1702
1113 Ga0307508_10000397 3300031616 Bacteria 52462
1114 Ga0307508_10079786 3300031616 Bacteria 2854
1115 Ga0265314_10000483 3300031711 Bacteria 52032
1116 Ga0265314_10005492 3300031711 Bacteria 11424
1117 Ga0265314_10010860 3300031711 Bacteria 7569
1118 Ga0265314_10015208 3300031711 Bacteria 6113
1119 Ga0265314_10035958 3300031711 Bacteria 3605
1120 Ga0265314_10059271 3300031711 Bacteria 2619
1121 Ga0265342_10003830 3300031712 Bacteria 12110
1122 Ga0265342_10004574 3300031712 Bacteria 10812
1123 Ga0265342_10026709 3300031712 Bacteria 3615
1124 Ga0265342_10068513 3300031712 Bacteria 2073
1125 Ga0265342_10093420 3300031712 Bacteria 1722
1126 Ga0265342_10146900 3300031712 Bacteria 1312
1127 Ga0307516_10124772 3300031730 Bacteria 2360
1128 Ga0307516_10210808 3300031730 Bacteria 1657
1129 Ga0307405_10000482 3300031731 Bacteria 14958
1130 Ga0307405_10112789 3300031731 Bacteria 1845
1131 Ga0307413_10203409 3300031824 Bacteria 1432
1132 Ga0307412_10009613 3300031911 Bacteria 5554
1133 Ga0315914_1000167 3300031967 Bacteria 65125
1134 Ga0307409_100042510 3300031995 Bacteria 3405
1135 Ga0307409_100262852 3300031995 Bacteria 1585
1136 Ga0307409_100333650 3300031995 Bacteria 1424
1137 Ga0307416_100035018 3300032002 Bacteria 3829
1138 Ga0307415_100086904 3300032126 Bacteria 2251
1139 Ga0307415_100115160 3300032126 Bacteria 2003
1140 Ga0316583_10007791 3300032133 Bacteria 3862
1141 Ga0307507_10030837 3300033179 Bacteria 5642
1142 Ga0307510_10195581 3300033180 Bacteria 1564
1143 Ga0315913_1000038 3300033430 Bacteria 64995
1144 Ga0315911_1000017 3300033442 Bacteria 161609
1145 Ga0315915_1000019 3300033464 Bacteria 129295
1146 Ga0373930_0000026 3300034816 Bacteria 13528
1147 Ga0373948_0000180 3300034817 Bacteria 7225
1148 Ga0373950_0001017 3300034818 Bacteria 3570
1149 Ga0373958_0000141 3300034819 Bacteria 8073
1150 Ga0373959_0000602 3300034820 Bacteria 6316
1151 Ga0373938_0000550 3300034957 Bacteria 6063
1152 Ga0373926_0053303 3300035083 Bacteria 1463
1153 Ga0373928_0006282 3300035084 Bacteria 2284
1154 Ga0373934_0012347 3300035086 Bacteria 3225
1155 Ga0373934_0013519 3300035086 Bacteria 3088
1156 Ga0373934_0019707 3300035086 Bacteria 2591
1157 Ga0373934_0056410 3300035086 Bacteria 1562
1158 Ga0373934_0061412 3300035086 Bacteria 1497
1159 Ga0373944_0000032 3300035089 Bacteria 23358
1160 Ga0373949_0002906 3300035090 Bacteria 4224
1161 Ga0373952_0001795 3300035092 Bacteria 3908
1162 Ga0373952_0003944 3300035092 Bacteria 2684
1163 Ga0373923_0000024 3300035111 Bacteria 22677
1164 Ga0373923_0002988 3300035111 Bacteria 5337
1165 Ga0373923_0014155 3300035111 Bacteria 2991
1166 Ga0373923_0041946 3300035111 Bacteria 1888
1167 Ga0373932_0000372 3300035112 Bacteria 13829
1168 Ga0373936_0004456 3300035113 Bacteria 5297
1169 Ga0373936_0008271 3300035113 Bacteria 3912
1170 Ga0373936_0023638 3300035113 Bacteria 2396
1171 Ga0373939_0000679 3300035114 Bacteria 8454
1172 Ga0373939_0005214 3300035114 Bacteria 3089
1173 Ga0373941_0001044 3300035115 Bacteria 5761
1174 Ga0373941_0040293 3300035115 Bacteria 1440
1175 Ga0373945_0000540 3300035116 Bacteria 10781
1176 Ga0373945_0001823 3300035116 Bacteria 6585
1177 Ga0373945_0003624 3300035116 Bacteria 4864
1178 Ga0373945_0009136 3300035116 Bacteria 3241
1179 Ga0373953_0000323 3300035117 Bacteria 12895
1180 Ga0373953_0000601 3300035117 Bacteria 9950
1181 Ga0373953_0005320 3300035117 Bacteria 4167
1182 Ga0373953_0028503 3300035117 Bacteria 2153
1183 Ga0373953_0058584 3300035117 Bacteria 1570
1184 Ga0373954_0000513 3300035118 Bacteria 14519
1185 Ga0373954_0003957 3300035118 Bacteria 6339
1186 Ga0373954_0004064 3300035118 Bacteria 6266
1187 Ga0373954_0005351 3300035118 Bacteria 5545
1188 Ga0373954_0006859 3300035118 Bacteria 4971
1189 Ga0373954_0049337 3300035118 Bacteria 1973
1190 Ga0373956_0001475 3300035119 Bacteria 9724
1191 Ga0373956_0003133 3300035119 Bacteria 6686
1192 Ga0373956_0005887 3300035119 Bacteria 4904
1193 Ga0373956_0031194 3300035119 Bacteria 2334
1194 Ga0373956_0103659 3300035119 Bacteria 1321
1195 Ga0373957_0003468 3300035120 Bacteria 4663
1196 Ga0373957_0004955 3300035120 Bacteria 4098
1197 Ga0373957_0005072 3300035120 Bacteria 4064
1198 Ga0373943_0000111 3300035170 Bacteria 30271
1199 Ga0373943_0004198 3300035170 Bacteria 6532
1200 Ga0373943_0004632 3300035170 Bacteria 6217
1201 Ga0373943_0005475 3300035170 Bacteria 5712
1202 Ga0373943_0006405 3300035170 Bacteria 5287
1203 Ga0373943_0028462 3300035170 Bacteria 2633
1204 Ga0373946_0004567 3300035171 Bacteria 4961
1205 Ga0373946_0007784 3300035171 Bacteria 3931
1206 Ga0373946_0027296 3300035171 Bacteria 2257
1207 Ga0373946_0027966 3300035171 Bacteria 2234
1208 Ga0373946_0049105 3300035171 Bacteria 1759
1209 Ga0373955_0000131 3300035172 Bacteria 29719
1210 Ga0373955_0001036 3300035172 Bacteria 11811
1211 Ga0373955_0004173 3300035172 Bacteria 6376
1212 Ga0373955_0004495 3300035172 Bacteria 6174
1213 Ga0373955_0005836 3300035172 Bacteria 5560
1214 Ga0373955_0007749 3300035172 Bacteria 4947
1215 Ga0373955_0012218 3300035172 Bacteria 4122
1216 Ga0373955_0013667 3300035172 Bacteria 3932
1217 Ga0373955_0047608 3300035172 Bacteria 2322
1218 Ga0373955_0139964 3300035172 Bacteria 1418
1219 Ga0373942_0000051 3300035207 Bacteria 23168
1220 Ga0373961_0000755 3300035241 Bacteria 11128
1221 Ga0373961_0029910 3300035241 Bacteria 1511
1222 Ga0373962_0000997 3300035242 Bacteria 6548
1223 Ga0316574_0013426 3300035398 Bacteria 4709
1224 Ga0373924_0002185 3300035410 Bacteria 6553
1225 Ga0373924_0044548 3300035410 Bacteria 1823
1226 Ga0373924_0060602 3300035410 Bacteria 1582
1227 Ga0373924_0061508 3300035410 Bacteria 1571
1228 Ga0373931_0004270 3300035691 Bacteria 6507
1229 Ga0373931_0017213 3300035691 Bacteria 3570
1230 Ga0373931_0084804 3300035691 Bacteria 1755
1231 Ga0373935_0000315 3300035692 Bacteria 24180
1232 Ga0373935_0031047 3300035692 Bacteria 3313
1233 Ga0373935_0049415 3300035692 Bacteria 2665
1234 Ga0373935_0057343 3300035692 Bacteria 2484
1235 Ga0373935_0085670 3300035692 Bacteria 2054
1236 Ga0373927_0002955 3300035695 Bacteria 12344
1237 Ga0373927_0019683 3300035695 Bacteria 4425
1238 Ga0373927_0019716 3300035695 Bacteria 4422
1239 Ga0373927_0030721 3300035695 Bacteria 3504
1240 Ga0373927_0034169 3300035695 Bacteria 3308
1241 Ga0373927_0106944 3300035695 Bacteria 1822
1242 Ga0373927_0123146 3300035695 Bacteria 1692
1243 Ga0373927_0127709 3300035695 Bacteria 1660
1244 Ga0373927_0135831 3300035695 Bacteria 1607
1245 Ga0373933_0000184 3300035724 Bacteria 41316
1246 Ga0373933_0002482 3300035724 Bacteria 10383
1247 Ga0373933_0002846 3300035724 Bacteria 9665
1248 Ga0373933_0004713 3300035724 Bacteria 7459
1249 Ga0373933_0005779 3300035724 Bacteria 6728
1250 Ga0373933_0018156 3300035724 Bacteria 3952
1251 Ga0373933_0018834 3300035724 Bacteria 3888
1252 Ga0373933_0043844 3300035724 Bacteria 2647
1253 Ga0373933_0065363 3300035724 Bacteria 2202
1254 Ga0373947_0003354 3300035725 Bacteria 9481
1255 Ga0373947_0005224 3300035725 Bacteria 7588
1256 Ga0373947_0024013 3300035725 Bacteria 3549
1257 Ga0373947_0067604 3300035725 Bacteria 2183
1258 Ga0373947_0072677 3300035725 Bacteria 2112
1259 Ga0373947_0192653 3300035725 Bacteria 1331
1260 Ga0373937_0000212 3300036401 Bacteria 55966
1261 Ga0373937_0003633 3300036401 Bacteria 13011
1262 Ga0373937_0003875 3300036401 Bacteria 12650
1263 Ga0373937_0004343 3300036401 Bacteria 12027
1264 Ga0373937_0008780 3300036401 Bacteria 8769
1265 Ga0373937_0011842 3300036401 Bacteria 7659
1266 Ga0373937_0015962 3300036401 Bacteria 6659
1267 Ga0373937_0113508 3300036401 Bacteria 2521
1268 Ga0373937_0119792 3300036401 Bacteria 2452
1269 Ga0373925_0000002 3300037068 Bacteria 368879
1270 Ga0373925_0003356 3300037068 Bacteria 12423
1271 Ga0373925_0007031 3300037068 Bacteria 8221
1272 Ga0373925_0009469 3300037068 Bacteria 7091
1273 Ga0373925_0014982 3300037068 Bacteria 5605
1274 Ga0373925_0029641 3300037068 Bacteria 4014
1275 Ga0373925_0038162 3300037068 Bacteria 3550
1276 Ga0373925_0063479 3300037068 Bacteria 2779
1277 Ga0373925_0065123 3300037068 Bacteria 2745
1278 Ga0373925_0185191 3300037068 Bacteria 1650
1279 Ga0395899_0000014 3300037312 Bacteria 488813
1280 Ga0395899_0020826 3300037312 Bacteria 4973
1281 Ga0395899_0070127 3300037312 Bacteria 2565
1282 Ga0395899_0155494 3300037312 Bacteria 1618
1283 Ga0395900_0000007 3300037418 Bacteria 488860
1284 Ga0395900_0001833 3300037418 Bacteria 24228
1285 Ga0395900_0002921 3300037418 Bacteria 18614
1286 Ga0395900_0005150 3300037418 Bacteria 13733
1287 Ga0395900_0007393 3300037418 Bacteria 11356
1288 Ga0395900_0061220 3300037418 Bacteria 3871
1289 Ga0395900_0140928 3300037418 Bacteria 2469
1290 Ga0395900_0203341 3300037418 Bacteria 2003
1291 Ga0395898_0000011 3300037466 Bacteria 488860
1292 Ga0395898_0012309 3300037466 Bacteria 8845
1293 Ga0395898_0041638 3300037466 Bacteria 4536
1294 Ga0395905_0000008 3300037471 Bacteria 488860
1295 Ga0395905_0000479 3300037471 Bacteria 55266
1296 Ga0395905_0000969 3300037471 Bacteria 36854
1297 Ga0395905_0011280 3300037471 Bacteria 8637
1298 Ga0395905_0011626 3300037471 Bacteria 8502
1299 Ga0395905_0016505 3300037471 Bacteria 7019
1300 Ga0395905_0134974 3300037471 Bacteria 2321
1301 Ga0395905_0231322 3300037471 Bacteria 1728
1302 Ga0436364_0211631 3300037853 Bacteria 2820
1303 Ga0436364_0232280 3300037853 Bacteria 88632
1304 Ga0436364_0753583 3300037853 Bacteria 4550
1305 Ga0436364_0998932 3300037853 Bacteria 1521
1306 Ga0395901_0000020 3300038443 Bacteria 314918
1307 Ga0395901_0033652 3300038443 Bacteria 5292
1308 Ga0395901_0045118 3300038443 Bacteria 4573
1309 Ga0395901_0091118 3300038443 Bacteria 3191
1310 Ga0395901_0160678 3300038443 Bacteria 2360
1311 Ga0395901_0252196 3300038443 Bacteria 1838
1312 Ga0395901_0365733 3300038443 Bacteria 1486
1313 Ga0395901_0386666 3300038443 Bacteria 1439
1314 Ga0436365_0138538 3300039437 Bacteria 4148
1315 Ga0436365_0221937 3300039437 Bacteria 4585
1316 Ga0436365_0348734 3300039437 Bacteria 7894
1317 Ga0436365_0443161 3300039437 Bacteria 3239
1318 Ga0436365_0775021 3300039437 Bacteria 21907
1319 Ga0436365_1013804 3300039437 Bacteria 25684
1320 Ga0436365_1037067 3300039437 Bacteria 36463
1321 Ga0436365_1103669 3300039437 Bacteria 1457
1322 Ga0436365_1107307 3300039437 Bacteria 1932
1323 Ga0436360_0762243 3300039438 Bacteria 1916
1324 Ga0436360_1037370 3300039438 Bacteria 8110
1325 Ga0436360_1202621 3300039438 Bacteria 3525
1326 Ga0436361_0066830 3300039447 Bacteria 1942
1327 Ga0436361_0069285 3300039447 Bacteria 3110
1328 Ga0436361_0384903 3300039447 Bacteria 3063
1329 Ga0436361_0560429 3300039447 Bacteria 2405
1330 Ga0436361_0794959 3300039447 Bacteria 3165
1331 Ga0436361_0822087 3300039447 Bacteria 15373
1332 Ga0436363_0333941 3300039450 Bacteria 1626
1333 Ga0436363_0517921 3300039450 Bacteria 3404
1334 Ga0436363_0669500 3300039450 Bacteria 8184
1335 Ga0436363_0908022 3300039450 Bacteria 13569
1336 Ga0436363_1355236 3300039450 Bacteria 24089
1337 Ga0436363_1422262 3300039450 Bacteria 1908
1338 Ga0436362_0765609 3300039453 Bacteria 13645
1339 Ga0439453_0013379 3300041408 Bacteria 1395
1340 Ga0439465_0012906 3300041413 Bacteria 2611
1341 Ga0439443_010117 3300042003 Bacteria 1363
1342 Ga0439449_0009292 3300042007 Bacteria 3727
1343 Ga0439450_009778 3300042008 Bacteria 1832
1344 Ga0439435_0004763 3300042436 Bacteria 2943
1345 Ga0439460_0004611 3300042461 Bacteria 3364
1346 Ga0466969_0018912 3300044656 Bacteria 3587
1347 Ga0466972_0000264 3300044658 Bacteria 33879
1348 Ga0466972_0007828 3300044658 Bacteria 5360
1349 Ga0466966_0001752 3300044684 Bacteria 14054
1350 Ga0466966_0070219 3300044684 Bacteria 2196
1351 Ga0466961_0000042 3300044693 Bacteria 78589
1352 Ga0466961_0090309 3300044693 Bacteria 1935
1353 Ga0466963_0024768 3300044694 Bacteria 3821
1354 Ga0466963_0033828 3300044694 Bacteria 3322
1355 Ga0466963_0038019 3300044694 Bacteria 3146
1356 Ga0466963_0220837 3300044694 Bacteria 1327
1357 Ga0466968_0014223 3300044735 Bacteria 3142
1358 Ga0466968_0032305 3300044735 Bacteria 2176
1359 Ga0466968_0053355 3300044735 Bacteria 1731
1360 Ga0466970_0042207 3300044765 Bacteria 2425
1361 Ga0466957_0004875 3300044842 Bacteria 7512
1362 Ga0466957_0042138 3300044842 Bacteria 2761
1363 Ga0466957_0053132 3300044842 Bacteria 2469
1364 Ga0466960_0009108 3300044901 Bacteria 4084
1365 Ga0466959_0040948 3300045049 Bacteria 3422
1366 Ga0451576_0011112 3300045051 Bacteria 10271
1367 Ga0466958_0001399 3300045836 Bacteria 11414
1368 Ga0466958_0058623 3300045836 Bacteria 2341
1369 Ga0466967_0023371 3300045976 Bacteria 5064
1370 Ga0466967_0086184 3300045976 Bacteria 2845
1371 Ga0466967_0177290 3300045976 Bacteria 2008
1372 Ga0466967_0184616 3300045976 Bacteria 1969
1373 Ga0495592_0000265 3300046454 Bacteria 44816
1374 Ga0495592_0001426 3300046454 Bacteria 16599
1375 Ga0495592_0008300 3300046454 Bacteria 7793
1376 Ga0495592_0011467 3300046454 Bacteria 6708
1377 Ga0495592_0025347 3300046454 Bacteria 4503
1378 Ga0495592_0028861 3300046454 Bacteria 4199
1379 Ga0495603_0001349 3300046455 Bacteria 14260
1380 Ga0495603_0017479 3300046455 Bacteria 4338
1381 Ga0495603_0036792 3300046455 Bacteria 2938
1382 Ga0495603_0046649 3300046455 Bacteria 2582
1383 Ga0495603_0056303 3300046455 Bacteria 2328
1384 Ga0495603_0063972 3300046455 Bacteria 2170
1385 Ga0495629_0000388 3300046459 Bacteria 36900
1386 Ga0495629_0001654 3300046459 Bacteria 17497
1387 Ga0495629_0004972 3300046459 Bacteria 9972
1388 Ga0495629_0006277 3300046459 Bacteria 8822
1389 Ga0495629_0007918 3300046459 Bacteria 7818
1390 Ga0495629_0009524 3300046459 Bacteria 7098
1391 Ga0495629_0104167 3300046459 Bacteria 1979
1392 Ga0495638_0003980 3300046460 Bacteria 11370
1393 Ga0495638_0011741 3300046460 Bacteria 6029
1394 Ga0495638_0020112 3300046460 Bacteria 4411
1395 Ga0495638_0028717 3300046460 Bacteria 3589
1396 Ga0495638_0070871 3300046460 Bacteria 2133
1397 Ga0495638_0071364 3300046460 Bacteria 2124
1398 Ga0495641_0002671 3300046461 Bacteria 13892
1399 Ga0495651_0002142 3300046462 Bacteria 15273
1400 Ga0495651_0004420 3300046462 Bacteria 10773
1401 Ga0495651_0006821 3300046462 Bacteria 8722
1402 Ga0495651_0008855 3300046462 Bacteria 7724
1403 Ga0495651_0012430 3300046462 Bacteria 6566
1404 Ga0495651_0024497 3300046462 Bacteria 4694
1405 Ga0495651_0029814 3300046462 Bacteria 4254
1406 Ga0495651_0072954 3300046462 Bacteria 2606
1407 Ga0495651_0164939 3300046462 Bacteria 1583
1408 Ga0495653_0000006 3300046463 Bacteria 363285
1409 Ga0495653_0000822 3300046463 Bacteria 23878
1410 Ga0495653_0001549 3300046463 Bacteria 17954
1411 Ga0495653_0005319 3300046463 Bacteria 10474
1412 Ga0495653_0006892 3300046463 Bacteria 9341
1413 Ga0495653_0011002 3300046463 Bacteria 7403
1414 Ga0495653_0093663 3300046463 Bacteria 2190
1415 Ga0495580_0001008 3300046472 Bacteria 24768
1416 Ga0495580_0002996 3300046472 Bacteria 14481
1417 Ga0495580_0005259 3300046472 Bacteria 10752
1418 Ga0495580_0220073 3300046472 Bacteria 1305
1419 Ga0495582_0003020 3300046473 Bacteria 9430
1420 Ga0495582_0003812 3300046473 Bacteria 8483
1421 Ga0495582_0035997 3300046473 Bacteria 2722
1422 Ga0495605_0069299 3300046474 Bacteria 1670
1423 Ga0495605_0107712 3300046474 Bacteria 1274
1424 Ga0495639_0001542 3300046475 Bacteria 10277
1425 Ga0495639_0003840 3300046475 Bacteria 6451
1426 Ga0495639_0018412 3300046475 Bacteria 3040
1427 Ga0495662_0003379 3300046476 Bacteria 8091
1428 Ga0495662_0029134 3300046476 Bacteria 2666
1429 Ga0495664_0000002 3300046477 Bacteria 625183
1430 Ga0495664_0000906 3300046477 Bacteria 15223
1431 Ga0495664_0000994 3300046477 Bacteria 14602
1432 Ga0495664_0011190 3300046477 Bacteria 5053
1433 Ga0495664_0030554 3300046477 Bacteria 3155
1434 Ga0495664_0076985 3300046477 Bacteria 1997
1435 Ga0495664_0085860 3300046477 Bacteria 1890
1436 Ga0495664_0140337 3300046477 Bacteria 1465
1437 Ga0495584_0013187 3300046491 Bacteria 4218
1438 Ga0495584_0031825 3300046491 Bacteria 2670
1439 Ga0495585_0036719 3300046492 Bacteria 2761
1440 Ga0495594_0127109 3300046499 Bacteria 1442
1441 Ga0495594_0148182 3300046499 Bacteria 1332
1442 Ga0495583_0036768 3300046506 Bacteria 2326
1443 Ga0495583_0040625 3300046506 Bacteria 2184
1444 Ga0495583_0060022 3300046506 Bacteria 1702
1445 Ga0495606_0000244 3300046507 Bacteria 95942
1446 Ga0495608_0000006 3300046511 Bacteria 324334
1447 Ga0495608_0000289 3300046511 Bacteria 35308
1448 Ga0495608_0001963 3300046511 Bacteria 14735
1449 Ga0495608_0010179 3300046511 Bacteria 6562
1450 Ga0495608_0025283 3300046511 Bacteria 4053
1451 Ga0495608_0027069 3300046511 Bacteria 3904
1452 Ga0495608_0043448 3300046511 Bacteria 3002
1453 Ga0495608_0074810 3300046511 Bacteria 2207
1454 Ga0495610_0059645 3300046512 Bacteria 1820
1455 Ga0495610_0073210 3300046512 Bacteria 1593
1456 Ga0495616_0040043 3300046513 Bacteria 2397
1457 Ga0495618_0000264 3300046514 Bacteria 38284
1458 Ga0495618_0006815 3300046514 Bacteria 6919
1459 Ga0495618_0011931 3300046514 Bacteria 5272
1460 Ga0495618_0016952 3300046514 Bacteria 4464
1461 Ga0495618_0050325 3300046514 Bacteria 2631
1462 Ga0495618_0127738 3300046514 Bacteria 1627
1463 Ga0495618_0151427 3300046514 Bacteria 1481
1464 Ga0495628_0000002 3300046516 Bacteria 589399
1465 Ga0495628_0002476 3300046516 Bacteria 16640
1466 Ga0495628_0011857 3300046516 Bacteria 7355
1467 Ga0495628_0011916 3300046516 Bacteria 7332
1468 Ga0495628_0013613 3300046516 Bacteria 6839
1469 Ga0495628_0021457 3300046516 Bacteria 5311
1470 Ga0495628_0030031 3300046516 Bacteria 4402
1471 Ga0495628_0050304 3300046516 Bacteria 3297
1472 Ga0495628_0083992 3300046516 Bacteria 2471
1473 Ga0495630_0000922 3300046517 Bacteria 20488
1474 Ga0495630_0007569 3300046517 Bacteria 7764
1475 Ga0495630_0023295 3300046517 Bacteria 4577
1476 Ga0495630_0064137 3300046517 Bacteria 2759
1477 Ga0495631_0025430 3300046518 Bacteria 2727
1478 Ga0495632_0015207 3300046519 Bacteria 4326
1479 Ga0495632_0053863 3300046519 Bacteria 1974
1480 Ga0495632_0074181 3300046519 Bacteria 1630
1481 Ga0495637_0072001 3300046520 Bacteria 1393
1482 Ga0495643_0113292 3300046522 Bacteria 1377
1483 Ga0495644_0002153 3300046523 Bacteria 7901
1484 Ga0495648_0000943 3300046524 Bacteria 30112
1485 Ga0495648_0004878 3300046524 Bacteria 11300
1486 Ga0495648_0013335 3300046524 Bacteria 6083
1487 Ga0495666_0000006 3300046526 Bacteria 114619
1488 Ga0495666_0011220 3300046526 Bacteria 4470
1489 Ga0495666_0024149 3300046526 Bacteria 3004
1490 Ga0495666_0031624 3300046526 Bacteria 2593
1491 Ga0495652_0000004 3300046529 Bacteria 588877
1492 Ga0495652_0006286 3300046529 Bacteria 11066
1493 Ga0495652_0008449 3300046529 Bacteria 9395
1494 Ga0495652_0009418 3300046529 Bacteria 8875
1495 Ga0495652_0018828 3300046529 Bacteria 6152
1496 Ga0495652_0051451 3300046529 Bacteria 3518
1497 Ga0495652_0062149 3300046529 Bacteria 3149
1498 Ga0495652_0081685 3300046529 Bacteria 2665
1499 Ga0495652_0128004 3300046529 Bacteria 2014
1500 Ga0495652_0161741 3300046529 Bacteria 1737
1501 Ga0495654_0000180 3300046530 Bacteria 61780
1502 Ga0495654_0017399 3300046530 Bacteria 3781
1503 Ga0495665_0006571 3300046531 Bacteria 6279
1504 Ga0495665_0006666 3300046531 Bacteria 6230
1505 Ga0495665_0031727 3300046531 Bacteria 2827
1506 Ga0495640_0000007 3300046533 Bacteria 265481
1507 Ga0495640_0006016 3300046533 Bacteria 9624
1508 Ga0495640_0006561 3300046533 Bacteria 9195
1509 Ga0495640_0024460 3300046533 Bacteria 4394
1510 Ga0495640_0036896 3300046533 Bacteria 3451
1511 Ga0495640_0058495 3300046533 Bacteria 2628
1512 Ga0495640_0067704 3300046533 Bacteria 2405
1513 Ga0495640_0084740 3300046533 Bacteria 2101
1514 Ga0495640_0126346 3300046533 Bacteria 1658
1515 Ga0495587_0000031 3300046536 Bacteria 126721
1516 Ga0495587_0006418 3300046536 Bacteria 7666
1517 Ga0495587_0007962 3300046536 Bacteria 6846
1518 Ga0495587_0010201 3300046536 Bacteria 5990
1519 Ga0495587_0012027 3300046536 Bacteria 5466
1520 Ga0495587_0012306 3300046536 Bacteria 5393
1521 Ga0495587_0014909 3300046536 Bacteria 4861
1522 Ga0495587_0087094 3300046536 Bacteria 1807
1523 Ga0495587_0155375 3300046536 Bacteria 1303
1524 Ga0495598_0031182 3300046537 Bacteria 1498
1525 Ga0495645_0000003 3300046543 Bacteria 570133
1526 Ga0495645_0000795 3300046543 Bacteria 21661
1527 Ga0495645_0004352 3300046543 Bacteria 9677
1528 Ga0495645_0013623 3300046543 Bacteria 5758
1529 Ga0495645_0017745 3300046543 Bacteria 5103
1530 Ga0495622_0004994 3300046557 Bacteria 6148
1531 Ga0495622_0013142 3300046557 Bacteria 3842
1532 Ga0495622_0028076 3300046557 Bacteria 2627
1533 Ga0495622_0045282 3300046557 Bacteria 2044
1534 Ga0495633_0003640 3300046558 Bacteria 10189
1535 Ga0495667_0000002 3300046559 Bacteria 437535
1536 Ga0495667_0002033 3300046559 Bacteria 13415
1537 Ga0495667_0002298 3300046559 Bacteria 12812
1538 Ga0495667_0005427 3300046559 Bacteria 8616
1539 Ga0495667_0009201 3300046559 Bacteria 6706
1540 Ga0495667_0009299 3300046559 Bacteria 6662
1541 Ga0495667_0035682 3300046559 Bacteria 3321
1542 Ga0495667_0041758 3300046559 Bacteria 3041
1543 Ga0495656_0009206 3300046615 Bacteria 3547
1544 Ga0495656_0014888 3300046615 Bacteria 2926
1545 Ga0495634_0000110 3300046642 Bacteria 68101
1546 Ga0495634_0001894 3300046642 Bacteria 17946
1547 Ga0495634_0007460 3300046642 Bacteria 8212
1548 Ga0495634_0009648 3300046642 Bacteria 7108
1549 Ga0495634_0016003 3300046642 Bacteria 5373
1550 Ga0495634_0026375 3300046642 Bacteria 4056
1551 Ga0495634_0035930 3300046642 Bacteria 3390
1552 Ga0495634_0037463 3300046642 Bacteria 3313
1553 Ga0495634_0052862 3300046642 Bacteria 2722
1554 Ga0495634_0058959 3300046642 Bacteria 2558
1555 Ga0495634_0090767 3300046642 Bacteria 1984
1556 Ga0495634_0102782 3300046642 Bacteria 1845
1557 Ga0495625_0106365 3300046660 Bacteria 1921
1558 Ga0495625_0209552 3300046660 Bacteria 1282
1559 Ga0495635_0000022 3300046663 Bacteria 160907
1560 Ga0495635_0000288 3300046663 Bacteria 32286
1561 Ga0495635_0001168 3300046663 Bacteria 17510
1562 Ga0495635_0001402 3300046663 Bacteria 16074
1563 Ga0495635_0007716 3300046663 Bacteria 7508
1564 Ga0495635_0008149 3300046663 Bacteria 7320
1565 Ga0495635_0010102 3300046663 Bacteria 6600
1566 Ga0495635_0010787 3300046663 Bacteria 6401
1567 Ga0495635_0013043 3300046663 Bacteria 5818
1568 Ga0495635_0015913 3300046663 Bacteria 5254
1569 Ga0495635_0071144 3300046663 Bacteria 2384
1570 Ga0495635_0099734 3300046663 Bacteria 1985
1571 Ga0495659_0001100 3300046664 Bacteria 9416
1572 Ga0495659_0052646 3300046664 Bacteria 1486
1573 Ga0495661_0104638 3300046665 Bacteria 1587
1574 Ga0495588_0006573 3300046674 Bacteria 5245
1575 Ga0495588_0068182 3300046674 Bacteria 1847
1576 Ga0495657_0000072 3300046675 Bacteria 91747
1577 Ga0495657_0015860 3300046675 Bacteria 5502
1578 Ga0495657_0016056 3300046675 Bacteria 5462
1579 Ga0495657_0034341 3300046675 Bacteria 3523
1580 Ga0495657_0044614 3300046675 Bacteria 3014
1581 Ga0495657_0057359 3300046675 Bacteria 2589
1582 Ga0495599_0000001 3300046678 Bacteria 537563
1583 Ga0495599_0003372 3300046678 Bacteria 9340
1584 Ga0495599_0006130 3300046678 Bacteria 7242
1585 Ga0495599_0007175 3300046678 Bacteria 6748
1586 Ga0495599_0107154 3300046678 Bacteria 1741
1587 Ga0495623_0000001 3300046679 Bacteria 313861
1588 Ga0495623_0005612 3300046679 Bacteria 8191
1589 Ga0495623_0070800 3300046679 Bacteria 2171
1590 Ga0495646_0000014 3300046680 Bacteria 143781
1591 Ga0495646_0000602 3300046680 Bacteria 19568
1592 Ga0495646_0005603 3300046680 Bacteria 7944
1593 Ga0495646_0006900 3300046680 Bacteria 7205
1594 Ga0495646_0009008 3300046680 Bacteria 6333
1595 Ga0495646_0014178 3300046680 Bacteria 5067
1596 Ga0495647_0000491 3300046681 Bacteria 11512
1597 Ga0495647_0023197 3300046681 Bacteria 2248
1598 Ga0495647_0023329 3300046681 Bacteria 2243
1599 Ga0495647_0066842 3300046681 Bacteria 1430
1600 Ga0495658_0003012 3300046683 Bacteria 8436
1601 Ga0495658_0003472 3300046683 Bacteria 7792
1602 Ga0495658_0004272 3300046683 Bacteria 7030
1603 Ga0495658_0013109 3300046683 Bacteria 4216
1604 Ga0495658_0021459 3300046683 Bacteria 3404
1605 Ga0495669_0085207 3300046684 Bacteria 1454
1606 Ga0495669_0100100 3300046684 Bacteria 1346
1607 Ga0495613_0003519 3300046689 Bacteria 11724
1608 Ga0495613_0011931 3300046689 Bacteria 6459
1609 Ga0495613_0019414 3300046689 Bacteria 5065
1610 Ga0495613_0019969 3300046689 Bacteria 4993
1611 Ga0495613_0072685 3300046689 Bacteria 2507
1612 Ga0495613_0103421 3300046689 Bacteria 2056
1613 Ga0495613_0122064 3300046689 Bacteria 1870
1614 Ga0495624_0001428 3300046690 Bacteria 18558
1615 Ga0495670_0001262 3300046691 Bacteria 12379
1616 Ga0495671_0056262 3300046692 Bacteria 1947
1617 Ga0495671_0071269 3300046692 Bacteria 1707
1618 Ga0495589_0056154 3300046794 Bacteria 1938
1619 Ga0495600_0000125 3300046809 Bacteria 42880
1620 Ga0495600_0000732 3300046809 Bacteria 17255
1621 Ga0495600_0003964 3300046809 Bacteria 8799
1622 Ga0495600_0004287 3300046809 Bacteria 8528
1623 Ga0495600_0020521 3300046809 Bacteria 4225
1624 Ga0495600_0026293 3300046809 Bacteria 3755
1625 Ga0495600_0038671 3300046809 Bacteria 3105
1626 Ga0495600_0045449 3300046809 Bacteria 2865
1627 Ga0495600_0098835 3300046809 Bacteria 1902
1628 Ga0495600_0124770 3300046809 Bacteria 1674
1629 Ga0495581_0012365 3300047315 Bacteria 4944
1630 Ga0495581_0036543 3300047315 Bacteria 2842
1631 Ga0495581_0051337 3300047315 Bacteria 2381
1632 Ga0495581_0130944 3300047315 Bacteria 1461
1633 Ga0495604_0000005 3300047317 Bacteria 424516
1634 Ga0495604_0000518 3300047317 Bacteria 33955
1635 Ga0495604_0002291 3300047317 Bacteria 15331
1636 Ga0495604_0003472 3300047317 Bacteria 12564
1637 Ga0495604_0004766 3300047317 Bacteria 10748
1638 Ga0495604_0007687 3300047317 Bacteria 8539
1639 Ga0495604_0016039 3300047317 Bacteria 5982
1640 Ga0495604_0021381 3300047317 Bacteria 5165
1641 Ga0495604_0029179 3300047317 Bacteria 4388
1642 Ga0495604_0042393 3300047317 Bacteria 3566
1643 Ga0495604_0059975 3300047317 Bacteria 2914
1644 Ga0495604_0146677 3300047317 Bacteria 1681
1645 Ga0495674_0000003 3300047319 Bacteria 562126
1646 Ga0495674_0000106 3300047319 Bacteria 61645
1647 Ga0495674_0005390 3300047319 Bacteria 12281
1648 Ga0495674_0009229 3300047319 Bacteria 9374
1649 Ga0495674_0016219 3300047319 Bacteria 6949
1650 Ga0495674_0018724 3300047319 Bacteria 6444
1651 Ga0495674_0022837 3300047319 Bacteria 5766
1652 Ga0495674_0025317 3300047319 Bacteria 5442
1653 Ga0495674_0033497 3300047319 Bacteria 4652
1654 Ga0495674_0122291 3300047319 Bacteria 2198
1655 Ga0495674_0226629 3300047319 Bacteria 1543
1656 Ga0495672_0011526 3300047320 Bacteria 6232
1657 Ga0495672_0016486 3300047320 Bacteria 4976
1658 Ga0495672_0109411 3300047320 Bacteria 1485
1659 Ga0495676_0036136 3300047321 Bacteria 4127
1660 Ga0495676_0040840 3300047321 Bacteria 3825
1661 Ga0495676_0111806 3300047321 Bacteria 2003
1662 Ga0495680_0000871 3300047322 Bacteria 33528
1663 Ga0495680_0001213 3300047322 Bacteria 28254
1664 Ga0495680_0001647 3300047322 Bacteria 23728
1665 Ga0495680_0002522 3300047322 Bacteria 18719
1666 Ga0495680_0003933 3300047322 Bacteria 14370
1667 Ga0495680_0010136 3300047322 Bacteria 8421
1668 Ga0495680_0016372 3300047322 Bacteria 6373
1669 Ga0495680_0020334 3300047322 Bacteria 5587
1670 Ga0495680_0137306 3300047322 Bacteria 1792
1671 Ga0495687_018943 3300047443 Bacteria 3389
1672 Ga0495675_0000133 3300047444 Bacteria 52544
1673 Ga0495675_0001589 3300047444 Bacteria 13680
1674 Ga0495675_0002008 3300047444 Bacteria 12157
1675 Ga0495675_0002866 3300047444 Bacteria 10343
1676 Ga0495675_0099187 3300047444 Bacteria 1824
1677 Ga0495681_0032061 3300047470 Bacteria 2650
1678 Ga0495684_0000035 3300047471 Bacteria 107768
1679 Ga0495684_0000161 3300047471 Bacteria 50269
1680 Ga0495684_0001218 3300047471 Bacteria 20671
1681 Ga0495684_0021587 3300047471 Bacteria 4957
1682 Ga0495684_0024812 3300047471 Bacteria 4610
1683 Ga0495684_0121068 3300047471 Bacteria 1971
1684 Ga0495684_0152132 3300047471 Bacteria 1729
1685 Ga0495686_0029726 3300047472 Bacteria 3553
1686 Ga0495686_0055201 3300047472 Bacteria 2485
1687 Ga0495686_0056220 3300047472 Bacteria 2459
1688 Ga0495686_0072295 3300047472 Bacteria 2121
1689 Ga0495593_0000235 3300047673 Bacteria 29724
1690 Ga0495593_0000707 3300047673 Bacteria 19277
1691 Ga0495593_0002230 3300047673 Bacteria 11618
1692 Ga0495593_0002912 3300047673 Bacteria 10311
1693 Ga0495593_0036611 3300047673 Bacteria 2660
1694 Ga0495593_0037637 3300047673 Bacteria 2616
1695 Ga0495593_0068685 3300047673 Bacteria 1844
1696 Ga0495593_0104755 3300047673 Bacteria 1448
1697 Ga0495593_0124237 3300047673 Bacteria 1312
1698 Ga0495602_0000029 3300048088 Bacteria 142344
1699 Ga0495602_0003618 3300048088 Bacteria 16007
1700 Ga0495602_0010148 3300048088 Bacteria 9778
1701 Ga0495602_0012004 3300048088 Bacteria 8932
1702 Ga0495602_0020750 3300048088 Bacteria 6487
1703 Ga0495602_0043270 3300048088 Bacteria 4096
1704 Ga0495602_0084246 3300048088 Bacteria 2660
1705 Ga0495602_0142429 3300048088 Bacteria 1896
1706 Ga0495602_0209229 3300048088 Bacteria 1482
1707 Ga0495614_0004761 3300048089 Bacteria 6124
1708 Ga0496100_0002512 3300048903 Bacteria 9338
1709 Ga0496100_0032616 3300048903 Bacteria 3250
1710 Ga0496100_0040819 3300048903 Bacteria 2955
1711 Ga0496100_0084930 3300048903 Bacteria 2147
1712 Ga0496101_0003987 3300048904 Bacteria 9237
1713 Ga0496101_0005069 3300048904 Bacteria 8377
1714 Ga0496101_0010137 3300048904 Bacteria 6214
1715 Ga0496101_0173220 3300048904 Bacteria 1659
1716 Ga0496102_0001659 3300048905 Bacteria 19565
1717 Ga0496102_0001927 3300048905 Bacteria 17864
1718 Ga0496102_0002058 3300048905 Bacteria 17323
1719 Ga0496102_0032070 3300048905 Bacteria 4719
1720 Ga0496102_0036216 3300048905 Bacteria 4445
1721 Ga0496102_0059016 3300048905 Bacteria 3507
1722 Ga0496102_0070914 3300048905 Bacteria 3199
1723 Ga0496102_0076705 3300048905 Bacteria 3075
1724 Ga0496102_0365934 3300048905 Bacteria 1357
1725 Ga0496103_0000614 3300048906 Bacteria 27714
1726 Ga0496103_0031972 3300048906 Bacteria 3209
1727 Ga0496103_0039243 3300048906 Bacteria 2910
1728 Ga0496104_0000339 3300048907 Bacteria 41808
1729 Ga0496104_0000438 3300048907 Bacteria 36163
1730 Ga0496104_0000512 3300048907 Bacteria 33206
1731 Ga0496104_0000827 3300048907 Bacteria 26682
1732 Ga0496104_0005940 3300048907 Bacteria 10688
1733 Ga0496104_0006506 3300048907 Bacteria 10276
1734 Ga0496104_0007645 3300048907 Bacteria 9570
1735 Ga0496104_0010668 3300048907 Bacteria 8212
1736 Ga0496104_0011047 3300048907 Bacteria 8079
1737 Ga0496104_0015190 3300048907 Bacteria 6970
1738 Ga0496104_0020418 3300048907 Bacteria 6072
1739 Ga0496104_0025027 3300048907 Bacteria 5499
1740 Ga0496104_0029636 3300048907 Bacteria 5076
1741 Ga0496104_0081710 3300048907 Bacteria 3082
1742 Ga0496104_0090586 3300048907 Bacteria 2922
1743 Ga0496104_0129267 3300048907 Bacteria 2426
1744 Ga0496104_0181680 3300048907 Bacteria 2014
1745 Ga0496104_0228189 3300048907 Bacteria 1774
1746 Ga0496104_0254378 3300048907 Bacteria 1669
1747 Ga0496105_0000153 3300048908 Bacteria 45370
1748 Ga0496105_0000288 3300048908 Bacteria 33190
1749 Ga0496105_0000290 3300048908 Bacteria 33077
1750 Ga0496105_0000736 3300048908 Bacteria 22200
1751 Ga0496105_0002167 3300048908 Bacteria 14218
1752 Ga0496105_0010544 3300048908 Bacteria 7269
1753 Ga0496105_0031454 3300048908 Bacteria 4350
1754 Ga0496105_0032017 3300048908 Bacteria 4312
1755 Ga0496105_0036625 3300048908 Bacteria 4042
1756 Ga0496105_0037038 3300048908 Bacteria 4019
1757 Ga0496105_0059703 3300048908 Bacteria 3147
1758 Ga0496105_0122668 3300048908 Bacteria 2142
1759 Ga0496106_0001557 3300048909 Bacteria 17282
1760 Ga0496106_0040460 3300048909 Bacteria 3491
1761 Ga0496106_0045870 3300048909 Bacteria 3284
1762 Ga0496106_0047149 3300048909 Bacteria 3242
1763 Ga0496106_0069635 3300048909 Bacteria 2685
1764 Ga0496106_0100150 3300048909 Bacteria 2247
1765 Ga0496107_0064439 3300048910 Bacteria 2656
1766 Ga0496107_0064491 3300048910 Bacteria 2655
1767 Ga0496108_0001742 3300048911 Bacteria 17294
1768 Ga0496108_0006111 3300048911 Bacteria 9741
1769 Ga0496108_0008352 3300048911 Bacteria 8398
1770 Ga0496108_0015731 3300048911 Bacteria 6169
1771 Ga0496108_0030916 3300048911 Bacteria 4438
1772 Ga0496108_0032957 3300048911 Bacteria 4303
1773 Ga0496108_0073785 3300048911 Bacteria 2880
1774 Ga0496108_0089622 3300048911 Bacteria 2614
1775 Ga0496108_0106071 3300048911 Bacteria 2399
1776 Ga0496108_0168116 3300048911 Bacteria 1896
1777 Ga0496108_0232968 3300048911 Bacteria 1601
1778 Ga0496109_0000834 3300048912 Bacteria 25715
1779 Ga0496109_0001925 3300048912 Bacteria 17251
1780 Ga0496109_0039298 3300048912 Bacteria 4282
1781 Ga0496109_0051158 3300048912 Bacteria 3763
1782 Ga0496109_0092374 3300048912 Bacteria 2799
1783 Ga0496109_0105468 3300048912 Bacteria 2617
1784 Ga0496109_0129361 3300048912 Bacteria 2356
1785 Ga0496109_0160803 3300048912 Bacteria 2104
1786 Ga0496110_0001898 3300048913 Bacteria 15449
1787 Ga0496110_0009925 3300048913 Bacteria 7719
1788 Ga0496110_0027656 3300048913 Bacteria 4862
1789 Ga0496110_0033943 3300048913 Bacteria 4416
1790 Ga0496110_0046210 3300048913 Bacteria 3809
1791 Ga0496110_0072817 3300048913 Bacteria 3049
1792 Ga0496110_0111837 3300048913 Bacteria 2455
1793 Ga0496110_0122550 3300048913 Bacteria 2343
1794 Ga0496110_0125506 3300048913 Bacteria 2315
1795 Ga0496110_0213373 3300048913 Bacteria 1755
1796 Ga0496110_0221478 3300048913 Bacteria 1721
1797 Ga0496111_0042028 3300048914 Bacteria 3281
1798 Ga0496111_0046236 3300048914 Bacteria 3133
1799 Ga0496111_0048202 3300048914 Bacteria 3069
1800 Ga0496111_0048746 3300048914 Bacteria 3052
1801 Ga0496111_0119615 3300048914 Bacteria 1945
1802 Ga0496111_0136665 3300048914 Bacteria 1816
1803 Ga0496111_0203772 3300048914 Bacteria 1470
1804 Ga0496112_0000174 3300048915 Bacteria 41054
1805 Ga0496112_0004306 3300048915 Bacteria 12027
1806 Ga0496112_0009009 3300048915 Bacteria 8961
1807 Ga0496112_0011073 3300048915 Bacteria 8218
1808 Ga0496112_0013924 3300048915 Bacteria 7441
1809 Ga0496112_0046408 3300048915 Bacteria 4261
1810 Ga0496112_0055716 3300048915 Bacteria 3888
1811 Ga0496112_0062176 3300048915 Bacteria 3683
1812 Ga0496112_0134244 3300048915 Bacteria 2445
1813 Ga0496112_0192855 3300048915 Bacteria 1998
1814 Ga0496113_0006601 3300048916 Bacteria 7376
1815 Ga0496113_0006892 3300048916 Bacteria 7251
1816 Ga0496113_0019116 3300048916 Bacteria 4787
1817 Ga0496113_0019228 3300048916 Bacteria 4774
1818 Ga0496113_0034232 3300048916 Bacteria 3704
1819 Ga0496113_0041556 3300048916 Bacteria 3393
1820 Ga0496113_0062277 3300048916 Bacteria 2817
1821 Ga0496113_0096095 3300048916 Bacteria 2290
1822 Ga0496113_0124934 3300048916 Bacteria 2014
1823 Ga0496114_0041626 3300048917 Bacteria 3808
1824 Ga0496114_0064050 3300048917 Bacteria 3078
1825 Ga0496114_0121966 3300048917 Bacteria 2242
1826 Ga0496114_0133389 3300048917 Bacteria 2146
1827 Ga0496114_0145796 3300048917 Bacteria 2052
1828 Ga0496114_0241317 3300048917 Bacteria 1589
1829 Ga0496115_0001771 3300048918 Bacteria 15463
1830 Ga0496115_0002325 3300048918 Bacteria 13619
1831 Ga0496115_0021464 3300048918 Bacteria 4990
1832 Ga0496115_0033303 3300048918 Bacteria 4067
1833 Ga0496115_0053670 3300048918 Bacteria 3235
1834 Ga0496115_0055834 3300048918 Bacteria 3173
1835 Ga0496115_0057711 3300048918 Bacteria 3122
1836 Ga0496115_0085540 3300048918 Bacteria 2572
1837 Ga0496115_0128121 3300048918 Bacteria 2091
1838 Ga0496115_0137509 3300048918 Bacteria 2015
1839 Ga0496116_0000100 3300048919 Bacteria 194740
1840 Ga0496116_0000934 3300048919 Bacteria 35950
1841 Ga0496116_0002794 3300048919 Bacteria 17923
1842 Ga0496116_0029820 3300048919 Bacteria 3926
1843 Ga0496116_0036499 3300048919 Bacteria 3438
1844 Ga0496116_0047019 3300048919 Bacteria 2908
1845 Ga0496117_0000002 3300048920 Bacteria 2483758
1846 Ga0496117_0000739 3300048920 Bacteria 51387
1847 Ga0496117_0005902 3300048920 Bacteria 12650
1848 Ga0496117_0019487 3300048920 Bacteria 5569
1849 Ga0496117_0058338 3300048920 Bacteria 2674
1850 Ga0496117_0081360 3300048920 Bacteria 2126
1851 Ga0496117_0105334 3300048920 Bacteria 1773
1852 Ga0496117_0132717 3300048920 Bacteria 1506
1853 Ga0496118_0000862 3300048921 Bacteria 48139
1854 Ga0496118_0000943 3300048921 Bacteria 45458
1855 Ga0496118_0001431 3300048921 Bacteria 35926
1856 Ga0496118_0001493 3300048921 Bacteria 34920
1857 Ga0496118_0004386 3300048921 Bacteria 16775
1858 Ga0496118_0029865 3300048921 Bacteria 4562
1859 Ga0496118_0046575 3300048921 Bacteria 3371
1860 Ga0496118_0061701 3300048921 Bacteria 2774
1861 Ga0496118_0072424 3300048921 Bacteria 2475
1862 Ga0496119_0000891 3300048922 Bacteria 39078
1863 Ga0496119_0001063 3300048922 Bacteria 34964
1864 Ga0496119_0010321 3300048922 Bacteria 7871
1865 Ga0496119_0026987 3300048922 Bacteria 3964
1866 Ga0496119_0033436 3300048922 Bacteria 3407
1867 Ga0496119_0034365 3300048922 Bacteria 3341
1868 Ga0496120_0000021 3300048923 Bacteria 250966
1869 Ga0496120_0001546 3300048923 Bacteria 26928
1870 Ga0496120_0020050 3300048923 Bacteria 4260
1871 Ga0496120_0090929 3300048923 Bacteria 1630
1872 Ga0496120_0117181 3300048923 Bacteria 1382
1873 Ga0496121_0000001 3300048924 Bacteria 1830318
1874 Ga0496121_0000135 3300048924 Bacteria 165485
1875 Ga0496121_0000897 3300048924 Bacteria 53790
1876 Ga0496121_0000998 3300048924 Bacteria 50597
1877 Ga0496121_0001462 3300048924 Bacteria 39875
1878 Ga0496121_0003809 3300048924 Bacteria 21023
1879 Ga0496121_0005324 3300048924 Bacteria 16540
1880 Ga0496121_0006319 3300048924 Bacteria 14783
1881 Ga0496121_0010678 3300048924 Bacteria 10307
1882 Ga0496121_0016207 3300048924 Bacteria 7712
1883 Ga0496121_0027955 3300048924 Bacteria 5265
1884 Ga0496121_0031227 3300048924 Bacteria 4870
1885 Ga0496121_0225995 3300048924 Bacteria 1314
1886 Ga0496122_0000001 3300048925 Bacteria 1827766
1887 Ga0496122_0000018 3300048925 Bacteria 426350
1888 Ga0496122_0007327 3300048925 Bacteria 12318
1889 Ga0496122_0009277 3300048925 Bacteria 10403
1890 Ga0496122_0014786 3300048925 Bacteria 7519
1891 Ga0496122_0018155 3300048925 Bacteria 6515
1892 Ga0496122_0058531 3300048925 Bacteria 2851
1893 Ga0496123_0000001 3300048926 Bacteria 1831497
1894 Ga0496123_0000015 3300048926 Bacteria 426088
1895 Ga0496123_0000332 3300048926 Bacteria 89657
1896 Ga0496123_0000339 3300048926 Bacteria 88118
1897 Ga0496123_0006065 3300048926 Bacteria 11861
1898 Ga0496123_0010075 3300048926 Bacteria 8409
1899 Ga0496123_0034361 3300048926 Bacteria 3633
1900 Ga0496123_0044602 3300048926 Bacteria 3031
1901 Ga0496123_0094579 3300048926 Bacteria 1760
1902 Ga0496123_0095739 3300048926 Bacteria 1745
1903 Ga0496124_0000063 3300048927 Bacteria 229705
1904 Ga0496124_0000513 3300048927 Bacteria 66793
1905 Ga0496124_0001399 3300048927 Bacteria 36108
1906 Ga0496124_0003946 3300048927 Bacteria 17721
1907 Ga0496124_0006047 3300048927 Bacteria 13334
1908 Ga0496124_0007638 3300048927 Bacteria 11442
1909 Ga0496124_0059373 3300048927 Bacteria 3213
1910 Ga0496124_0164907 3300048927 Bacteria 1723
1911 Ga0496124_0204796 3300048927 Bacteria 1497
1912 Ga0496125_0000001 3300048928 Bacteria 1766138
1913 Ga0496125_0000048 3300048928 Bacteria 290651
1914 Ga0496125_0000299 3300048928 Bacteria 97532
1915 Ga0496125_0000664 3300048928 Bacteria 57244
1916 Ga0496125_0016378 3300048928 Bacteria 7124
1917 Ga0496125_0022463 3300048928 Bacteria 5858
1918 Ga0496125_0058589 3300048928 Bacteria 3110
1919 Ga0496125_0084872 3300048928 Bacteria 2402
1920 Ga0496126_0000311 3300048929 Bacteria 103353
1921 Ga0496126_0000380 3300048929 Bacteria 92061
1922 Ga0496126_0000934 3300048929 Bacteria 50431
1923 Ga0496126_0011178 3300048929 Bacteria 9317
1924 Ga0496126_0012908 3300048929 Bacteria 8531
1925 Ga0496126_0015005 3300048929 Bacteria 7810
1926 Ga0496126_0044980 3300048929 Bacteria 4060
1927 Ga0496126_0062445 3300048929 Bacteria 3342
1928 Ga0496126_0087897 3300048929 Bacteria 2739
1929 Ga0496126_0124603 3300048929 Bacteria 2231
1930 Ga0496126_0140367 3300048929 Bacteria 2080
1931 Ga0496126_0143815 3300048929 Bacteria 2050
1932 Ga0501031_0000003 3300049568 Bacteria 206821
1933 Ga0501031_0014923 3300049568 Bacteria 5048
1934 Ga0501031_0026627 3300049568 Bacteria 3769
1935 Ga0501031_0049572 3300049568 Bacteria 2737
1936 Ga0501032_0000010 3300049569 Bacteria 206795
1937 Ga0501032_0013029 3300049569 Bacteria 5921
1938 Ga0501032_0019622 3300049569 Bacteria 4725
1939 Ga0501032_0032102 3300049569 Bacteria 3599
1940 Ga0501032_0192574 3300049569 Bacteria 1332
1941 Ga0501033_0000017 3300049570 Bacteria 206819
1942 Ga0501033_0000728 3300049570 Bacteria 30172
1943 Ga0501033_0000786 3300049570 Bacteria 29077
1944 Ga0501033_0001121 3300049570 Bacteria 24283
1945 Ga0501033_0019053 3300049570 Bacteria 5188
1946 Ga0501033_0027013 3300049570 Bacteria 4317
1947 Ga0501033_0030633 3300049570 Bacteria 4042
1948 Ga0501033_0030913 3300049570 Bacteria 4024
1949 Ga0501033_0064999 3300049570 Bacteria 2684
1950 Ga0501033_0068368 3300049570 Bacteria 2612
1951 Ga0501033_0105532 3300049570 Bacteria 2053
1952 Ga0501033_0191018 3300049570 Bacteria 1465
1953 Ga0501034_0000053 3300049571 Bacteria 206821
1954 Ga0501034_0000181 3300049571 Bacteria 117767
1955 Ga0501034_0000319 3300049571 Bacteria 84488
1956 Ga0501034_0010204 3300049571 Bacteria 9797
1957 Ga0501034_0020409 3300049571 Bacteria 6764
1958 Ga0501034_0024771 3300049571 Bacteria 6104
1959 Ga0501034_0063364 3300049571 Bacteria 3711
1960 Ga0501034_0069127 3300049571 Bacteria 3542
1961 Ga0501034_0120155 3300049571 Bacteria 2614
1962 Ga0501034_0163359 3300049571 Bacteria 2197
1963 Ga0501034_0174995 3300049571 Bacteria 2112
1964 Ga0501034_0176349 3300049571 Bacteria 2103
1965 Ga0501034_0191480 3300049571 Bacteria 2007
1966 Ga0501034_0330843 3300049571 Bacteria 1455
1967 Ga0501036_0000009 3300049572 Bacteria 206821
1968 Ga0501036_0002326 3300049572 Bacteria 14864
1969 Ga0501036_0010368 3300049572 Bacteria 7694
1970 Ga0501036_0013644 3300049572 Bacteria 6755
1971 Ga0501036_0084254 3300049572 Bacteria 2687
1972 Ga0501036_0104976 3300049572 Bacteria 2389
1973 Ga0501036_0111655 3300049572 Bacteria 2310
1974 Ga0501036_0170996 3300049572 Bacteria 1831
1975 Ga0501037_0000008 3300049573 Bacteria 206812
1976 Ga0501037_0000283 3300049573 Bacteria 43184
1977 Ga0501037_0004511 3300049573 Bacteria 10116
1978 Ga0501037_0059770 3300049573 Bacteria 2780
1979 Ga0501037_0081009 3300049573 Bacteria 2354
1980 Ga0501037_0145281 3300049573 Bacteria 1696
1981 Ga0501038_0000008 3300049574 Bacteria 206821
1982 Ga0501038_0001231 3300049574 Bacteria 23218
1983 Ga0501038_0025475 3300049574 Bacteria 5272
1984 Ga0501038_0038493 3300049574 Bacteria 4187
1985 Ga0501038_0060876 3300049574 Bacteria 3230
1986 Ga0501038_0291350 3300049574 Bacteria 1283
1987 Ga0501039_0000021 3300049575 Bacteria 162552
1988 Ga0501039_0000114 3300049575 Bacteria 54651
1989 Ga0501039_0002026 3300049575 Bacteria 15009
1990 Ga0501039_0120355 3300049575 Bacteria 2057
1991 Ga0501039_0254506 3300049575 Bacteria 1380
1992 Ga0501040_0019792 3300049576 Bacteria 4478
1993 Ga0501040_0161247 3300049576 Bacteria 1585
1994 Ga0501041_0007622 3300049577 Bacteria 6358
1995 Ga0501041_0092650 3300049577 Bacteria 1866
1996 Ga0501042_0001978 3300049578 Bacteria 12351
1997 Ga0501042_0057203 3300049578 Bacteria 2783
1998 Ga0501042_0091631 3300049578 Bacteria 2182
1999 Ga0501043_0000005 3300049579 Bacteria 254466
2000 Ga0501043_0000188 3300049579 Bacteria 56057
2001 Ga0501043_0022002 3300049579 Bacteria 5001
2002 Ga0501043_0046251 3300049579 Bacteria 3422
2003 Ga0501043_0049983 3300049579 Bacteria 3287
2004 Ga0501043_0104753 3300049579 Bacteria 2223
2005 Ga0501043_0122510 3300049579 Bacteria 2039
2006 Ga0501046_0000153 3300049580 Bacteria 71187
2007 Ga0501046_0037382 3300049580 Bacteria 3901
2008 Ga0501046_0046943 3300049580 Bacteria 3426
2009 Ga0501046_0061186 3300049580 Bacteria 2945
2010 Ga0501046_0073776 3300049580 Bacteria 2648
2011 Ga0501047_0000126 3300049581 Bacteria 93841
2012 Ga0501047_0000230 3300049581 Bacteria 66338
2013 Ga0501047_0008403 3300049581 Bacteria 9742
2014 Ga0501047_0018437 3300049581 Bacteria 6691
2015 Ga0501047_0023014 3300049581 Bacteria 5981
2016 Ga0501047_0030095 3300049581 Bacteria 5234
2017 Ga0501047_0092948 3300049581 Bacteria 2895
2018 Ga0501047_0133302 3300049581 Bacteria 2364
2019 Ga0501047_0153783 3300049581 Bacteria 2175
2020 Ga0501047_0229943 3300049581 Bacteria 1708
2021 Ga0501047_0233360 3300049581 Bacteria 1692
2022 Ga0501047_0233998 3300049581 Bacteria 1689
2023 Ga0501047_0313669 3300049581 Bacteria 1408
2024 Ga0501048_0000095 3300049582 Bacteria 47963
2025 Ga0501048_0006765 3300049582 Bacteria 8709
2026 Ga0501048_0087494 3300049582 Bacteria 2198
2027 Ga0501048_0226168 3300049582 Bacteria 1327
2028 Ga0501067_0000405 3300049583 Bacteria 23546
2029 Ga0501067_0005631 3300049583 Bacteria 6957
2030 Ga0501067_0060123 3300049583 Bacteria 2103
2031 Ga0501068_0000680 3300049584 Bacteria 17413
2032 Ga0501068_0010671 3300049584 Bacteria 5166
2033 Ga0501068_0032264 3300049584 Bacteria 3114
2034 Ga0501068_0081580 3300049584 Bacteria 1985
2035 Ga0501069_0000033 3300049585 Bacteria 92477
2036 Ga0501069_0001561 3300049585 Bacteria 11323
2037 Ga0501069_0049669 3300049585 Bacteria 2331
2038 Ga0501070_0000020 3300049586 Bacteria 169025
2039 Ga0501070_0013663 3300049586 Bacteria 6839
2040 Ga0501070_0016211 3300049586 Bacteria 6261
2041 Ga0501070_0021019 3300049586 Bacteria 5475
2042 Ga0501070_0029379 3300049586 Bacteria 4610
2043 Ga0501070_0031721 3300049586 Bacteria 4427
2044 Ga0501070_0037850 3300049586 Bacteria 4026
2045 Ga0501070_0042578 3300049586 Bacteria 3782
2046 Ga0501070_0070256 3300049586 Bacteria 2899
2047 Ga0501070_0075732 3300049586 Bacteria 2786
2048 Ga0501070_0138492 3300049586 Bacteria 2009
2049 Ga0501070_0176193 3300049586 Bacteria 1760
2050 Ga0501070_0235295 3300049586 Bacteria 1500
2051 Ga0501071_0044573 3300049587 Bacteria 3182
2052 Ga0501071_0049419 3300049587 Bacteria 3028
2053 Ga0501072_0003713 3300049588 Bacteria 11511
2054 Ga0501072_0022932 3300049588 Bacteria 4846
2055 Ga0501072_0116150 3300049588 Bacteria 2131
2056 Ga0501072_0141864 3300049588 Bacteria 1916
2057 Ga0501073_0000055 3300049589 Bacteria 71726
2058 Ga0501073_0003886 3300049589 Bacteria 11219
2059 Ga0501073_0008019 3300049589 Bacteria 7841
2060 Ga0501073_0013876 3300049589 Bacteria 5857
2061 Ga0501073_0067202 3300049589 Bacteria 2499
2062 Ga0501073_0075216 3300049589 Bacteria 2351
2063 Ga0501073_0122646 3300049589 Bacteria 1801
2064 Ga0501074_0000053 3300049590 Bacteria 56031
2065 Ga0501074_0001461 3300049590 Bacteria 15852
2066 Ga0501074_0003342 3300049590 Bacteria 11362
2067 Ga0501074_0033588 3300049590 Bacteria 3718
2068 Ga0501074_0049249 3300049590 Bacteria 3042
2069 Ga0501074_0097038 3300049590 Bacteria 2110
2070 Ga0501074_0128903 3300049590 Bacteria 1810
2071 Ga0501074_0173315 3300049590 Bacteria 1539
2072 Ga0501075_0008410 3300049591 Bacteria 7199
2073 Ga0501075_0009660 3300049591 Bacteria 6756
2074 Ga0501076_0077591 3300049592 Bacteria 2665
2075 Ga0501076_0177434 3300049592 Bacteria 1736
2076 Ga0501077_0047443 3300049593 Bacteria 2729
2077 Ga0501077_0077180 3300049593 Bacteria 2110
2078 Ga0501252_001748 3300049682 Bacteria 2066
2079 Ga0501079_0004890 3300049741 Bacteria 9933
2080 Ga0501080_0001837 3300049742 Bacteria 18212
2081 Ga0501080_0001932 3300049742 Bacteria 17895
2082 Ga0501080_0004187 3300049742 Bacteria 12790
2083 Ga0501080_0004864 3300049742 Bacteria 11974
2084 Ga0501080_0006910 3300049742 Bacteria 10235
2085 Ga0501080_0068496 3300049742 Bacteria 3301
2086 Ga0501080_0141604 3300049742 Bacteria 2223
2087 Ga0501081_0013982 3300049743 Bacteria 5285
2088 Ga0501081_0055061 3300049743 Bacteria 2748
2089 Ga0501083_0000063 3300049744 Bacteria 74976
2090 Ga0501083_0000382 3300049744 Bacteria 28074
2091 Ga0501083_0022911 3300049744 Bacteria 4333
2092 Ga0501083_0028114 3300049744 Bacteria 3878
2093 Ga0501083_0058548 3300049744 Bacteria 2578
2094 Ga0501083_0104989 3300049744 Bacteria 1861
2095 Ga0501083_0130790 3300049744 Bacteria 1645
2096 Ga0501083_0136102 3300049744 Bacteria 1610
2097 Ga0501035_0000023 3300049822 Bacteria 206821
2098 Ga0501035_0000086 3300049822 Bacteria 115822
2099 Ga0501035_0000249 3300049822 Bacteria 64886
2100 Ga0501035_0000288 3300049822 Bacteria 59750
2101 Ga0501035_0000322 3300049822 Bacteria 55416
2102 Ga0501035_0000355 3300049822 Bacteria 52714
2103 Ga0501035_0000378 3300049822 Bacteria 51250
2104 Ga0501035_0000904 3300049822 Bacteria 31387
2105 Ga0501035_0021127 3300049822 Bacteria 5983
2106 Ga0501035_0036945 3300049822 Bacteria 4425
2107 Ga0501035_0038430 3300049822 Bacteria 4333
2108 Ga0501035_0092934 3300049822 Bacteria 2654
2109 Ga0501035_0107877 3300049822 Bacteria 2441
2110 Ga0501035_0159842 3300049822 Bacteria 1951
2111 Ga0501035_0167564 3300049822 Bacteria 1899
2112 Ga0501035_0182013 3300049822 Bacteria 1810
2113 Ga0501035_0222375 3300049822 Bacteria 1611
2114 Ga0501044_0000021 3300049823 Bacteria 206821
2115 Ga0501044_0000223 3300049823 Bacteria 71752
2116 Ga0501044_0000243 3300049823 Bacteria 68966
2117 Ga0501044_0000716 3300049823 Bacteria 40010
2118 Ga0501044_0004132 3300049823 Bacteria 16298
2119 Ga0501044_0008148 3300049823 Bacteria 11498
2120 Ga0501044_0012601 3300049823 Bacteria 9157
2121 Ga0501044_0013317 3300049823 Bacteria 8901
2122 Ga0501044_0027229 3300049823 Bacteria 6043
2123 Ga0501044_0028969 3300049823 Bacteria 5841
2124 Ga0501044_0049727 3300049823 Bacteria 4327
2125 Ga0501044_0051532 3300049823 Bacteria 4243
2126 Ga0501044_0053488 3300049823 Bacteria 4154
2127 Ga0501044_0079730 3300049823 Bacteria 3317
2128 Ga0501044_0095035 3300049823 Bacteria 3004
2129 Ga0501044_0106534 3300049823 Bacteria 2815
2130 Ga0501044_0108417 3300049823 Bacteria 2787
2131 Ga0501044_0154762 3300049823 Bacteria 2272
2132 Ga0501044_0181778 3300049823 Bacteria 2069
2133 Ga0501044_0198534 3300049823 Bacteria 1965
2134 Ga0501044_0221564 3300049823 Bacteria 1842
2135 Ga0501044_0263614 3300049823 Bacteria 1661
2136 Ga0501044_0266912 3300049823 Bacteria 1648
2137 Ga0501045_0044524 3300049824 Bacteria 3233
2138 Ga0501045_0093767 3300049824 Bacteria 2220
2139 Ga0501045_0266776 3300049824 Bacteria 1275
2140 nmdc:mga03683_18374_c1 3300050489 Bacteria 2658
2141 nmdc:mga03n38_25513_c1 3300050490 Bacteria 2429
2142 nmdc:mga03n38_39057_c1 3300050490 Bacteria 2057
2143 nmdc:mga00v17_174864_c1 3300050491 Bacteria 1385
2144 nmdc:mga00v17_2361_c1 3300050491 Bacteria 9666
2145 nmdc:mga00v17_3310_c1 3300050491 Bacteria 8306
2146 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
2147 nmdc:mga00v17_5905_c1 3300050491 Bacteria 6469
2148 nmdc:mga00v17_62085_c1 3300050491 Bacteria 2298
2149 nmdc:mga00v17_8141_c1 3300050491 Bacteria 2891
2150 nmdc:mga0yw44_128363_c1 3300050492 Bacteria 1639
2151 nmdc:mga0yw44_1426_c1 3300050492 Bacteria 5694
2152 nmdc:mga0yw44_173046_c1 3300050492 Bacteria 1418
2153 nmdc:mga0yw44_2404_c1 3300050492 Bacteria 7966
2154 nmdc:mga0yw44_57170_c1 3300050492 Bacteria 2379
2155 nmdc:mga0k408_104967_c1 3300050493 Bacteria 1668
2156 nmdc:mga0k408_105667_c1 3300050493 Bacteria 1663
2157 nmdc:mga0k408_17523_c1 3300050493 Bacteria 3992
2158 nmdc:mga0k408_36021_c1 3300050493 Bacteria 2839
2159 nmdc:mga0k408_40577_c1 3300050493 Bacteria 2679
2160 nmdc:mga06z11_29084_c1 3300050494 Bacteria 2658
2161 nmdc:mga06z11_30956_c1 3300050494 Bacteria 2595
2162 nmdc:mga06z11_47930_c1 3300050494 Bacteria 2172
2163 nmdc:mga04h51_66410_c1 3300050495 Bacteria 1249
2164 nmdc:mga07m45_155494_c1 3300050496 Bacteria 1327
2165 nmdc:mga07m45_18360_c1 3300050496 Bacteria 3774
2166 nmdc:mga07m45_5300_c1 3300050496 Bacteria 6413
2167 nmdc:mga05p37_12665_c1 3300050507 Bacteria 10076
2168 nmdc:mga05p37_136_c1 3300050507 Bacteria 68034
2169 nmdc:mga05p37_225125_c1 3300050507 Bacteria 2262
2170 nmdc:mga05p37_353858_c1 3300050507 Bacteria 1728
2171 nmdc:mga05p37_49728_c1 3300050507 Bacteria 5157
2172 nmdc:mga05p37_59_c1 3300050507 Bacteria 95449
2173 nmdc:mga09592_3214_c1 3300050508 Bacteria 13228
2174 nmdc:mga0qj67_152_c1 3300050509 Bacteria 46576
2175 nmdc:mga0qj67_154652_c1 3300050509 Bacteria 1861
2176 nmdc:mga0qj67_34697_c1 3300050509 Bacteria 3942
2177 nmdc:mga0qj67_65877_c1 3300050509 Bacteria 2884
2178 nmdc:mga06r32_113396_c1 3300050510 Bacteria 2668
2179 nmdc:mga06r32_11540_c1 3300050510 Bacteria 7960
2180 nmdc:mga06r32_150_c1 3300050510 Bacteria 52922
2181 nmdc:mga06r32_278363_c1 3300050510 Bacteria 1660
2182 nmdc:mga06r32_94259_c1 3300050510 Bacteria 2929
2183 nmdc:mga08y16_109557_c1 3300050511 Bacteria 2875
2184 nmdc:mga08y16_2132_c1 3300050511 Bacteria 20280
2185 nmdc:mga08y16_23217_c1 3300050511 Bacteria 6548
2186 nmdc:mga08y16_23507_c1 3300050511 Bacteria 6512
2187 nmdc:mga08y16_2542_c1 3300050511 Bacteria 18766
2188 nmdc:mga08y16_314870_c1 3300050511 Bacteria 1611
2189 nmdc:mga08y16_40735_c1 3300050511 Bacteria 4868
2190 nmdc:mga08y16_95_c1 3300050511 Bacteria 74728
2191 nmdc:mga0n895_242569_c1 3300050512 Bacteria 1829
2192 nmdc:mga0n895_257162_c1 3300050512 Bacteria 1772
2193 nmdc:mga0n895_52715_c1 3300050512 Bacteria 3994
2194 nmdc:mga0n895_56_c1 3300050512 Bacteria 65877
2195 nmdc:mga0n895_78057_c1 3300050512 Bacteria 3295
2196 nmdc:mga0rr50_4773_c1 3300050513 Bacteria 7996
2197 nmdc:mga0rr50_6267_c1 3300050513 Bacteria 7219
2198 nmdc:mga0rr50_8695_c1 3300050513 Bacteria 6330
2199 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
2200 nmdc:mga0a205_107336_c1 3300050515 Bacteria 2690
2201 nmdc:mga0a205_19578_c1 3300050515 Bacteria 3906
2202 nmdc:mga0a205_23_c1 3300050515 Bacteria 88424
2203 nmdc:mga0a205_5754_c1 3300050515 Bacteria 11170
2204 nmdc:mga0sz30_28471_c1 3300050516 Bacteria 2300
2205 nmdc:mga0sz30_3130_c1 3300050516 Bacteria 5926
2206 Ga0495601_0000008 3300053077 Bacteria 362152
2207 Ga0495601_0001913 3300053077 Bacteria 11643
2208 Ga0495601_0003115 3300053077 Bacteria 9472
2209 Ga0495601_0003149 3300053077 Bacteria 9446
2210 Ga0495601_0004336 3300053077 Bacteria 8195
2211 Ga0495601_0007948 3300053077 Bacteria 6246
2212 Ga0495601_0009007 3300053077 Bacteria 5892
2213 Ga0495601_0010285 3300053077 Bacteria 5564
2214 Ga0495601_0018529 3300053077 Bacteria 4238
2215 Ga0495601_0037272 3300053077 Bacteria 3039
2216 Ga0495601_0039918 3300053077 Bacteria 2939
2217 Ga0495612_0000002 3300053078 Bacteria 310466
2218 Ga0495612_0000320 3300053078 Bacteria 19454
2219 Ga0495612_0000877 3300053078 Bacteria 12277
2220 Ga0495612_0002422 3300053078 Bacteria 7689
2221 Ga0495612_0007872 3300053078 Bacteria 4344
2222 Ga0500635_0003511 3300053080 Bacteria 3956
2223 Ga0495595_0000024 3300053084 Bacteria 108008
2224 Ga0495595_0001647 3300053084 Bacteria 8745
2225 Ga0495595_0002414 3300053084 Bacteria 7297
2226 Ga0495595_0008723 3300053084 Bacteria 4172
2227 Ga0495595_0011340 3300053084 Bacteria 3723
2228 Ga0495595_0033176 3300053084 Bacteria 2328
2229 Ga0495595_0044587 3300053084 Bacteria 2038
2230 Ga0495595_0073548 3300053084 Bacteria 1618
2231 Ga0495595_0073961 3300053084 Bacteria 1614
2232 Ga0495619_0000002 3300053085 Bacteria 530226
2233 Ga0495619_0000056 3300053085 Bacteria 95385
2234 Ga0495619_0000470 3300053085 Bacteria 27189
2235 Ga0495619_0000742 3300053085 Bacteria 21214
2236 Ga0495619_0002178 3300053085 Bacteria 12985
2237 Ga0495619_0004772 3300053085 Bacteria 8619
2238 Ga0495619_0019066 3300053085 Bacteria 4358
2239 Ga0495619_0024669 3300053085 Bacteria 3858
2240 Ga0495619_0067409 3300053085 Bacteria 2389
2241 Ga0495619_0099967 3300053085 Bacteria 1973
2242 Ga0495619_0135165 3300053085 Bacteria 1696
2243 Ga0500643_000231 3300053087 Bacteria 51641
2244 Ga0500643_013670 3300053087 Bacteria 2857
2245 Ga0500643_023977 3300053087 Bacteria 1943
2246 Ga0500643_044155 3300053087 Bacteria 1297
2247 Ga0500644_0001358 3300053088 Bacteria 6549
2248 Ga0500647_0012163 3300053091 Bacteria 3867
2249 Ga0500651_0059763 3300053093 Bacteria 2383
2250 Ga0500566_0004285 3300053094 Bacteria 8516
2251 Ga0500566_0006859 3300053094 Bacteria 6744
2252 Ga0500566_0011700 3300053094 Bacteria 5168
2253 Ga0500566_0019769 3300053094 Bacteria 3955
2254 Ga0500566_0035176 3300053094 Bacteria 2911
2255 Ga0500641_0016988 3300053096 Bacteria 2714
2256 Ga0500641_0037147 3300053096 Bacteria 1951
2257 Ga0500650_0011622 3300053098 Bacteria 3633
2258 Ga0500556_0000005 3300053104 Bacteria 581135
2259 Ga0500557_000028 3300053105 Bacteria 78414
2260 Ga0500572_002185 3300053111 Bacteria 4804
2261 Ga0500572_013686 3300053111 Bacteria 2013
2262 Ga0500592_001845 3300053116 Bacteria 3415
2263 Ga0500595_000001 3300053119 Bacteria 1088438
2264 Ga0500595_011941 3300053119 Bacteria 3377
2265 Ga0500595_025904 3300053119 Bacteria 2026
2266 Ga0500608_052135 3300053122 Bacteria 1965
2267 Ga0500608_053078 3300053122 Bacteria 1946
2268 Ga0500608_070805 3300053122 Bacteria 1658
2269 Ga0500618_000090 3300053125 Bacteria 74320
2270 Ga0500618_012538 3300053125 Bacteria 2216
2271 Ga0500642_0000009 3300053130 Bacteria 286829
2272 Ga0500642_0000563 3300053130 Bacteria 11247
2273 Ga0500652_000017 3300053131 Bacteria 121760
2274 Ga0500652_001538 3300053131 Bacteria 7060
2275 Ga0500658_0025087 3300053134 Bacteria 2290
2276 Ga0500559_0000379 3300053136 Bacteria 32520
2277 Ga0500559_0000393 3300053136 Bacteria 31876
2278 Ga0500559_0050186 3300053136 Bacteria 1840
2279 Ga0500559_0109362 3300053136 Bacteria 1279
2280 Ga0500568_0008801 3300053139 Bacteria 4840
2281 Ga0500568_0021528 3300053139 Bacteria 2772
2282 Ga0500577_0061698 3300053142 Bacteria 1443
2283 Ga0500586_003049 3300053145 Bacteria 3898
2284 Ga0500603_009476 3300053150 Bacteria 2181
2285 Ga0500616_0000001 3300053153 Bacteria 1986011
2286 Ga0500616_0000118 3300053153 Bacteria 143496
2287 Ga0500616_0003533 3300053153 Bacteria 11863
2288 Ga0500616_0019821 3300053153 Bacteria 3788
2289 Ga0500616_0034095 3300053153 Bacteria 2775
2290 Ga0500616_0058076 3300053153 Bacteria 2014
2291 Ga0500620_000869 3300053155 Bacteria 5248
2292 Ga0500622_0002229 3300053156 Bacteria 14273
2293 Ga0500622_0005852 3300053156 Bacteria 7276
2294 Ga0500622_0006604 3300053156 Bacteria 6690
2295 Ga0500622_0033374 3300053156 Bacteria 2698
2296 Ga0500627_0064488 3300053158 Bacteria 1616
2297 Ga0500630_039573 3300053159 Bacteria 2302
2298 Ga0500634_0007081 3300053161 Bacteria 5495
2299 Ga0500639_022926 3300053163 Bacteria 3297
2300 Ga0500639_035678 3300053163 Bacteria 2623
2301 Ga0500639_077139 3300053163 Bacteria 1685
2302 Ga0500636_0000006 3300053177 Bacteria 183899
2303 Ga0500636_0000301 3300053177 Bacteria 27451
2304 Ga0500636_0000458 3300053177 Bacteria 22291
2305 Ga0500636_0018433 3300053177 Bacteria 4128
2306 Ga0500636_0035620 3300053177 Bacteria 2945
2307 Ga0500636_0125071 3300053177 Bacteria 1438
2308 Ga0500637_0000301 3300053178 Bacteria 18689
2309 Ga0500637_0001692 3300053178 Bacteria 9492
2310 Ga0500637_0031848 3300053178 Bacteria 2938
2311 Ga0500625_014652 3300053729 Bacteria 3626
2312 Ga0500645_000050 3300053730 Bacteria 99596
2313 Ga0500645_034782 3300053730 Bacteria 1504
2314 Ga0500609_003725 3300053731 Bacteria 2126
2315 Ga0500596_002166 3300053735 Bacteria 3897
2316 Ga0500596_005585 3300053735 Bacteria 2196
2317 Ga0500601_000309 3300053737 Bacteria 9149
2318 Ga0501084_0001342 3300054114 Bacteria 19438
2319 Ga0501084_0026481 3300054114 Bacteria 4839
2320 Ga0501084_0072810 3300054114 Bacteria 2878
2321 Ga0501084_0100881 3300054114 Bacteria 2424
2322 Ga0501084_0128238 3300054114 Bacteria 2135
2323 Ga0587090_000144 3300059510 Bacteria 4722
2324 Ga0501082_0001472 3300060353 Bacteria 20720
2325 Ga0501082_0003623 3300060353 Bacteria 13491
2326 Ga0501082_0016131 3300060353 Bacteria 6426
2327 Ga0501082_0018376 3300060353 Bacteria 6020
2328 Ga0501082_0038855 3300060353 Bacteria 4105
2329 Ga0501082_0042935 3300060353 Bacteria 3897
2330 Ga0501082_0068505 3300060353 Bacteria 3055
2331 Ga0501082_0131500 3300060353 Bacteria 2172
2332 Ga0501082_0298930 3300060353 Bacteria 1402
2333 Ga0501082_0336906 3300060353 Bacteria 1314
2334 Ga0466962_0071109 3300061719 Bacteria 1662

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019530166 8019531666 364
2 2162886007 SwRhRL2b_contig_3176492 SwRhRL2b_0921.00005850 367
3 3300048925 Ga0496122_0007327 Ga0496122_0007327_4072_5175 367
4 3300048926 Ga0496123_0000332 Ga0496123_0000332_52960_54063 367
5 3300025893 Ga0207682_10008196 Ga0207682_100081962 372
6 3300009766 Ga0123342_1019759 Ga0123342_10197592 373
7 3300046681 Ga0495647_0066842 Ga0495647_0066842_15_1148 376
8 3300047315 Ga0495581_0130944 Ga0495581_0130944_277_1410 376
9 3300037471 Ga0395905_0000479 Ga0395905_0000479_21_1163 379
10 iso_pu_bacteria 8019629233 8019631155 382
11 3300049823 Ga0501044_0221564 Ga0501044_0221564_221_1375 383
12 iso_pu_bacteria 2977907340 2977912716 388
13 iso_pu_bacteria 8019538911 8019539873 388
14 3300005455 Ga0070663_100075868 Ga0070663_1000758682 393
15 3300026067 Ga0207678_10068114 Ga0207678_100681142 393
16 iso_pu_bacteria 2551306089 2551709020 393
17 iso_pu_bacteria 2551306089 2551712762 393
18 3300048907 Ga0496104_0010668 Ga0496104_0010668_2671_3858 394
19 3300053119 Ga0500595_011941 Ga0500595_011941_156_1364 396
20 iso_pu_bacteria 2671180195 2671838876 396
21 iso_pu_bacteria 2773857922 2774857032 396
22 iso_pu_bacteria 2503198000 2503204711 397
23 iso_pu_bacteria 2507262055 2507505742 397
24 iso_pu_bacteria 2508501009 2508539938 397
25 iso_pu_bacteria 2508501042 2508696003 397
26 iso_pu_bacteria 2508501050 2508728850 397
27 iso_pu_bacteria 2508501114 2509075723 397
28 iso_pu_bacteria 2508501122 2509111702 397
29 iso_pu_bacteria 2508501123 2509113555 397
30 iso_pu_bacteria 2508501127 2509145068 397
31 iso_pu_bacteria 2508501128 2509150778 397
32 iso_pu_bacteria 2509276018 2509370238 397
33 iso_pu_bacteria 2509276019 2509375164 397
34 iso_pu_bacteria 2509276021 2509388606 397
35 iso_pu_bacteria 2509276022 2509398971 397
36 iso_pu_bacteria 2509276033 2509444161 397
37 iso_pu_bacteria 2510065019 2510131246 397
38 iso_pu_bacteria 2510065057 2510303484 397
39 iso_pu_bacteria 2510065059 2510314309 397
40 iso_pu_bacteria 2510461069 2510841749 397
41 iso_pu_bacteria 2510461076 2510897583 397
42 iso_pu_bacteria 2510917022 2511134764 397
43 iso_pu_bacteria 2510917026 2511175032 397
44 iso_pu_bacteria 2510917028 2511184647 397
45 iso_pu_bacteria 2510917030 2511197699 397
46 iso_pu_bacteria 2511231027 2511389251 397
47 iso_pu_bacteria 2511231028 2511398862 397
48 iso_pu_bacteria 2511231052 2511500283 397
49 iso_pu_bacteria 2512047086 2512531816 397
50 iso_pu_bacteria 2512875016 2512934554 397
51 iso_pu_bacteria 2512875024 2512962900 397
52 iso_pu_bacteria 2512875026 2512972925 397
53 iso_pu_bacteria 2513237084 2513570450 397
54 iso_pu_bacteria 2513237085 2513574545 397
55 iso_pu_bacteria 2513237086 2513582305 397
56 iso_pu_bacteria 2513237088 2513597244 397
57 iso_pu_bacteria 2513237089 2513602739 397
58 iso_pu_bacteria 2513237090 2513613525 397
59 iso_pu_bacteria 2513237091 2513616580 397
60 iso_pu_bacteria 2513237092 2513625638 397
61 iso_pu_bacteria 2513237093 2513636579 397
62 iso_pu_bacteria 2513237094 2513641765 397
63 iso_pu_bacteria 2513237095 2513648160 397
64 iso_pu_bacteria 2513237096 2513657424 397
65 iso_pu_bacteria 2513237098 2513678363 397
66 iso_pu_bacteria 2513237101 2513694407 397
67 iso_pu_bacteria 2513237102 2513703244 397
68 iso_pu_bacteria 2513237103 2513707146 397
69 iso_pu_bacteria 2513237104 2513715547 397
70 iso_pu_bacteria 2513237137 2513857146 397
71 iso_pu_bacteria 2513237138 2513864999 397
72 iso_pu_bacteria 2513237139 2513874050 397
73 iso_pu_bacteria 2513237140 2513885800 397
74 iso_pu_bacteria 2513237141 2513889724 397
75 iso_pu_bacteria 2513237143 2513903918 397
76 iso_pu_bacteria 2513237144 2513914183 397
77 iso_pu_bacteria 2513237145 2513916677 397
78 iso_pu_bacteria 2513237146 2513929352 397
79 iso_pu_bacteria 2513237156 2513985755 397
80 iso_pu_bacteria 2513237159 2513996589 397
81 iso_pu_bacteria 2513237160 2514005003 397
82 iso_pu_bacteria 2513237161 2514010179 397
83 iso_pu_bacteria 2513237162 2514020425 397
84 iso_pu_bacteria 2513237164 2514037427 397
85 iso_pu_bacteria 2513237305 2514416958 397
86 iso_pu_bacteria 2513237351 2514592839 397
87 iso_pu_bacteria 2515075009 2515110180 397
88 iso_pu_bacteria 2515154107 2515607557 397
89 iso_pu_bacteria 2515154112 2515627733 397
90 iso_pu_bacteria 2515154113 2515637467 397
91 iso_pu_bacteria 2515154114 2515643623 397
92 iso_pu_bacteria 2515154116 2515657017 397
93 iso_pu_bacteria 2515154134 2515740744 397
94 iso_pu_bacteria 2516143018 2516204498 397
95 iso_pu_bacteria 2516653046 2516891684 397
96 iso_pu_bacteria 2516653077 2517038873 397
97 iso_pu_bacteria 2516653085 2517079120 397
98 iso_pu_bacteria 2517093000 2517093059 397
99 iso_pu_bacteria 2517093001 2517107018 397
100 iso_pu_bacteria 2517287029 2517409337 397
101 iso_pu_bacteria 2517487022 2517568459 397
102 iso_pu_bacteria 2517572143 2517888089 397
103 iso_pu_bacteria 2519899620 2520378988 397
104 iso_pu_bacteria 2524023205 2524435591 397
105 iso_pu_bacteria 2524023207 2524450710 397
106 iso_pu_bacteria 2524023209 2524458252 397
107 iso_pu_bacteria 2524023210 2524467865 397
108 iso_pu_bacteria 2524023228 2524533239 397
109 iso_pu_bacteria 2528768022 2528854739 397
110 iso_pu_bacteria 2529292951 2530647985 397
111 iso_pu_bacteria 2534681786 2535486743 397
112 iso_pu_bacteria 2534681796 2535514943 397
113 iso_pu_bacteria 2537561587 2537876020 397
114 iso_pu_bacteria 2545555834 2545672721 397
115 iso_pu_bacteria 2551306084 2551674461 397
116 iso_pu_bacteria 2551306085 2551686491 397
117 iso_pu_bacteria 2551306087 2551700483 397
118 iso_pu_bacteria 2551306090 2551716531 397
119 iso_pu_bacteria 2551306090 2551720277 397
120 iso_pu_bacteria 2551306092 2551736169 397
121 iso_pu_bacteria 2551306093 2551746325 397
122 iso_pu_bacteria 2554235003 2554246533 397
123 iso_pu_bacteria 2558860100 2558866266 397
124 iso_pu_bacteria 2558860242 2559293708 397
125 iso_pu_bacteria 2558860983 2561466781 397
126 iso_pu_bacteria 2582581283 2585164739 397
127 iso_pu_bacteria 2582581294 2585203519 397
128 iso_pu_bacteria 2582581298 2585223624 397
129 iso_pu_bacteria 2582581299 2585229694 397
130 iso_pu_bacteria 2582581304 2585256048 397
131 iso_pu_bacteria 2582581306 2585265114 397
132 iso_pu_bacteria 2582581307 2585273831 397
133 iso_pu_bacteria 2582581308 2585280132 397
134 iso_pu_bacteria 2582581315 2585326089 397
135 iso_pu_bacteria 2582581316 2585330254 397
136 iso_pu_bacteria 2582581865 2585385755 397
137 iso_pu_bacteria 2582581866 2585392095 397
138 iso_pu_bacteria 2582581867 2585398720 397
139 iso_pu_bacteria 2585427526 2585523545 397
140 iso_pu_bacteria 2585427527 2585533617 397
141 iso_pu_bacteria 2585427528 2585542040 397
142 iso_pu_bacteria 2585427529 2585545780 397
143 iso_pu_bacteria 2585427530 2585553207 397
144 iso_pu_bacteria 2585427531 2585560007 397
145 iso_pu_bacteria 2585427590 2585819158 397
146 iso_pu_bacteria 2585427593 2585840312 397
147 iso_pu_bacteria 2585427594 2585844070 397
148 iso_pu_bacteria 2585427608 2585900682 397
149 iso_pu_bacteria 2585427609 2585905813 397
150 iso_pu_bacteria 2585427633 2585992927 397
151 iso_pu_bacteria 2585427634 2586003646 397
152 iso_pu_bacteria 2585428125 2587979071 397
153 iso_pu_bacteria 2588253730 2588514161 397
154 iso_pu_bacteria 2595698237 2596372227 397
155 iso_pu_bacteria 2597489875 2597816556 397
156 iso_pu_bacteria 2599185156 2599332860 397
157 iso_pu_bacteria 2599185170 2599419345 397
158 iso_pu_bacteria 2599185210 2599606512 397
159 iso_pu_bacteria 2599185236 2599719668 397
160 iso_pu_bacteria 2599185301 2599935841 397
161 iso_pu_bacteria 2599185352 2600191231 397
162 iso_pu_bacteria 2600254933 2600376483 397
163 iso_pu_bacteria 2600255279 2601609267 397
164 iso_pu_bacteria 2600255308 2601746042 397
165 iso_pu_bacteria 2602042107 2603858074 397
166 iso_pu_bacteria 2615840624 2616293597 397
167 iso_pu_bacteria 2615840626 2616310321 397
168 iso_pu_bacteria 2615840698 2616553300 397
169 iso_pu_bacteria 2617270735 2617350179 397
170 iso_pu_bacteria 2617270741 2617374263 397
171 iso_pu_bacteria 2617270742 2617380368 397
172 iso_pu_bacteria 2643221547 2643758521 397
173 iso_pu_bacteria 2643221550 2643773356 397
174 iso_pu_bacteria 2643221551 2643777909 397
175 iso_pu_bacteria 2643221555 2643796357 397
176 iso_pu_bacteria 2643221557 2643806119 397
177 iso_pu_bacteria 2643221558 2643812779 397
178 iso_pu_bacteria 2643221564 2643839509 397
179 iso_pu_bacteria 2643221568 2643857265 397
180 iso_pu_bacteria 2643221582 2643918302 397
181 iso_pu_bacteria 2643221595 2643984923 397
182 iso_pu_bacteria 2643221599 2644004765 397
183 iso_pu_bacteria 2643221607 2644047393 397
184 iso_pu_bacteria 2643221610 2644070327 397
185 iso_pu_bacteria 2643221618 2644103463 397
186 iso_pu_bacteria 2643221623 2644130024 397
187 iso_pu_bacteria 2643221626 2644144342 397
188 iso_pu_bacteria 2643221627 2644155536 397
189 iso_pu_bacteria 2643221636 2644199811 397
190 iso_pu_bacteria 2643221637 2644206937 397
191 iso_pu_bacteria 2643221643 2644237321 397
192 iso_pu_bacteria 2643221651 2644290022 397
193 iso_pu_bacteria 2643221653 2644297782 397
194 iso_pu_bacteria 2643221655 2644306393 397
195 iso_pu_bacteria 2643221659 2644330583 397
196 iso_pu_bacteria 2643221668 2644377381 397
197 iso_pu_bacteria 2643221675 2644421089 397
198 iso_pu_bacteria 2643221680 2644454612 397
199 iso_pu_bacteria 2643221683 2644464266 397
200 iso_pu_bacteria 2643221686 2644480182 397
201 iso_pu_bacteria 2643221688 2644492702 397
202 iso_pu_bacteria 2643221689 2644496979 397
203 iso_pu_bacteria 2643221693 2644519325 397
204 iso_pu_bacteria 2643221698 2644542613 397
205 iso_pu_bacteria 2643221712 2644612004 397
206 iso_pu_bacteria 2643221718 2644650585 397
207 iso_pu_bacteria 2643221719 2644656035 397
208 iso_pu_bacteria 2643221723 2644671806 397
209 iso_pu_bacteria 2643221726 2644692551 397
210 iso_pu_bacteria 2643221733 2644728033 397
211 iso_pu_bacteria 2643221734 2644733828 397
212 iso_pu_bacteria 2643221736 2644742314 397
213 iso_pu_bacteria 2657244999 2657683042 397
214 iso_pu_bacteria 2667528174 2671113770 397
215 iso_pu_bacteria 2667528175 2671119443 397
216 iso_pu_bacteria 2687453392 2688601339 397
217 iso_pu_bacteria 2690316117 2692317455 397
218 iso_pu_bacteria 2693429783 2694630430 397
219 iso_pu_bacteria 2693429784 2694637785 397
220 iso_pu_bacteria 2718217882 2719179384 397
221 iso_pu_bacteria 2718217927 2719383954 397
222 iso_pu_bacteria 2718217997 2719663744 397
223 iso_pu_bacteria 2718218009 2719730054 397
224 iso_pu_bacteria 2718218199 2720490163 397
225 iso_pu_bacteria 2718218232 2720611544 397
226 iso_pu_bacteria 2718218233 2720618393 397
227 iso_pu_bacteria 2718218235 2720629801 397
228 iso_pu_bacteria 2718218269 2720773496 397
229 iso_pu_bacteria 2718218363 2721145477 397
230 iso_pu_bacteria 2718218365 2721157011 397
231 iso_pu_bacteria 2718218366 2721162372 397
232 iso_pu_bacteria 2718218423 2721397724 397
233 iso_pu_bacteria 2721755514 2722838542 397
234 iso_pu_bacteria 2721755556 2723025168 397
235 iso_pu_bacteria 2721755684 2723558753 397
236 iso_pu_bacteria 2721755685 2723565322 397
237 iso_pu_bacteria 2721755686 2723578505 397
238 iso_pu_bacteria 2721755755 2723842143 397
239 iso_pu_bacteria 2721755809 2724036534 397
240 iso_pu_bacteria 2721755810 2724042810 397
241 iso_pu_bacteria 2721755819 2724088103 397
242 iso_pu_bacteria 2721755822 2724102587 397
243 iso_pu_bacteria 2721755823 2724108483 397
244 iso_pu_bacteria 2724679232 2725950967 397
245 iso_pu_bacteria 2728368998 2728753748 397
246 iso_pu_bacteria 2728369352 2730106104 397
247 iso_pu_bacteria 2728369365 2730162621 397
248 iso_pu_bacteria 2728369397 2730296643 397
249 iso_pu_bacteria 2738541281 2738746049 397
250 iso_pu_bacteria 2738541293 2738801376 397
251 iso_pu_bacteria 2738541317 2738947762 397
252 iso_pu_bacteria 2738541333 2739036724 397
253 iso_pu_bacteria 2738543024 2739310013 397
254 iso_pu_bacteria 2738543032 2739355279 397
255 iso_pu_bacteria 2744054633 2745079846 397
256 iso_pu_bacteria 2751185800 2753357976 397
257 iso_pu_bacteria 2751185821 2753462616 397
258 iso_pu_bacteria 2756170246 2756674652 397
259 iso_pu_bacteria 2757320392 2757572445 397
260 iso_pu_bacteria 2758568016 2758638782 397
261 iso_pu_bacteria 2765235802 2765464120 397
262 iso_pu_bacteria 2765235942 2766062736 397
263 iso_pu_bacteria 2767802442 2770196679 397
264 iso_pu_bacteria 2775506901 2776262024 397
265 iso_pu_bacteria 2775506902 2776272709 397
266 iso_pu_bacteria 2775506904 2776284652 397
267 iso_pu_bacteria 2775507049 2776911937 397
268 iso_pu_bacteria 2775507266 2778179608 397
269 iso_pu_bacteria 2791355082 2792583081 397
270 iso_pu_bacteria 2791355091 2792621249 397
271 iso_pu_bacteria 2791355092 2792625464 397
272 iso_pu_bacteria 2791355094 2792637898 397
273 iso_pu_bacteria 2791355123 2792746475 397
274 iso_pu_bacteria 2791355196 2793059172 397
275 iso_pu_bacteria 2791355197 2793073362 397
276 iso_pu_bacteria 2791355199 2793079758 397
277 iso_pu_bacteria 2791355253 2793282182 397
278 iso_pu_bacteria 2791355256 2793295375 397
279 iso_pu_bacteria 2791355259 2793317971 397
280 iso_pu_bacteria 2791355260 2793325110 397
281 iso_pu_bacteria 2791355261 2793326316 397
282 iso_pu_bacteria 2791355262 2793334403 397
283 iso_pu_bacteria 2791355263 2793344696 397
284 iso_pu_bacteria 2791355264 2793348315 397
285 iso_pu_bacteria 2791355265 2793355636 397
286 iso_pu_bacteria 2791355266 2793361687 397
287 iso_pu_bacteria 2791355267 2793365714 397
288 iso_pu_bacteria 2802428858 2802718494 397
289 iso_pu_bacteria 2802428859 2802726317 397
290 iso_pu_bacteria 2802428860 2802734819 397
291 iso_pu_bacteria 2802428861 2802740841 397
292 iso_pu_bacteria 2802428862 2802742423 397
293 iso_pu_bacteria 2802428863 2802749129 397
294 iso_pu_bacteria 2802429268 2804750759 397
295 iso_pu_bacteria 2802429603 2805920407 397
296 iso_pu_bacteria 2802429605 2805929221 397
297 iso_pu_bacteria 2802429606 2805932522 397
298 iso_pu_bacteria 2802429633 2806048424 397
299 iso_pu_bacteria 2802429634 2806055905 397
300 iso_pu_bacteria 2802429635 2806062767 397
301 iso_pu_bacteria 2802429636 2806066425 397
302 iso_pu_bacteria 2802429637 2806073480 397
303 iso_pu_bacteria 2808606387 2808986462 397
304 iso_pu_bacteria 2816332527 2818237124 397
305 iso_pu_bacteria 2818991272 2819245026 397
306 iso_pu_bacteria 2818991439 2819556592 397
307 iso_pu_bacteria 2818991448 2819608517 397
308 iso_pu_bacteria 2818991453 2819640625 397
309 iso_pu_bacteria 2818991461 2819686114 397
310 iso_pu_bacteria 2818991467 2819716882 397
311 iso_pu_bacteria 2821123053 2821123510 397
312 iso_pu_bacteria 2824600985 2824603599 397
313 iso_pu_bacteria 2824609381 2824609636 397
314 iso_pu_bacteria 2824609381 2824610990 397
315 iso_pu_bacteria 2824617872 2824618685 397
316 iso_pu_bacteria 2824626560 2824628791 397
317 iso_pu_bacteria 2824635225 2824638096 397
318 iso_pu_bacteria 2824644064 2824648862 397
319 iso_pu_bacteria 2824653114 2824653840 397
320 iso_pu_bacteria 2824653114 2824654043 397
321 iso_pu_bacteria 2824661429 2824664327 397
322 iso_pu_bacteria 2824671348 2824678176 397
323 iso_pu_bacteria 2824679649 2824686503 397
324 iso_pu_bacteria 2824687955 2824694565 397
325 iso_pu_bacteria 2824696289 2824698615 397
326 iso_pu_bacteria 2824704595 2824709327 397
327 iso_pu_bacteria 2824714736 2824717902 397
328 iso_pu_bacteria 2824723954 2824726153 397
329 iso_pu_bacteria 2824732956 2824736768 397
330 iso_pu_bacteria 2824746037 2824752266 397
331 iso_pu_bacteria 2824753945 2824754858 397
332 iso_pu_bacteria 2824763712 2824765287 397
333 iso_pu_bacteria 2824773399 2824778127 397
334 iso_pu_bacteria 2829745981 2829750358 397
335 iso_pu_bacteria 2835312727 2835320014 397
336 iso_pu_bacteria 2837651117 2837651822 397
337 iso_pu_bacteria 2837678835 2837679568 397
338 iso_pu_bacteria 2838016132 2838020112 397
339 iso_pu_bacteria 2838022645 2838027648 397
340 iso_pu_bacteria 2838029111 2838029400 397
341 iso_pu_bacteria 2838035591 2838040121 397
342 iso_pu_bacteria 2838042994 2838048664 397
343 iso_pu_bacteria 2838048938 2838051674 397
344 iso_pu_bacteria 2838061910 2838064238 397
345 iso_pu_bacteria 2838068647 2838070939 397
346 iso_pu_bacteria 2838074704 2838075180 397
347 iso_pu_bacteria 2838122688 2838125908 397
348 iso_pu_bacteria 2838661181 2838665947 397
349 iso_pu_bacteria 2838668709 2838673377 397
350 iso_pu_bacteria 2838675328 2838677321 397
351 iso_pu_bacteria 2838680041 2838680420 397
352 iso_pu_bacteria 2838686498 2838691782 397
353 iso_pu_bacteria 2838694306 2838695547 397
354 iso_pu_bacteria 2838701080 2838706124 397
355 iso_pu_bacteria 2838707686 2838708924 397
356 iso_pu_bacteria 2838714209 2838716209 397
357 iso_pu_bacteria 2838719591 2838719991 397
358 iso_pu_bacteria 2838724970 2838726961 397
359 iso_pu_bacteria 2838729681 2838733734 397
360 iso_pu_bacteria 2838736955 2838739469 397
361 iso_pu_bacteria 2838742623 2838749592 397
362 iso_pu_bacteria 2839993093 2839994101 397
363 iso_pu_bacteria 2840764183 2840769493 397
364 iso_pu_bacteria 2841734538 2841735740 397
365 iso_pu_bacteria 2841760612 2841763731 397
366 iso_pu_bacteria 2841840854 2841844407 397
367 iso_pu_bacteria 2841846520 2841846923 397
368 iso_pu_bacteria 2841851746 2841856343 397
369 iso_pu_bacteria 2841859092 2841860549 397
370 iso_pu_bacteria 2841864319 2841866982 397
371 iso_pu_bacteria 2841911363 2841916827 397
372 iso_pu_bacteria 2841917233 2841917669 397
373 iso_pu_bacteria 2841941048 2841942698 397
374 iso_pu_bacteria 2841949485 2841952951 397
375 iso_pu_bacteria 2841957949 2841962958 397
376 iso_pu_bacteria 2841966195 2841971022 397
377 iso_pu_bacteria 2841974524 2841977720 397
378 iso_pu_bacteria 2841983080 2841984718 397
379 iso_pu_bacteria 2842038055 2842041561 397
380 iso_pu_bacteria 2842045827 2842049603 397
381 iso_pu_bacteria 2842077413 2842079841 397
382 iso_pu_bacteria 2842110456 2842112021 397
383 iso_pu_bacteria 2842118031 2842120459 397
384 iso_pu_bacteria 2842124991 2842127048 397
385 iso_pu_bacteria 2842130223 2842132214 397
386 iso_pu_bacteria 2842140634 2842144128 397
387 iso_pu_bacteria 2842146304 2842150533 397
388 iso_pu_bacteria 2842152218 2842152617 397
389 iso_pu_bacteria 2842156927 2842162132 397
390 iso_pu_bacteria 2842163707 2842165346 397
391 iso_pu_bacteria 2842170452 2842172454 397
392 iso_pu_bacteria 2842175837 2842176236 397
393 iso_pu_bacteria 2842180545 2842185973 397
394 iso_pu_bacteria 2842187318 2842189316 397
395 iso_pu_bacteria 2842192696 2842192735 397
396 iso_pu_bacteria 2842198810 2842205051 397
397 iso_pu_bacteria 2842205361 2842207111 397
398 iso_pu_bacteria 2842211629 2842213630 397
399 iso_pu_bacteria 2842217011 2842219014 397
400 iso_pu_bacteria 2842224351 2842224752 397
401 iso_pu_bacteria 2842229732 2842236215 397
402 iso_pu_bacteria 2842237096 2842238335 397
403 iso_pu_bacteria 2842243621 2842248044 397
404 iso_pu_bacteria 2842250916 2842255588 397
405 iso_pu_bacteria 2842257432 2842262362 397
406 iso_pu_bacteria 2842264693 2842270462 397
407 iso_pu_bacteria 2842271015 2842276755 397
408 iso_pu_bacteria 2842278818 2842280196 397
409 iso_pu_bacteria 2842285085 2842286654 397
410 iso_pu_bacteria 2842291075 2842293502 397
411 iso_pu_bacteria 2842298080 2842299562 397
412 iso_pu_bacteria 2842304105 2842306681 397
413 iso_pu_bacteria 2842311132 2842312795 397
414 iso_pu_bacteria 2842317721 2842323882 397
415 iso_pu_bacteria 2842341865 2842343245 397
416 iso_pu_bacteria 2842357229 2842360989 397
417 iso_pu_bacteria 2842363717 2842367028 397
418 iso_pu_bacteria 2842370503 2842370883 397
419 iso_pu_bacteria 2842377471 2842379899 397
420 iso_pu_bacteria 2842384541 2842386970 397
421 iso_pu_bacteria 2842395702 2842399053 397
422 iso_pu_bacteria 2842402390 2842403793 397
423 iso_pu_bacteria 2842409023 2842410505 397
424 iso_pu_bacteria 2842415677 2842417152 397
425 iso_pu_bacteria 2842422224 2842424554 397
426 iso_pu_bacteria 2842428310 2842434284 397
427 iso_pu_bacteria 2842434925 2842440609 397
428 iso_pu_bacteria 2842441272 2842447261 397
429 iso_pu_bacteria 2842447887 2842452021 397
430 iso_pu_bacteria 2842462802 2842468695 397
431 iso_pu_bacteria 2842469257 2842475222 397
432 iso_pu_bacteria 2842475841 2842476170 397
433 iso_pu_bacteria 2842482326 2842487636 397
434 iso_pu_bacteria 2842489311 2842492614 397
435 iso_pu_bacteria 2842495871 2842500204 397
436 iso_pu_bacteria 2842502639 2842502928 397
437 iso_pu_bacteria 2842509118 2842512777 397
438 iso_pu_bacteria 2842515876 2842517334 397
439 iso_pu_bacteria 2842521101 2842521518 397
440 iso_pu_bacteria 2842694124 2842697246 397
441 iso_pu_bacteria 2842698319 2842701160 397
442 iso_pu_bacteria 2842871566 2842873143 397
443 iso_pu_bacteria 2842922631 2842923151 397
444 iso_pu_bacteria 2844002411 2844004210 397
445 iso_pu_bacteria 2844009547 2844010000 397
446 iso_pu_bacteria 2844104063 2844109365 397
447 iso_pu_bacteria 2844163670 2844165086 397
448 iso_pu_bacteria 2844315083 2844321654 397
449 iso_pu_bacteria 2844454524 2844456191 397
450 iso_pu_bacteria 2847670302 2847672869 397
451 iso_pu_bacteria 2847686936 2847689345 397
452 iso_pu_bacteria 2847930680 2847939639 397
453 iso_pu_bacteria 2847939898 2847943085 397
454 iso_pu_bacteria 2848992105 2848992312 397
455 iso_pu_bacteria 2849076700 2849076831 397
456 iso_pu_bacteria 2850079185 2850079814 397
457 iso_pu_bacteria 2851182111 2851182985 397
458 iso_pu_bacteria 2851246043 2851251472 397
459 iso_pu_bacteria 2852387548 2852388364 397
460 iso_pu_bacteria 2854896431 2854898114 397
461 iso_pu_bacteria 2854911287 2854916141 397
462 iso_pu_bacteria 2854916844 2854919789 397
463 iso_pu_bacteria 2855825444 2855828053 397
464 iso_pu_bacteria 2855839649 2855839823 397
465 iso_pu_bacteria 2855872281 2855873549 397
466 iso_pu_bacteria 2856314179 2856314819 397
467 iso_pu_bacteria 2856320880 2856327956 397
468 iso_pu_bacteria 2856328259 2856332132 397
469 iso_pu_bacteria 2856334872 2856335120 397
470 iso_pu_bacteria 2856342000 2856346706 397
471 iso_pu_bacteria 2856349417 2856350944 397
472 iso_pu_bacteria 2856364286 2856371151 397
473 iso_pu_bacteria 2857349434 2857354244 397
474 iso_pu_bacteria 2857367948 2857372826 397
475 iso_pu_bacteria 2857509624 2857513166 397
476 iso_pu_bacteria 2857516855 2857521860 397
477 iso_pu_bacteria 2857524615 2857527460 397
478 iso_pu_bacteria 2857531043 2857531073 397
479 iso_pu_bacteria 2858800743 2858803798 397
480 iso_pu_bacteria 2861691609 2861693770 397
481 iso_pu_bacteria 2869162929 2869164619 397
482 iso_pu_bacteria 2869169390 2869172441 397
483 iso_pu_bacteria 2869234852 2869242126 397
484 iso_pu_bacteria 2869242130 2869244788 397
485 iso_pu_bacteria 2869249662 2869253935 397
486 iso_pu_bacteria 2869256925 2869263699 397
487 iso_pu_bacteria 2869264136 2869269735 397
488 iso_pu_bacteria 2869271264 2869275368 397
489 iso_pu_bacteria 2869278585 2869279906 397
490 iso_pu_bacteria 2869285874 2869292374 397
491 iso_pu_bacteria 2871429161 2871429189 397
492 iso_pu_bacteria 2871435913 2871437251 397
493 iso_pu_bacteria 2871444079 2871451363 397
494 iso_pu_bacteria 2871451962 2871453724 397
495 iso_pu_bacteria 2871459585 2871461262 397
496 iso_pu_bacteria 2871474448 2871480276 397
497 iso_pu_bacteria 2871481445 2871485445 397
498 iso_pu_bacteria 2871488783 2871490712 397
499 iso_pu_bacteria 2871495908 2871499287 397
500 iso_pu_bacteria 2874102143 2874105521 397
501 iso_pu_bacteria 2874109183 2874114665 397
502 iso_pu_bacteria 2874116593 2874121867 397
503 iso_pu_bacteria 2874123672 2874129605 397
504 iso_pu_bacteria 2874139085 2874145600 397
505 iso_pu_bacteria 2874146452 2874154095 397
506 iso_pu_bacteria 2874155637 2874161597 397
507 iso_pu_bacteria 2874162495 2874162658 397
508 iso_pu_bacteria 2874168670 2874171664 397
509 iso_pu_bacteria 2874590934 2874593778 397
510 iso_pu_bacteria 2874604998 2874606995 397
511 iso_pu_bacteria 2874612657 2874620509 397
512 iso_pu_bacteria 2874620515 2874621997 397
513 iso_pu_bacteria 2874628541 2874629340 397
514 iso_pu_bacteria 2874645413 2874646205 397
515 iso_pu_bacteria 2874645413 2874648017 397
516 iso_pu_bacteria 2876363079 2876363184 397
517 iso_pu_bacteria 2876369609 2876371083 397
518 iso_pu_bacteria 2876377896 2876385501 397
519 iso_pu_bacteria 2876386047 2876386169 397
520 iso_pu_bacteria 2876392853 2876393019 397
521 iso_pu_bacteria 2876399893 2876404306 397
522 iso_pu_bacteria 2876413966 2876419779 397
523 iso_pu_bacteria 2876420981 2876422894 397
524 iso_pu_bacteria 2876761206 2876762370 397
525 iso_pu_bacteria 2876771140 2876772003 397
526 iso_pu_bacteria 2876808645 2876812668 397
527 iso_pu_bacteria 2876818435 2876826402 397
528 iso_pu_bacteria 2878035449 2878036099 397
529 iso_pu_bacteria 2878738818 2878740251 397
530 iso_pu_bacteria 2878745973 2878752717 397
531 iso_pu_bacteria 2878753008 2878755116 397
532 iso_pu_bacteria 2878760144 2878763477 397
533 iso_pu_bacteria 2878767105 2878770475 397
534 iso_pu_bacteria 2878781027 2878786017 397
535 iso_pu_bacteria 2879074833 2879077565 397
536 iso_pu_bacteria 2879083081 2879089565 397
537 iso_pu_bacteria 2879099564 2879105488 397
538 iso_pu_bacteria 2879110137 2879115066 397
539 iso_pu_bacteria 2879127579 2879134354 397
540 iso_pu_bacteria 2879142872 2879147312 397
541 iso_pu_bacteria 2881147464 2881147521 397
542 iso_pu_bacteria 2881155292 2881158625 397
543 iso_pu_bacteria 2881161766 2881164297 397
544 iso_pu_bacteria 2881364244 2881364497 397
545 iso_pu_bacteria 2881665667 2881666109 397
546 iso_pu_bacteria 2881845957 2881849519 397
547 iso_pu_bacteria 2881861095 2881863313 397
548 iso_pu_bacteria 2882456835 2882458494 397
549 iso_pu_bacteria 2882632389 2882632861 397
550 iso_pu_bacteria 2882912400 2882917612 397
551 iso_pu_bacteria 2884298095 2884299046 397
552 iso_pu_bacteria 2885305155 2885306160 397
553 iso_pu_bacteria 2885312484 2885314785 397
554 iso_pu_bacteria 2885318864 2885320467 397
555 iso_pu_bacteria 2885326080 2885328229 397
556 iso_pu_bacteria 2885334103 2885342406 397
557 iso_pu_bacteria 2885342637 2885350172 397
558 iso_pu_bacteria 2885350715 2885353683 397
559 iso_pu_bacteria 2885366525 2885369083 397
560 iso_pu_bacteria 2885374607 2885375902 397
561 iso_pu_bacteria 2885383462 2885391619 397
562 iso_pu_bacteria 2885409591 2885414562 397
563 iso_pu_bacteria 2888337043 2888342612 397
564 iso_pu_bacteria 2888343758 2888350314 397
565 iso_pu_bacteria 2888350351 2888352177 397
566 iso_pu_bacteria 2888378607 2888380166 397
567 iso_pu_bacteria 2888388044 2888390130 397
568 iso_pu_bacteria 2888419890 2888420925 397
569 iso_pu_bacteria 2889010040 2889014168 397
570 iso_pu_bacteria 2889016732 2889021126 397
571 iso_pu_bacteria 2889033259 2889034909 397
572 iso_pu_bacteria 2889306138 2889310841 397
573 iso_pu_bacteria 2889790730 2889793379 397
574 iso_pu_bacteria 2889914905 2889916287 397
575 iso_pu_bacteria 2891088606 2891089637 397
576 iso_pu_bacteria 2891373044 2891375127 397
577 iso_pu_bacteria 2893066018 2893066952 397
578 iso_pu_bacteria 2894232714 2894235600 397
579 iso_pu_bacteria 2894652903 2894652960 397
580 iso_pu_bacteria 2896384573 2896388597 397
581 iso_pu_bacteria 2899792073 2899795139 397
582 iso_pu_bacteria 2899803654 2899805463 397
583 iso_pu_bacteria 2899845264 2899846000 397
584 iso_pu_bacteria 2902330777 2902336595 397
585 iso_pu_bacteria 2902405164 2902406798 397
586 iso_pu_bacteria 2903448605 2903454742 397
587 iso_pu_bacteria 2903492973 2903494816 397
588 iso_pu_bacteria 2903492973 2903499403 397
589 iso_pu_bacteria 2903521522 2903525134 397
590 iso_pu_bacteria 2903528002 2903532122 397
591 iso_pu_bacteria 2903540706 2903544092 397
592 iso_pu_bacteria 2903727486 2903727771 397
593 iso_pu_bacteria 2903748898 2903755010 397
594 iso_pu_bacteria 2903768456 2903773071 397
595 iso_pu_bacteria 2904578770 2904579234 397
596 iso_pu_bacteria 2904659560 2904659725 397
597 iso_pu_bacteria 2904666416 2904669411 397
598 iso_pu_bacteria 2904690495 2904695672 397
599 iso_pu_bacteria 2904699407 2904707662 397
600 iso_pu_bacteria 2904711408 2904714476 397
601 iso_pu_bacteria 2906308376 2906315108 397
602 iso_pu_bacteria 2906321335 2906321364 397
603 iso_pu_bacteria 2906328253 2906334644 397
604 iso_pu_bacteria 2906354277 2906356072 397
605 iso_pu_bacteria 2906363423 2906370559 397
606 iso_pu_bacteria 2906370794 2906376472 397
607 iso_pu_bacteria 2906378014 2906384839 397
608 iso_pu_bacteria 2906393657 2906394610 397
609 iso_pu_bacteria 2906401398 2906407571 397
610 iso_pu_bacteria 2906408224 2906411536 397
611 iso_pu_bacteria 2906414383 2906415008 397
612 iso_pu_bacteria 2906602504 2906602743 397
613 iso_pu_bacteria 2906610324 2906614560 397
614 iso_pu_bacteria 2906626472 2906634712 397
615 iso_pu_bacteria 2906635258 2906642040 397
616 iso_pu_bacteria 2906643746 2906644526 397
617 iso_pu_bacteria 2906660503 2906666515 397
618 iso_pu_bacteria 2908739725 2908746619 397
619 iso_pu_bacteria 2908756301 2908764076 397
620 iso_pu_bacteria 2908775508 2908776742 397
621 iso_pu_bacteria 2909042592 2909042659 397
622 iso_pu_bacteria 2913295892 2913298152 397
623 iso_pu_bacteria 2913308742 2913311584 397
624 iso_pu_bacteria 2915650412 2915652889 397
625 iso_pu_bacteria 2915980308 2915984023 397
626 iso_pu_bacteria 2915986958 2915990682 397
627 iso_pu_bacteria 2915993759 2915997170 397
628 iso_pu_bacteria 2916000859 2916000924 397
629 iso_pu_bacteria 2916007675 2916011181 397
630 iso_pu_bacteria 2916014648 2916021285 397
631 iso_pu_bacteria 2916021584 2916021980 397
632 iso_pu_bacteria 2916028427 2916034086 397
633 iso_pu_bacteria 2916035215 2916036341 397
634 iso_pu_bacteria 2916041962 2916048403 397
635 iso_pu_bacteria 2916048683 2916053655 397
636 iso_pu_bacteria 2916055098 2916056945 397
637 iso_pu_bacteria 2916061851 2916068600 397
638 iso_pu_bacteria 2916068649 2916071312 397
639 iso_pu_bacteria 2916076590 2916080760 397
640 iso_pu_bacteria 2917554339 2917556243 397
641 iso_pu_bacteria 2917699015 2917701602 397
642 iso_pu_bacteria 2919073203 2919073281 397
643 iso_pu_bacteria 2919100787 2919101492 397
644 iso_pu_bacteria 2919114240 2919116413 397
645 iso_pu_bacteria 2919119836 2919121940 397
646 iso_pu_bacteria 2919166419 2919166759 397
647 iso_pu_bacteria 2919171160 2919176679 397
648 iso_pu_bacteria 2919408235 2919408692 397
649 iso_pu_bacteria 2920760137 2920763565 397
650 iso_pu_bacteria 2920822456 2920823210 397
651 iso_pu_bacteria 2921201388 2921206152 397
652 iso_pu_bacteria 2921208531 2921213703 397
653 iso_pu_bacteria 2921237296 2921241517 397
654 iso_pu_bacteria 2921244191 2921247095 397
655 iso_pu_bacteria 2921250672 2921254463 397
656 iso_pu_bacteria 2921257292 2921262829 397
657 iso_pu_bacteria 2921263974 2921268691 397
658 iso_pu_bacteria 2921282425 2921288224 397
659 iso_pu_bacteria 2921289301 2921291764 397
660 iso_pu_bacteria 2921296804 2921300809 397
661 iso_pu_bacteria 2922151315 2922154205 397
662 iso_pu_bacteria 2922172374 2922174085 397
663 iso_pu_bacteria 2922361189 2922364658 397
664 iso_pu_bacteria 2922368715 2922377700 397
665 iso_pu_bacteria 2922386360 2922391868 397
666 iso_pu_bacteria 2922393267 2922400226 397
667 iso_pu_bacteria 2922425934 2922426425 397
668 iso_pu_bacteria 2923556063 2923556567 397
669 iso_pu_bacteria 2924144063 2924150760 397
670 iso_pu_bacteria 2924150972 2924156675 397
671 iso_pu_bacteria 2924158325 2924160313 397
672 iso_pu_bacteria 2924165586 2924170736 397
673 iso_pu_bacteria 2924172951 2924176853 397
674 iso_pu_bacteria 2924179722 2924183649 397
675 iso_pu_bacteria 2924186466 2924190434 397
676 iso_pu_bacteria 2924193448 2924198987 397
677 iso_pu_bacteria 2924200457 2924200855 397
678 iso_pu_bacteria 2924207177 2924209221 397
679 iso_pu_bacteria 2924214083 2924216109 397
680 iso_pu_bacteria 2924221636 2924226552 397
681 iso_pu_bacteria 2924228884 2924232747 397
682 iso_pu_bacteria 2924710171 2924716972 397
683 iso_pu_bacteria 2924718760 2924725951 397
684 iso_pu_bacteria 2924726620 2924726652 397
685 iso_pu_bacteria 2924733363 2924735754 397
686 iso_pu_bacteria 2924741084 2924743505 397
687 iso_pu_bacteria 2924748358 2924748769 397
688 iso_pu_bacteria 2924762789 2924767604 397
689 iso_pu_bacteria 2924776078 2924777851 397
690 iso_pu_bacteria 2924784321 2924791334 397
691 iso_pu_bacteria 2926754445 2926757366 397
692 iso_pu_bacteria 2926760298 2926761610 397
693 iso_pu_bacteria 2928125067 2928126916 397
694 iso_pu_bacteria 2928521798 2928522079 397
695 iso_pu_bacteria 2929138655 2929138710 397
696 iso_pu_bacteria 2929615660 2929623329 397
697 iso_pu_bacteria 2929624759 2929632579 397
698 iso_pu_bacteria 2932784394 2932788197 397
699 iso_pu_bacteria 2932794094 2932794843 397
700 iso_pu_bacteria 2932801729 2932805365 397
701 iso_pu_bacteria 2932809354 2932813568 397
702 iso_pu_bacteria 2932818245 2932820265 397
703 iso_pu_bacteria 2932828146 2932832668 397
704 iso_pu_bacteria 2933006813 2933007262 397
705 iso_pu_bacteria 2933011516 2933015147 397
706 iso_pu_bacteria 2933016740 2933016758 397
707 iso_pu_bacteria 2933570622 2933576992 397
708 iso_pu_bacteria 2933577622 2933585233 397
709 iso_pu_bacteria 2933586486 2933587350 397
710 iso_pu_bacteria 2933594066 2933594466 397
711 iso_pu_bacteria 2933599457 2933601738 397
712 iso_pu_bacteria 2935608549 2935614793 397
713 iso_pu_bacteria 2935616580 2935620158 397
714 iso_pu_bacteria 2935630451 2935632764 397
715 iso_pu_bacteria 2935638405 2935640477 397
716 iso_pu_bacteria 2935648319 2935649191 397
717 iso_pu_bacteria 2935656913 2935658037 397
718 iso_pu_bacteria 2935665750 2935668670 397
719 iso_pu_bacteria 2935675223 2935681972 397
720 iso_pu_bacteria 2935684952 2935686978 397
721 iso_pu_bacteria 2935694250 2935697052 397
722 iso_pu_bacteria 2935703347 2935709820 397
723 iso_pu_bacteria 2935713505 2935716666 397
724 iso_pu_bacteria 2935722832 2935723209 397
725 iso_pu_bacteria 2935732158 2935734766 397
726 iso_pu_bacteria 2935741537 2935744443 397
727 iso_pu_bacteria 2935750917 2935752944 397
728 iso_pu_bacteria 2935760218 2935766842 397
729 iso_pu_bacteria 2935769743 2935775599 397
730 iso_pu_bacteria 2935777560 2935777949 397
731 iso_pu_bacteria 2935785616 2935791347 397
732 iso_pu_bacteria 2935793552 2935799659 397
733 iso_pu_bacteria 2935801545 2935804590 397
734 iso_pu_bacteria 2935810662 2935815743 397
735 iso_pu_bacteria 2935819856 2935826167 397
736 iso_pu_bacteria 2935827899 2935831983 397
737 iso_pu_bacteria 2935837841 2935841186 397
738 iso_pu_bacteria 2935847175 2935853663 397
739 iso_pu_bacteria 2935855204 2935859044 397
740 iso_pu_bacteria 2935864058 2935864225 397
741 iso_pu_bacteria 2935873716 2935875423 397
742 iso_pu_bacteria 2935883170 2935887554 397
743 iso_pu_bacteria 2935894831 2935896071 397
744 iso_pu_bacteria 2935901341 2935902734 397
745 iso_pu_bacteria 2935908558 2935910885 397
746 iso_pu_bacteria 2935916978 2935922067 397
747 iso_pu_bacteria 2935926038 2935929796 397
748 iso_pu_bacteria 2935934488 2935937464 397
749 iso_pu_bacteria 2935942939 2935948137 397
750 iso_pu_bacteria 2935951376 2935957642 397
751 iso_pu_bacteria 2935959822 2935964295 397
752 iso_pu_bacteria 2935967501 2935971079 397
753 iso_pu_bacteria 2935975950 2935978398 397
754 iso_pu_bacteria 2935984226 2935985470 397
755 iso_pu_bacteria 2935992306 2935995598 397
756 iso_pu_bacteria 2936002035 2936008018 397
757 iso_pu_bacteria 2936011229 2936012256 397
758 iso_pu_bacteria 2936019824 2936020663 397
759 iso_pu_bacteria 2936028420 2936029549 397
760 iso_pu_bacteria 2936037263 2936041645 397
761 iso_pu_bacteria 2936046547 2936048127 397
762 iso_pu_bacteria 2936055302 2936056762 397
763 iso_pu_bacteria 2936367885 2936369120 397
764 iso_pu_bacteria 2936375103 2936377535 397
765 iso_pu_bacteria 2936381700 2936383584 397
766 iso_pu_bacteria 2936996657 2937001855 397
767 iso_pu_bacteria 2937002841 2937007708 397
768 iso_pu_bacteria 2937009748 2937014957 397
769 iso_pu_bacteria 2937016420 2937022299 397
770 iso_pu_bacteria 2937023124 2937023377 397
771 iso_pu_bacteria 2937029754 2937034425 397
772 iso_pu_bacteria 2937036028 2937040506 397
773 iso_pu_bacteria 2937042894 2937044854 397
774 iso_pu_bacteria 2937049772 2937053363 397
775 iso_pu_bacteria 2937056579 2937061548 397
776 iso_pu_bacteria 2937063883 2937064241 397
777 iso_pu_bacteria 2937071275 2937074893 397
778 iso_pu_bacteria 2937078374 2937078913 397
779 iso_pu_bacteria 2937084907 2937088991 397
780 iso_pu_bacteria 2937091812 2937092050 397
781 iso_pu_bacteria 2937098957 2937099887 397
782 iso_pu_bacteria 2937106411 2937106417 397
783 iso_pu_bacteria 2937113482 2937119471 397
784 iso_pu_bacteria 2937119839 2937126191 397
785 iso_pu_bacteria 2937126314 2937131614 397
786 iso_pu_bacteria 2937813078 2937821649 397
787 iso_pu_bacteria 2937822353 2937825921 397
788 iso_pu_bacteria 2937836603 2937837170 397
789 iso_pu_bacteria 2937843397 2937844788 397
790 iso_pu_bacteria 2937848649 2937849920 397
791 iso_pu_bacteria 2937861824 2937868213 397
792 iso_pu_bacteria 2937868953 2937875754 397
793 iso_pu_bacteria 2937877337 2937884413 397
794 iso_pu_bacteria 2937891427 2937894076 397
795 iso_pu_bacteria 2937972304 2937980437 397
796 iso_pu_bacteria 2937980651 2937987864 397
797 iso_pu_bacteria 2937994558 2937997937 397
798 iso_pu_bacteria 2938014810 2938018682 397
799 iso_pu_bacteria 2940556831 2940558857 397
800 iso_pu_bacteria 2941499720 2941500888 397
801 iso_pu_bacteria 2941507105 2941508572 397
802 iso_pu_bacteria 2941515067 2941516402 397
803 iso_pu_bacteria 2941523033 2941524582 397
804 iso_pu_bacteria 2941531003 2941532215 397
805 iso_pu_bacteria 2941538514 2941543412 397
806 iso_pu_bacteria 2954011201 2954014560 397
807 iso_pu_bacteria 2957375807 2957381326 397
808 iso_pu_bacteria 2957382221 2957388677 397
809 iso_pu_bacteria 2957388812 2957393379 397
810 iso_pu_bacteria 2957395598 2957396886 397
811 iso_pu_bacteria 2957402308 2957403892 397
812 iso_pu_bacteria 2957408893 2957413321 397
813 iso_pu_bacteria 2957415311 2957417676 397
814 iso_pu_bacteria 2957422303 2957423336 397
815 iso_pu_bacteria 2957430029 2957436887 397
816 iso_pu_bacteria 2957437181 2957443675 397
817 iso_pu_bacteria 2957443900 2957447297 397
818 iso_pu_bacteria 2957450854 2957451220 397
819 iso_pu_bacteria 2957457609 2957460179 397
820 iso_pu_bacteria 2957464669 2957469575 397
821 iso_pu_bacteria 2957471148 2957473523 397
822 iso_pu_bacteria 2957478035 2957482004 397
823 iso_pu_bacteria 2957484790 2957484830 397
824 iso_pu_bacteria 2957491536 2957492105 397
825 iso_pu_bacteria 2957498199 2957500669 397
826 iso_pu_bacteria 2957505466 2957508123 397
827 iso_pu_bacteria 2958034702 2958035773 397
828 iso_pu_bacteria 2958041894 2958044804 397
829 iso_pu_bacteria 2958071322 2958076394 397
830 iso_pu_bacteria 2958084443 2958091724 397
831 iso_pu_bacteria 2958092219 2958095750 397
832 iso_pu_bacteria 2958100919 2958106009 397
833 iso_pu_bacteria 2958108152 2958114534 397
834 iso_pu_bacteria 2958115193 2958119765 397
835 iso_pu_bacteria 2958122699 2958125238 397
836 iso_pu_bacteria 2958130278 2958136774 397
837 iso_pu_bacteria 2958158011 2958163049 397
838 iso_pu_bacteria 2958165035 2958168412 397
839 iso_pu_bacteria 2958172287 2958174439 397
840 iso_pu_bacteria 2958179912 2958186657 397
841 iso_pu_bacteria 2960584000 2960586159 397
842 iso_pu_bacteria 2960591022 2960594594 397
843 iso_pu_bacteria 2960597568 2960603383 397
844 iso_pu_bacteria 2960603979 2960607809 397
845 iso_pu_bacteria 2960610863 2960611723 397
846 iso_pu_bacteria 2960617483 2960621527 397
847 iso_pu_bacteria 2960624210 2960626770 397
848 iso_pu_bacteria 2960631154 2960634975 397
849 iso_pu_bacteria 2960637947 2960641534 397
850 iso_pu_bacteria 2960645483 2960648086 397
851 iso_pu_bacteria 2960652885 2960658312 397
852 iso_pu_bacteria 2960660292 2960660581 397
853 iso_pu_bacteria 2960667422 2960672183 397
854 iso_pu_bacteria 2960674078 2960679605 397
855 iso_pu_bacteria 2960680706 2960684718 397
856 iso_pu_bacteria 2960687367 2960687503 397
857 iso_pu_bacteria 2960693952 2960694509 397
858 iso_pu_bacteria 2961077736 2961085158 397
859 iso_pu_bacteria 2961114664 2961115049 397
860 iso_pu_bacteria 2961127735 2961136197 397
861 iso_pu_bacteria 2961136820 2961140161 397
862 iso_pu_bacteria 2961163497 2961166876 397
863 iso_pu_bacteria 2961170736 2961176843 397
864 iso_pu_bacteria 2961183825 2961190623 397
865 iso_pu_bacteria 2963644680 2963651063 397
866 iso_pu_bacteria 2964607997 2964610533 397
867 iso_pu_bacteria 2964615318 2964618425 397
868 iso_pu_bacteria 2964621998 2964625440 397
869 iso_pu_bacteria 2964628898 2964633784 397
870 iso_pu_bacteria 2964636051 2964639467 397
871 iso_pu_bacteria 2964643177 2964649384 397
872 iso_pu_bacteria 2964649959 2964650162 397
873 iso_pu_bacteria 2964656573 2964663082 397
874 iso_pu_bacteria 2964663802 2964668092 397
875 iso_pu_bacteria 2964670856 2964671856 397
876 iso_pu_bacteria 2964678106 2964682518 397
877 iso_pu_bacteria 2964685014 2964687573 397
878 iso_pu_bacteria 2964691889 2964697707 397
879 iso_pu_bacteria 2964698721 2964703359 397
880 iso_pu_bacteria 2964705432 2964710206 397
881 iso_pu_bacteria 2964712639 2964717218 397
882 iso_pu_bacteria 2964719344 2964722030 397
883 iso_pu_bacteria 2965018300 2965021700 397
884 iso_pu_bacteria 2965025482 2965028939 397
885 iso_pu_bacteria 2965032056 2965040118 397
886 iso_pu_bacteria 2965040258 2965044148 397
887 iso_pu_bacteria 2965047637 2965049438 397
888 iso_pu_bacteria 2965062239 2965064908 397
889 iso_pu_bacteria 2965089291 2965090796 397
890 iso_pu_bacteria 2965102966 2965104334 397
891 iso_pu_bacteria 2965110997 2965113562 397
892 iso_pu_bacteria 2965119406 2965122394 397
893 iso_pu_bacteria 2967664464 2967670521 397
894 iso_pu_bacteria 2967671571 2967671854 397
895 iso_pu_bacteria 2967678726 2967680935 397
896 iso_pu_bacteria 2967686174 2967689597 397
897 iso_pu_bacteria 2967693043 2967694900 397
898 iso_pu_bacteria 2967699805 2967703538 397
899 iso_pu_bacteria 2967706974 2967712303 397
900 iso_pu_bacteria 2967714385 2967714494 397
901 iso_pu_bacteria 2967721400 2967723442 397
902 iso_pu_bacteria 2967728569 2967730386 397
903 iso_pu_bacteria 2967735183 2967739244 397
904 iso_pu_bacteria 2967742019 2967744831 397
905 iso_pu_bacteria 2967748971 2967754882 397
906 iso_pu_bacteria 2967755722 2967761164 397
907 iso_pu_bacteria 2967762386 2967766559 397
908 iso_pu_bacteria 2967769361 2967769936 397
909 iso_pu_bacteria 2967775926 2967778060 397
910 iso_pu_bacteria 2967996073 2968001050 397
911 iso_pu_bacteria 2968003550 2968007103 397
912 iso_pu_bacteria 2968016561 2968021537 397
913 iso_pu_bacteria 2968083720 2968089081 397
914 iso_pu_bacteria 2968091066 2968093019 397
915 iso_pu_bacteria 2968097103 2968102658 397
916 iso_pu_bacteria 2968110612 2968110777 397
917 iso_pu_bacteria 2968117919 2968121496 397
918 iso_pu_bacteria 2968128360 2968131471 397
919 iso_pu_bacteria 2968138860 2968139175 397
920 iso_pu_bacteria 2968171901 2968175282 397
921 iso_pu_bacteria 2970019648 2970023283 397
922 iso_pu_bacteria 2970026789 2970030887 397
923 iso_pu_bacteria 2970033650 2970037115 397
924 iso_pu_bacteria 2970040964 2970041111 397
925 iso_pu_bacteria 2970047711 2970050689 397
926 iso_pu_bacteria 2970054988 2970056853 397
927 iso_pu_bacteria 2970061556 2970062743 397
928 iso_pu_bacteria 2970068827 2970075398 397
929 iso_pu_bacteria 2970076120 2970081787 397
930 iso_pu_bacteria 2970082768 2970088380 397
931 iso_pu_bacteria 2970088815 2970089497 397
932 iso_pu_bacteria 2970095765 2970101906 397
933 iso_pu_bacteria 2970102677 2970105988 397
934 iso_pu_bacteria 2970109326 2970115761 397
935 iso_pu_bacteria 2970116247 2970117626 397
936 iso_pu_bacteria 2970122695 2970128972 397
937 iso_pu_bacteria 2970129317 2970131398 397
938 iso_pu_bacteria 2970136068 2970138964 397
939 iso_pu_bacteria 2970143518 2970144276 397
940 iso_pu_bacteria 2970149975 2970154476 397
941 iso_pu_bacteria 2970156795 2970162061 397
942 iso_pu_bacteria 2970164137 2970170121 397
943 iso_pu_bacteria 2970170962 2970175829 397
944 iso_pu_bacteria 2970177841 2970183676 397
945 iso_pu_bacteria 2970184632 2970188838 397
946 iso_pu_bacteria 2970191845 2970197457 397
947 iso_pu_bacteria 2970469710 2970476784 397
948 iso_pu_bacteria 2970489779 2970494244 397
949 iso_pu_bacteria 2970503327 2970509515 397
950 iso_pu_bacteria 2970510686 2970515077 397
951 iso_pu_bacteria 2970524798 2970525426 397
952 iso_pu_bacteria 2970532167 2970535266 397
953 iso_pu_bacteria 2970547951 2970552274 397
954 iso_pu_bacteria 2970554993 2970558320 397
955 iso_pu_bacteria 2970593180 2970594505 397
956 iso_pu_bacteria 2970619444 2970619776 397
957 iso_pu_bacteria 2970627176 2970634005 397
958 iso_pu_bacteria 2977516862 2977521111 397
959 iso_pu_bacteria 2977523885 2977528542 397
960 iso_pu_bacteria 2977530762 2977532619 397
961 iso_pu_bacteria 2977537788 2977543796 397
962 iso_pu_bacteria 2977544691 2977550359 397
963 iso_pu_bacteria 2977551784 2977553465 397
964 iso_pu_bacteria 2977558990 2977563730 397
965 iso_pu_bacteria 2977565890 2977571732 397
966 iso_pu_bacteria 2977572785 2977574687 397
967 iso_pu_bacteria 2977579622 2977584435 397
968 iso_pu_bacteria 2977821940 2977824256 397
969 iso_pu_bacteria 2977843712 2977850125 397
970 iso_pu_bacteria 2977851361 2977854983 397
971 iso_pu_bacteria 2977858184 2977862049 397
972 iso_pu_bacteria 2977864932 2977868416 397
973 iso_pu_bacteria 2977872689 2977873880 397
974 iso_pu_bacteria 2977898635 2977900565 397
975 iso_pu_bacteria 2977915119 2977915903 397
976 iso_pu_bacteria 2977922695 2977927258 397
977 iso_pu_bacteria 2977935797 2977939996 397
978 iso_pu_bacteria 2977942078 2977943739 397
979 iso_pu_bacteria 2977950692 2977952999 397
980 iso_pu_bacteria 2977957713 2977964987 397
981 iso_pu_bacteria 2977971508 2977975956 397
982 iso_pu_bacteria 2977986579 2977986633 397
983 iso_pu_bacteria 2978969890 2978973158 397
984 iso_pu_bacteria 2979089926 2979093129 397
985 iso_pu_bacteria 2979095461 2979099484 397
986 iso_pu_bacteria 2979100975 2979105095 397
987 iso_pu_bacteria 2979710463 2979713047 397
988 iso_pu_bacteria 2979742915 2979747950 397
989 iso_pu_bacteria 2979764755 2979772052 397
990 iso_pu_bacteria 2979772303 2979773174 397
991 iso_pu_bacteria 2979779861 2979786389 397
992 iso_pu_bacteria 2979793036 2979800687 397
993 iso_pu_bacteria 2979808191 2979814303 397
994 iso_pu_bacteria 2984509177 2984513090 397
995 iso_pu_bacteria 2984518228 2984520545 397
996 iso_pu_bacteria 2984537506 2984539839 397
997 iso_pu_bacteria 2984587000 2984591427 397
998 iso_pu_bacteria 2984601300 2984602074 397
999 iso_pu_bacteria 2987636660 2987642346 397
1000 iso_pu_bacteria 2987645492 2987647995 397
1001 iso_pu_bacteria 2987652177 2987654341 397
1002 iso_pu_bacteria 2987659509 2987662888 397
1003 iso_pu_bacteria 2987666974 2987668076 397
1004 iso_pu_bacteria 2989349275 2989351648 397
1005 iso_pu_bacteria 2989771324 2989772637 397
1006 iso_pu_bacteria 2989776772 2989777274 397
1007 iso_pu_bacteria 2996310559 2996312716 397
1008 iso_pu_bacteria 2996336353 2996337210 397
1009 iso_pu_bacteria 2996341866 2996346367 397
1010 iso_pu_bacteria 2996348954 2996356209 397
1011 iso_pu_bacteria 2996386984 2996393624 397
1012 iso_pu_bacteria 2996887358 2996888366 397
1013 iso_pu_bacteria 2996893221 2996893276 397
1014 iso_pu_bacteria 3000135777 3000135846 397
1015 iso_pu_bacteria 3002141150 3002142520 397
1016 iso_pu_bacteria 3003665799 3003668924 397
1017 iso_pu_bacteria 3003930520 3003931770 397
1018 iso_pu_bacteria 3004167301 3004172448 397
1019 iso_pu_bacteria 3004188549 3004191940 397
1020 iso_pu_bacteria 3004195979 3004198394 397
1021 iso_pu_bacteria 3004203850 3004210428 397
1022 iso_pu_bacteria 3004211236 3004216783 397
1023 iso_pu_bacteria 3004218560 3004219816 397
1024 iso_pu_bacteria 3004232784 3004235185 397
1025 iso_pu_bacteria 3004239961 3004242714 397
1026 iso_pu_bacteria 3004248173 3004250598 397
1027 iso_pu_bacteria 3004268573 3004269607 397
1028 iso_pu_bacteria 3004275668 3004282523 397
1029 iso_pu_bacteria 3004289098 3004297062 397
1030 iso_pu_bacteria 3004334049 3004338159 397
1031 iso_pu_bacteria 3005409236 3005411030 397
1032 iso_pu_bacteria 3005416602 3005422917 397
1033 iso_pu_bacteria 3005445848 3005446042 397
1034 iso_pu_bacteria 3005452660 3005452702 397
1035 iso_pu_bacteria 3005474847 3005475764 397
1036 iso_pu_bacteria 3005483717 3005490955 397
1037 iso_pu_bacteria 3005506211 3005506449 397
1038 iso_pu_bacteria 3005587118 3005594287 397
1039 iso_pu_bacteria 3005594810 3005602030 397
1040 iso_pu_bacteria 3005710791 3005717762 397
1041 iso_pu_bacteria 3005718088 3005724811 397
1042 iso_pu_bacteria 637000159 637077725 397
1043 iso_pu_bacteria 639633055 639646467 397
1044 iso_pu_bacteria 641522639 641643466 397
1045 iso_pu_bacteria 643348564 643602871 397
1046 iso_pu_bacteria 643692032 643824376 397
1047 iso_pu_bacteria 648276728 648738448 397
1048 iso_pu_bacteria 649633066 649875768 397
1049 iso_pu_bacteria 650716007 650738952 397
1050 iso_pu_bacteria 8002060224 8002063203 397
1051 iso_pu_bacteria 8002285264 8002288497 397
1052 iso_pu_bacteria 8003570095 8003572582 397
1053 iso_pu_bacteria 8003992118 8003992277 397
1054 iso_pu_bacteria 8003999396 8003999541 397
1055 iso_pu_bacteria 8004300914 8004300940 397
1056 iso_pu_bacteria 8004312739 8004313831 397
1057 iso_pu_bacteria 8004361976 8004364211 397
1058 iso_pu_bacteria 8004374579 8004376695 397
1059 iso_pu_bacteria 8004387939 8004395048 397
1060 iso_pu_bacteria 8004395343 8004401733 397
1061 iso_pu_bacteria 8004445564 8004446743 397
1062 iso_pu_bacteria 8004633249 8004635627 397
1063 iso_pu_bacteria 8004640170 8004647010 397
1064 iso_pu_bacteria 8004695233 8004697906 397
1065 iso_pu_bacteria 8004703790 8004707349 397
1066 iso_pu_bacteria 8004714634 8004721369 397
1067 iso_pu_bacteria 8004727605 8004731042 397
1068 iso_pu_bacteria 8005246636 8005247557 397
1069 iso_pu_bacteria 8005258706 8005261078 397
1070 iso_pu_bacteria 8005275841 8005278664 397
1071 iso_pu_bacteria 8005282627 8005289181 397
1072 iso_pu_bacteria 8005289223 8005291253 397
1073 iso_pu_bacteria 8005301065 8005301376 397
1074 iso_pu_bacteria 8005307578 8005310661 397
1075 iso_pu_bacteria 8005314921 8005321547 397
1076 iso_pu_bacteria 8005321885 8005322893 397
1077 iso_pu_bacteria 8005376324 8005377614 397
1078 iso_pu_bacteria 8005382845 8005387460 397
1079 iso_pu_bacteria 8005395548 8005399962 397
1080 iso_pu_bacteria 8005430974 8005432759 397
1081 iso_pu_bacteria 8005460587 8005460817 397
1082 iso_pu_bacteria 8005484373 8005484838 397
1083 iso_pu_bacteria 8005497431 8005498489 397
1084 iso_pu_bacteria 8005542996 8005543615 397
1085 iso_pu_bacteria 8005556819 8005560427 397
1086 iso_pu_bacteria 8005563573 8005564113 397
1087 iso_pu_bacteria 8005570704 8005572132 397
1088 iso_pu_bacteria 8005619151 8005619681 397
1089 iso_pu_bacteria 8005626139 8005628253 397
1090 iso_pu_bacteria 8005645114 8005649533 397
1091 iso_pu_bacteria 8005658619 8005660202 397
1092 iso_pu_bacteria 8005668836 8005669900 397
1093 iso_pu_bacteria 8005682033 8005685224 397
1094 iso_pu_bacteria 8005688590 8005692416 397
1095 iso_pu_bacteria 8005695170 8005699453 397
1096 iso_pu_bacteria 8006926726 8006929230 397
1097 iso_pu_bacteria 8006933436 8006937087 397
1098 iso_pu_bacteria 8006964411 8006971255 397
1099 iso_pu_bacteria 8006973647 8006977097 397
1100 iso_pu_bacteria 8006984368 8006988554 397
1101 iso_pu_bacteria 8006994254 8006995241 397
1102 iso_pu_bacteria 8006994254 8007002260 397
1103 iso_pu_bacteria 8016511872 8016517565 397
1104 iso_pu_bacteria 8016522445 8016526756 397
1105 iso_pu_bacteria 8016530956 8016531845 397
1106 iso_pu_bacteria 8016539877 8016545046 397
1107 iso_pu_bacteria 8016548790 8016557033 397
1108 iso_pu_bacteria 8016557553 8016565380 397
1109 iso_pu_bacteria 8016575299 8016582689 397
1110 iso_pu_bacteria 8016583857 8016585634 397
1111 iso_pu_bacteria 8016595262 8016603018 397
1112 iso_pu_bacteria 8016613128 8016617807 397
1113 iso_pu_bacteria 8016622563 8016623765 397
1114 iso_pu_bacteria 8016630954 8016635093 397
1115 iso_pu_bacteria 8017057580 8017059055 397
1116 iso_pu_bacteria 8018127388 8018132923 397
1117 iso_pu_bacteria 8018150411 8018152971 397
1118 iso_pu_bacteria 8018163183 8018165416 397
1119 iso_pu_bacteria 8018176218 8018181010 397
1120 iso_pu_bacteria 8019547302 8019550787 397
1121 iso_pu_bacteria 8019555841 8019561582 397
1122 iso_pu_bacteria 8019565922 8019571657 397
1123 iso_pu_bacteria 8019576017 8019576584 397
1124 iso_pu_bacteria 8019586578 8019594456 397
1125 iso_pu_bacteria 8019597564 8019607104 397
1126 iso_pu_bacteria 8019608314 8019611403 397
1127 iso_pu_bacteria 8019619141 8019622157 397
1128 iso_pu_bacteria 8019638758 8019639466 397
1129 iso_pu_bacteria 8019648815 8019651892 397
1130 iso_pu_bacteria 8019659431 8019667963 397
1131 iso_pu_bacteria 8019668869 8019677383 397
1132 iso_pu_bacteria 8019687851 8019695664 397
1133 iso_pu_bacteria 8023680758 8023684427 397
1134 iso_pu_bacteria 8024479707 8024480104 397
1135 iso_pu_bacteria 8024486573 8024491518 397
1136 iso_pu_bacteria 8024501048 8024501755 397
1137 iso_pu_bacteria 8045864390 8045868370 397
1138 iso_pu_bacteria 8046767195 8046770814 397
1139 iso_pu_bacteria 8049293176 8049293313 397
1140 iso_pu_bacteria 8054460903 8054461209 397
1141 iso_pu_bacteria 8054558443 8054563018 397
1142 iso_pu_bacteria 8055431914 8055433551 397
1143 iso_pu_bacteria 8055617313 8055624736 397
1144 iso_pu_bacteria 8055742211 8055743272 397
1145 iso_pu_bacteria 8056375014 8056378607 397
1146 iso_pu_bacteria 8056382006 8056385788 397
1147 iso_pu_bacteria 8056673599 8056679267 397
1148 iso_pu_bacteria 8056681323 8056687090 397
1149 iso_pu_bacteria 8056689827 8056694628 397
1150 iso_pu_bacteria 8056875544 8056877120 397
1151 iso_pu_bacteria 8056967851 8056975531 397
1152 iso_pu_bacteria 8057529695 8057534333 397
1153 iso_pu_bacteria 8057575449 8057580584 397
1154 iso_pu_bacteria 8057874678 8057875852 397
1155 3300046526 Ga0495666_0000006 Ga0495666_0000006_16772_17977 400
1156 3300046680 Ga0495646_0014178 Ga0495646_0014178_24_1235 400
1157 3300047319 Ga0495674_0000106 Ga0495674_0000106_48982_50187 400
1158 3300047320 Ga0495672_0011526 Ga0495672_0011526_2221_3426 400
1159 3300049568 Ga0501031_0014923 Ga0501031_0014923_3736_4941 400
1160 3300049570 Ga0501033_0000786 Ga0501033_0000786_19989_21194 400
1161 3300049573 Ga0501037_0000283 Ga0501037_0000283_34204_35409 400
1162 3300049579 Ga0501043_0000005 Ga0501043_0000005_212767_213972 400
1163 3300049584 Ga0501068_0010671 Ga0501068_0010671_1328_2533 400
1164 3300049585 Ga0501069_0000033 Ga0501069_0000033_50733_51938 400
1165 3300049586 Ga0501070_0013663 Ga0501070_0013663_399_1604 400
1166 3300049590 Ga0501074_0000053 Ga0501074_0000053_16249_17454 400
1167 3300049590 Ga0501074_0049249 Ga0501074_0049249_578_1783 400
1168 3300049742 Ga0501080_0004864 Ga0501080_0004864_2714_3919 400
1169 3300049744 Ga0501083_0000063 Ga0501083_0000063_66539_67744 400
1170 3300049822 Ga0501035_0000086 Ga0501035_0000086_74078_75283 400
1171 3300049822 Ga0501035_0000288 Ga0501035_0000288_34098_35303 400
1172 3300049822 Ga0501035_0036945 Ga0501035_0036945_2582_3787 400
1173 3300049823 Ga0501044_0000223 Ga0501044_0000223_5035_6240 400
1174 3300049823 Ga0501044_0028969 Ga0501044_0028969_2132_3337 400
1175 3300049823 Ga0501044_0095035 Ga0501044_0095035_745_1950 400
1176 3300049823 Ga0501044_0106534 Ga0501044_0106534_612_1817 400
1177 3300053156 Ga0500622_0002229 Ga0500622_0002229_47_1252 400
1178 3300060353 Ga0501082_0068505 Ga0501082_0068505_1616_2821 400
1179 2209111006 2214856302 2213902446 401
1180 3300000042 ARSoilYngRDRAFT_c00110 ARSoilYngRDRAFT_001108 401
1181 3300000043 ARcpr5yngRDRAFT_c000135 ARcpr5yngRDRAFT_0001353 401
1182 3300000044 ARSoilOldRDRAFT_c000118 ARSoilOldRDRAFT_0001188 401
1183 3300000045 ARCol0oldRDRAFT_c00031 ARCol0oldRDRAFT_000313 401
1184 3300000652 ARCol0yngRDRAFT_1000154 ARCol0yngRDRAFT_10001548 401
1185 3300001989 JGI24739J22299_10037086 JGI24739J22299_100370862 401
1186 3300002067 JGI24735J21928_10032585 JGI24735J21928_100325851 401
1187 3300002244 JGI24742J22300_10003084 JGI24742J22300_100030842 401
1188 3300002704 JGI25155J39150_1000013 JGI25155J39150_100001322 401
1189 3300002705 JGI25156J39149_1000011 JGI25156J39149_100001122 401
1190 3300002737 JGI25162J39368_1000169 JGI25162J39368_100016944 401
1191 3300002737 JGI25162J39368_1003036 JGI25162J39368_10030362 401
1192 3300002738 JGI25154J39366_1000030 JGI25154J39366_100003022 401
1193 3300002739 JGI25158J39367_1003938 JGI25158J39367_10039381 401
1194 3300002741 JGI25157J39369_1000013 JGI25157J39369_100001322 401
1195 3300002773 JGI25152J39213_1000798 JGI25152J39213_10007985 401
1196 3300002773 JGI25152J39213_1001975 JGI25152J39213_10019752 401
1197 3300002773 JGI25152J39213_1003710 JGI25152J39213_10037104 401
1198 3300002773 JGI25152J39213_1005747 JGI25152J39213_10057472 401
1199 3300002774 JGI25150J39212_1000810 JGI25150J39212_10008101 401
1200 3300002774 JGI25150J39212_1005834 JGI25150J39212_10058342 401
1201 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003188 401
1202 3300002987 JGI25159J45721_1000591 JGI25159J45721_100059113 401
1203 3300002987 JGI25159J45721_1002704 JGI25159J45721_10027045 401
1204 3300003187 JGI25151J46595_10000018 JGI25151J46595_1000001863 401
1205 3300003187 JGI25151J46595_10000110 JGI25151J46595_1000011010 401
1206 3300003187 JGI25151J46595_10000681 JGI25151J46595_1000068114 401
1207 3300003187 JGI25151J46595_10003489 JGI25151J46595_100034897 401
1208 3300003187 JGI25151J46595_10009047 JGI25151J46595_100090474 401
1209 3300003187 JGI25151J46595_10010820 JGI25151J46595_100108202 401
1210 3300003203 JGI25406J46586_10000063 JGI25406J46586_1000006323 401
1211 3300003203 JGI25406J46586_10030475 JGI25406J46586_100304751 401
1212 3300003214 JGI25165J46597_1000019 JGI25165J46597_1000019299 401
1213 3300003214 JGI25165J46597_1000349 JGI25165J46597_100034931 401
1214 3300003214 JGI25165J46597_1000355 JGI25165J46597_100035510 401
1215 3300003214 JGI25165J46597_1005721 JGI25165J46597_10057211 401
1216 3300003215 JGI25153J46596_10001081 JGI25153J46596_100010816 401
1217 3300003215 JGI25153J46596_10002687 JGI25153J46596_100026872 401
1218 3300003215 JGI25153J46596_10014754 JGI25153J46596_100147543 401
1219 3300003215 JGI25153J46596_10018100 JGI25153J46596_100181002 401
1220 3300003215 JGI25153J46596_10020756 JGI25153J46596_100207562 401
1221 3300003320 rootH2_10018950 rootH2_1001895013 401
1222 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003369 401
1223 3300003354 JGI25160J50197_1000041 JGI25160J50197_100004187 401
1224 3300003354 JGI25160J50197_1002508 JGI25160J50197_10025088 401
1225 3300003354 JGI25160J50197_1004045 JGI25160J50197_10040456 401
1226 3300003354 JGI25160J50197_1011256 JGI25160J50197_10112561 401
1227 3300003354 JGI25160J50197_1018142 JGI25160J50197_10181422 401
1228 3300003374 JGI25161J50226_1000002 JGI25161J50226_100000287 401
1229 3300003374 JGI25161J50226_1000122 JGI25161J50226_10001222 401
1230 3300003374 JGI25161J50226_1001136 JGI25161J50226_10011364 401
1231 3300003374 JGI25161J50226_1007267 JGI25161J50226_10072672 401
1232 3300003578 Ga0006562J51391_1013576 Ga0006562J51391_10135763 401
1233 3300003659 JGI25404J52841_10005199 JGI25404J52841_100051992 401
1234 3300003659 JGI25404J52841_10010567 JGI25404J52841_100105672 401
1235 3300003762 Ga0055542_1000656 Ga0055542_100065621 401
1236 3300003771 Ga0055526_1000243 Ga0055526_100024313 401
1237 3300003771 Ga0055526_1000725 Ga0055526_100072510 401
1238 3300003771 Ga0055526_1001105 Ga0055526_10011058 401
1239 3300003771 Ga0055526_1001581 Ga0055526_100158110 401
1240 3300003771 Ga0055526_1008338 Ga0055526_10083384 401
1241 3300003771 Ga0055526_1016655 Ga0055526_10166552 401
1242 3300003771 Ga0055526_1017886 Ga0055526_10178862 401
1243 3300003771 Ga0055526_1018301 Ga0055526_10183012 401
1244 3300003775 Ga0055524_1000048 Ga0055524_100004868 401
1245 3300003775 Ga0055524_1000553 Ga0055524_100055313 401
1246 3300003775 Ga0055524_1010740 Ga0055524_10107403 401
1247 3300003775 Ga0055524_1013232 Ga0055524_10132322 401
1248 3300003775 Ga0055524_1016018 Ga0055524_10160182 401
1249 3300003790 Ga0055528_1001113 Ga0055528_100111311 401
1250 3300003790 Ga0055528_1006363 Ga0055528_10063632 401
1251 3300003790 Ga0055528_1008984 Ga0055528_10089842 401
1252 3300003790 Ga0055528_1011964 Ga0055528_10119642 401
1253 3300003792 Ga0055540_1000190 Ga0055540_100019037 401
1254 3300003792 Ga0055540_1002584 Ga0055540_10025845 401
1255 3300003792 Ga0055540_1008813 Ga0055540_10088132 401
1256 3300003794 Ga0055531_10007481 Ga0055531_100074812 401
1257 3300003794 Ga0055531_10011017 Ga0055531_100110173 401
1258 3300003856 Ga0058692_1006646 Ga0058692_10066462 401
1259 3300003856 Ga0058692_1010698 Ga0058692_10106982 401
1260 3300003856 Ga0058692_1014934 Ga0058692_10149341 401
1261 3300004625 Ga0055543_1000008 Ga0055543_100000829 401
1262 3300004625 Ga0055543_1000059 Ga0055543_100005984 401
1263 3300004625 Ga0055543_1005647 Ga0055543_10056472 401
1264 3300004625 Ga0055543_1006626 Ga0055543_10066262 401
1265 3300005262 Ga0065165_1000031 Ga0065165_1000031100 401
1266 3300005262 Ga0065165_1000084 Ga0065165_100008445 401
1267 3300005262 Ga0065165_1000337 Ga0065165_100033767 401
1268 3300005262 Ga0065165_1001384 Ga0065165_100138411 401
1269 3300005262 Ga0065165_1001884 Ga0065165_100188419 401
1270 3300005262 Ga0065165_1004086 Ga0065165_10040865 401
1271 3300005262 Ga0065165_1004925 Ga0065165_10049252 401
1272 3300005262 Ga0065165_1007961 Ga0065165_10079615 401
1273 3300005262 Ga0065165_1014726 Ga0065165_10147262 401
1274 3300005276 Ga0065717_1001970 Ga0065717_10019703 401
1275 3300005277 Ga0065716_1002100 Ga0065716_10021002 401
1276 3300005290 Ga0065712_10000879 Ga0065712_100008796 401
1277 3300005290 Ga0065712_10088405 Ga0065712_100884053 401
1278 3300005290 Ga0065712_10089909 Ga0065712_100899092 401
1279 3300005293 Ga0065715_10001041 Ga0065715_100010418 401
1280 3300005295 Ga0065707_10000429 Ga0065707_1000042977 401
1281 3300005327 Ga0070658_10008048 Ga0070658_100080484 401
1282 3300005327 Ga0070658_10041998 Ga0070658_100419983 401
1283 3300005327 Ga0070658_10106990 Ga0070658_101069902 401
1284 3300005327 Ga0070658_10126919 Ga0070658_101269191 401
1285 3300005328 Ga0070676_10066760 Ga0070676_100667601 401
1286 3300005330 Ga0070690_100010321 Ga0070690_1000103214 401
1287 3300005330 Ga0070690_100112157 Ga0070690_1001121572 401
1288 3300005330 Ga0070690_100137030 Ga0070690_1001370301 401
1289 3300005330 Ga0070690_100198009 Ga0070690_1001980091 401
1290 3300005331 Ga0070670_100000160 Ga0070670_10000016047 401
1291 3300005331 Ga0070670_100012351 Ga0070670_1000123515 401
1292 3300005331 Ga0070670_100045666 Ga0070670_1000456662 401
1293 3300005331 Ga0070670_100056600 Ga0070670_1000566003 401
1294 3300005331 Ga0070670_100206197 Ga0070670_1002061971 401
1295 3300005334 Ga0068869_100002361 Ga0068869_1000023618 401
1296 3300005334 Ga0068869_100105365 Ga0068869_1001053652 401
1297 3300005334 Ga0068869_100214637 Ga0068869_1002146371 401
1298 3300005335 Ga0070666_10038386 Ga0070666_100383862 401
1299 3300005336 Ga0070680_100008313 Ga0070680_1000083133 401
1300 3300005336 Ga0070680_100009816 Ga0070680_1000098163 401
1301 3300005336 Ga0070680_100031370 Ga0070680_1000313702 401
1302 3300005336 Ga0070680_100040837 Ga0070680_1000408373 401
1303 3300005336 Ga0070680_100064174 Ga0070680_1000641742 401
1304 3300005336 Ga0070680_100123337 Ga0070680_1001233372 401
1305 3300005336 Ga0070680_100145083 Ga0070680_1001450833 401
1306 3300005336 Ga0070680_100189074 Ga0070680_1001890742 401
1307 3300005337 Ga0070682_100001700 Ga0070682_1000017003 401
1308 3300005337 Ga0070682_100037461 Ga0070682_1000374612 401
1309 3300005337 Ga0070682_100048214 Ga0070682_1000482142 401
1310 3300005337 Ga0070682_100101196 Ga0070682_1001011961 401
1311 3300005337 Ga0070682_100117519 Ga0070682_1001175192 401
1312 3300005338 Ga0068868_100035824 Ga0068868_1000358243 401
1313 3300005339 Ga0070660_100003066 Ga0070660_1000030663 401
1314 3300005339 Ga0070660_100022096 Ga0070660_1000220963 401
1315 3300005339 Ga0070660_100076905 Ga0070660_1000769052 401
1316 3300005339 Ga0070660_100103580 Ga0070660_1001035802 401
1317 3300005339 Ga0070660_100110176 Ga0070660_1001101763 401
1318 3300005339 Ga0070660_100149476 Ga0070660_1001494761 401
1319 3300005340 Ga0070689_100011560 Ga0070689_1000115601 401
1320 3300005340 Ga0070689_100256063 Ga0070689_1002560632 401
1321 3300005341 Ga0070691_10047014 Ga0070691_100470142 401
1322 3300005343 Ga0070687_100033814 Ga0070687_1000338143 401
1323 3300005343 Ga0070687_100046191 Ga0070687_1000461913 401
1324 3300005344 Ga0070661_100136283 Ga0070661_1001362832 401
1325 3300005345 Ga0070692_10041383 Ga0070692_100413831 401
1326 3300005345 Ga0070692_10135050 Ga0070692_101350501 401
1327 3300005347 Ga0070668_100118002 Ga0070668_1001180022 401
1328 3300005347 Ga0070668_100133084 Ga0070668_1001330841 401
1329 3300005347 Ga0070668_100307814 Ga0070668_1003078141 401
1330 3300005353 Ga0070669_100035485 Ga0070669_1000354852 401
1331 3300005353 Ga0070669_100054477 Ga0070669_1000544771 401
1332 3300005354 Ga0070675_100089051 Ga0070675_1000890513 401
1333 3300005354 Ga0070675_100259109 Ga0070675_1002591091 401
1334 3300005355 Ga0070671_100061825 Ga0070671_1000618253 401
1335 3300005355 Ga0070671_100237081 Ga0070671_1002370812 401
1336 3300005356 Ga0070674_100000400 Ga0070674_10000040010 401
1337 3300005364 Ga0070673_100066348 Ga0070673_1000663483 401
1338 3300005364 Ga0070673_100306090 Ga0070673_1003060901 401
1339 3300005365 Ga0070688_100004865 Ga0070688_1000048651 401
1340 3300005365 Ga0070688_100020032 Ga0070688_1000200323 401
1341 3300005365 Ga0070688_100052505 Ga0070688_1000525051 401
1342 3300005366 Ga0070659_100090913 Ga0070659_1000909132 401
1343 3300005366 Ga0070659_100158003 Ga0070659_1001580031 401
1344 3300005367 Ga0070667_100096959 Ga0070667_1000969593 401
1345 3300005367 Ga0070667_100172829 Ga0070667_1001728292 401
1346 3300005367 Ga0070667_100204605 Ga0070667_1002046051 401
1347 3300005434 Ga0070709_10000703 Ga0070709_1000070314 401
1348 3300005434 Ga0070709_10004239 Ga0070709_100042393 401
1349 3300005434 Ga0070709_10009871 Ga0070709_100098712 401
1350 3300005434 Ga0070709_10027103 Ga0070709_100271032 401
1351 3300005434 Ga0070709_10052964 Ga0070709_100529642 401
1352 3300005435 Ga0070714_100005875 Ga0070714_1000058755 401
1353 3300005435 Ga0070714_100030096 Ga0070714_1000300963 401
1354 3300005435 Ga0070714_100033356 Ga0070714_1000333562 401
1355 3300005435 Ga0070714_100056490 Ga0070714_1000564902 401
1356 3300005435 Ga0070714_100076284 Ga0070714_1000762842 401
1357 3300005435 Ga0070714_100259619 Ga0070714_1002596192 401
1358 3300005436 Ga0070713_100002629 Ga0070713_1000026292 401
1359 3300005436 Ga0070713_100030587 Ga0070713_1000305872 401
1360 3300005436 Ga0070713_100040317 Ga0070713_1000403173 401
1361 3300005436 Ga0070713_100044541 Ga0070713_1000445412 401
1362 3300005436 Ga0070713_100059393 Ga0070713_1000593932 401
1363 3300005436 Ga0070713_100067939 Ga0070713_1000679392 401
1364 3300005436 Ga0070713_100134887 Ga0070713_1001348872 401
1365 3300005436 Ga0070713_100258504 Ga0070713_1002585042 401
1366 3300005437 Ga0070710_10000433 Ga0070710_100004332 401
1367 3300005437 Ga0070710_10010456 Ga0070710_100104562 401
1368 3300005437 Ga0070710_10040861 Ga0070710_100408613 401
1369 3300005437 Ga0070710_10178862 Ga0070710_101788621 401
1370 3300005438 Ga0070701_10060305 Ga0070701_100603051 401
1371 3300005439 Ga0070711_100012274 Ga0070711_1000122743 401
1372 3300005439 Ga0070711_100069923 Ga0070711_1000699231 401
1373 3300005440 Ga0070705_100089207 Ga0070705_1000892073 401
1374 3300005440 Ga0070705_100096063 Ga0070705_1000960632 401
1375 3300005441 Ga0070700_100001050 Ga0070700_1000010508 401
1376 3300005444 Ga0070694_100062440 Ga0070694_1000624403 401
1377 3300005455 Ga0070663_100028807 Ga0070663_1000288073 401
1378 3300005455 Ga0070663_100041678 Ga0070663_1000416782 401
1379 3300005455 Ga0070663_100213041 Ga0070663_1002130412 401
1380 3300005456 Ga0070678_100081577 Ga0070678_1000815773 401
1381 3300005457 Ga0070662_100006555 Ga0070662_1000065556 401
1382 3300005457 Ga0070662_100071923 Ga0070662_1000719232 401
1383 3300005457 Ga0070662_100085970 Ga0070662_1000859703 401
1384 3300005457 Ga0070662_100122176 Ga0070662_1001221763 401
1385 3300005458 Ga0070681_10007294 Ga0070681_100072942 401
1386 3300005458 Ga0070681_10012773 Ga0070681_100127736 401
1387 3300005458 Ga0070681_10036487 Ga0070681_100364874 401
1388 3300005458 Ga0070681_10071184 Ga0070681_100711841 401
1389 3300005458 Ga0070681_10126704 Ga0070681_101267041 401
1390 3300005458 Ga0070681_10250639 Ga0070681_102506391 401
1391 3300005458 Ga0070681_10328692 Ga0070681_103286922 401
1392 3300005459 Ga0068867_100008314 Ga0068867_1000083147 401
1393 3300005459 Ga0068867_100036408 Ga0068867_1000364083 401
1394 3300005466 Ga0070685_10003371 Ga0070685_100033716 401
1395 3300005468 Ga0070707_100037450 Ga0070707_1000374502 401
1396 3300005468 Ga0070707_100188909 Ga0070707_1001889092 401
1397 3300005468 Ga0070707_100234455 Ga0070707_1002344552 401
1398 3300005518 Ga0070699_100001130 Ga0070699_10000113015 401
1399 3300005518 Ga0070699_100073094 Ga0070699_1000730943 401
1400 3300005530 Ga0070679_100013144 Ga0070679_1000131442 401
1401 3300005530 Ga0070679_100037517 Ga0070679_1000375172 401
1402 3300005530 Ga0070679_100042937 Ga0070679_1000429372 401
1403 3300005530 Ga0070679_100047969 Ga0070679_1000479693 401
1404 3300005530 Ga0070679_100070987 Ga0070679_1000709873 401
1405 3300005530 Ga0070679_100112400 Ga0070679_1001124001 401
1406 3300005530 Ga0070679_100446223 Ga0070679_1004462231 401
1407 3300005535 Ga0070684_100001394 Ga0070684_1000013944 401
1408 3300005535 Ga0070684_100061206 Ga0070684_1000612063 401
1409 3300005536 Ga0070697_100091706 Ga0070697_1000917062 401
1410 3300005539 Ga0068853_100097730 Ga0068853_1000977302 401
1411 3300005543 Ga0070672_100002147 Ga0070672_1000021473 401
1412 3300005543 Ga0070672_100024262 Ga0070672_1000242622 401
1413 3300005543 Ga0070672_100060219 Ga0070672_1000602193 401
1414 3300005544 Ga0070686_100027605 Ga0070686_1000276051 401
1415 3300005544 Ga0070686_100170313 Ga0070686_1001703132 401
1416 3300005545 Ga0070695_100023440 Ga0070695_1000234403 401
1417 3300005545 Ga0070695_100090389 Ga0070695_1000903892 401
1418 3300005546 Ga0070696_100023961 Ga0070696_1000239612 401
1419 3300005546 Ga0070696_100032459 Ga0070696_1000324591 401
1420 3300005547 Ga0070693_100001982 Ga0070693_1000019822 401
1421 3300005547 Ga0070693_100012855 Ga0070693_1000128553 401
1422 3300005548 Ga0070665_100012421 Ga0070665_1000124215 401
1423 3300005548 Ga0070665_100016963 Ga0070665_1000169633 401
1424 3300005548 Ga0070665_100076983 Ga0070665_1000769833 401
1425 3300005548 Ga0070665_100093220 Ga0070665_1000932202 401
1426 3300005548 Ga0070665_100127570 Ga0070665_1001275702 401
1427 3300005548 Ga0070665_100147170 Ga0070665_1001471703 401
1428 3300005548 Ga0070665_100225864 Ga0070665_1002258642 401
1429 3300005549 Ga0070704_100271893 Ga0070704_1002718931 401
1430 3300005563 Ga0068855_100002901 Ga0068855_10000290113 401
1431 3300005563 Ga0068855_100007643 Ga0068855_1000076432 401
1432 3300005563 Ga0068855_100018537 Ga0068855_1000185374 401
1433 3300005563 Ga0068855_100095545 Ga0068855_1000955451 401
1434 3300005563 Ga0068855_100116677 Ga0068855_1001166772 401
1435 3300005563 Ga0068855_100145794 Ga0068855_1001457941 401
1436 3300005563 Ga0068855_100153468 Ga0068855_1001534682 401
1437 3300005563 Ga0068855_100153912 Ga0068855_1001539122 401
1438 3300005564 Ga0070664_100093900 Ga0070664_1000939002 401
1439 3300005564 Ga0070664_100192704 Ga0070664_1001927043 401
1440 3300005577 Ga0068857_100011714 Ga0068857_1000117145 401
1441 3300005614 Ga0068856_100000834 Ga0068856_10000083411 401
1442 3300005614 Ga0068856_100059894 Ga0068856_1000598942 401
1443 3300005614 Ga0068856_100101546 Ga0068856_1001015462 401
1444 3300005614 Ga0068856_100202925 Ga0068856_1002029253 401
1445 3300005614 Ga0068856_100203002 Ga0068856_1002030022 401
1446 3300005615 Ga0070702_100060542 Ga0070702_1000605422 401
1447 3300005615 Ga0070702_100152264 Ga0070702_1001522642 401
1448 3300005616 Ga0068852_100027241 Ga0068852_1000272414 401
1449 3300005616 Ga0068852_100040980 Ga0068852_1000409802 401
1450 3300005616 Ga0068852_100046218 Ga0068852_1000462182 401
1451 3300005616 Ga0068852_100093575 Ga0068852_1000935752 401
1452 3300005616 Ga0068852_100102533 Ga0068852_1001025331 401
1453 3300005616 Ga0068852_100181504 Ga0068852_1001815043 401
1454 3300005617 Ga0068859_100029761 Ga0068859_1000297615 401
1455 3300005617 Ga0068859_100217649 Ga0068859_1002176493 401
1456 3300005618 Ga0068864_100000147 Ga0068864_10000014726 401
1457 3300005618 Ga0068864_100004760 Ga0068864_1000047602 401
1458 3300005618 Ga0068864_100017107 Ga0068864_1000171072 401
1459 3300005718 Ga0068866_10015728 Ga0068866_100157283 401
1460 3300005719 Ga0068861_100116997 Ga0068861_1001169972 401
1461 3300005834 Ga0068851_10092354 Ga0068851_100923542 401
1462 3300005840 Ga0068870_10039192 Ga0068870_100391922 401
1463 3300005841 Ga0068863_100000420 Ga0068863_10000042028 401
1464 3300005842 Ga0068858_100000037 Ga0068858_10000003713 401
1465 3300005842 Ga0068858_100102379 Ga0068858_1001023793 401
1466 3300005842 Ga0068858_100114420 Ga0068858_1001144203 401
1467 3300005843 Ga0068860_100027519 Ga0068860_1000275192 401
1468 3300005843 Ga0068860_100050583 Ga0068860_1000505832 401
1469 3300005843 Ga0068860_100187556 Ga0068860_1001875563 401
1470 3300005844 Ga0068862_100020998 Ga0068862_1000209982 401
1471 3300005844 Ga0068862_100051815 Ga0068862_1000518152 401
1472 3300005937 Ga0081455_10000012 Ga0081455_100000128 401
1473 3300005937 Ga0081455_10006646 Ga0081455_1000664610 401
1474 3300005937 Ga0081455_10010801 Ga0081455_100108018 401
1475 3300005937 Ga0081455_10018867 Ga0081455_100188675 401
1476 3300005937 Ga0081455_10051245 Ga0081455_100512454 401
1477 3300005937 Ga0081455_10098266 Ga0081455_100982662 401
1478 3300005937 Ga0081455_10122450 Ga0081455_101224503 401
1479 3300005981 Ga0081538_10002850 Ga0081538_100028504 401
1480 3300005981 Ga0081538_10063683 Ga0081538_100636832 401
1481 3300005983 Ga0081540_1000198 Ga0081540_10001987 401
1482 3300005983 Ga0081540_1002214 Ga0081540_10022142 401
1483 3300005983 Ga0081540_1002722 Ga0081540_10027226 401
1484 3300005983 Ga0081540_1003234 Ga0081540_10032342 401
1485 3300005983 Ga0081540_1003934 Ga0081540_10039345 401
1486 3300005983 Ga0081540_1006521 Ga0081540_10065215 401
1487 3300005983 Ga0081540_1007668 Ga0081540_10076682 401
1488 3300005983 Ga0081540_1014692 Ga0081540_10146923 401
1489 3300005983 Ga0081540_1023137 Ga0081540_10231372 401
1490 3300005983 Ga0081540_1024308 Ga0081540_10243082 401
1491 3300005983 Ga0081540_1030214 Ga0081540_10302141 401
1492 3300005983 Ga0081540_1078430 Ga0081540_10784302 401
1493 3300005985 Ga0081539_10000229 Ga0081539_1000022992 401
1494 3300005985 Ga0081539_10001874 Ga0081539_1000187423 401
1495 3300005985 Ga0081539_10002458 Ga0081539_1000245811 401
1496 3300005985 Ga0081539_10014525 Ga0081539_100145253 401
1497 3300005985 Ga0081539_10023586 Ga0081539_100235862 401
1498 3300005985 Ga0081539_10034816 Ga0081539_100348162 401
1499 3300006028 Ga0070717_10013620 Ga0070717_100136205 401
1500 3300006028 Ga0070717_10065196 Ga0070717_100651961 401
1501 3300006028 Ga0070717_10072363 Ga0070717_100723632 401
1502 3300006038 Ga0075365_10002583 Ga0075365_100025836 401
1503 3300006038 Ga0075365_10005121 Ga0075365_100051216 401
1504 3300006038 Ga0075365_10010926 Ga0075365_100109262 401
1505 3300006038 Ga0075365_10031267 Ga0075365_100312672 401
1506 3300006038 Ga0075365_10033656 Ga0075365_100336562 401
1507 3300006048 Ga0075363_100006469 Ga0075363_1000064693 401
1508 3300006048 Ga0075363_100008679 Ga0075363_1000086793 401
1509 3300006048 Ga0075363_100043168 Ga0075363_1000431681 401
1510 3300006048 Ga0075363_100073811 Ga0075363_1000738111 401
1511 3300006048 Ga0075363_100103997 Ga0075363_1001039972 401
1512 3300006048 Ga0075363_100164419 Ga0075363_1001644191 401
1513 3300006051 Ga0075364_10000893 Ga0075364_100008936 401
1514 3300006051 Ga0075364_10001760 Ga0075364_100017602 401
1515 3300006051 Ga0075364_10012189 Ga0075364_100121894 401
1516 3300006051 Ga0075364_10014661 Ga0075364_100146613 401
1517 3300006051 Ga0075364_10039819 Ga0075364_100398192 401
1518 3300006163 Ga0070715_10010133 Ga0070715_100101333 401
1519 3300006173 Ga0070716_100048153 Ga0070716_1000481532 401
1520 3300006175 Ga0070712_100002680 Ga0070712_1000026805 401
1521 3300006175 Ga0070712_100015792 Ga0070712_1000157924 401
1522 3300006175 Ga0070712_100065316 Ga0070712_1000653162 401
1523 3300006177 Ga0075362_10002581 Ga0075362_100025811 401
1524 3300006177 Ga0075362_10019052 Ga0075362_100190522 401
1525 3300006177 Ga0075362_10029975 Ga0075362_100299752 401
1526 3300006178 Ga0075367_10032701 Ga0075367_100327013 401
1527 3300006178 Ga0075367_10042101 Ga0075367_100421013 401
1528 3300006178 Ga0075367_10099789 Ga0075367_100997891 401
1529 3300006178 Ga0075367_10111824 Ga0075367_101118241 401
1530 3300006186 Ga0075369_10009607 Ga0075369_100096071 401
1531 3300006186 Ga0075369_10013034 Ga0075369_100130342 401
1532 3300006186 Ga0075369_10015418 Ga0075369_100154182 401
1533 3300006186 Ga0075369_10041507 Ga0075369_100415072 401
1534 3300006194 Ga0075427_10001919 Ga0075427_100019192 401
1535 3300006195 Ga0075366_10012501 Ga0075366_100125013 401
1536 3300006195 Ga0075366_10020324 Ga0075366_100203243 401
1537 3300006195 Ga0075366_10021871 Ga0075366_100218714 401
1538 3300006195 Ga0075366_10022296 Ga0075366_100222962 401
1539 3300006195 Ga0075366_10091874 Ga0075366_100918742 401
1540 3300006237 Ga0097621_100000078 Ga0097621_1000000783 401
1541 3300006237 Ga0097621_100044356 Ga0097621_1000443563 401
1542 3300006237 Ga0097621_100190838 Ga0097621_1001908382 401
1543 3300006353 Ga0075370_10008411 Ga0075370_100084113 401
1544 3300006353 Ga0075370_10024188 Ga0075370_100241882 401
1545 3300006353 Ga0075370_10029532 Ga0075370_100295323 401
1546 3300006353 Ga0075370_10038419 Ga0075370_100384192 401
1547 3300006353 Ga0075370_10137195 Ga0075370_101371952 401
1548 3300006358 Ga0068871_100001124 Ga0068871_10000112415 401
1549 3300006358 Ga0068871_100040769 Ga0068871_1000407693 401
1550 3300006358 Ga0068871_100045582 Ga0068871_1000455821 401
1551 3300006358 Ga0068871_100210916 Ga0068871_1002109162 401
1552 3300006844 Ga0075428_100051970 Ga0075428_1000519702 401
1553 3300006844 Ga0075428_100089962 Ga0075428_1000899622 401
1554 3300006844 Ga0075428_100125363 Ga0075428_1001253633 401
1555 3300006844 Ga0075428_100211473 Ga0075428_1002114732 401
1556 3300006846 Ga0075430_100000269 Ga0075430_10000026928 401
1557 3300006846 Ga0075430_100022779 Ga0075430_1000227793 401
1558 3300006846 Ga0075430_100186156 Ga0075430_1001861562 401
1559 3300006846 Ga0075430_100198905 Ga0075430_1001989052 401
1560 3300006847 Ga0075431_100004768 Ga0075431_1000047683 401
1561 3300006847 Ga0075431_100022354 Ga0075431_1000223544 401
1562 3300006847 Ga0075431_100194567 Ga0075431_1001945672 401
1563 3300006852 Ga0075433_10000085 Ga0075433_1000008515 401
1564 3300006852 Ga0075433_10135960 Ga0075433_101359602 401
1565 3300006871 Ga0075434_100000251 Ga0075434_10000025116 401
1566 3300006871 Ga0075434_100010176 Ga0075434_1000101765 401
1567 3300006871 Ga0075434_100030752 Ga0075434_1000307524 401
1568 3300006871 Ga0075434_100076565 Ga0075434_1000765653 401
1569 3300006871 Ga0075434_100078083 Ga0075434_1000780832 401
1570 3300006871 Ga0075434_100130748 Ga0075434_1001307482 401
1571 3300006871 Ga0075434_100259460 Ga0075434_1002594602 401
1572 3300006880 Ga0075429_100001112 Ga0075429_1000011123 401
1573 3300006881 Ga0068865_100049746 Ga0068865_1000497462 401
1574 3300006914 Ga0075436_100180261 Ga0075436_1001802611 401
1575 3300006931 Ga0097620_100029760 Ga0097620_1000297601 401
1576 3300006931 Ga0097620_100217641 Ga0097620_1002176411 401
1577 3300006941 Ga0099825_1020613 Ga0099825_10206132 401
1578 3300006941 Ga0099825_1028185 Ga0099825_10281852 401
1579 3300006942 Ga0099824_1016270 Ga0099824_10162706 401
1580 3300006943 Ga0099822_1001342 Ga0099822_10013424 401
1581 3300006944 Ga0099823_1034924 Ga0099823_10349244 401
1582 3300006946 Ga0079104_1001143 Ga0079104_100114315 401
1583 3300006946 Ga0079104_1005235 Ga0079104_10052353 401
1584 3300006946 Ga0079104_1006305 Ga0079104_10063053 401
1585 3300006948 Ga0099826_10000109 Ga0099826_1000010924 401
1586 3300006948 Ga0099826_10020329 Ga0099826_100203292 401
1587 3300007076 Ga0075435_100061188 Ga0075435_1000611883 401
1588 3300007265 Ga0099794_10003122 Ga0099794_100031223 401
1589 3300007788 Ga0099795_10008608 Ga0099795_100086083 401
1590 3300007788 Ga0099795_10018316 Ga0099795_100183161 401
1591 3300009011 Ga0105251_10065194 Ga0105251_100651942 401
1592 3300009093 Ga0105240_10000460 Ga0105240_1000046061 401
1593 3300009093 Ga0105240_10032853 Ga0105240_100328534 401
1594 3300009093 Ga0105240_10102914 Ga0105240_101029142 401
1595 3300009094 Ga0111539_10000250 Ga0111539_1000025010 401
1596 3300009094 Ga0111539_10000762 Ga0111539_1000076225 401
1597 3300009094 Ga0111539_10007868 Ga0111539_100078681 401
1598 3300009094 Ga0111539_10028827 Ga0111539_100288273 401
1599 3300009094 Ga0111539_10029942 Ga0111539_100299421 401
1600 3300009094 Ga0111539_10058596 Ga0111539_100585963 401
1601 3300009094 Ga0111539_10113248 Ga0111539_101132482 401
1602 3300009094 Ga0111539_10117112 Ga0111539_101171121 401
1603 3300009094 Ga0111539_10153265 Ga0111539_101532652 401
1604 3300009094 Ga0111539_10433614 Ga0111539_104336141 401
1605 3300009098 Ga0105245_10006056 Ga0105245_100060563 401
1606 3300009098 Ga0105245_10056197 Ga0105245_100561972 401
1607 3300009098 Ga0105245_10115382 Ga0105245_101153822 401
1608 3300009098 Ga0105245_10266556 Ga0105245_102665562 401
1609 3300009101 Ga0105247_10050062 Ga0105247_100500622 401
1610 3300009147 Ga0114129_10005184 Ga0114129_1000518414 401
1611 3300009147 Ga0114129_10006771 Ga0114129_1000677110 401
1612 3300009147 Ga0114129_10031896 Ga0114129_100318962 401
1613 3300009147 Ga0114129_10052206 Ga0114129_100522063 401
1614 3300009147 Ga0114129_10220155 Ga0114129_102201551 401
1615 3300009147 Ga0114129_10252977 Ga0114129_102529772 401
1616 3300009148 Ga0105243_10087064 Ga0105243_100870643 401
1617 3300009148 Ga0105243_10150242 Ga0105243_101502422 401
1618 3300009174 Ga0105241_10054764 Ga0105241_100547641 401
1619 3300009174 Ga0105241_10080717 Ga0105241_100807171 401
1620 3300009174 Ga0105241_10179381 Ga0105241_101793811 401
1621 3300009176 Ga0105242_10111489 Ga0105242_101114892 401
1622 3300009177 Ga0105248_10004135 Ga0105248_1000413513 401
1623 3300009177 Ga0105248_10004606 Ga0105248_100046065 401
1624 3300009177 Ga0105248_10006469 Ga0105248_100064696 401
1625 3300009177 Ga0105248_10140184 Ga0105248_101401842 401
1626 3300009177 Ga0105248_10164736 Ga0105248_101647361 401
1627 3300009177 Ga0105248_10175005 Ga0105248_101750052 401
1628 3300009177 Ga0105248_10176078 Ga0105248_101760782 401
1629 3300009545 Ga0105237_10026532 Ga0105237_100265322 401
1630 3300009545 Ga0105237_10066954 Ga0105237_100669542 401
1631 3300009545 Ga0105237_10101393 Ga0105237_101013932 401
1632 3300009545 Ga0105237_10149594 Ga0105237_101495943 401
1633 3300009545 Ga0105237_10172544 Ga0105237_101725443 401
1634 3300009545 Ga0105237_10303150 Ga0105237_103031502 401
1635 3300009551 Ga0105238_10001735 Ga0105238_100017356 401
1636 3300009551 Ga0105238_10004417 Ga0105238_100044173 401
1637 3300009551 Ga0105238_10023557 Ga0105238_100235574 401
1638 3300009551 Ga0105238_10077647 Ga0105238_100776473 401
1639 3300009551 Ga0105238_10142297 Ga0105238_101422972 401
1640 3300009553 Ga0105249_10014822 Ga0105249_100148221 401
1641 3300009553 Ga0105249_10309553 Ga0105249_103095531 401
1642 3300009765 Ga0123341_1001936 Ga0123341_100193611 401
1643 3300010375 Ga0105239_10000803 Ga0105239_100008032 401
1644 3300010375 Ga0105239_10001281 Ga0105239_100012815 401
1645 3300010375 Ga0105239_10060046 Ga0105239_100600463 401
1646 3300010375 Ga0105239_10087765 Ga0105239_100877653 401
1647 3300010375 Ga0105239_10143165 Ga0105239_101431653 401
1648 3300010375 Ga0105239_10157149 Ga0105239_101571492 401
1649 3300010375 Ga0105239_10212035 Ga0105239_102120352 401
1650 3300011119 Ga0105246_10060308 Ga0105246_100603082 401
1651 3300012480 Ga0157346_1000757 Ga0157346_10007572 401
1652 3300013100 Ga0157373_10032680 Ga0157373_100326802 401
1653 3300013100 Ga0157373_10063521 Ga0157373_100635212 401
1654 3300013102 Ga0157371_10000004 Ga0157371_10000004390 401
1655 3300013102 Ga0157371_10106927 Ga0157371_101069273 401
1656 3300013104 Ga0157370_10000185 Ga0157370_1000018545 401
1657 3300013104 Ga0157370_10000879 Ga0157370_1000087920 401
1658 3300013104 Ga0157370_10025421 Ga0157370_100254215 401
1659 3300013104 Ga0157370_10176137 Ga0157370_101761371 401
1660 3300013105 Ga0157369_10013216 Ga0157369_100132164 401
1661 3300013105 Ga0157369_10097753 Ga0157369_100977533 401
1662 3300013105 Ga0157369_10267738 Ga0157369_102677382 401
1663 3300013249 Ga0171463_1001 Ga0171463_1001921 401
1664 3300013250 Ga0171462_1009 Ga0171462_100962 401
1665 3300013296 Ga0157374_10142880 Ga0157374_101428802 401
1666 3300013297 Ga0157378_10004399 Ga0157378_100043992 401
1667 3300013297 Ga0157378_10024858 Ga0157378_100248583 401
1668 3300013297 Ga0157378_10207419 Ga0157378_102074191 401
1669 3300013306 Ga0163162_10089212 Ga0163162_100892122 401
1670 3300013306 Ga0163162_10124721 Ga0163162_101247212 401
1671 3300013306 Ga0163162_10340623 Ga0163162_103406232 401
1672 3300013307 Ga0157372_10008823 Ga0157372_100088232 401
1673 3300013307 Ga0157372_10043253 Ga0157372_100432532 401
1674 3300013307 Ga0157372_10249482 Ga0157372_102494822 401
1675 3300013308 Ga0157375_10125212 Ga0157375_101252121 401
1676 3300014325 Ga0163163_10017889 Ga0163163_100178891 401
1677 3300014325 Ga0163163_10122252 Ga0163163_101222522 401
1678 3300014325 Ga0163163_10217483 Ga0163163_102174832 401
1679 3300014326 Ga0157380_10002299 Ga0157380_100022996 401
1680 3300014326 Ga0157380_10033282 Ga0157380_100332823 401
1681 3300014326 Ga0157380_10073424 Ga0157380_100734242 401
1682 3300014326 Ga0157380_10088483 Ga0157380_100884831 401
1683 3300014326 Ga0157380_10326357 Ga0157380_103263572 401
1684 3300014968 Ga0157379_10030336 Ga0157379_100303363 401
1685 3300014968 Ga0157379_10058501 Ga0157379_100585013 401
1686 3300015262 Ga0182007_10024047 Ga0182007_100240472 401
1687 3300015684 Ga0183365_10236 Ga0183365_102362 401
1688 3300015690 Ga0183363_1134 Ga0183363_11345 401
1689 3300017792 Ga0163161_10026891 Ga0163161_100268913 401
1690 3300017792 Ga0163161_10055661 Ga0163161_100556612 401
1691 3300017792 Ga0163161_10123133 Ga0163161_101231332 401
1692 3300021320 Ga0214544_1000003 Ga0214544_1000003264 401
1693 3300021320 Ga0214544_1002289 Ga0214544_10022894 401
1694 3300021321 Ga0214542_1000003 Ga0214542_1000003254 401
1695 3300021321 Ga0214542_1001074 Ga0214542_100107433 401
1696 3300021324 Ga0214545_1000004 Ga0214545_1000004267 401
1697 3300021324 Ga0214545_1027665 Ga0214545_10276652 401
1698 3300021327 Ga0214543_1000007 Ga0214543_1000007150 401
1699 3300021327 Ga0214543_1000027 Ga0214543_1000027159 401
1700 3300021327 Ga0214543_1000897 Ga0214543_100089733 401
1701 3300021327 Ga0214543_1027547 Ga0214543_10275472 401
1702 3300021361 Ga0213872_10061427 Ga0213872_100614272 401
1703 3300021377 Ga0213874_10009803 Ga0213874_100098032 401
1704 3300021384 Ga0213876_10002253 Ga0213876_100022536 401
1705 3300021384 Ga0213876_10002567 Ga0213876_100025672 401
1706 3300021384 Ga0213876_10021282 Ga0213876_100212822 401
1707 3300021384 Ga0213876_10026316 Ga0213876_100263162 401
1708 3300021384 Ga0213876_10028813 Ga0213876_100288133 401
1709 3300021384 Ga0213876_10047056 Ga0213876_100470563 401
1710 3300021384 Ga0213876_10047691 Ga0213876_100476912 401
1711 3300021388 Ga0213875_10000011 Ga0213875_1000001140 401
1712 3300021388 Ga0213875_10016147 Ga0213875_100161473 401
1713 3300021388 Ga0213875_10019974 Ga0213875_100199742 401
1714 3300021441 Ga0213871_10017503 Ga0213871_100175031 401
1715 3300021441 Ga0213871_10030986 Ga0213871_100309861 401
1716 3300022467 Ga0224712_10017747 Ga0224712_100177472 401
1717 3300022739 Ga0228711_1000041 Ga0228711_100004163 401
1718 3300022740 Ga0228710_1000024 Ga0228710_100002490 401
1719 3300023547 Ga0247554_100353 Ga0247554_1003531 401
1720 3300024225 Ga0224572_1012666 Ga0224572_10126661 401
1721 3300024227 Ga0228598_1000352 Ga0228598_10003525 401
1722 3300025206 Ga0209435_100026 Ga0209435_10002622 401
1723 3300025208 Ga0209436_100006 Ga0209436_10000694 401
1724 3300025228 Ga0209672_104047 Ga0209672_1040472 401
1725 3300025233 Ga0209437_100056 Ga0209437_10005681 401
1726 3300025233 Ga0209437_100196 Ga0209437_10019685 401
1727 3300025233 Ga0209437_104701 Ga0209437_1047012 401
1728 3300025245 Ga0207425_1000012 Ga0207425_1000012155 401
1729 3300025245 Ga0207425_1000942 Ga0207425_10009429 401
1730 3300025245 Ga0207425_1005429 Ga0207425_10054292 401
1731 3300025246 Ga0209646_1000084 Ga0209646_100008422 401
1732 3300025246 Ga0209646_1005895 Ga0209646_10058952 401
1733 3300025250 Ga0209026_1000013 Ga0209026_100001395 401
1734 3300025250 Ga0209026_1000080 Ga0209026_100008022 401
1735 3300025253 Ga0209677_100296 Ga0209677_10029621 401
1736 3300025253 Ga0209677_101907 Ga0209677_1019076 401
1737 3300025253 Ga0209677_102649 Ga0209677_1026492 401
1738 3300025254 Ga0209148_1000210 Ga0209148_100021037 401
1739 3300025254 Ga0209148_1002306 Ga0209148_10023066 401
1740 3300025256 Ga0209759_1000061 Ga0209759_100006122 401
1741 3300025258 Ga0209129_1000105 Ga0209129_1000105106 401
1742 3300025258 Ga0209129_1000429 Ga0209129_10004299 401
1743 3300025258 Ga0209129_1001159 Ga0209129_100115910 401
1744 3300025258 Ga0209129_1002089 Ga0209129_10020893 401
1745 3300025261 Ga0209233_1000034 Ga0209233_1000034482 401
1746 3300025261 Ga0209233_1000037 Ga0209233_1000037477 401
1747 3300025261 Ga0209233_1000071 Ga0209233_100007181 401
1748 3300025261 Ga0209233_1000243 Ga0209233_100024336 401
1749 3300025261 Ga0209233_1002398 Ga0209233_10023986 401
1750 3300025261 Ga0209233_1010503 Ga0209233_10105032 401
1751 3300025272 Ga0209455_1000098 Ga0209455_100009856 401
1752 3300025272 Ga0209455_1006501 Ga0209455_10065012 401
1753 3300025273 Ga0209673_1000015 Ga0209673_1000015541 401
1754 3300025273 Ga0209673_1000063 Ga0209673_1000063158 401
1755 3300025273 Ga0209673_1001004 Ga0209673_100100436 401
1756 3300025273 Ga0209673_1004453 Ga0209673_10044533 401
1757 3300025273 Ga0209673_1006768 Ga0209673_10067684 401
1758 3300025273 Ga0209673_1012697 Ga0209673_10126971 401
1759 3300025284 Ga0209130_1000002 Ga0209130_1000002230 401
1760 3300025284 Ga0209130_1000005 Ga0209130_1000005109 401
1761 3300025284 Ga0209130_1000382 Ga0209130_100038219 401
1762 3300025284 Ga0209130_1000384 Ga0209130_100038425 401
1763 3300025291 Ga0209675_1001743 Ga0209675_10017435 401
1764 3300025294 Ga0209025_1000010 Ga0209025_100001071 401
1765 3300025294 Ga0209025_1000024 Ga0209025_1000024155 401
1766 3300025294 Ga0209025_1000037 Ga0209025_1000037233 401
1767 3300025294 Ga0209025_1000060 Ga0209025_1000060250 401
1768 3300025294 Ga0209025_1000479 Ga0209025_10004793 401
1769 3300025294 Ga0209025_1000638 Ga0209025_100063834 401
1770 3300025294 Ga0209025_1001253 Ga0209025_100125320 401
1771 3300025294 Ga0209025_1002771 Ga0209025_10027717 401
1772 3300025294 Ga0209025_1007442 Ga0209025_10074425 401
1773 3300025294 Ga0209025_1008173 Ga0209025_10081738 401
1774 3300025294 Ga0209025_1022121 Ga0209025_10221212 401
1775 3300025294 Ga0209025_1025170 Ga0209025_10251702 401
1776 3300025295 Ga0209564_1000019 Ga0209564_1000019248 401
1777 3300025295 Ga0209564_1000034 Ga0209564_1000034238 401
1778 3300025295 Ga0209564_1000093 Ga0209564_1000093112 401
1779 3300025295 Ga0209564_1000384 Ga0209564_100038411 401
1780 3300025295 Ga0209564_1000482 Ga0209564_100048260 401
1781 3300025295 Ga0209564_1001037 Ga0209564_10010374 401
1782 3300025295 Ga0209564_1006011 Ga0209564_10060115 401
1783 3300025295 Ga0209564_1006766 Ga0209564_10067663 401
1784 3300025295 Ga0209564_1007145 Ga0209564_10071456 401
1785 3300025295 Ga0209564_1016310 Ga0209564_10163102 401
1786 3300025295 Ga0209564_1029248 Ga0209564_10292481 401
1787 3300025297 Ga0209758_1000030 Ga0209758_1000030330 401
1788 3300025297 Ga0209758_1000150 Ga0209758_100015010 401
1789 3300025297 Ga0209758_1000329 Ga0209758_100032912 401
1790 3300025297 Ga0209758_1000361 Ga0209758_100036152 401
1791 3300025297 Ga0209758_1000428 Ga0209758_100042842 401
1792 3300025297 Ga0209758_1000499 Ga0209758_100049957 401
1793 3300025297 Ga0209758_1000876 Ga0209758_100087631 401
1794 3300025297 Ga0209758_1000979 Ga0209758_100097910 401
1795 3300025297 Ga0209758_1001056 Ga0209758_10010562 401
1796 3300025297 Ga0209758_1002045 Ga0209758_10020452 401
1797 3300025297 Ga0209758_1004010 Ga0209758_10040106 401
1798 3300025297 Ga0209758_1004113 Ga0209758_10041132 401
1799 3300025297 Ga0209758_1004414 Ga0209758_10044148 401
1800 3300025297 Ga0209758_1004871 Ga0209758_10048712 401
1801 3300025297 Ga0209758_1008595 Ga0209758_10085953 401
1802 3300025297 Ga0209758_1018205 Ga0209758_10182052 401
1803 3300025298 Ga0209050_1006901 Ga0209050_10069013 401
1804 3300025298 Ga0209050_1015315 Ga0209050_10153153 401
1805 3300025299 Ga0209256_1000026 Ga0209256_1000026226 401
1806 3300025299 Ga0209256_1000027 Ga0209256_1000027300 401
1807 3300025299 Ga0209256_1000182 Ga0209256_100018216 401
1808 3300025299 Ga0209256_1000996 Ga0209256_100099628 401
1809 3300025299 Ga0209256_1001405 Ga0209256_10014052 401
1810 3300025299 Ga0209256_1003026 Ga0209256_10030266 401
1811 3300025299 Ga0209256_1004103 Ga0209256_10041036 401
1812 3300025299 Ga0209256_1013277 Ga0209256_10132772 401
1813 3300025302 Ga0207426_1000012 Ga0207426_1000012221 401
1814 3300025302 Ga0207426_1000013 Ga0207426_1000013230 401
1815 3300025302 Ga0207426_1000015 Ga0207426_1000015490 401
1816 3300025302 Ga0207426_1000070 Ga0207426_1000070212 401
1817 3300025302 Ga0207426_1000380 Ga0207426_100038014 401
1818 3300025302 Ga0207426_1001626 Ga0207426_100162615 401
1819 3300025302 Ga0207426_1004309 Ga0207426_10043097 401
1820 3300025302 Ga0207426_1005208 Ga0207426_10052086 401
1821 3300025302 Ga0207426_1012795 Ga0207426_10127952 401
1822 3300025302 Ga0207426_1019290 Ga0207426_10192902 401
1823 3300025303 Ga0209051_1000135 Ga0209051_100013583 401
1824 3300025303 Ga0209051_1017639 Ga0209051_10176392 401
1825 3300025304 Ga0209257_1001109 Ga0209257_100110934 401
1826 3300025304 Ga0209257_1001899 Ga0209257_100189916 401
1827 3300025304 Ga0209257_1003037 Ga0209257_100303711 401
1828 3300025304 Ga0209257_1017293 Ga0209257_10172932 401
1829 3300025315 Ga0207697_10072924 Ga0207697_100729242 401
1830 3300025321 Ga0207656_10005325 Ga0207656_100053252 401
1831 3300025885 Ga0207653_10013980 Ga0207653_100139802 401
1832 3300025893 Ga0207682_10000107 Ga0207682_100001073 401
1833 3300025898 Ga0207692_10000771 Ga0207692_100007712 401
1834 3300025898 Ga0207692_10057435 Ga0207692_100574351 401
1835 3300025899 Ga0207642_10005858 Ga0207642_100058583 401
1836 3300025900 Ga0207710_10021687 Ga0207710_100216872 401
1837 3300025900 Ga0207710_10043769 Ga0207710_100437692 401
1838 3300025900 Ga0207710_10047664 Ga0207710_100476642 401
1839 3300025901 Ga0207688_10009370 Ga0207688_100093705 401
1840 3300025901 Ga0207688_10059455 Ga0207688_100594551 401
1841 3300025904 Ga0207647_10031233 Ga0207647_100312332 401
1842 3300025904 Ga0207647_10067905 Ga0207647_100679052 401
1843 3300025904 Ga0207647_10100331 Ga0207647_101003312 401
1844 3300025905 Ga0207685_10000788 Ga0207685_100007882 401
1845 3300025905 Ga0207685_10008157 Ga0207685_100081573 401
1846 3300025906 Ga0207699_10000568 Ga0207699_100005685 401
1847 3300025906 Ga0207699_10006281 Ga0207699_100062812 401
1848 3300025906 Ga0207699_10018806 Ga0207699_100188062 401
1849 3300025906 Ga0207699_10032028 Ga0207699_100320283 401
1850 3300025906 Ga0207699_10051979 Ga0207699_100519792 401
1851 3300025906 Ga0207699_10057079 Ga0207699_100570793 401
1852 3300025907 Ga0207645_10010290 Ga0207645_100102904 401
1853 3300025907 Ga0207645_10036335 Ga0207645_100363353 401
1854 3300025907 Ga0207645_10081554 Ga0207645_100815542 401
1855 3300025907 Ga0207645_10100436 Ga0207645_101004361 401
1856 3300025907 Ga0207645_10115316 Ga0207645_101153162 401
1857 3300025907 Ga0207645_10125765 Ga0207645_101257651 401
1858 3300025908 Ga0207643_10000123 Ga0207643_1000012327 401
1859 3300025908 Ga0207643_10060360 Ga0207643_100603602 401
1860 3300025909 Ga0207705_10000345 Ga0207705_1000034517 401
1861 3300025909 Ga0207705_10037654 Ga0207705_100376542 401
1862 3300025910 Ga0207684_10051820 Ga0207684_100518204 401
1863 3300025912 Ga0207707_10000514 Ga0207707_1000051421 401
1864 3300025912 Ga0207707_10000830 Ga0207707_1000083017 401
1865 3300025912 Ga0207707_10001115 Ga0207707_1000111525 401
1866 3300025912 Ga0207707_10003928 Ga0207707_100039288 401
1867 3300025912 Ga0207707_10004635 Ga0207707_100046352 401
1868 3300025912 Ga0207707_10045738 Ga0207707_100457382 401
1869 3300025912 Ga0207707_10231781 Ga0207707_102317812 401
1870 3300025912 Ga0207707_10270561 Ga0207707_102705611 401
1871 3300025913 Ga0207695_10000036 Ga0207695_1000003660 401
1872 3300025913 Ga0207695_10000059 Ga0207695_10000059219 401
1873 3300025913 Ga0207695_10120025 Ga0207695_101200252 401
1874 3300025914 Ga0207671_10002082 Ga0207671_100020824 401
1875 3300025914 Ga0207671_10008401 Ga0207671_100084012 401
1876 3300025914 Ga0207671_10008976 Ga0207671_100089768 401
1877 3300025914 Ga0207671_10156487 Ga0207671_101564872 401
1878 3300025915 Ga0207693_10004037 Ga0207693_100040376 401
1879 3300025915 Ga0207693_10004184 Ga0207693_100041846 401
1880 3300025915 Ga0207693_10005556 Ga0207693_100055567 401
1881 3300025915 Ga0207693_10019145 Ga0207693_100191453 401
1882 3300025915 Ga0207693_10025041 Ga0207693_100250414 401
1883 3300025915 Ga0207693_10044585 Ga0207693_100445852 401
1884 3300025915 Ga0207693_10047970 Ga0207693_100479702 401
1885 3300025915 Ga0207693_10074702 Ga0207693_100747022 401
1886 3300025915 Ga0207693_10134018 Ga0207693_101340182 401
1887 3300025916 Ga0207663_10000271 Ga0207663_1000027114 401
1888 3300025916 Ga0207663_10073941 Ga0207663_100739412 401
1889 3300025917 Ga0207660_10002319 Ga0207660_100023198 401
1890 3300025917 Ga0207660_10002659 Ga0207660_100026591 401
1891 3300025917 Ga0207660_10006983 Ga0207660_100069834 401
1892 3300025917 Ga0207660_10050576 Ga0207660_100505762 401
1893 3300025917 Ga0207660_10053997 Ga0207660_100539972 401
1894 3300025917 Ga0207660_10135160 Ga0207660_101351602 401
1895 3300025917 Ga0207660_10231203 Ga0207660_102312031 401
1896 3300025917 Ga0207660_10277780 Ga0207660_102777801 401
1897 3300025918 Ga0207662_10039862 Ga0207662_100398623 401
1898 3300025918 Ga0207662_10088683 Ga0207662_100886832 401
1899 3300025919 Ga0207657_10000333 Ga0207657_1000033335 401
1900 3300025919 Ga0207657_10001268 Ga0207657_100012682 401
1901 3300025919 Ga0207657_10003031 Ga0207657_1000303113 401
1902 3300025919 Ga0207657_10070938 Ga0207657_100709382 401
1903 3300025919 Ga0207657_10071581 Ga0207657_100715811 401
1904 3300025919 Ga0207657_10103485 Ga0207657_101034852 401
1905 3300025920 Ga0207649_10001290 Ga0207649_100012904 401
1906 3300025920 Ga0207649_10045898 Ga0207649_100458982 401
1907 3300025920 Ga0207649_10056854 Ga0207649_100568543 401
1908 3300025921 Ga0207652_10001135 Ga0207652_1000113523 401
1909 3300025921 Ga0207652_10001200 Ga0207652_100012009 401
1910 3300025921 Ga0207652_10006215 Ga0207652_100062152 401
1911 3300025921 Ga0207652_10010824 Ga0207652_100108243 401
1912 3300025921 Ga0207652_10048803 Ga0207652_100488032 401
1913 3300025921 Ga0207652_10117332 Ga0207652_101173322 401
1914 3300025921 Ga0207652_10142719 Ga0207652_101427192 401
1915 3300025921 Ga0207652_10156894 Ga0207652_101568942 401
1916 3300025921 Ga0207652_10348967 Ga0207652_103489671 401
1917 3300025922 Ga0207646_10074340 Ga0207646_100743402 401
1918 3300025922 Ga0207646_10261307 Ga0207646_102613071 401
1919 3300025923 Ga0207681_10037287 Ga0207681_100372872 401
1920 3300025924 Ga0207694_10105054 Ga0207694_101050542 401
1921 3300025925 Ga0207650_10000776 Ga0207650_1000077614 401
1922 3300025925 Ga0207650_10040260 Ga0207650_100402602 401
1923 3300025925 Ga0207650_10085235 Ga0207650_100852352 401
1924 3300025925 Ga0207650_10118805 Ga0207650_101188052 401
1925 3300025926 Ga0207659_10011240 Ga0207659_100112404 401
1926 3300025926 Ga0207659_10161601 Ga0207659_101616012 401
1927 3300025927 Ga0207687_10001937 Ga0207687_1000193710 401
1928 3300025927 Ga0207687_10055338 Ga0207687_100553382 401
1929 3300025927 Ga0207687_10275899 Ga0207687_102758991 401
1930 3300025928 Ga0207700_10005653 Ga0207700_100056534 401
1931 3300025928 Ga0207700_10009296 Ga0207700_100092965 401
1932 3300025928 Ga0207700_10034378 Ga0207700_100343783 401
1933 3300025928 Ga0207700_10049032 Ga0207700_100490321 401
1934 3300025928 Ga0207700_10055478 Ga0207700_100554783 401
1935 3300025928 Ga0207700_10060041 Ga0207700_100600412 401
1936 3300025928 Ga0207700_10070426 Ga0207700_100704262 401
1937 3300025929 Ga0207664_10010079 Ga0207664_100100793 401
1938 3300025929 Ga0207664_10029945 Ga0207664_100299452 401
1939 3300025929 Ga0207664_10126394 Ga0207664_101263942 401
1940 3300025931 Ga0207644_10003098 Ga0207644_100030983 401
1941 3300025931 Ga0207644_10057933 Ga0207644_100579332 401
1942 3300025931 Ga0207644_10196678 Ga0207644_101966782 401
1943 3300025931 Ga0207644_10233170 Ga0207644_102331702 401
1944 3300025932 Ga0207690_10044437 Ga0207690_100444372 401
1945 3300025932 Ga0207690_10090298 Ga0207690_100902983 401
1946 3300025932 Ga0207690_10100627 Ga0207690_101006271 401
1947 3300025933 Ga0207706_10002469 Ga0207706_100024694 401
1948 3300025933 Ga0207706_10007491 Ga0207706_100074911 401
1949 3300025933 Ga0207706_10078057 Ga0207706_100780572 401
1950 3300025933 Ga0207706_10091615 Ga0207706_100916152 401
1951 3300025934 Ga0207686_10055331 Ga0207686_100553312 401
1952 3300025934 Ga0207686_10074697 Ga0207686_100746971 401
1953 3300025935 Ga0207709_10002659 Ga0207709_100026592 401
1954 3300025935 Ga0207709_10023812 Ga0207709_100238122 401
1955 3300025936 Ga0207670_10000819 Ga0207670_100008195 401
1956 3300025936 Ga0207670_10014336 Ga0207670_100143362 401
1957 3300025936 Ga0207670_10015114 Ga0207670_100151142 401
1958 3300025936 Ga0207670_10136880 Ga0207670_101368802 401
1959 3300025937 Ga0207669_10010414 Ga0207669_100104142 401
1960 3300025937 Ga0207669_10016612 Ga0207669_100166122 401
1961 3300025937 Ga0207669_10017036 Ga0207669_100170363 401
1962 3300025937 Ga0207669_10026784 Ga0207669_100267842 401
1963 3300025937 Ga0207669_10036344 Ga0207669_100363442 401
1964 3300025939 Ga0207665_10000806 Ga0207665_1000080612 401
1965 3300025939 Ga0207665_10220558 Ga0207665_102205582 401
1966 3300025940 Ga0207691_10003281 Ga0207691_100032813 401
1967 3300025940 Ga0207691_10090968 Ga0207691_100909682 401
1968 3300025940 Ga0207691_10180537 Ga0207691_101805371 401
1969 3300025940 Ga0207691_10241011 Ga0207691_102410111 401
1970 3300025940 Ga0207691_10276047 Ga0207691_102760471 401
1971 3300025941 Ga0207711_10002477 Ga0207711_1000247711 401
1972 3300025941 Ga0207711_10021175 Ga0207711_100211753 401
1973 3300025941 Ga0207711_10053475 Ga0207711_100534753 401
1974 3300025941 Ga0207711_10055557 Ga0207711_100555572 401
1975 3300025941 Ga0207711_10116097 Ga0207711_101160971 401
1976 3300025941 Ga0207711_10116807 Ga0207711_101168072 401
1977 3300025941 Ga0207711_10136460 Ga0207711_101364602 401
1978 3300025941 Ga0207711_10144308 Ga0207711_101443082 401
1979 3300025941 Ga0207711_10237762 Ga0207711_102377622 401
1980 3300025942 Ga0207689_10000348 Ga0207689_1000034834 401
1981 3300025942 Ga0207689_10029817 Ga0207689_100298172 401
1982 3300025942 Ga0207689_10216408 Ga0207689_102164081 401
1983 3300025944 Ga0207661_10203816 Ga0207661_102038162 401
1984 3300025944 Ga0207661_10360297 Ga0207661_103602971 401
1985 3300025945 Ga0207679_10008112 Ga0207679_100081122 401
1986 3300025945 Ga0207679_10016091 Ga0207679_100160912 401
1987 3300025945 Ga0207679_10090755 Ga0207679_100907552 401
1988 3300025945 Ga0207679_10205967 Ga0207679_102059672 401
1989 3300025949 Ga0207667_10047589 Ga0207667_100475893 401
1990 3300025949 Ga0207667_10058743 Ga0207667_100587432 401
1991 3300025949 Ga0207667_10068189 Ga0207667_100681893 401
1992 3300025949 Ga0207667_10101317 Ga0207667_101013172 401
1993 3300025949 Ga0207667_10128589 Ga0207667_101285892 401
1994 3300025949 Ga0207667_10180147 Ga0207667_101801472 401
1995 3300025960 Ga0207651_10034896 Ga0207651_100348963 401
1996 3300025960 Ga0207651_10050027 Ga0207651_100500273 401
1997 3300025960 Ga0207651_10076163 Ga0207651_100761632 401
1998 3300025960 Ga0207651_10234133 Ga0207651_102341331 401
1999 3300025960 Ga0207651_10297103 Ga0207651_102971032 401
2000 3300025961 Ga0207712_10015658 Ga0207712_100156582 401
2001 3300025961 Ga0207712_10076782 Ga0207712_100767823 401
2002 3300025972 Ga0207668_10043576 Ga0207668_100435763 401
2003 3300025981 Ga0207640_10009648 Ga0207640_100096482 401
2004 3300025981 Ga0207640_10139758 Ga0207640_101397582 401
2005 3300025981 Ga0207640_10255627 Ga0207640_102556271 401
2006 3300025986 Ga0207658_10080129 Ga0207658_100801293 401
2007 3300026023 Ga0207677_10023560 Ga0207677_100235603 401
2008 3300026023 Ga0207677_10095346 Ga0207677_100953461 401
2009 3300026023 Ga0207677_10132359 Ga0207677_101323592 401
2010 3300026035 Ga0207703_10000342 Ga0207703_1000034221 401
2011 3300026035 Ga0207703_10034145 Ga0207703_100341452 401
2012 3300026041 Ga0207639_10006646 Ga0207639_100066467 401
2013 3300026041 Ga0207639_10033783 Ga0207639_100337832 401
2014 3300026067 Ga0207678_10010164 Ga0207678_100101643 401
2015 3300026067 Ga0207678_10017585 Ga0207678_100175854 401
2016 3300026067 Ga0207678_10021660 Ga0207678_100216604 401
2017 3300026067 Ga0207678_10081794 Ga0207678_100817942 401
2018 3300026067 Ga0207678_10095725 Ga0207678_100957253 401
2019 3300026067 Ga0207678_10098153 Ga0207678_100981531 401
2020 3300026067 Ga0207678_10347423 Ga0207678_103474231 401
2021 3300026075 Ga0207708_10071470 Ga0207708_100714702 401
2022 3300026075 Ga0207708_10277223 Ga0207708_102772231 401
2023 3300026078 Ga0207702_10000802 Ga0207702_1000080211 401
2024 3300026078 Ga0207702_10048188 Ga0207702_100481883 401
2025 3300026078 Ga0207702_10061413 Ga0207702_100614132 401
2026 3300026078 Ga0207702_10079307 Ga0207702_100793072 401
2027 3300026078 Ga0207702_10250323 Ga0207702_102503231 401
2028 3300026088 Ga0207641_10000007 Ga0207641_10000007123 401
2029 3300026089 Ga0207648_10003261 Ga0207648_1000326114 401
2030 3300026089 Ga0207648_10034254 Ga0207648_100342543 401
2031 3300026089 Ga0207648_10076697 Ga0207648_100766972 401
2032 3300026089 Ga0207648_10318937 Ga0207648_103189371 401
2033 3300026095 Ga0207676_10000330 Ga0207676_1000033025 401
2034 3300026095 Ga0207676_10001647 Ga0207676_1000164716 401
2035 3300026095 Ga0207676_10247608 Ga0207676_102476082 401
2036 3300026116 Ga0207674_10103030 Ga0207674_101030303 401
2037 3300026116 Ga0207674_10223382 Ga0207674_102233822 401
2038 3300026116 Ga0207674_10313350 Ga0207674_103133502 401
2039 3300026118 Ga0207675_100041578 Ga0207675_1000415784 401
2040 3300026121 Ga0207683_10000069 Ga0207683_100000693 401
2041 3300026121 Ga0207683_10001824 Ga0207683_100018244 401
2042 3300026121 Ga0207683_10003110 Ga0207683_100031105 401
2043 3300026121 Ga0207683_10098393 Ga0207683_100983932 401
2044 3300026121 Ga0207683_10142705 Ga0207683_101427052 401
2045 3300026142 Ga0207698_10024663 Ga0207698_100246633 401
2046 3300026142 Ga0207698_10026028 Ga0207698_100260282 401
2047 3300027111 Ga0209281_1000409 Ga0209281_100040915 401
2048 3300027111 Ga0209281_1000520 Ga0209281_100052019 401
2049 3300027111 Ga0209281_1002614 Ga0209281_10026142 401
2050 3300027111 Ga0209281_1007427 Ga0209281_10074273 401
2051 3300027296 Ga0209389_1000165 Ga0209389_100016515 401
2052 3300027296 Ga0209389_1000422 Ga0209389_10004228 401
2053 3300027312 Ga0209371_1000009 Ga0209371_1000009555 401
2054 3300027312 Ga0209371_1000424 Ga0209371_100042440 401
2055 3300027312 Ga0209371_1000697 Ga0209371_10006971 401
2056 3300027312 Ga0209371_1005706 Ga0209371_10057061 401
2057 3300027312 Ga0209371_1007824 Ga0209371_10078242 401
2058 3300027357 Ga0209589_1000002 Ga0209589_1000002712 401
2059 3300027357 Ga0209589_1001841 Ga0209589_100184115 401
2060 3300027361 Ga0209489_100002 Ga0209489_100002712 401
2061 3300027361 Ga0209489_102693 Ga0209489_10269321 401
2062 3300027361 Ga0209489_104637 Ga0209489_1046378 401
2063 3300027363 Ga0209700_100002 Ga0209700_100002712 401
2064 3300027363 Ga0209700_100018 Ga0209700_10001815 401
2065 3300027512 Ga0209179_1000847 Ga0209179_10008473 401
2066 3300027512 Ga0209179_1009622 Ga0209179_10096221 401
2067 3300027552 Ga0209982_1004667 Ga0209982_10046671 401
2068 3300027666 Ga0209282_1000090 Ga0209282_100009015 401
2069 3300027666 Ga0209282_1006880 Ga0209282_10068803 401
2070 3300027666 Ga0209282_1024516 Ga0209282_10245163 401
2071 3300027695 Ga0209966_1005197 Ga0209966_10051972 401
2072 3300027717 Ga0209998_10001507 Ga0209998_100015076 401
2073 3300027866 Ga0209813_10046190 Ga0209813_100461901 401
2074 3300027876 Ga0209974_10011468 Ga0209974_100114682 401
2075 3300027907 Ga0207428_10000111 Ga0207428_1000011161 401
2076 3300027907 Ga0207428_10000987 Ga0207428_100009873 401
2077 3300027907 Ga0207428_10005328 Ga0207428_100053282 401
2078 3300027907 Ga0207428_10007680 Ga0207428_100076806 401
2079 3300027907 Ga0207428_10058988 Ga0207428_100589882 401
2080 3300028379 Ga0268266_10002477 Ga0268266_100024775 401
2081 3300028379 Ga0268266_10010325 Ga0268266_100103256 401
2082 3300028379 Ga0268266_10012267 Ga0268266_100122673 401
2083 3300028379 Ga0268266_10016889 Ga0268266_100168892 401
2084 3300028379 Ga0268266_10052771 Ga0268266_100527712 401
2085 3300028379 Ga0268266_10060689 Ga0268266_100606892 401
2086 3300028379 Ga0268266_10271987 Ga0268266_102719872 401
2087 3300028379 Ga0268266_10299171 Ga0268266_102991712 401
2088 3300028380 Ga0268265_10008736 Ga0268265_100087363 401
2089 3300028380 Ga0268265_10105325 Ga0268265_101053251 401
2090 3300028380 Ga0268265_10115162 Ga0268265_101151622 401
2091 3300028381 Ga0268264_10000049 Ga0268264_1000004934 401
2092 3300028381 Ga0268264_10006295 Ga0268264_100062952 401
2093 3300028381 Ga0268264_10106429 Ga0268264_101064291 401
2094 3300028381 Ga0268264_10212982 Ga0268264_102129822 401
2095 3300028556 Ga0265337_1018690 Ga0265337_10186902 401
2096 3300028563 Ga0265319_1014361 Ga0265319_10143612 401
2097 3300028573 Ga0265334_10001384 Ga0265334_100013845 401
2098 3300028577 Ga0265318_10069036 Ga0265318_100690361 401
2099 3300028653 Ga0265323_10001829 Ga0265323_100018293 401
2100 3300028666 Ga0265336_10000786 Ga0265336_1000078613 401
2101 3300028786 Ga0307517_10000650 Ga0307517_1000065064 401
2102 3300028794 Ga0307515_10000674 Ga0307515_100006744 401
2103 3300028794 Ga0307515_10001722 Ga0307515_1000172222 401
2104 3300028800 Ga0265338_10000024 Ga0265338_10000024211 401
2105 3300028800 Ga0265338_10005729 Ga0265338_100057297 401
2106 3300029957 Ga0265324_10005055 Ga0265324_100050552 401
2107 3300030500 Ga0268256_1000010 Ga0268256_1000010554 401
2108 3300030500 Ga0268256_1001848 Ga0268256_10018486 401
2109 3300030500 Ga0268256_1008094 Ga0268256_10080942 401
2110 3300030500 Ga0268256_1008873 Ga0268256_10088731 401
2111 3300030744 Ga0316181_1013580 Ga0316181_10135801 401
2112 3300031090 Ga0265760_10013964 Ga0265760_100139644 401
2113 3300031235 Ga0265330_10022754 Ga0265330_100227542 401
2114 3300031235 Ga0265330_10023244 Ga0265330_100232442 401
2115 3300031235 Ga0265330_10051648 Ga0265330_100516482 401
2116 3300031238 Ga0265332_10001742 Ga0265332_100017426 401
2117 3300031239 Ga0265328_10000072 Ga0265328_1000007229 401
2118 3300031239 Ga0265328_10000141 Ga0265328_1000014115 401
2119 3300031239 Ga0265328_10001227 Ga0265328_100012272 401
2120 3300031239 Ga0265328_10001795 Ga0265328_100017957 401
2121 3300031239 Ga0265328_10002282 Ga0265328_100022829 401
2122 3300031239 Ga0265328_10006655 Ga0265328_100066553 401
2123 3300031239 Ga0265328_10015108 Ga0265328_100151082 401
2124 3300031239 Ga0265328_10040077 Ga0265328_100400772 401
2125 3300031241 Ga0265325_10000004 Ga0265325_1000000456 401
2126 3300031241 Ga0265325_10000637 Ga0265325_1000063725 401
2127 3300031241 Ga0265325_10014495 Ga0265325_100144952 401
2128 3300031241 Ga0265325_10015987 Ga0265325_100159873 401
2129 3300031241 Ga0265325_10030159 Ga0265325_100301593 401
2130 3300031241 Ga0265325_10035919 Ga0265325_100359192 401
2131 3300031241 Ga0265325_10040265 Ga0265325_100402653 401
2132 3300031242 Ga0265329_10012851 Ga0265329_100128512 401
2133 3300031242 Ga0265329_10022092 Ga0265329_100220922 401
2134 3300031242 Ga0265329_10036062 Ga0265329_100360621 401
2135 3300031247 Ga0265340_10000546 Ga0265340_100005465 401
2136 3300031247 Ga0265340_10005250 Ga0265340_100052505 401
2137 3300031247 Ga0265340_10006054 Ga0265340_100060543 401
2138 3300031249 Ga0265339_10000420 Ga0265339_1000042014 401
2139 3300031249 Ga0265339_10020102 Ga0265339_100201022 401
2140 3300031249 Ga0265339_10045669 Ga0265339_100456693 401
2141 3300031250 Ga0265331_10000058 Ga0265331_10000058146 401
2142 3300031250 Ga0265331_10000297 Ga0265331_1000029713 401
2143 3300031250 Ga0265331_10004444 Ga0265331_100044445 401
2144 3300031251 Ga0265327_10081666 Ga0265327_100816661 401
2145 3300031344 Ga0265316_10000454 Ga0265316_100004546 401
2146 3300031344 Ga0265316_10009031 Ga0265316_100090318 401
2147 3300031344 Ga0265316_10021215 Ga0265316_100212154 401
2148 3300031344 Ga0265316_10024211 Ga0265316_100242113 401
2149 3300031344 Ga0265316_10026512 Ga0265316_100265124 401
2150 3300031456 Ga0307513_10007088 Ga0307513_100070886 401
2151 3300031456 Ga0307513_10032310 Ga0307513_100323102 401
2152 3300031456 Ga0307513_10074643 Ga0307513_100746431 401
2153 3300031456 Ga0307513_10093408 Ga0307513_100934082 401
2154 3300031507 Ga0307509_10212914 Ga0307509_102129142 401
2155 3300031507 Ga0307509_10263716 Ga0307509_102637162 401
2156 3300031548 Ga0307408_100044103 Ga0307408_1000441031 401
2157 3300031548 Ga0307408_100086836 Ga0307408_1000868362 401
2158 3300031548 Ga0307408_100138058 Ga0307408_1001380581 401
2159 3300031548 Ga0307408_100170857 Ga0307408_1001708572 401
2160 3300031595 Ga0265313_10000637 Ga0265313_100006378 401
2161 3300031595 Ga0265313_10001864 Ga0265313_1000186412 401
2162 3300031595 Ga0265313_10064597 Ga0265313_100645972 401
2163 3300031616 Ga0307508_10000397 Ga0307508_1000039739 401
2164 3300031616 Ga0307508_10079786 Ga0307508_100797862 401
2165 3300031711 Ga0265314_10000483 Ga0265314_1000048313 401
2166 3300031711 Ga0265314_10005492 Ga0265314_100054927 401
2167 3300031711 Ga0265314_10010860 Ga0265314_100108604 401
2168 3300031711 Ga0265314_10015208 Ga0265314_100152084 401
2169 3300031711 Ga0265314_10035958 Ga0265314_100359583 401
2170 3300031711 Ga0265314_10059271 Ga0265314_100592712 401
2171 3300031712 Ga0265342_10003830 Ga0265342_100038306 401
2172 3300031712 Ga0265342_10004574 Ga0265342_100045743 401
2173 3300031712 Ga0265342_10026709 Ga0265342_100267093 401
2174 3300031712 Ga0265342_10068513 Ga0265342_100685132 401
2175 3300031712 Ga0265342_10093420 Ga0265342_100934202 401
2176 3300031712 Ga0265342_10146900 Ga0265342_101469001 401
2177 3300031730 Ga0307516_10124772 Ga0307516_101247722 401
2178 3300031730 Ga0307516_10210808 Ga0307516_102108082 401
2179 3300031731 Ga0307405_10000482 Ga0307405_1000048210 401
2180 3300031731 Ga0307405_10112789 Ga0307405_101127891 401
2181 3300031824 Ga0307413_10203409 Ga0307413_102034091 401
2182 3300031911 Ga0307412_10009613 Ga0307412_100096133 401
2183 3300031967 Ga0315914_1000167 Ga0315914_100016749 401
2184 3300031995 Ga0307409_100042510 Ga0307409_1000425103 401
2185 3300031995 Ga0307409_100262852 Ga0307409_1002628521 401
2186 3300031995 Ga0307409_100333650 Ga0307409_1003336502 401
2187 3300032002 Ga0307416_100035018 Ga0307416_1000350183 401
2188 3300032126 Ga0307415_100086904 Ga0307415_1000869042 401
2189 3300032126 Ga0307415_100115160 Ga0307415_1001151602 401
2190 3300032133 Ga0316583_10007791 Ga0316583_100077913 401
2191 3300033179 Ga0307507_10030837 Ga0307507_100308371 401
2192 3300033180 Ga0307510_10195581 Ga0307510_101955812 401
2193 3300033430 Ga0315913_1000038 Ga0315913_100003849 401
2194 3300033442 Ga0315911_1000017 Ga0315911_100001737 401
2195 3300033464 Ga0315915_1000019 Ga0315915_100001915 401
2196 3300034816 Ga0373930_0000026 Ga0373930_0000026_6600_7808 401
2197 3300034817 Ga0373948_0000180 Ga0373948_0000180_4004_5212 401
2198 3300034818 Ga0373950_0001017 Ga0373950_0001017_1001_2209 401
2199 3300034819 Ga0373958_0000141 Ga0373958_0000141_6104_7312 401
2200 3300034820 Ga0373959_0000602 Ga0373959_0000602_592_1800 401
2201 3300034957 Ga0373938_0000550 Ga0373938_0000550_3460_4668 401
2202 3300035083 Ga0373926_0053303 Ga0373926_0053303_38_1246 401
2203 3300035084 Ga0373928_0006282 Ga0373928_0006282_263_1471 401
2204 3300035086 Ga0373934_0012347 Ga0373934_0012347_1954_3162 401
2205 3300035086 Ga0373934_0013519 Ga0373934_0013519_1866_3074 401
2206 3300035086 Ga0373934_0019707 Ga0373934_0019707_633_1841 401
2207 3300035086 Ga0373934_0056410 Ga0373934_0056410_23_1231 401
2208 3300035086 Ga0373934_0061412 Ga0373934_0061412_211_1419 401
2209 3300035089 Ga0373944_0000032 Ga0373944_0000032_14196_15404 401
2210 3300035090 Ga0373949_0002906 Ga0373949_0002906_888_2096 401
2211 3300035092 Ga0373952_0001795 Ga0373952_0001795_1572_2780 401
2212 3300035092 Ga0373952_0003944 Ga0373952_0003944_1236_2444 401
2213 3300035111 Ga0373923_0002988 Ga0373923_0002988_1222_2430 401
2214 3300035111 Ga0373923_0014155 Ga0373923_0014155_1769_2977 401
2215 3300035111 Ga0373923_0041946 Ga0373923_0041946_654_1862 401
2216 3300035112 Ga0373932_0000372 Ga0373932_0000372_5376_6584 401
2217 3300035113 Ga0373936_0004456 Ga0373936_0004456_1102_2310 401
2218 3300035113 Ga0373936_0023638 Ga0373936_0023638_617_1825 401
2219 3300035114 Ga0373939_0000679 Ga0373939_0000679_6601_7809 401
2220 3300035114 Ga0373939_0005214 Ga0373939_0005214_1072_2280 401
2221 3300035115 Ga0373941_0001044 Ga0373941_0001044_2668_3876 401
2222 3300035115 Ga0373941_0040293 Ga0373941_0040293_93_1301 401
2223 3300035116 Ga0373945_0000540 Ga0373945_0000540_6317_7525 401
2224 3300035116 Ga0373945_0003624 Ga0373945_0003624_3551_4759 401
2225 3300035116 Ga0373945_0009136 Ga0373945_0009136_182_1390 401
2226 3300035117 Ga0373953_0000323 Ga0373953_0000323_3112_4320 401
2227 3300035117 Ga0373953_0000601 Ga0373953_0000601_24_1232 401
2228 3300035117 Ga0373953_0028503 Ga0373953_0028503_240_1448 401
2229 3300035117 Ga0373953_0058584 Ga0373953_0058584_298_1506 401
2230 3300035118 Ga0373954_0000513 Ga0373954_0000513_832_2040 401
2231 3300035118 Ga0373954_0003957 Ga0373954_0003957_265_1473 401
2232 3300035118 Ga0373954_0005351 Ga0373954_0005351_2419_3627 401
2233 3300035118 Ga0373954_0006859 Ga0373954_0006859_1401_2609 401
2234 3300035118 Ga0373954_0049337 Ga0373954_0049337_111_1319 401
2235 3300035119 Ga0373956_0001475 Ga0373956_0001475_4979_6187 401
2236 3300035119 Ga0373956_0003133 Ga0373956_0003133_1264_2472 401
2237 3300035119 Ga0373956_0005887 Ga0373956_0005887_1674_2882 401
2238 3300035119 Ga0373956_0031194 Ga0373956_0031194_651_1859 401
2239 3300035119 Ga0373956_0103659 Ga0373956_0103659_12_1220 401
2240 3300035120 Ga0373957_0003468 Ga0373957_0003468_3342_4550 401
2241 3300035120 Ga0373957_0004955 Ga0373957_0004955_1267_2475 401
2242 3300035120 Ga0373957_0005072 Ga0373957_0005072_1461_2669 401
2243 3300035170 Ga0373943_0000111 Ga0373943_0000111_10547_11755 401
2244 3300035170 Ga0373943_0004198 Ga0373943_0004198_2458_3666 401
2245 3300035170 Ga0373943_0004632 Ga0373943_0004632_3752_4960 401
2246 3300035170 Ga0373943_0005475 Ga0373943_0005475_3874_5082 401
2247 3300035170 Ga0373943_0028462 Ga0373943_0028462_1408_2616 401
2248 3300035171 Ga0373946_0007784 Ga0373946_0007784_1211_2419 401
2249 3300035171 Ga0373946_0027296 Ga0373946_0027296_506_1714 401
2250 3300035171 Ga0373946_0027966 Ga0373946_0027966_881_2089 401
2251 3300035171 Ga0373946_0049105 Ga0373946_0049105_55_1263 401
2252 3300035172 Ga0373955_0001036 Ga0373955_0001036_7526_8734 401
2253 3300035172 Ga0373955_0004173 Ga0373955_0004173_1565_2773 401
2254 3300035172 Ga0373955_0004495 Ga0373955_0004495_3536_4744 401
2255 3300035172 Ga0373955_0005836 Ga0373955_0005836_4297_5505 401
2256 3300035172 Ga0373955_0007749 Ga0373955_0007749_2144_3352 401
2257 3300035172 Ga0373955_0012218 Ga0373955_0012218_540_1748 401
2258 3300035172 Ga0373955_0013667 Ga0373955_0013667_1342_2550 401
2259 3300035172 Ga0373955_0047608 Ga0373955_0047608_1068_2276 401
2260 3300035172 Ga0373955_0139964 Ga0373955_0139964_88_1296 401
2261 3300035207 Ga0373942_0000051 Ga0373942_0000051_21309_22517 401
2262 3300035241 Ga0373961_0000755 Ga0373961_0000755_5736_6944 401
2263 3300035241 Ga0373961_0029910 Ga0373961_0029910_113_1321 401
2264 3300035242 Ga0373962_0000997 Ga0373962_0000997_1001_2209 401
2265 3300035398 Ga0316574_0013426 Ga0316574_0013426_3367_4578 401
2266 3300035410 Ga0373924_0002185 Ga0373924_0002185_5176_6384 401
2267 3300035410 Ga0373924_0044548 Ga0373924_0044548_313_1521 401
2268 3300035410 Ga0373924_0060602 Ga0373924_0060602_260_1468 401
2269 3300035410 Ga0373924_0061508 Ga0373924_0061508_266_1474 401
2270 3300035691 Ga0373931_0004270 Ga0373931_0004270_3335_4543 401
2271 3300035691 Ga0373931_0017213 Ga0373931_0017213_479_1687 401
2272 3300035691 Ga0373931_0084804 Ga0373931_0084804_103_1311 401
2273 3300035692 Ga0373935_0031047 Ga0373935_0031047_879_2087 401
2274 3300035692 Ga0373935_0049415 Ga0373935_0049415_939_2147 401
2275 3300035692 Ga0373935_0057343 Ga0373935_0057343_939_2147 401
2276 3300035692 Ga0373935_0085670 Ga0373935_0085670_317_1525 401
2277 3300035695 Ga0373927_0002955 Ga0373927_0002955_5371_6579 401
2278 3300035695 Ga0373927_0019683 Ga0373927_0019683_1499_2707 401
2279 3300035695 Ga0373927_0019716 Ga0373927_0019716_397_1605 401
2280 3300035695 Ga0373927_0030721 Ga0373927_0030721_2121_3329 401
2281 3300035695 Ga0373927_0034169 Ga0373927_0034169_1452_2660 401
2282 3300035695 Ga0373927_0106944 Ga0373927_0106944_428_1636 401
2283 3300035695 Ga0373927_0123146 Ga0373927_0123146_446_1654 401
2284 3300035695 Ga0373927_0127709 Ga0373927_0127709_66_1274 401
2285 3300035695 Ga0373927_0135831 Ga0373927_0135831_273_1481 401
2286 3300035724 Ga0373933_0000184 Ga0373933_0000184_24017_25225 401
2287 3300035724 Ga0373933_0002846 Ga0373933_0002846_1087_2295 401
2288 3300035724 Ga0373933_0004713 Ga0373933_0004713_85_1293 401
2289 3300035724 Ga0373933_0005779 Ga0373933_0005779_5475_6683 401
2290 3300035724 Ga0373933_0018156 Ga0373933_0018156_867_2075 401
2291 3300035724 Ga0373933_0018834 Ga0373933_0018834_1730_2938 401
2292 3300035724 Ga0373933_0043844 Ga0373933_0043844_57_1265 401
2293 3300035724 Ga0373933_0065363 Ga0373933_0065363_22_1230 401
2294 3300035725 Ga0373947_0003354 Ga0373947_0003354_4899_6107 401
2295 3300035725 Ga0373947_0024013 Ga0373947_0024013_984_2192 401
2296 3300035725 Ga0373947_0067604 Ga0373947_0067604_172_1380 401
2297 3300035725 Ga0373947_0072677 Ga0373947_0072677_870_2078 401
2298 3300035725 Ga0373947_0192653 Ga0373947_0192653_96_1304 401
2299 3300036401 Ga0373937_0003633 Ga0373937_0003633_11779_12987 401
2300 3300036401 Ga0373937_0003875 Ga0373937_0003875_7146_8354 401
2301 3300036401 Ga0373937_0004343 Ga0373937_0004343_406_1614 401
2302 3300036401 Ga0373937_0008780 Ga0373937_0008780_5723_6931 401
2303 3300036401 Ga0373937_0011842 Ga0373937_0011842_1205_2413 401
2304 3300036401 Ga0373937_0015962 Ga0373937_0015962_2501_3709 401
2305 3300036401 Ga0373937_0113508 Ga0373937_0113508_437_1645 401
2306 3300036401 Ga0373937_0119792 Ga0373937_0119792_406_1614 401
2307 3300037068 Ga0373925_0003356 Ga0373925_0003356_8195_9403 401
2308 3300037068 Ga0373925_0007031 Ga0373925_0007031_4497_5705 401
2309 3300037068 Ga0373925_0009469 Ga0373925_0009469_1672_2880 401
2310 3300037068 Ga0373925_0014982 Ga0373925_0014982_3166_4374 401
2311 3300037068 Ga0373925_0029641 Ga0373925_0029641_1449_2657 401
2312 3300037068 Ga0373925_0038162 Ga0373925_0038162_1535_2743 401
2313 3300037068 Ga0373925_0063479 Ga0373925_0063479_1527_2735 401
2314 3300037068 Ga0373925_0065123 Ga0373925_0065123_961_2169 401
2315 3300037068 Ga0373925_0185191 Ga0373925_0185191_321_1529 401
2316 3300037312 Ga0395899_0000014 Ga0395899_0000014_319423_320631 401
2317 3300037312 Ga0395899_0020826 Ga0395899_0020826_2868_4076 401
2318 3300037312 Ga0395899_0070127 Ga0395899_0070127_1181_2389 401
2319 3300037312 Ga0395899_0155494 Ga0395899_0155494_35_1243 401
2320 3300037418 Ga0395900_0000007 Ga0395900_0000007_319442_320650 401
2321 3300037418 Ga0395900_0001833 Ga0395900_0001833_13272_14480 401
2322 3300037418 Ga0395900_0002921 Ga0395900_0002921_7816_9024 401
2323 3300037418 Ga0395900_0005150 Ga0395900_0005150_4833_6041 401
2324 3300037418 Ga0395900_0007393 Ga0395900_0007393_7720_8928 401
2325 3300037418 Ga0395900_0061220 Ga0395900_0061220_580_1788 401
2326 3300037418 Ga0395900_0140928 Ga0395900_0140928_63_1271 401
2327 3300037418 Ga0395900_0203341 Ga0395900_0203341_131_1339 401
2328 3300037466 Ga0395898_0000011 Ga0395898_0000011_168211_169419 401
2329 3300037466 Ga0395898_0012309 Ga0395898_0012309_2101_3309 401
2330 3300037466 Ga0395898_0041638 Ga0395898_0041638_279_1487 401
2331 3300037471 Ga0395905_0000008 Ga0395905_0000008_319442_320650 401
2332 3300037471 Ga0395905_0000969 Ga0395905_0000969_4369_5577 401
2333 3300037471 Ga0395905_0011280 Ga0395905_0011280_1863_3071 401
2334 3300037471 Ga0395905_0011626 Ga0395905_0011626_3084_4292 401
2335 3300037471 Ga0395905_0016505 Ga0395905_0016505_2401_3609 401
2336 3300037471 Ga0395905_0134974 Ga0395905_0134974_638_1846 401
2337 3300037471 Ga0395905_0231322 Ga0395905_0231322_87_1295 401
2338 3300037853 Ga0436364_0211631 Ga0436364_0211631_1597_2805 401
2339 3300037853 Ga0436364_0232280 Ga0436364_0232280_47179_48387 401
2340 3300037853 Ga0436364_0753583 Ga0436364_0753583_884_2092 401
2341 3300037853 Ga0436364_0998932 Ga0436364_0998932_21_1229 401
2342 3300038443 Ga0395901_0000020 Ga0395901_0000020_145500_146708 401
2343 3300038443 Ga0395901_0033652 Ga0395901_0033652_2020_3228 401
2344 3300038443 Ga0395901_0045118 Ga0395901_0045118_482_1690 401
2345 3300038443 Ga0395901_0091118 Ga0395901_0091118_1418_2626 401
2346 3300038443 Ga0395901_0160678 Ga0395901_0160678_915_2123 401
2347 3300038443 Ga0395901_0252196 Ga0395901_0252196_444_1652 401
2348 3300038443 Ga0395901_0365733 Ga0395901_0365733_250_1458 401
2349 3300038443 Ga0395901_0386666 Ga0395901_0386666_197_1405 401
2350 3300039437 Ga0436365_0138538 Ga0436365_0138538_981_2189 401
2351 3300039437 Ga0436365_0221937 Ga0436365_0221937_2224_3432 401
2352 3300039437 Ga0436365_0348734 Ga0436365_0348734_5235_6443 401
2353 3300039437 Ga0436365_0443161 Ga0436365_0443161_286_1494 401
2354 3300039437 Ga0436365_0775021 Ga0436365_0775021_10324_11532 401
2355 3300039437 Ga0436365_1013804 Ga0436365_1013804_1119_2327 401
2356 3300039437 Ga0436365_1037067 Ga0436365_1037067_21276_22484 401
2357 3300039437 Ga0436365_1103669 Ga0436365_1103669_194_1402 401
2358 3300039437 Ga0436365_1107307 Ga0436365_1107307_11_1219 401
2359 3300039438 Ga0436360_0762243 Ga0436360_0762243_651_1859 401
2360 3300039438 Ga0436360_1037370 Ga0436360_1037370_2290_3498 401
2361 3300039438 Ga0436360_1202621 Ga0436360_1202621_1490_2698 401
2362 3300039447 Ga0436361_0066830 Ga0436361_0066830_35_1243 401
2363 3300039447 Ga0436361_0069285 Ga0436361_0069285_863_2071 401
2364 3300039447 Ga0436361_0384903 Ga0436361_0384903_926_2134 401
2365 3300039447 Ga0436361_0560429 Ga0436361_0560429_1134_2342 401
2366 3300039447 Ga0436361_0794959 Ga0436361_0794959_636_1844 401
2367 3300039447 Ga0436361_0822087 Ga0436361_0822087_1019_2227 401
2368 3300039450 Ga0436363_0333941 Ga0436363_0333941_335_1543 401
2369 3300039450 Ga0436363_0517921 Ga0436363_0517921_930_2138 401
2370 3300039450 Ga0436363_0669500 Ga0436363_0669500_225_1433 401
2371 3300039450 Ga0436363_0908022 Ga0436363_0908022_3395_4603 401
2372 3300039450 Ga0436363_1355236 Ga0436363_1355236_2647_3855 401
2373 3300039450 Ga0436363_1422262 Ga0436363_1422262_296_1504 401
2374 3300039453 Ga0436362_0765609 Ga0436362_0765609_7571_8779 401
2375 3300041408 Ga0439453_0013379 Ga0439453_0013379_55_1263 401
2376 3300041413 Ga0439465_0012906 Ga0439465_0012906_88_1296 401
2377 3300042003 Ga0439443_010117 Ga0439443_010117_64_1272 401
2378 3300042007 Ga0439449_0009292 Ga0439449_0009292_631_1839 401
2379 3300042008 Ga0439450_009778 Ga0439450_009778_594_1802 401
2380 3300042436 Ga0439435_0004763 Ga0439435_0004763_1604_2812 401
2381 3300042461 Ga0439460_0004611 Ga0439460_0004611_976_2184 401
2382 3300044656 Ga0466969_0018912 Ga0466969_0018912_1485_2693 401
2383 3300044658 Ga0466972_0000264 Ga0466972_0000264_2986_4194 401
2384 3300044658 Ga0466972_0007828 Ga0466972_0007828_3007_4215 401
2385 3300044684 Ga0466966_0001752 Ga0466966_0001752_5306_6514 401
2386 3300044684 Ga0466966_0070219 Ga0466966_0070219_767_1975 401
2387 3300044693 Ga0466961_0000042 Ga0466961_0000042_9837_11045 401
2388 3300044693 Ga0466961_0090309 Ga0466961_0090309_620_1828 401
2389 3300044694 Ga0466963_0024768 Ga0466963_0024768_312_1523 401
2390 3300044694 Ga0466963_0033828 Ga0466963_0033828_1350_2558 401
2391 3300044694 Ga0466963_0038019 Ga0466963_0038019_1292_2500 401
2392 3300044694 Ga0466963_0220837 Ga0466963_0220837_64_1272 401
2393 3300044735 Ga0466968_0014223 Ga0466968_0014223_1579_2787 401
2394 3300044735 Ga0466968_0032305 Ga0466968_0032305_530_1738 401
2395 3300044735 Ga0466968_0053355 Ga0466968_0053355_185_1393 401
2396 3300044765 Ga0466970_0042207 Ga0466970_0042207_972_2180 401
2397 3300044842 Ga0466957_0004875 Ga0466957_0004875_3493_4701 401
2398 3300044842 Ga0466957_0042138 Ga0466957_0042138_981_2192 401
2399 3300044842 Ga0466957_0053132 Ga0466957_0053132_223_1431 401
2400 3300044901 Ga0466960_0009108 Ga0466960_0009108_2041_3249 401
2401 3300045049 Ga0466959_0040948 Ga0466959_0040948_337_1545 401
2402 3300045051 Ga0451576_0011112 Ga0451576_0011112_423_1631 401
2403 3300045836 Ga0466958_0001399 Ga0466958_0001399_6150_7361 401
2404 3300045836 Ga0466958_0058623 Ga0466958_0058623_1080_2288 401
2405 3300045976 Ga0466967_0023371 Ga0466967_0023371_537_1748 401
2406 3300045976 Ga0466967_0086184 Ga0466967_0086184_128_1336 401
2407 3300045976 Ga0466967_0177290 Ga0466967_0177290_11_1219 401
2408 3300045976 Ga0466967_0184616 Ga0466967_0184616_686_1894 401
2409 3300046454 Ga0495592_0001426 Ga0495592_0001426_3643_4851 401
2410 3300046454 Ga0495592_0008300 Ga0495592_0008300_4296_5504 401
2411 3300046454 Ga0495592_0011467 Ga0495592_0011467_363_1571 401
2412 3300046454 Ga0495592_0025347 Ga0495592_0025347_2094_3302 401
2413 3300046454 Ga0495592_0028861 Ga0495592_0028861_2948_4156 401
2414 3300046455 Ga0495603_0001349 Ga0495603_0001349_8979_10187 401
2415 3300046455 Ga0495603_0017479 Ga0495603_0017479_526_1734 401
2416 3300046455 Ga0495603_0036792 Ga0495603_0036792_869_2077 401
2417 3300046455 Ga0495603_0046649 Ga0495603_0046649_798_2006 401
2418 3300046455 Ga0495603_0056303 Ga0495603_0056303_262_1470 401
2419 3300046455 Ga0495603_0063972 Ga0495603_0063972_933_2141 401
2420 3300046459 Ga0495629_0000388 Ga0495629_0000388_12850_14058 401
2421 3300046459 Ga0495629_0001654 Ga0495629_0001654_7509_8717 401
2422 3300046459 Ga0495629_0004972 Ga0495629_0004972_4985_6193 401
2423 3300046459 Ga0495629_0006277 Ga0495629_0006277_1582_2790 401
2424 3300046459 Ga0495629_0007918 Ga0495629_0007918_6238_7446 401
2425 3300046459 Ga0495629_0104167 Ga0495629_0104167_373_1581 401
2426 3300046460 Ga0495638_0003980 Ga0495638_0003980_259_1467 401
2427 3300046460 Ga0495638_0011741 Ga0495638_0011741_1252_2460 401
2428 3300046460 Ga0495638_0020112 Ga0495638_0020112_2470_3678 401
2429 3300046460 Ga0495638_0028717 Ga0495638_0028717_1407_2615 401
2430 3300046460 Ga0495638_0070871 Ga0495638_0070871_370_1578 401
2431 3300046460 Ga0495638_0071364 Ga0495638_0071364_380_1588 401
2432 3300046461 Ga0495641_0002671 Ga0495641_0002671_6053_7261 401
2433 3300046462 Ga0495651_0004420 Ga0495651_0004420_7990_9198 401
2434 3300046462 Ga0495651_0006821 Ga0495651_0006821_4315_5523 401
2435 3300046462 Ga0495651_0008855 Ga0495651_0008855_304_1512 401
2436 3300046462 Ga0495651_0012430 Ga0495651_0012430_2334_3542 401
2437 3300046462 Ga0495651_0024497 Ga0495651_0024497_2655_3863 401
2438 3300046462 Ga0495651_0029814 Ga0495651_0029814_620_1828 401
2439 3300046462 Ga0495651_0072954 Ga0495651_0072954_294_1502 401
2440 3300046462 Ga0495651_0164939 Ga0495651_0164939_317_1525 401
2441 3300046463 Ga0495653_0000822 Ga0495653_0000822_13453_14661 401
2442 3300046463 Ga0495653_0001549 Ga0495653_0001549_4269_5477 401
2443 3300046463 Ga0495653_0005319 Ga0495653_0005319_5611_6819 401
2444 3300046463 Ga0495653_0006892 Ga0495653_0006892_4024_5232 401
2445 3300046463 Ga0495653_0011002 Ga0495653_0011002_3591_4799 401
2446 3300046463 Ga0495653_0093663 Ga0495653_0093663_79_1287 401
2447 3300046472 Ga0495580_0001008 Ga0495580_0001008_22809_24017 401
2448 3300046472 Ga0495580_0002996 Ga0495580_0002996_11005_12213 401
2449 3300046472 Ga0495580_0005259 Ga0495580_0005259_3531_4739 401
2450 3300046472 Ga0495580_0220073 Ga0495580_0220073_87_1295 401
2451 3300046473 Ga0495582_0003020 Ga0495582_0003020_5321_6529 401
2452 3300046473 Ga0495582_0003812 Ga0495582_0003812_3325_4533 401
2453 3300046473 Ga0495582_0035997 Ga0495582_0035997_798_2006 401
2454 3300046474 Ga0495605_0069299 Ga0495605_0069299_257_1465 401
2455 3300046474 Ga0495605_0107712 Ga0495605_0107712_16_1224 401
2456 3300046475 Ga0495639_0001542 Ga0495639_0001542_40_1248 401
2457 3300046475 Ga0495639_0003840 Ga0495639_0003840_555_1763 401
2458 3300046475 Ga0495639_0018412 Ga0495639_0018412_889_2097 401
2459 3300046476 Ga0495662_0003379 Ga0495662_0003379_2165_3373 401
2460 3300046476 Ga0495662_0029134 Ga0495662_0029134_706_1914 401
2461 3300046477 Ga0495664_0000906 Ga0495664_0000906_9637_10845 401
2462 3300046477 Ga0495664_0000994 Ga0495664_0000994_6334_7542 401
2463 3300046477 Ga0495664_0011190 Ga0495664_0011190_2651_3859 401
2464 3300046477 Ga0495664_0030554 Ga0495664_0030554_1717_2925 401
2465 3300046477 Ga0495664_0076985 Ga0495664_0076985_276_1484 401
2466 3300046477 Ga0495664_0085860 Ga0495664_0085860_396_1604 401
2467 3300046477 Ga0495664_0140337 Ga0495664_0140337_38_1246 401
2468 3300046491 Ga0495584_0013187 Ga0495584_0013187_2725_3933 401
2469 3300046491 Ga0495584_0031825 Ga0495584_0031825_489_1697 401
2470 3300046492 Ga0495585_0036719 Ga0495585_0036719_665_1873 401
2471 3300046499 Ga0495594_0127109 Ga0495594_0127109_128_1336 401
2472 3300046499 Ga0495594_0148182 Ga0495594_0148182_60_1268 401
2473 3300046506 Ga0495583_0036768 Ga0495583_0036768_686_1894 401
2474 3300046506 Ga0495583_0040625 Ga0495583_0040625_262_1470 401
2475 3300046506 Ga0495583_0060022 Ga0495583_0060022_274_1482 401
2476 3300046507 Ga0495606_0000244 Ga0495606_0000244_80891_82099 401
2477 3300046511 Ga0495608_0000289 Ga0495608_0000289_30206_31414 401
2478 3300046511 Ga0495608_0001963 Ga0495608_0001963_3223_4431 401
2479 3300046511 Ga0495608_0010179 Ga0495608_0010179_2951_4159 401
2480 3300046511 Ga0495608_0025283 Ga0495608_0025283_2548_3756 401
2481 3300046511 Ga0495608_0027069 Ga0495608_0027069_1809_3017 401
2482 3300046511 Ga0495608_0043448 Ga0495608_0043448_1739_2947 401
2483 3300046511 Ga0495608_0074810 Ga0495608_0074810_985_2193 401
2484 3300046512 Ga0495610_0059645 Ga0495610_0059645_237_1445 401
2485 3300046512 Ga0495610_0073210 Ga0495610_0073210_84_1292 401
2486 3300046513 Ga0495616_0040043 Ga0495616_0040043_1056_2264 401
2487 3300046514 Ga0495618_0006815 Ga0495618_0006815_4906_6114 401
2488 3300046514 Ga0495618_0011931 Ga0495618_0011931_131_1339 401
2489 3300046514 Ga0495618_0016952 Ga0495618_0016952_2501_3709 401
2490 3300046514 Ga0495618_0050325 Ga0495618_0050325_189_1397 401
2491 3300046514 Ga0495618_0127738 Ga0495618_0127738_342_1550 401
2492 3300046514 Ga0495618_0151427 Ga0495618_0151427_132_1340 401
2493 3300046516 Ga0495628_0002476 Ga0495628_0002476_1933_3141 401
2494 3300046516 Ga0495628_0011857 Ga0495628_0011857_2259_3467 401
2495 3300046516 Ga0495628_0011916 Ga0495628_0011916_1158_2366 401
2496 3300046516 Ga0495628_0013613 Ga0495628_0013613_5412_6620 401
2497 3300046516 Ga0495628_0021457 Ga0495628_0021457_937_2145 401
2498 3300046516 Ga0495628_0030031 Ga0495628_0030031_3136_4344 401
2499 3300046516 Ga0495628_0050304 Ga0495628_0050304_1957_3165 401
2500 3300046516 Ga0495628_0083992 Ga0495628_0083992_304_1512 401
2501 3300046517 Ga0495630_0007569 Ga0495630_0007569_692_1900 401
2502 3300046517 Ga0495630_0023295 Ga0495630_0023295_1869_3077 401
2503 3300046517 Ga0495630_0064137 Ga0495630_0064137_317_1525 401
2504 3300046518 Ga0495631_0025430 Ga0495631_0025430_572_1780 401
2505 3300046519 Ga0495632_0015207 Ga0495632_0015207_2607_3815 401
2506 3300046519 Ga0495632_0053863 Ga0495632_0053863_230_1438 401
2507 3300046519 Ga0495632_0074181 Ga0495632_0074181_188_1396 401
2508 3300046520 Ga0495637_0072001 Ga0495637_0072001_113_1321 401
2509 3300046522 Ga0495643_0113292 Ga0495643_0113292_134_1342 401
2510 3300046523 Ga0495644_0002153 Ga0495644_0002153_2465_3673 401
2511 3300046524 Ga0495648_0000943 Ga0495648_0000943_24070_25278 401
2512 3300046524 Ga0495648_0004878 Ga0495648_0004878_2219_3427 401
2513 3300046524 Ga0495648_0013335 Ga0495648_0013335_1814_3022 401
2514 3300046526 Ga0495666_0011220 Ga0495666_0011220_1449_2657 401
2515 3300046526 Ga0495666_0024149 Ga0495666_0024149_612_1820 401
2516 3300046526 Ga0495666_0031624 Ga0495666_0031624_466_1674 401
2517 3300046529 Ga0495652_0006286 Ga0495652_0006286_3004_4212 401
2518 3300046529 Ga0495652_0008449 Ga0495652_0008449_4258_5466 401
2519 3300046529 Ga0495652_0009418 Ga0495652_0009418_3025_4233 401
2520 3300046529 Ga0495652_0018828 Ga0495652_0018828_54_1262 401
2521 3300046529 Ga0495652_0051451 Ga0495652_0051451_178_1386 401
2522 3300046529 Ga0495652_0062149 Ga0495652_0062149_197_1405 401
2523 3300046529 Ga0495652_0081685 Ga0495652_0081685_987_2195 401
2524 3300046529 Ga0495652_0128004 Ga0495652_0128004_347_1555 401
2525 3300046529 Ga0495652_0161741 Ga0495652_0161741_405_1613 401
2526 3300046530 Ga0495654_0000180 Ga0495654_0000180_59683_60891 401
2527 3300046530 Ga0495654_0017399 Ga0495654_0017399_233_1441 401
2528 3300046531 Ga0495665_0006571 Ga0495665_0006571_4891_6099 401
2529 3300046531 Ga0495665_0006666 Ga0495665_0006666_206_1414 401
2530 3300046531 Ga0495665_0031727 Ga0495665_0031727_131_1339 401
2531 3300046533 Ga0495640_0006016 Ga0495640_0006016_4308_5516 401
2532 3300046533 Ga0495640_0006561 Ga0495640_0006561_3971_5179 401
2533 3300046533 Ga0495640_0024460 Ga0495640_0024460_2481_3689 401
2534 3300046533 Ga0495640_0036896 Ga0495640_0036896_1580_2788 401
2535 3300046533 Ga0495640_0058495 Ga0495640_0058495_560_1768 401
2536 3300046533 Ga0495640_0067704 Ga0495640_0067704_1144_2352 401
2537 3300046533 Ga0495640_0084740 Ga0495640_0084740_854_2062 401
2538 3300046533 Ga0495640_0126346 Ga0495640_0126346_413_1621 401
2539 3300046536 Ga0495587_0006418 Ga0495587_0006418_932_2140 401
2540 3300046536 Ga0495587_0007962 Ga0495587_0007962_4989_6197 401
2541 3300046536 Ga0495587_0010201 Ga0495587_0010201_4324_5532 401
2542 3300046536 Ga0495587_0012027 Ga0495587_0012027_3862_5070 401
2543 3300046536 Ga0495587_0012306 Ga0495587_0012306_2701_3909 401
2544 3300046536 Ga0495587_0014909 Ga0495587_0014909_3593_4801 401
2545 3300046536 Ga0495587_0087094 Ga0495587_0087094_161_1369 401
2546 3300046536 Ga0495587_0155375 Ga0495587_0155375_46_1254 401
2547 3300046537 Ga0495598_0031182 Ga0495598_0031182_157_1365 401
2548 3300046543 Ga0495645_0000795 Ga0495645_0000795_4475_5683 401
2549 3300046543 Ga0495645_0004352 Ga0495645_0004352_7831_9039 401
2550 3300046543 Ga0495645_0013623 Ga0495645_0013623_1714_2922 401
2551 3300046543 Ga0495645_0017745 Ga0495645_0017745_2169_3377 401
2552 3300046557 Ga0495622_0004994 Ga0495622_0004994_2314_3522 401
2553 3300046557 Ga0495622_0013142 Ga0495622_0013142_1415_2623 401
2554 3300046557 Ga0495622_0028076 Ga0495622_0028076_10_1218 401
2555 3300046557 Ga0495622_0045282 Ga0495622_0045282_183_1391 401
2556 3300046558 Ga0495633_0003640 Ga0495633_0003640_954_2162 401
2557 3300046559 Ga0495667_0002033 Ga0495667_0002033_12182_13390 401
2558 3300046559 Ga0495667_0002298 Ga0495667_0002298_7280_8488 401
2559 3300046559 Ga0495667_0005427 Ga0495667_0005427_4725_5933 401
2560 3300046559 Ga0495667_0009201 Ga0495667_0009201_4780_5988 401
2561 3300046559 Ga0495667_0009299 Ga0495667_0009299_1765_2973 401
2562 3300046559 Ga0495667_0035682 Ga0495667_0035682_631_1839 401
2563 3300046559 Ga0495667_0041758 Ga0495667_0041758_1021_2229 401
2564 3300046615 Ga0495656_0009206 Ga0495656_0009206_858_2066 401
2565 3300046615 Ga0495656_0014888 Ga0495656_0014888_991_2199 401
2566 3300046642 Ga0495634_0001894 Ga0495634_0001894_11086_12294 401
2567 3300046642 Ga0495634_0007460 Ga0495634_0007460_5306_6514 401
2568 3300046642 Ga0495634_0009648 Ga0495634_0009648_2008_3216 401
2569 3300046642 Ga0495634_0016003 Ga0495634_0016003_4058_5266 401
2570 3300046642 Ga0495634_0026375 Ga0495634_0026375_1905_3113 401
2571 3300046642 Ga0495634_0035930 Ga0495634_0035930_317_1525 401
2572 3300046642 Ga0495634_0037463 Ga0495634_0037463_834_2042 401
2573 3300046642 Ga0495634_0052862 Ga0495634_0052862_612_1820 401
2574 3300046642 Ga0495634_0058959 Ga0495634_0058959_535_1743 401
2575 3300046642 Ga0495634_0090767 Ga0495634_0090767_555_1763 401
2576 3300046642 Ga0495634_0102782 Ga0495634_0102782_242_1450 401
2577 3300046660 Ga0495625_0106365 Ga0495625_0106365_29_1237 401
2578 3300046660 Ga0495625_0209552 Ga0495625_0209552_40_1248 401
2579 3300046663 Ga0495635_0000288 Ga0495635_0000288_30248_31456 401
2580 3300046663 Ga0495635_0001168 Ga0495635_0001168_5960_7168 401
2581 3300046663 Ga0495635_0001402 Ga0495635_0001402_6990_8198 401
2582 3300046663 Ga0495635_0007716 Ga0495635_0007716_2289_3497 401
2583 3300046663 Ga0495635_0008149 Ga0495635_0008149_2236_3444 401
2584 3300046663 Ga0495635_0010102 Ga0495635_0010102_5051_6259 401
2585 3300046663 Ga0495635_0010787 Ga0495635_0010787_4984_6192 401
2586 3300046663 Ga0495635_0013043 Ga0495635_0013043_2225_3433 401
2587 3300046663 Ga0495635_0015913 Ga0495635_0015913_1747_2955 401
2588 3300046663 Ga0495635_0071144 Ga0495635_0071144_939_2147 401
2589 3300046663 Ga0495635_0099734 Ga0495635_0099734_467_1675 401
2590 3300046664 Ga0495659_0001100 Ga0495659_0001100_49_1257 401
2591 3300046664 Ga0495659_0052646 Ga0495659_0052646_194_1402 401
2592 3300046665 Ga0495661_0104638 Ga0495661_0104638_312_1520 401
2593 3300046674 Ga0495588_0006573 Ga0495588_0006573_2566_3774 401
2594 3300046674 Ga0495588_0068182 Ga0495588_0068182_540_1748 401
2595 3300046675 Ga0495657_0015860 Ga0495657_0015860_3547_4755 401
2596 3300046675 Ga0495657_0016056 Ga0495657_0016056_3610_4818 401
2597 3300046675 Ga0495657_0034341 Ga0495657_0034341_1763_2971 401
2598 3300046675 Ga0495657_0044614 Ga0495657_0044614_747_1955 401
2599 3300046675 Ga0495657_0057359 Ga0495657_0057359_297_1505 401
2600 3300046678 Ga0495599_0003372 Ga0495599_0003372_6312_7520 401
2601 3300046678 Ga0495599_0006130 Ga0495599_0006130_3224_4432 401
2602 3300046678 Ga0495599_0007175 Ga0495599_0007175_3970_5178 401
2603 3300046678 Ga0495599_0107154 Ga0495599_0107154_294_1502 401
2604 3300046679 Ga0495623_0005612 Ga0495623_0005612_4202_5410 401
2605 3300046679 Ga0495623_0070800 Ga0495623_0070800_556_1764 401
2606 3300046680 Ga0495646_0000602 Ga0495646_0000602_146_1354 401
2607 3300046680 Ga0495646_0005603 Ga0495646_0005603_651_1859 401
2608 3300046680 Ga0495646_0006900 Ga0495646_0006900_4300_5508 401
2609 3300046680 Ga0495646_0009008 Ga0495646_0009008_486_1694 401
2610 3300046681 Ga0495647_0000491 Ga0495647_0000491_6196_7404 401
2611 3300046681 Ga0495647_0023197 Ga0495647_0023197_717_1925 401
2612 3300046681 Ga0495647_0023329 Ga0495647_0023329_855_2063 401
2613 3300046683 Ga0495658_0003012 Ga0495658_0003012_6726_7934 401
2614 3300046683 Ga0495658_0003472 Ga0495658_0003472_5520_6728 401
2615 3300046683 Ga0495658_0004272 Ga0495658_0004272_23_1231 401
2616 3300046683 Ga0495658_0013109 Ga0495658_0013109_2942_4150 401
2617 3300046683 Ga0495658_0021459 Ga0495658_0021459_825_2033 401
2618 3300046684 Ga0495669_0085207 Ga0495669_0085207_59_1267 401
2619 3300046684 Ga0495669_0100100 Ga0495669_0100100_97_1305 401
2620 3300046689 Ga0495613_0003519 Ga0495613_0003519_8460_9668 401
2621 3300046689 Ga0495613_0011931 Ga0495613_0011931_597_1805 401
2622 3300046689 Ga0495613_0019969 Ga0495613_0019969_2510_3718 401
2623 3300046689 Ga0495613_0072685 Ga0495613_0072685_906_2114 401
2624 3300046689 Ga0495613_0103421 Ga0495613_0103421_113_1321 401
2625 3300046689 Ga0495613_0122064 Ga0495613_0122064_51_1259 401
2626 3300046690 Ga0495624_0001428 Ga0495624_0001428_15169_16377 401
2627 3300046691 Ga0495670_0001262 Ga0495670_0001262_5916_7124 401
2628 3300046692 Ga0495671_0056262 Ga0495671_0056262_274_1482 401
2629 3300046692 Ga0495671_0071269 Ga0495671_0071269_278_1486 401
2630 3300046794 Ga0495589_0056154 Ga0495589_0056154_52_1260 401
2631 3300046809 Ga0495600_0000732 Ga0495600_0000732_3855_5063 401
2632 3300046809 Ga0495600_0003964 Ga0495600_0003964_3274_4482 401
2633 3300046809 Ga0495600_0004287 Ga0495600_0004287_6214_7422 401
2634 3300046809 Ga0495600_0020521 Ga0495600_0020521_1642_2850 401
2635 3300046809 Ga0495600_0026293 Ga0495600_0026293_151_1359 401
2636 3300046809 Ga0495600_0038671 Ga0495600_0038671_1478_2686 401
2637 3300046809 Ga0495600_0045449 Ga0495600_0045449_29_1237 401
2638 3300046809 Ga0495600_0098835 Ga0495600_0098835_635_1843 401
2639 3300046809 Ga0495600_0124770 Ga0495600_0124770_413_1621 401
2640 3300047315 Ga0495581_0012365 Ga0495581_0012365_3106_4314 401
2641 3300047315 Ga0495581_0036543 Ga0495581_0036543_713_1921 401
2642 3300047315 Ga0495581_0051337 Ga0495581_0051337_768_1976 401
2643 3300047317 Ga0495604_0000518 Ga0495604_0000518_2427_3635 401
2644 3300047317 Ga0495604_0002291 Ga0495604_0002291_1500_2708 401
2645 3300047317 Ga0495604_0003472 Ga0495604_0003472_325_1533 401
2646 3300047317 Ga0495604_0004766 Ga0495604_0004766_8772_9980 401
2647 3300047317 Ga0495604_0007687 Ga0495604_0007687_30_1238 401
2648 3300047317 Ga0495604_0016039 Ga0495604_0016039_1668_2876 401
2649 3300047317 Ga0495604_0021381 Ga0495604_0021381_1265_2473 401
2650 3300047317 Ga0495604_0029179 Ga0495604_0029179_532_1740 401
2651 3300047317 Ga0495604_0042393 Ga0495604_0042393_1921_3129 401
2652 3300047317 Ga0495604_0059975 Ga0495604_0059975_832_2040 401
2653 3300047317 Ga0495604_0146677 Ga0495604_0146677_58_1266 401
2654 3300047319 Ga0495674_0005390 Ga0495674_0005390_8726_9934 401
2655 3300047319 Ga0495674_0009229 Ga0495674_0009229_2497_3705 401
2656 3300047319 Ga0495674_0016219 Ga0495674_0016219_2399_3607 401
2657 3300047319 Ga0495674_0018724 Ga0495674_0018724_2953_4161 401
2658 3300047319 Ga0495674_0022837 Ga0495674_0022837_2603_3811 401
2659 3300047319 Ga0495674_0025317 Ga0495674_0025317_3161_4369 401
2660 3300047319 Ga0495674_0033497 Ga0495674_0033497_1200_2408 401
2661 3300047319 Ga0495674_0122291 Ga0495674_0122291_964_2172 401
2662 3300047319 Ga0495674_0226629 Ga0495674_0226629_19_1227 401
2663 3300047320 Ga0495672_0016486 Ga0495672_0016486_3382_4590 401
2664 3300047320 Ga0495672_0109411 Ga0495672_0109411_245_1453 401
2665 3300047321 Ga0495676_0036136 Ga0495676_0036136_2546_3754 401
2666 3300047321 Ga0495676_0040840 Ga0495676_0040840_2058_3266 401
2667 3300047321 Ga0495676_0111806 Ga0495676_0111806_31_1239 401
2668 3300047322 Ga0495680_0000871 Ga0495680_0000871_4576_5784 401
2669 3300047322 Ga0495680_0001213 Ga0495680_0001213_24643_25851 401
2670 3300047322 Ga0495680_0001647 Ga0495680_0001647_7714_8922 401
2671 3300047322 Ga0495680_0003933 Ga0495680_0003933_2859_4067 401
2672 3300047322 Ga0495680_0010136 Ga0495680_0010136_692_1900 401
2673 3300047322 Ga0495680_0016372 Ga0495680_0016372_3452_4660 401
2674 3300047322 Ga0495680_0020334 Ga0495680_0020334_3719_4927 401
2675 3300047322 Ga0495680_0137306 Ga0495680_0137306_298_1506 401
2676 3300047443 Ga0495687_018943 Ga0495687_018943_953_2161 401
2677 3300047444 Ga0495675_0001589 Ga0495675_0001589_9197_10405 401
2678 3300047444 Ga0495675_0002008 Ga0495675_0002008_2173_3381 401
2679 3300047444 Ga0495675_0002866 Ga0495675_0002866_5597_6805 401
2680 3300047444 Ga0495675_0099187 Ga0495675_0099187_57_1265 401
2681 3300047470 Ga0495681_0032061 Ga0495681_0032061_561_1769 401
2682 3300047471 Ga0495684_0000161 Ga0495684_0000161_36568_37776 401
2683 3300047471 Ga0495684_0001218 Ga0495684_0001218_19441_20649 401
2684 3300047471 Ga0495684_0021587 Ga0495684_0021587_2964_4172 401
2685 3300047471 Ga0495684_0024812 Ga0495684_0024812_2810_4018 401
2686 3300047471 Ga0495684_0121068 Ga0495684_0121068_180_1388 401
2687 3300047471 Ga0495684_0152132 Ga0495684_0152132_242_1450 401
2688 3300047472 Ga0495686_0029726 Ga0495686_0029726_1692_2900 401
2689 3300047472 Ga0495686_0055201 Ga0495686_0055201_593_1801 401
2690 3300047472 Ga0495686_0056220 Ga0495686_0056220_761_1969 401
2691 3300047472 Ga0495686_0072295 Ga0495686_0072295_124_1332 401
2692 3300047673 Ga0495593_0000235 Ga0495593_0000235_22479_23687 401
2693 3300047673 Ga0495593_0000707 Ga0495593_0000707_16911_18119 401
2694 3300047673 Ga0495593_0002230 Ga0495593_0002230_10146_11354 401
2695 3300047673 Ga0495593_0002912 Ga0495593_0002912_5938_7146 401
2696 3300047673 Ga0495593_0036611 Ga0495593_0036611_850_2058 401
2697 3300047673 Ga0495593_0037637 Ga0495593_0037637_1187_2395 401
2698 3300047673 Ga0495593_0068685 Ga0495593_0068685_110_1318 401
2699 3300047673 Ga0495593_0104755 Ga0495593_0104755_45_1253 401
2700 3300047673 Ga0495593_0124237 Ga0495593_0124237_71_1279 401
2701 3300048088 Ga0495602_0003618 Ga0495602_0003618_1580_2788 401
2702 3300048088 Ga0495602_0010148 Ga0495602_0010148_1714_2922 401
2703 3300048088 Ga0495602_0012004 Ga0495602_0012004_4173_5381 401
2704 3300048088 Ga0495602_0020750 Ga0495602_0020750_3305_4513 401
2705 3300048088 Ga0495602_0043270 Ga0495602_0043270_485_1693 401
2706 3300048088 Ga0495602_0084246 Ga0495602_0084246_904_2112 401
2707 3300048088 Ga0495602_0142429 Ga0495602_0142429_507_1715 401
2708 3300048088 Ga0495602_0209229 Ga0495602_0209229_25_1233 401
2709 3300048089 Ga0495614_0004761 Ga0495614_0004761_2715_3923 401
2710 3300048903 Ga0496100_0002512 Ga0496100_0002512_2104_3312 401
2711 3300048903 Ga0496100_0032616 Ga0496100_0032616_1937_3145 401
2712 3300048903 Ga0496100_0040819 Ga0496100_0040819_1388_2596 401
2713 3300048903 Ga0496100_0084930 Ga0496100_0084930_32_1240 401
2714 3300048904 Ga0496101_0003987 Ga0496101_0003987_7574_8782 401
2715 3300048904 Ga0496101_0005069 Ga0496101_0005069_1698_2906 401
2716 3300048904 Ga0496101_0010137 Ga0496101_0010137_1381_2589 401
2717 3300048904 Ga0496101_0173220 Ga0496101_0173220_258_1466 401
2718 3300048905 Ga0496102_0001927 Ga0496102_0001927_10269_11477 401
2719 3300048905 Ga0496102_0002058 Ga0496102_0002058_14461_15669 401
2720 3300048905 Ga0496102_0032070 Ga0496102_0032070_3454_4662 401
2721 3300048905 Ga0496102_0036216 Ga0496102_0036216_662_1870 401
2722 3300048905 Ga0496102_0059016 Ga0496102_0059016_1901_3109 401
2723 3300048905 Ga0496102_0070914 Ga0496102_0070914_1168_2376 401
2724 3300048905 Ga0496102_0076705 Ga0496102_0076705_959_2167 401
2725 3300048905 Ga0496102_0365934 Ga0496102_0365934_79_1287 401
2726 3300048906 Ga0496103_0031972 Ga0496103_0031972_1006_2214 401
2727 3300048906 Ga0496103_0039243 Ga0496103_0039243_927_2135 401
2728 3300048907 Ga0496104_0000339 Ga0496104_0000339_32123_33331 401
2729 3300048907 Ga0496104_0000512 Ga0496104_0000512_30607_31815 401
2730 3300048907 Ga0496104_0000827 Ga0496104_0000827_58_1266 401
2731 3300048907 Ga0496104_0005940 Ga0496104_0005940_5347_6555 401
2732 3300048907 Ga0496104_0006506 Ga0496104_0006506_7394_8602 401
2733 3300048907 Ga0496104_0007645 Ga0496104_0007645_6744_7952 401
2734 3300048907 Ga0496104_0011047 Ga0496104_0011047_469_1677 401
2735 3300048907 Ga0496104_0015190 Ga0496104_0015190_5140_6348 401
2736 3300048907 Ga0496104_0020418 Ga0496104_0020418_243_1451 401
2737 3300048907 Ga0496104_0025027 Ga0496104_0025027_3144_4352 401
2738 3300048907 Ga0496104_0029636 Ga0496104_0029636_1503_2711 401
2739 3300048907 Ga0496104_0081710 Ga0496104_0081710_1576_2784 401
2740 3300048907 Ga0496104_0090586 Ga0496104_0090586_943_2151 401
2741 3300048907 Ga0496104_0129267 Ga0496104_0129267_1050_2258 401
2742 3300048907 Ga0496104_0181680 Ga0496104_0181680_668_1876 401
2743 3300048907 Ga0496104_0228189 Ga0496104_0228189_542_1750 401
2744 3300048907 Ga0496104_0254378 Ga0496104_0254378_158_1366 401
2745 3300048908 Ga0496105_0000153 Ga0496105_0000153_27364_28572 401
2746 3300048908 Ga0496105_0000290 Ga0496105_0000290_6529_7737 401
2747 3300048908 Ga0496105_0000736 Ga0496105_0000736_9194_10402 401
2748 3300048908 Ga0496105_0002167 Ga0496105_0002167_2954_4162 401
2749 3300048908 Ga0496105_0010544 Ga0496105_0010544_555_1763 401
2750 3300048908 Ga0496105_0031454 Ga0496105_0031454_2521_3729 401
2751 3300048908 Ga0496105_0032017 Ga0496105_0032017_2310_3518 401
2752 3300048908 Ga0496105_0036625 Ga0496105_0036625_524_1732 401
2753 3300048908 Ga0496105_0037038 Ga0496105_0037038_1159_2367 401
2754 3300048908 Ga0496105_0059703 Ga0496105_0059703_353_1561 401
2755 3300048908 Ga0496105_0122668 Ga0496105_0122668_432_1640 401
2756 3300048909 Ga0496106_0001557 Ga0496106_0001557_9550_10758 401
2757 3300048909 Ga0496106_0040460 Ga0496106_0040460_1208_2416 401
2758 3300048909 Ga0496106_0045870 Ga0496106_0045870_1777_2985 401
2759 3300048909 Ga0496106_0047149 Ga0496106_0047149_118_1326 401
2760 3300048909 Ga0496106_0069635 Ga0496106_0069635_1169_2377 401
2761 3300048909 Ga0496106_0100150 Ga0496106_0100150_277_1485 401
2762 3300048910 Ga0496107_0064439 Ga0496107_0064439_772_1980 401
2763 3300048910 Ga0496107_0064491 Ga0496107_0064491_608_1816 401
2764 3300048911 Ga0496108_0001742 Ga0496108_0001742_6529_7737 401
2765 3300048911 Ga0496108_0006111 Ga0496108_0006111_1772_2980 401
2766 3300048911 Ga0496108_0008352 Ga0496108_0008352_3746_4954 401
2767 3300048911 Ga0496108_0015731 Ga0496108_0015731_4002_5210 401
2768 3300048911 Ga0496108_0030916 Ga0496108_0030916_1334_2542 401
2769 3300048911 Ga0496108_0032957 Ga0496108_0032957_2885_4093 401
2770 3300048911 Ga0496108_0073785 Ga0496108_0073785_228_1436 401
2771 3300048911 Ga0496108_0089622 Ga0496108_0089622_800_2008 401
2772 3300048911 Ga0496108_0106071 Ga0496108_0106071_1118_2326 401
2773 3300048911 Ga0496108_0168116 Ga0496108_0168116_211_1419 401
2774 3300048911 Ga0496108_0232968 Ga0496108_0232968_64_1272 401
2775 3300048912 Ga0496109_0000834 Ga0496109_0000834_7190_8398 401
2776 3300048912 Ga0496109_0001925 Ga0496109_0001925_9506_10714 401
2777 3300048912 Ga0496109_0039298 Ga0496109_0039298_1937_3145 401
2778 3300048912 Ga0496109_0051158 Ga0496109_0051158_1874_3082 401
2779 3300048912 Ga0496109_0092374 Ga0496109_0092374_738_1946 401
2780 3300048912 Ga0496109_0105468 Ga0496109_0105468_44_1252 401
2781 3300048912 Ga0496109_0129361 Ga0496109_0129361_133_1341 401
2782 3300048912 Ga0496109_0160803 Ga0496109_0160803_436_1644 401
2783 3300048913 Ga0496110_0001898 Ga0496110_0001898_6507_7715 401
2784 3300048913 Ga0496110_0009925 Ga0496110_0009925_3260_4468 401
2785 3300048913 Ga0496110_0027656 Ga0496110_0027656_1504_2712 401
2786 3300048913 Ga0496110_0033943 Ga0496110_0033943_537_1745 401
2787 3300048913 Ga0496110_0046210 Ga0496110_0046210_954_2162 401
2788 3300048913 Ga0496110_0072817 Ga0496110_0072817_1552_2760 401
2789 3300048913 Ga0496110_0111837 Ga0496110_0111837_863_2071 401
2790 3300048913 Ga0496110_0122550 Ga0496110_0122550_750_1958 401
2791 3300048913 Ga0496110_0125506 Ga0496110_0125506_914_2122 401
2792 3300048913 Ga0496110_0213373 Ga0496110_0213373_479_1687 401
2793 3300048913 Ga0496110_0221478 Ga0496110_0221478_70_1278 401
2794 3300048914 Ga0496111_0042028 Ga0496111_0042028_290_1498 401
2795 3300048914 Ga0496111_0046236 Ga0496111_0046236_1845_3053 401
2796 3300048914 Ga0496111_0048202 Ga0496111_0048202_1303_2511 401
2797 3300048914 Ga0496111_0048746 Ga0496111_0048746_545_1753 401
2798 3300048914 Ga0496111_0119615 Ga0496111_0119615_692_1900 401
2799 3300048914 Ga0496111_0136665 Ga0496111_0136665_24_1232 401
2800 3300048914 Ga0496111_0203772 Ga0496111_0203772_58_1266 401
2801 3300048915 Ga0496112_0000174 Ga0496112_0000174_15578_16786 401
2802 3300048915 Ga0496112_0004306 Ga0496112_0004306_1011_2219 401
2803 3300048915 Ga0496112_0009009 Ga0496112_0009009_4496_5704 401
2804 3300048915 Ga0496112_0011073 Ga0496112_0011073_2313_3521 401
2805 3300048915 Ga0496112_0013924 Ga0496112_0013924_5270_6478 401
2806 3300048915 Ga0496112_0055716 Ga0496112_0055716_2331_3539 401
2807 3300048915 Ga0496112_0062176 Ga0496112_0062176_1172_2380 401
2808 3300048915 Ga0496112_0134244 Ga0496112_0134244_60_1268 401
2809 3300048915 Ga0496112_0192855 Ga0496112_0192855_479_1687 401
2810 3300048916 Ga0496113_0006601 Ga0496113_0006601_2124_3332 401
2811 3300048916 Ga0496113_0006892 Ga0496113_0006892_3484_4692 401
2812 3300048916 Ga0496113_0019116 Ga0496113_0019116_2633_3841 401
2813 3300048916 Ga0496113_0019228 Ga0496113_0019228_1533_2741 401
2814 3300048916 Ga0496113_0034232 Ga0496113_0034232_1783_2991 401
2815 3300048916 Ga0496113_0041556 Ga0496113_0041556_1164_2372 401
2816 3300048916 Ga0496113_0062277 Ga0496113_0062277_1430_2638 401
2817 3300048916 Ga0496113_0096095 Ga0496113_0096095_520_1728 401
2818 3300048916 Ga0496113_0124934 Ga0496113_0124934_431_1639 401
2819 3300048917 Ga0496114_0041626 Ga0496114_0041626_207_1415 401
2820 3300048917 Ga0496114_0064050 Ga0496114_0064050_130_1338 401
2821 3300048917 Ga0496114_0121966 Ga0496114_0121966_72_1280 401
2822 3300048917 Ga0496114_0133389 Ga0496114_0133389_901_2109 401
2823 3300048917 Ga0496114_0145796 Ga0496114_0145796_596_1804 401
2824 3300048917 Ga0496114_0241317 Ga0496114_0241317_110_1318 401
2825 3300048918 Ga0496115_0001771 Ga0496115_0001771_2042_3250 401
2826 3300048918 Ga0496115_0002325 Ga0496115_0002325_9637_10845 401
2827 3300048918 Ga0496115_0021464 Ga0496115_0021464_1050_2258 401
2828 3300048918 Ga0496115_0033303 Ga0496115_0033303_137_1345 401
2829 3300048918 Ga0496115_0053670 Ga0496115_0053670_208_1416 401
2830 3300048918 Ga0496115_0055834 Ga0496115_0055834_1807_3015 401
2831 3300048918 Ga0496115_0057711 Ga0496115_0057711_1721_2929 401
2832 3300048918 Ga0496115_0085540 Ga0496115_0085540_428_1636 401
2833 3300048918 Ga0496115_0128121 Ga0496115_0128121_38_1246 401
2834 3300048918 Ga0496115_0137509 Ga0496115_0137509_265_1473 401
2835 3300048919 Ga0496116_0000100 Ga0496116_0000100_67258_68466 401
2836 3300048919 Ga0496116_0000934 Ga0496116_0000934_22378_23586 401
2837 3300048919 Ga0496116_0002794 Ga0496116_0002794_311_1519 401
2838 3300048919 Ga0496116_0029820 Ga0496116_0029820_2395_3603 401
2839 3300048919 Ga0496116_0036499 Ga0496116_0036499_1160_2368 401
2840 3300048919 Ga0496116_0047019 Ga0496116_0047019_1236_2444 401
2841 3300048920 Ga0496117_0000002 Ga0496117_0000002_2064244_2065452 401
2842 3300048920 Ga0496117_0005902 Ga0496117_0005902_10954_12162 401
2843 3300048920 Ga0496117_0019487 Ga0496117_0019487_3284_4492 401
2844 3300048920 Ga0496117_0058338 Ga0496117_0058338_147_1352 401
2845 3300048920 Ga0496117_0081360 Ga0496117_0081360_535_1743 401
2846 3300048920 Ga0496117_0105334 Ga0496117_0105334_62_1270 401
2847 3300048920 Ga0496117_0132717 Ga0496117_0132717_49_1257 401
2848 3300048921 Ga0496118_0000943 Ga0496118_0000943_27868_29073 401
2849 3300048921 Ga0496118_0001431 Ga0496118_0001431_34663_35871 401
2850 3300048921 Ga0496118_0001493 Ga0496118_0001493_32407_33615 401
2851 3300048921 Ga0496118_0004386 Ga0496118_0004386_10946_12154 401
2852 3300048921 Ga0496118_0029865 Ga0496118_0029865_3311_4519 401
2853 3300048921 Ga0496118_0061701 Ga0496118_0061701_446_1651 401
2854 3300048921 Ga0496118_0072424 Ga0496118_0072424_723_1931 401
2855 3300048922 Ga0496119_0000891 Ga0496119_0000891_9712_10920 401
2856 3300048922 Ga0496119_0010321 Ga0496119_0010321_3279_4484 401
2857 3300048922 Ga0496119_0026987 Ga0496119_0026987_1652_2860 401
2858 3300048922 Ga0496119_0033436 Ga0496119_0033436_1782_2990 401
2859 3300048922 Ga0496119_0034365 Ga0496119_0034365_1076_2284 401
2860 3300048923 Ga0496120_0000021 Ga0496120_0000021_1123_2331 401
2861 3300048923 Ga0496120_0020050 Ga0496120_0020050_1691_2899 401
2862 3300048923 Ga0496120_0090929 Ga0496120_0090929_182_1390 401
2863 3300048923 Ga0496120_0117181 Ga0496120_0117181_28_1236 401
2864 3300048924 Ga0496121_0000001 Ga0496121_0000001_139389_140597 401
2865 3300048924 Ga0496121_0000135 Ga0496121_0000135_14243_15448 401
2866 3300048924 Ga0496121_0000897 Ga0496121_0000897_4645_5853 401
2867 3300048924 Ga0496121_0000998 Ga0496121_0000998_26616_27824 401
2868 3300048924 Ga0496121_0001462 Ga0496121_0001462_21340_22548 401
2869 3300048924 Ga0496121_0003809 Ga0496121_0003809_1167_2375 401
2870 3300048924 Ga0496121_0006319 Ga0496121_0006319_9665_10873 401
2871 3300048924 Ga0496121_0010678 Ga0496121_0010678_590_1798 401
2872 3300048924 Ga0496121_0016207 Ga0496121_0016207_3829_5037 401
2873 3300048924 Ga0496121_0027955 Ga0496121_0027955_3998_5206 401
2874 3300048924 Ga0496121_0031227 Ga0496121_0031227_1572_2780 401
2875 3300048924 Ga0496121_0225995 Ga0496121_0225995_59_1267 401
2876 3300048925 Ga0496122_0000001 Ga0496122_0000001_1435034_1436242 401
2877 3300048925 Ga0496122_0000018 Ga0496122_0000018_15406_16614 401
2878 3300048925 Ga0496122_0009277 Ga0496122_0009277_5390_6598 401
2879 3300048925 Ga0496122_0018155 Ga0496122_0018155_1691_2899 401
2880 3300048925 Ga0496122_0058531 Ga0496122_0058531_1029_2237 401
2881 3300048926 Ga0496123_0000001 Ga0496123_0000001_1438765_1439973 401
2882 3300048926 Ga0496123_0000015 Ga0496123_0000015_15406_16614 401
2883 3300048926 Ga0496123_0000339 Ga0496123_0000339_5386_6594 401
2884 3300048926 Ga0496123_0006065 Ga0496123_0006065_10324_11532 401
2885 3300048926 Ga0496123_0010075 Ga0496123_0010075_3929_5137 401
2886 3300048926 Ga0496123_0034361 Ga0496123_0034361_96_1304 401
2887 3300048926 Ga0496123_0044602 Ga0496123_0044602_1671_2879 401
2888 3300048926 Ga0496123_0094579 Ga0496123_0094579_387_1595 401
2889 3300048926 Ga0496123_0095739 Ga0496123_0095739_214_1422 401
2890 3300048927 Ga0496124_0000063 Ga0496124_0000063_206837_208045 401
2891 3300048927 Ga0496124_0000513 Ga0496124_0000513_2244_3452 401
2892 3300048927 Ga0496124_0001399 Ga0496124_0001399_19208_20416 401
2893 3300048927 Ga0496124_0003946 Ga0496124_0003946_5132_6340 401
2894 3300048927 Ga0496124_0006047 Ga0496124_0006047_8510_9718 401
2895 3300048927 Ga0496124_0059373 Ga0496124_0059373_304_1512 401
2896 3300048927 Ga0496124_0164907 Ga0496124_0164907_233_1441 401
2897 3300048927 Ga0496124_0204796 Ga0496124_0204796_158_1366 401
2898 3300048928 Ga0496125_0000001 Ga0496125_0000001_252846_254054 401
2899 3300048928 Ga0496125_0000048 Ga0496125_0000048_57646_58854 401
2900 3300048928 Ga0496125_0000299 Ga0496125_0000299_74323_75531 401
2901 3300048928 Ga0496125_0000664 Ga0496125_0000664_9858_11066 401
2902 3300048928 Ga0496125_0016378 Ga0496125_0016378_5258_6466 401
2903 3300048928 Ga0496125_0022463 Ga0496125_0022463_91_1299 401
2904 3300048928 Ga0496125_0058589 Ga0496125_0058589_1360_2568 401
2905 3300048928 Ga0496125_0084872 Ga0496125_0084872_470_1678 401
2906 3300048929 Ga0496126_0000311 Ga0496126_0000311_37742_38950 401
2907 3300048929 Ga0496126_0000380 Ga0496126_0000380_69590_70798 401
2908 3300048929 Ga0496126_0011178 Ga0496126_0011178_1809_3017 401
2909 3300048929 Ga0496126_0012908 Ga0496126_0012908_4664_5872 401
2910 3300048929 Ga0496126_0015005 Ga0496126_0015005_4744_5952 401
2911 3300048929 Ga0496126_0044980 Ga0496126_0044980_1001_2209 401
2912 3300048929 Ga0496126_0062445 Ga0496126_0062445_1266_2474 401
2913 3300048929 Ga0496126_0124603 Ga0496126_0124603_961_2169 401
2914 3300048929 Ga0496126_0140367 Ga0496126_0140367_110_1318 401
2915 3300049568 Ga0501031_0000003 Ga0501031_0000003_69480_70688 401
2916 3300049568 Ga0501031_0026627 Ga0501031_0026627_1308_2516 401
2917 3300049568 Ga0501031_0049572 Ga0501031_0049572_1163_2371 401
2918 3300049569 Ga0501032_0000010 Ga0501032_0000010_69480_70688 401
2919 3300049569 Ga0501032_0013029 Ga0501032_0013029_2614_3822 401
2920 3300049569 Ga0501032_0019622 Ga0501032_0019622_161_1369 401
2921 3300049569 Ga0501032_0032102 Ga0501032_0032102_639_1847 401
2922 3300049569 Ga0501032_0192574 Ga0501032_0192574_34_1242 401
2923 3300049570 Ga0501033_0000017 Ga0501033_0000017_69480_70688 401
2924 3300049570 Ga0501033_0000728 Ga0501033_0000728_14221_15429 401
2925 3300049570 Ga0501033_0001121 Ga0501033_0001121_19234_20442 401
2926 3300049570 Ga0501033_0019053 Ga0501033_0019053_1335_2543 401
2927 3300049570 Ga0501033_0027013 Ga0501033_0027013_259_1467 401
2928 3300049570 Ga0501033_0030913 Ga0501033_0030913_717_1925 401
2929 3300049570 Ga0501033_0064999 Ga0501033_0064999_428_1636 401
2930 3300049570 Ga0501033_0068368 Ga0501033_0068368_1289_2497 401
2931 3300049570 Ga0501033_0105532 Ga0501033_0105532_308_1516 401
2932 3300049570 Ga0501033_0191018 Ga0501033_0191018_209_1417 401
2933 3300049571 Ga0501034_0000053 Ga0501034_0000053_136134_137342 401
2934 3300049571 Ga0501034_0000181 Ga0501034_0000181_101779_102987 401
2935 3300049571 Ga0501034_0000319 Ga0501034_0000319_19334_20542 401
2936 3300049571 Ga0501034_0010204 Ga0501034_0010204_3695_4903 401
2937 3300049571 Ga0501034_0020409 Ga0501034_0020409_2100_3308 401
2938 3300049571 Ga0501034_0024771 Ga0501034_0024771_2100_3308 401
2939 3300049571 Ga0501034_0063364 Ga0501034_0063364_2381_3589 401
2940 3300049571 Ga0501034_0069127 Ga0501034_0069127_1822_3030 401
2941 3300049571 Ga0501034_0120155 Ga0501034_0120155_1260_2468 401
2942 3300049571 Ga0501034_0163359 Ga0501034_0163359_839_2047 401
2943 3300049571 Ga0501034_0174995 Ga0501034_0174995_622_1830 401
2944 3300049571 Ga0501034_0176349 Ga0501034_0176349_845_2053 401
2945 3300049571 Ga0501034_0191480 Ga0501034_0191480_322_1530 401
2946 3300049571 Ga0501034_0330843 Ga0501034_0330843_235_1443 401
2947 3300049572 Ga0501036_0000009 Ga0501036_0000009_69480_70688 401
2948 3300049572 Ga0501036_0002326 Ga0501036_0002326_7724_8932 401
2949 3300049572 Ga0501036_0010368 Ga0501036_0010368_6386_7594 401
2950 3300049572 Ga0501036_0013644 Ga0501036_0013644_2100_3308 401
2951 3300049572 Ga0501036_0084254 Ga0501036_0084254_221_1429 401
2952 3300049572 Ga0501036_0104976 Ga0501036_0104976_1023_2231 401
2953 3300049572 Ga0501036_0111655 Ga0501036_0111655_174_1382 401
2954 3300049572 Ga0501036_0170996 Ga0501036_0170996_565_1773 401
2955 3300049573 Ga0501037_0000008 Ga0501037_0000008_136125_137333 401
2956 3300049573 Ga0501037_0004511 Ga0501037_0004511_3063_4271 401
2957 3300049573 Ga0501037_0059770 Ga0501037_0059770_558_1766 401
2958 3300049573 Ga0501037_0081009 Ga0501037_0081009_487_1695 401
2959 3300049573 Ga0501037_0145281 Ga0501037_0145281_430_1638 401
2960 3300049574 Ga0501038_0000008 Ga0501038_0000008_136134_137342 401
2961 3300049574 Ga0501038_0001231 Ga0501038_0001231_10445_11653 401
2962 3300049574 Ga0501038_0038493 Ga0501038_0038493_880_2088 401
2963 3300049574 Ga0501038_0060876 Ga0501038_0060876_1800_3008 401
2964 3300049574 Ga0501038_0291350 Ga0501038_0291350_33_1241 401
2965 3300049575 Ga0501039_0000021 Ga0501039_0000021_25211_26419 401
2966 3300049575 Ga0501039_0000114 Ga0501039_0000114_41623_42831 401
2967 3300049575 Ga0501039_0002026 Ga0501039_0002026_11148_12356 401
2968 3300049575 Ga0501039_0120355 Ga0501039_0120355_750_1958 401
2969 3300049575 Ga0501039_0254506 Ga0501039_0254506_160_1368 401
2970 3300049576 Ga0501040_0019792 Ga0501040_0019792_695_1903 401
2971 3300049576 Ga0501040_0161247 Ga0501040_0161247_177_1385 401
2972 3300049577 Ga0501041_0007622 Ga0501041_0007622_4717_5925 401
2973 3300049577 Ga0501041_0092650 Ga0501041_0092650_363_1571 401
2974 3300049578 Ga0501042_0001978 Ga0501042_0001978_185_1393 401
2975 3300049578 Ga0501042_0057203 Ga0501042_0057203_413_1621 401
2976 3300049578 Ga0501042_0091631 Ga0501042_0091631_281_1489 401
2977 3300049579 Ga0501043_0000188 Ga0501043_0000188_14672_15880 401
2978 3300049579 Ga0501043_0022002 Ga0501043_0022002_1447_2655 401
2979 3300049579 Ga0501043_0046251 Ga0501043_0046251_1149_2357 401
2980 3300049579 Ga0501043_0049983 Ga0501043_0049983_1733_2941 401
2981 3300049579 Ga0501043_0104753 Ga0501043_0104753_595_1803 401
2982 3300049579 Ga0501043_0122510 Ga0501043_0122510_527_1735 401
2983 3300049580 Ga0501046_0000153 Ga0501046_0000153_10445_11653 401
2984 3300049580 Ga0501046_0037382 Ga0501046_0037382_2636_3844 401
2985 3300049580 Ga0501046_0046943 Ga0501046_0046943_1572_2780 401
2986 3300049580 Ga0501046_0061186 Ga0501046_0061186_467_1675 401
2987 3300049580 Ga0501046_0073776 Ga0501046_0073776_895_2103 401
2988 3300049581 Ga0501047_0000126 Ga0501047_0000126_23154_24362 401
2989 3300049581 Ga0501047_0000230 Ga0501047_0000230_35781_36989 401
2990 3300049581 Ga0501047_0008403 Ga0501047_0008403_2621_3829 401
2991 3300049581 Ga0501047_0018437 Ga0501047_0018437_5446_6654 401
2992 3300049581 Ga0501047_0023014 Ga0501047_0023014_2674_3882 401
2993 3300049581 Ga0501047_0030095 Ga0501047_0030095_1099_2307 401
2994 3300049581 Ga0501047_0092948 Ga0501047_0092948_907_2115 401
2995 3300049581 Ga0501047_0133302 Ga0501047_0133302_646_1854 401
2996 3300049581 Ga0501047_0153783 Ga0501047_0153783_743_1951 401
2997 3300049581 Ga0501047_0229943 Ga0501047_0229943_82_1290 401
2998 3300049581 Ga0501047_0233360 Ga0501047_0233360_202_1410 401
2999 3300049581 Ga0501047_0313669 Ga0501047_0313669_150_1358 401
3000 3300049582 Ga0501048_0000095 Ga0501048_0000095_30810_32018 401
3001 3300049582 Ga0501048_0006765 Ga0501048_0006765_10_1218 401
3002 3300049582 Ga0501048_0087494 Ga0501048_0087494_833_2041 401
3003 3300049582 Ga0501048_0226168 Ga0501048_0226168_38_1246 401
3004 3300049583 Ga0501067_0000405 Ga0501067_0000405_7638_8846 401
3005 3300049583 Ga0501067_0060123 Ga0501067_0060123_591_1799 401
3006 3300049584 Ga0501068_0000680 Ga0501068_0000680_1124_2332 401
3007 3300049584 Ga0501068_0032264 Ga0501068_0032264_1687_2895 401
3008 3300049584 Ga0501068_0081580 Ga0501068_0081580_25_1233 401
3009 3300049585 Ga0501069_0001561 Ga0501069_0001561_2642_3850 401
3010 3300049585 Ga0501069_0049669 Ga0501069_0049669_465_1673 401
3011 3300049586 Ga0501070_0000020 Ga0501070_0000020_23566_24774 401
3012 3300049586 Ga0501070_0016211 Ga0501070_0016211_3247_4455 401
3013 3300049586 Ga0501070_0021019 Ga0501070_0021019_1690_2898 401
3014 3300049586 Ga0501070_0029379 Ga0501070_0029379_253_1461 401
3015 3300049586 Ga0501070_0031721 Ga0501070_0031721_3150_4358 401
3016 3300049586 Ga0501070_0037850 Ga0501070_0037850_1492_2700 401
3017 3300049586 Ga0501070_0042578 Ga0501070_0042578_1140_2348 401
3018 3300049586 Ga0501070_0070256 Ga0501070_0070256_1273_2481 401
3019 3300049586 Ga0501070_0075732 Ga0501070_0075732_394_1602 401
3020 3300049586 Ga0501070_0138492 Ga0501070_0138492_466_1674 401
3021 3300049586 Ga0501070_0176193 Ga0501070_0176193_348_1556 401
3022 3300049586 Ga0501070_0235295 Ga0501070_0235295_54_1262 401
3023 3300049587 Ga0501071_0044573 Ga0501071_0044573_344_1552 401
3024 3300049587 Ga0501071_0049419 Ga0501071_0049419_397_1605 401
3025 3300049588 Ga0501072_0003713 Ga0501072_0003713_7128_8336 401
3026 3300049588 Ga0501072_0022932 Ga0501072_0022932_303_1511 401
3027 3300049588 Ga0501072_0116150 Ga0501072_0116150_200_1408 401
3028 3300049588 Ga0501072_0141864 Ga0501072_0141864_237_1445 401
3029 3300049589 Ga0501073_0000055 Ga0501073_0000055_47946_49154 401
3030 3300049589 Ga0501073_0003886 Ga0501073_0003886_2169_3377 401
3031 3300049589 Ga0501073_0008019 Ga0501073_0008019_1481_2689 401
3032 3300049589 Ga0501073_0013876 Ga0501073_0013876_1330_2538 401
3033 3300049589 Ga0501073_0067202 Ga0501073_0067202_1136_2344 401
3034 3300049589 Ga0501073_0075216 Ga0501073_0075216_620_1828 401
3035 3300049589 Ga0501073_0122646 Ga0501073_0122646_113_1321 401
3036 3300049590 Ga0501074_0001461 Ga0501074_0001461_13091_14299 401
3037 3300049590 Ga0501074_0003342 Ga0501074_0003342_1368_2576 401
3038 3300049590 Ga0501074_0033588 Ga0501074_0033588_1936_3144 401
3039 3300049590 Ga0501074_0097038 Ga0501074_0097038_75_1283 401
3040 3300049590 Ga0501074_0128903 Ga0501074_0128903_300_1508 401
3041 3300049590 Ga0501074_0173315 Ga0501074_0173315_283_1491 401
3042 3300049591 Ga0501075_0008410 Ga0501075_0008410_3754_4962 401
3043 3300049591 Ga0501075_0009660 Ga0501075_0009660_54_1262 401
3044 3300049592 Ga0501076_0077591 Ga0501076_0077591_756_1964 401
3045 3300049592 Ga0501076_0177434 Ga0501076_0177434_91_1299 401
3046 3300049593 Ga0501077_0047443 Ga0501077_0047443_1393_2601 401
3047 3300049593 Ga0501077_0077180 Ga0501077_0077180_374_1582 401
3048 3300049682 Ga0501252_001748 Ga0501252_001748_506_1714 401
3049 3300049741 Ga0501079_0004890 Ga0501079_0004890_8625_9833 401
3050 3300049742 Ga0501080_0001837 Ga0501080_0001837_16718_17926 401
3051 3300049742 Ga0501080_0001932 Ga0501080_0001932_2037_3245 401
3052 3300049742 Ga0501080_0004187 Ga0501080_0004187_7778_8986 401
3053 3300049742 Ga0501080_0006910 Ga0501080_0006910_2744_3952 401
3054 3300049742 Ga0501080_0068496 Ga0501080_0068496_943_2151 401
3055 3300049742 Ga0501080_0141604 Ga0501080_0141604_192_1400 401
3056 3300049743 Ga0501081_0013982 Ga0501081_0013982_4051_5259 401
3057 3300049743 Ga0501081_0055061 Ga0501081_0055061_270_1478 401
3058 3300049744 Ga0501083_0000382 Ga0501083_0000382_14765_15973 401
3059 3300049744 Ga0501083_0022911 Ga0501083_0022911_2126_3334 401
3060 3300049744 Ga0501083_0028114 Ga0501083_0028114_213_1421 401
3061 3300049744 Ga0501083_0058548 Ga0501083_0058548_507_1715 401
3062 3300049744 Ga0501083_0104989 Ga0501083_0104989_278_1486 401
3063 3300049744 Ga0501083_0136102 Ga0501083_0136102_384_1592 401
3064 3300049822 Ga0501035_0000023 Ga0501035_0000023_69480_70688 401
3065 3300049822 Ga0501035_0000249 Ga0501035_0000249_4945_6156 401
3066 3300049822 Ga0501035_0000322 Ga0501035_0000322_23665_24873 401
3067 3300049822 Ga0501035_0000355 Ga0501035_0000355_22157_23365 401
3068 3300049822 Ga0501035_0000378 Ga0501035_0000378_3473_4681 401
3069 3300049822 Ga0501035_0000904 Ga0501035_0000904_17569_18777 401
3070 3300049822 Ga0501035_0021127 Ga0501035_0021127_2100_3308 401
3071 3300049822 Ga0501035_0038430 Ga0501035_0038430_2100_3308 401
3072 3300049822 Ga0501035_0092934 Ga0501035_0092934_1025_2233 401
3073 3300049822 Ga0501035_0107877 Ga0501035_0107877_706_1914 401
3074 3300049822 Ga0501035_0159842 Ga0501035_0159842_491_1699 401
3075 3300049822 Ga0501035_0167564 Ga0501035_0167564_204_1412 401
3076 3300049822 Ga0501035_0182013 Ga0501035_0182013_491_1699 401
3077 3300049822 Ga0501035_0222375 Ga0501035_0222375_367_1575 401
3078 3300049823 Ga0501044_0000021 Ga0501044_0000021_136134_137342 401
3079 3300049823 Ga0501044_0000243 Ga0501044_0000243_40816_42024 401
3080 3300049823 Ga0501044_0000716 Ga0501044_0000716_5625_6833 401
3081 3300049823 Ga0501044_0004132 Ga0501044_0004132_8120_9328 401
3082 3300049823 Ga0501044_0008148 Ga0501044_0008148_333_1541 401
3083 3300049823 Ga0501044_0012601 Ga0501044_0012601_3785_4993 401
3084 3300049823 Ga0501044_0027229 Ga0501044_0027229_2100_3308 401
3085 3300049823 Ga0501044_0049727 Ga0501044_0049727_1785_2993 401
3086 3300049823 Ga0501044_0051532 Ga0501044_0051532_1069_2277 401
3087 3300049823 Ga0501044_0053488 Ga0501044_0053488_1082_2290 401
3088 3300049823 Ga0501044_0079730 Ga0501044_0079730_2038_3246 401
3089 3300049823 Ga0501044_0108417 Ga0501044_0108417_919_2127 401
3090 3300049823 Ga0501044_0154762 Ga0501044_0154762_49_1257 401
3091 3300049823 Ga0501044_0181778 Ga0501044_0181778_89_1297 401
3092 3300049823 Ga0501044_0198534 Ga0501044_0198534_497_1705 401
3093 3300049823 Ga0501044_0263614 Ga0501044_0263614_112_1320 401
3094 3300049823 Ga0501044_0266912 Ga0501044_0266912_268_1476 401
3095 3300049824 Ga0501045_0044524 Ga0501045_0044524_66_1274 401
3096 3300049824 Ga0501045_0093767 Ga0501045_0093767_430_1638 401
3097 3300049824 Ga0501045_0266776 Ga0501045_0266776_14_1222 401
3098 3300050489 nmdc:mga03683_18374_c1 nmdc:mga03683_18374_c1_1417_2625 401
3099 3300050490 nmdc:mga03n38_25513_c1 nmdc:mga03n38_25513_c1_21_1229 401
3100 3300050490 nmdc:mga03n38_39057_c1 nmdc:mga03n38_39057_c1_551_1759 401
3101 3300050491 nmdc:mga00v17_174864_c1 nmdc:mga00v17_174864_c1_145_1353 401
3102 3300050491 nmdc:mga00v17_2361_c1 nmdc:mga00v17_2361_c1_1814_3022 401
3103 3300050491 nmdc:mga00v17_3310_c1 nmdc:mga00v17_3310_c1_3097_4305 401
3104 3300050491 nmdc:mga00v17_48_c1 nmdc:mga00v17_48_c1_35682_36890 401
3105 3300050491 nmdc:mga00v17_5905_c1 nmdc:mga00v17_5905_c1_356_1564 401
3106 3300050491 nmdc:mga00v17_62085_c1 nmdc:mga00v17_62085_c1_945_2153 401
3107 3300050491 nmdc:mga00v17_8141_c1 nmdc:mga00v17_8141_c1_844_2052 401
3108 3300050492 nmdc:mga0yw44_128363_c1 nmdc:mga0yw44_128363_c1_398_1606 401
3109 3300050492 nmdc:mga0yw44_1426_c1 nmdc:mga0yw44_1426_c1_158_1366 401
3110 3300050492 nmdc:mga0yw44_173046_c1 nmdc:mga0yw44_173046_c1_22_1230 401
3111 3300050492 nmdc:mga0yw44_2404_c1 nmdc:mga0yw44_2404_c1_1399_2607 401
3112 3300050492 nmdc:mga0yw44_57170_c1 nmdc:mga0yw44_57170_c1_702_1910 401
3113 3300050493 nmdc:mga0k408_104967_c1 nmdc:mga0k408_104967_c1_146_1354 401
3114 3300050493 nmdc:mga0k408_105667_c1 nmdc:mga0k408_105667_c1_158_1366 401
3115 3300050493 nmdc:mga0k408_17523_c1 nmdc:mga0k408_17523_c1_567_1775 401
3116 3300050493 nmdc:mga0k408_36021_c1 nmdc:mga0k408_36021_c1_737_1945 401
3117 3300050493 nmdc:mga0k408_40577_c1 nmdc:mga0k408_40577_c1_1425_2633 401
3118 3300050494 nmdc:mga06z11_29084_c1 nmdc:mga06z11_29084_c1_725_1933 401
3119 3300050494 nmdc:mga06z11_30956_c1 nmdc:mga06z11_30956_c1_825_2033 401
3120 3300050494 nmdc:mga06z11_47930_c1 nmdc:mga06z11_47930_c1_28_1236 401
3121 3300050495 nmdc:mga04h51_66410_c1 nmdc:mga04h51_66410_c1_31_1239 401
3122 3300050496 nmdc:mga07m45_155494_c1 nmdc:mga07m45_155494_c1_57_1265 401
3123 3300050496 nmdc:mga07m45_18360_c1 nmdc:mga07m45_18360_c1_1310_2518 401
3124 3300050496 nmdc:mga07m45_5300_c1 nmdc:mga07m45_5300_c1_1589_2797 401
3125 3300050507 nmdc:mga05p37_12665_c1 nmdc:mga05p37_12665_c1_1030_2238 401
3126 3300050507 nmdc:mga05p37_136_c1 nmdc:mga05p37_136_c1_22592_23800 401
3127 3300050507 nmdc:mga05p37_225125_c1 nmdc:mga05p37_225125_c1_172_1380 401
3128 3300050507 nmdc:mga05p37_353858_c1 nmdc:mga05p37_353858_c1_242_1450 401
3129 3300050507 nmdc:mga05p37_49728_c1 nmdc:mga05p37_49728_c1_3702_4910 401
3130 3300050507 nmdc:mga05p37_59_c1 nmdc:mga05p37_59_c1_59712_60920 401
3131 3300050508 nmdc:mga09592_3214_c1 nmdc:mga09592_3214_c1_8858_10066 401
3132 3300050509 nmdc:mga0qj67_152_c1 nmdc:mga0qj67_152_c1_32893_34101 401
3133 3300050509 nmdc:mga0qj67_154652_c1 nmdc:mga0qj67_154652_c1_591_1799 401
3134 3300050509 nmdc:mga0qj67_34697_c1 nmdc:mga0qj67_34697_c1_2529_3737 401
3135 3300050509 nmdc:mga0qj67_65877_c1 nmdc:mga0qj67_65877_c1_254_1462 401
3136 3300050510 nmdc:mga06r32_113396_c1 nmdc:mga06r32_113396_c1_186_1394 401
3137 3300050510 nmdc:mga06r32_11540_c1 nmdc:mga06r32_11540_c1_219_1427 401
3138 3300050510 nmdc:mga06r32_150_c1 nmdc:mga06r32_150_c1_22499_23707 401
3139 3300050510 nmdc:mga06r32_94259_c1 nmdc:mga06r32_94259_c1_172_1380 401
3140 3300050511 nmdc:mga08y16_109557_c1 nmdc:mga08y16_109557_c1_1456_2664 401
3141 3300050511 nmdc:mga08y16_2132_c1 nmdc:mga08y16_2132_c1_3802_5010 401
3142 3300050511 nmdc:mga08y16_23217_c1 nmdc:mga08y16_23217_c1_137_1345 401
3143 3300050511 nmdc:mga08y16_23507_c1 nmdc:mga08y16_23507_c1_2882_4090 401
3144 3300050511 nmdc:mga08y16_2542_c1 nmdc:mga08y16_2542_c1_12306_13514 401
3145 3300050511 nmdc:mga08y16_314870_c1 nmdc:mga08y16_314870_c1_346_1554 401
3146 3300050511 nmdc:mga08y16_40735_c1 nmdc:mga08y16_40735_c1_2798_4006 401
3147 3300050511 nmdc:mga08y16_95_c1 nmdc:mga08y16_95_c1_41933_43141 401
3148 3300050512 nmdc:mga0n895_242569_c1 nmdc:mga0n895_242569_c1_371_1579 401
3149 3300050512 nmdc:mga0n895_257162_c1 nmdc:mga0n895_257162_c1_130_1338 401
3150 3300050512 nmdc:mga0n895_52715_c1 nmdc:mga0n895_52715_c1_313_1521 401
3151 3300050512 nmdc:mga0n895_56_c1 nmdc:mga0n895_56_c1_39154_40362 401
3152 3300050512 nmdc:mga0n895_78057_c1 nmdc:mga0n895_78057_c1_832_2040 401
3153 3300050513 nmdc:mga0rr50_6267_c1 nmdc:mga0rr50_6267_c1_5404_6612 401
3154 3300050513 nmdc:mga0rr50_8695_c1 nmdc:mga0rr50_8695_c1_3743_4951 401
3155 3300050515 nmdc:mga0a205_107336_c1 nmdc:mga0a205_107336_c1_1246_2454 401
3156 3300050515 nmdc:mga0a205_19578_c1 nmdc:mga0a205_19578_c1_1294_2502 401
3157 3300050515 nmdc:mga0a205_23_c1 nmdc:mga0a205_23_c1_50318_51526 401
3158 3300050515 nmdc:mga0a205_5754_c1 nmdc:mga0a205_5754_c1_3807_5015 401
3159 3300050516 nmdc:mga0sz30_28471_c1 nmdc:mga0sz30_28471_c1_540_1748 401
3160 3300050516 nmdc:mga0sz30_3130_c1 nmdc:mga0sz30_3130_c1_4002_5210 401
3161 3300053077 Ga0495601_0001913 Ga0495601_0001913_4345_5553 401
3162 3300053077 Ga0495601_0003115 Ga0495601_0003115_6876_8084 401
3163 3300053077 Ga0495601_0003149 Ga0495601_0003149_3850_5058 401
3164 3300053077 Ga0495601_0004336 Ga0495601_0004336_2692_3900 401
3165 3300053077 Ga0495601_0007948 Ga0495601_0007948_1404_2612 401
3166 3300053077 Ga0495601_0009007 Ga0495601_0009007_2414_3622 401
3167 3300053077 Ga0495601_0010285 Ga0495601_0010285_2682_3890 401
3168 3300053077 Ga0495601_0018529 Ga0495601_0018529_1158_2366 401
3169 3300053077 Ga0495601_0037272 Ga0495601_0037272_834_2042 401
3170 3300053077 Ga0495601_0039918 Ga0495601_0039918_374_1582 401
3171 3300053078 Ga0495612_0000320 Ga0495612_0000320_140_1348 401
3172 3300053078 Ga0495612_0000877 Ga0495612_0000877_9986_11194 401
3173 3300053078 Ga0495612_0002422 Ga0495612_0002422_5764_6972 401
3174 3300053078 Ga0495612_0007872 Ga0495612_0007872_1751_2959 401
3175 3300053080 Ga0500635_0003511 Ga0500635_0003511_1972_3180 401
3176 3300053084 Ga0495595_0001647 Ga0495595_0001647_823_2031 401
3177 3300053084 Ga0495595_0002414 Ga0495595_0002414_4706_5914 401
3178 3300053084 Ga0495595_0008723 Ga0495595_0008723_1003_2211 401
3179 3300053084 Ga0495595_0011340 Ga0495595_0011340_643_1851 401
3180 3300053084 Ga0495595_0033176 Ga0495595_0033176_972_2180 401
3181 3300053084 Ga0495595_0044587 Ga0495595_0044587_746_1954 401
3182 3300053084 Ga0495595_0073548 Ga0495595_0073548_275_1483 401
3183 3300053084 Ga0495595_0073961 Ga0495595_0073961_51_1259 401
3184 3300053085 Ga0495619_0000056 Ga0495619_0000056_50833_52041 401
3185 3300053085 Ga0495619_0000470 Ga0495619_0000470_12799_14007 401
3186 3300053085 Ga0495619_0000742 Ga0495619_0000742_8683_9891 401
3187 3300053085 Ga0495619_0002178 Ga0495619_0002178_4206_5414 401
3188 3300053085 Ga0495619_0004772 Ga0495619_0004772_1589_2797 401
3189 3300053085 Ga0495619_0019066 Ga0495619_0019066_1473_2681 401
3190 3300053085 Ga0495619_0024669 Ga0495619_0024669_1512_2720 401
3191 3300053085 Ga0495619_0067409 Ga0495619_0067409_964_2172 401
3192 3300053085 Ga0495619_0099967 Ga0495619_0099967_415_1623 401
3193 3300053085 Ga0495619_0135165 Ga0495619_0135165_321_1529 401
3194 3300053087 Ga0500643_000231 Ga0500643_000231_5318_6526 401
3195 3300053087 Ga0500643_013670 Ga0500643_013670_1196_2404 401
3196 3300053087 Ga0500643_023977 Ga0500643_023977_551_1759 401
3197 3300053087 Ga0500643_044155 Ga0500643_044155_16_1224 401
3198 3300053088 Ga0500644_0001358 Ga0500644_0001358_4018_5226 401
3199 3300053091 Ga0500647_0012163 Ga0500647_0012163_1135_2343 401
3200 3300053093 Ga0500651_0059763 Ga0500651_0059763_1019_2227 401
3201 3300053094 Ga0500566_0004285 Ga0500566_0004285_2318_3526 401
3202 3300053094 Ga0500566_0006859 Ga0500566_0006859_241_1449 401
3203 3300053094 Ga0500566_0011700 Ga0500566_0011700_3110_4318 401
3204 3300053094 Ga0500566_0019769 Ga0500566_0019769_342_1550 401
3205 3300053094 Ga0500566_0035176 Ga0500566_0035176_815_2023 401
3206 3300053096 Ga0500641_0016988 Ga0500641_0016988_599_1807 401
3207 3300053096 Ga0500641_0037147 Ga0500641_0037147_598_1806 401
3208 3300053098 Ga0500650_0011622 Ga0500650_0011622_2272_3480 401
3209 3300053104 Ga0500556_0000005 Ga0500556_0000005_355397_356605 401
3210 3300053105 Ga0500557_000028 Ga0500557_000028_74360_75568 401
3211 3300053111 Ga0500572_002185 Ga0500572_002185_2530_3738 401
3212 3300053111 Ga0500572_013686 Ga0500572_013686_325_1533 401
3213 3300053116 Ga0500592_001845 Ga0500592_001845_1369_2577 401
3214 3300053119 Ga0500595_000001 Ga0500595_000001_198310_199518 401
3215 3300053119 Ga0500595_025904 Ga0500595_025904_793_2001 401
3216 3300053122 Ga0500608_052135 Ga0500608_052135_676_1884 401
3217 3300053122 Ga0500608_053078 Ga0500608_053078_278_1486 401
3218 3300053122 Ga0500608_070805 Ga0500608_070805_104_1312 401
3219 3300053125 Ga0500618_000090 Ga0500618_000090_45084_46292 401
3220 3300053125 Ga0500618_012538 Ga0500618_012538_511_1719 401
3221 3300053130 Ga0500642_0000009 Ga0500642_0000009_243805_245013 401
3222 3300053130 Ga0500642_0000563 Ga0500642_0000563_5934_7142 401
3223 3300053131 Ga0500652_000017 Ga0500652_000017_39984_41192 401
3224 3300053131 Ga0500652_001538 Ga0500652_001538_2435_3643 401
3225 3300053134 Ga0500658_0025087 Ga0500658_0025087_534_1742 401
3226 3300053136 Ga0500559_0000379 Ga0500559_0000379_14587_15795 401
3227 3300053136 Ga0500559_0000393 Ga0500559_0000393_4226_5434 401
3228 3300053136 Ga0500559_0050186 Ga0500559_0050186_218_1426 401
3229 3300053136 Ga0500559_0109362 Ga0500559_0109362_41_1249 401
3230 3300053139 Ga0500568_0008801 Ga0500568_0008801_2260_3468 401
3231 3300053139 Ga0500568_0021528 Ga0500568_0021528_954_2162 401
3232 3300053142 Ga0500577_0061698 Ga0500577_0061698_146_1354 401
3233 3300053145 Ga0500586_003049 Ga0500586_003049_79_1287 401
3234 3300053150 Ga0500603_009476 Ga0500603_009476_185_1393 401
3235 3300053153 Ga0500616_0000001 Ga0500616_0000001_1787004_1788212 401
3236 3300053153 Ga0500616_0000118 Ga0500616_0000118_54166_55374 401
3237 3300053153 Ga0500616_0003533 Ga0500616_0003533_3403_4611 401
3238 3300053153 Ga0500616_0019821 Ga0500616_0019821_1921_3129 401
3239 3300053153 Ga0500616_0034095 Ga0500616_0034095_942_2150 401
3240 3300053153 Ga0500616_0058076 Ga0500616_0058076_296_1504 401
3241 3300053155 Ga0500620_000869 Ga0500620_000869_3567_4775 401
3242 3300053156 Ga0500622_0005852 Ga0500622_0005852_3527_4735 401
3243 3300053156 Ga0500622_0006604 Ga0500622_0006604_2299_3507 401
3244 3300053156 Ga0500622_0033374 Ga0500622_0033374_864_2072 401
3245 3300053158 Ga0500627_0064488 Ga0500627_0064488_108_1316 401
3246 3300053159 Ga0500630_039573 Ga0500630_039573_1052_2260 401
3247 3300053161 Ga0500634_0007081 Ga0500634_0007081_3137_4345 401
3248 3300053163 Ga0500639_022926 Ga0500639_022926_221_1429 401
3249 3300053163 Ga0500639_035678 Ga0500639_035678_363_1571 401
3250 3300053163 Ga0500639_077139 Ga0500639_077139_257_1465 401
3251 3300053177 Ga0500636_0000006 Ga0500636_0000006_94786_95994 401
3252 3300053177 Ga0500636_0000301 Ga0500636_0000301_13603_14811 401
3253 3300053177 Ga0500636_0000458 Ga0500636_0000458_14708_15916 401
3254 3300053177 Ga0500636_0018433 Ga0500636_0018433_2166_3374 401
3255 3300053177 Ga0500636_0035620 Ga0500636_0035620_598_1806 401
3256 3300053177 Ga0500636_0125071 Ga0500636_0125071_173_1381 401
3257 3300053178 Ga0500637_0000301 Ga0500637_0000301_12603_13811 401
3258 3300053178 Ga0500637_0001692 Ga0500637_0001692_7429_8637 401
3259 3300053178 Ga0500637_0031848 Ga0500637_0031848_643_1851 401
3260 3300053729 Ga0500625_014652 Ga0500625_014652_160_1368 401
3261 3300053730 Ga0500645_000050 Ga0500645_000050_53537_54745 401
3262 3300053730 Ga0500645_034782 Ga0500645_034782_68_1276 401
3263 3300053731 Ga0500609_003725 Ga0500609_003725_451_1659 401
3264 3300053735 Ga0500596_002166 Ga0500596_002166_468_1676 401
3265 3300053735 Ga0500596_005585 Ga0500596_005585_201_1409 401
3266 3300053737 Ga0500601_000309 Ga0500601_000309_7850_9058 401
3267 3300054114 Ga0501084_0001342 Ga0501084_0001342_7515_8723 401
3268 3300054114 Ga0501084_0026481 Ga0501084_0026481_834_2042 401
3269 3300054114 Ga0501084_0072810 Ga0501084_0072810_1360_2568 401
3270 3300054114 Ga0501084_0100881 Ga0501084_0100881_229_1437 401
3271 3300054114 Ga0501084_0128238 Ga0501084_0128238_811_2019 401
3272 3300059510 Ga0587090_000144 Ga0587090_000144_3227_4435 401
3273 3300060353 Ga0501082_0003623 Ga0501082_0003623_3078_4286 401
3274 3300060353 Ga0501082_0016131 Ga0501082_0016131_2774_3982 401
3275 3300060353 Ga0501082_0018376 Ga0501082_0018376_4466_5674 401
3276 3300060353 Ga0501082_0038855 Ga0501082_0038855_2541_3749 401
3277 3300060353 Ga0501082_0042935 Ga0501082_0042935_2483_3691 401
3278 3300060353 Ga0501082_0131500 Ga0501082_0131500_921_2129 401
3279 3300060353 Ga0501082_0298930 Ga0501082_0298930_34_1242 401
3280 3300060353 Ga0501082_0336906 Ga0501082_0336906_71_1279 401
3281 3300061719 Ga0466962_0071109 Ga0466962_0071109_16_1224 401
3282 3300002070 JGI24750J21931_1003973 JGI24750J21931_10039732 402
3283 3300002074 JGI24748J21848_1000499 JGI24748J21848_10004993 402
3284 3300002076 JGI24749J21850_1000004 JGI24749J21850_10000049 402
3285 3300002459 JGI24751J29686_10000021 JGI24751J29686_1000002153 402
3286 3300005289 Ga0065704_10070182 Ga0065704_1007018277 402
3287 3300005289 Ga0065704_10070243 Ga0065704_100702435 402
3288 3300005295 Ga0065707_10081920 Ga0065707_1008192015 402
3289 3300005331 Ga0070670_100000006 Ga0070670_100000006126 402
3290 3300005335 Ga0070666_10002554 Ga0070666_100025544 402
3291 3300005335 Ga0070666_10050139 Ga0070666_100501392 402
3292 3300005347 Ga0070668_100000161 Ga0070668_10000016131 402
3293 3300005347 Ga0070668_100011381 Ga0070668_1000113814 402
3294 3300005353 Ga0070669_100000142 Ga0070669_10000014218 402
3295 3300005353 Ga0070669_100000305 Ga0070669_1000003052 402
3296 3300005353 Ga0070669_100000546 Ga0070669_10000054617 402
3297 3300005355 Ga0070671_100010353 Ga0070671_1000103534 402
3298 3300005367 Ga0070667_100001090 Ga0070667_1000010903 402
3299 3300005367 Ga0070667_100001112 Ga0070667_10000111213 402
3300 3300005367 Ga0070667_100011132 Ga0070667_1000111321 402
3301 3300005440 Ga0070705_100008424 Ga0070705_1000084244 402
3302 3300005548 Ga0070665_100019777 Ga0070665_1000197773 402
3303 3300005548 Ga0070665_100050063 Ga0070665_1000500634 402
3304 3300005617 Ga0068859_100001301 Ga0068859_10000130112 402
3305 3300005617 Ga0068859_100009078 Ga0068859_1000090787 402
3306 3300005617 Ga0068859_100078911 Ga0068859_1000789112 402
3307 3300005618 Ga0068864_100000014 Ga0068864_100000014190 402
3308 3300005618 Ga0068864_100003177 Ga0068864_1000031779 402
3309 3300005618 Ga0068864_100058496 Ga0068864_1000584964 402
3310 3300005719 Ga0068861_100001400 Ga0068861_10000140011 402
3311 3300005719 Ga0068861_100005625 Ga0068861_1000056254 402
3312 3300005841 Ga0068863_100008689 Ga0068863_1000086898 402
3313 3300005842 Ga0068858_100013014 Ga0068858_1000130143 402
3314 3300005842 Ga0068858_100034304 Ga0068858_1000343043 402
3315 3300005843 Ga0068860_100006717 Ga0068860_1000067174 402
3316 3300005843 Ga0068860_100008824 Ga0068860_1000088247 402
3317 3300005843 Ga0068860_100083444 Ga0068860_1000834443 402
3318 3300005844 Ga0068862_100000007 Ga0068862_100000007113 402
3319 3300005844 Ga0068862_100003319 Ga0068862_1000033194 402
3320 3300005844 Ga0068862_100007185 Ga0068862_1000071853 402
3321 3300006931 Ga0097620_100001301 Ga0097620_10000130112 402
3322 3300006931 Ga0097620_100009078 Ga0097620_1000090787 402
3323 3300006931 Ga0097620_100078905 Ga0097620_1000789052 402
3324 3300009101 Ga0105247_10003944 Ga0105247_100039447 402
3325 3300009101 Ga0105247_10022312 Ga0105247_100223123 402
3326 3300009177 Ga0105248_10001329 Ga0105248_100013291 402
3327 3300009177 Ga0105248_10003552 Ga0105248_100035524 402
3328 3300009177 Ga0105248_10004676 Ga0105248_1000467611 402
3329 3300009553 Ga0105249_10008381 Ga0105249_100083817 402
3330 3300013306 Ga0163162_10002633 Ga0163162_100026337 402
3331 3300013306 Ga0163162_10004642 Ga0163162_100046429 402
3332 3300014326 Ga0157380_10000014 Ga0157380_1000001499 402
3333 3300014968 Ga0157379_10006065 Ga0157379_1000606511 402
3334 3300025315 Ga0207697_10000609 Ga0207697_1000060913 402
3335 3300025711 Ga0207696_1000560 Ga0207696_100056016 402
3336 3300025900 Ga0207710_10003912 Ga0207710_100039126 402
3337 3300025900 Ga0207710_10012491 Ga0207710_100124913 402
3338 3300025903 Ga0207680_10001007 Ga0207680_100010079 402
3339 3300025903 Ga0207680_10009278 Ga0207680_100092782 402
3340 3300025923 Ga0207681_10000001 Ga0207681_10000001184 402
3341 3300025923 Ga0207681_10000229 Ga0207681_1000022934 402
3342 3300025923 Ga0207681_10000283 Ga0207681_1000028319 402
3343 3300025925 Ga0207650_10000023 Ga0207650_10000023185 402
3344 3300025931 Ga0207644_10000388 Ga0207644_1000038819 402
3345 3300025931 Ga0207644_10001197 Ga0207644_100011972 402
3346 3300025941 Ga0207711_10001287 Ga0207711_1000128712 402
3347 3300025941 Ga0207711_10026646 Ga0207711_100266461 402
3348 3300025941 Ga0207711_10038734 Ga0207711_100387341 402
3349 3300025941 Ga0207711_10038881 Ga0207711_100388813 402
3350 3300025961 Ga0207712_10000119 Ga0207712_1000011910 402
3351 3300025961 Ga0207712_10000897 Ga0207712_100008979 402
3352 3300025961 Ga0207712_10008536 Ga0207712_100085363 402
3353 3300025972 Ga0207668_10000891 Ga0207668_100008917 402
3354 3300025972 Ga0207668_10003321 Ga0207668_100033217 402
3355 3300025986 Ga0207658_10002134 Ga0207658_100021342 402
3356 3300025986 Ga0207658_10006704 Ga0207658_100067043 402
3357 3300025986 Ga0207658_10044903 Ga0207658_100449032 402
3358 3300026035 Ga0207703_10000457 Ga0207703_1000045727 402
3359 3300026088 Ga0207641_10002448 Ga0207641_100024487 402
3360 3300026088 Ga0207641_10383455 Ga0207641_103834552 402
3361 3300026095 Ga0207676_10000017 Ga0207676_10000017187 402
3362 3300026095 Ga0207676_10000129 Ga0207676_1000012948 402
3363 3300026095 Ga0207676_10003188 Ga0207676_100031884 402
3364 3300026118 Ga0207675_100001035 Ga0207675_10000103518 402
3365 3300026118 Ga0207675_100001434 Ga0207675_10000143413 402
3366 3300028379 Ga0268266_10016104 Ga0268266_100161043 402
3367 3300028380 Ga0268265_10000002 Ga0268265_10000002190 402
3368 3300028380 Ga0268265_10002412 Ga0268265_1000241212 402
3369 3300028380 Ga0268265_10002909 Ga0268265_100029091 402
3370 3300028380 Ga0268265_10020789 Ga0268265_100207892 402
3371 3300028381 Ga0268264_10001053 Ga0268264_1000105320 402
3372 3300028381 Ga0268264_10065265 Ga0268264_100652652 402
3373 3300048929 Ga0496126_0143815 Ga0496126_0143815_648_1859 402
3374 3300050510 nmdc:mga06r32_278363_c1 nmdc:mga06r32_278363_c1_195_1406 402
3375 3300014325 Ga0163163_10118500 Ga0163163_101185001 403
3376 3300049744 Ga0501083_0130790 Ga0501083_0130790_343_1557 403
3377 3300060353 Ga0501082_0001472 Ga0501082_0001472_52_1266 403
3378 iso_pu_bacteria 2841966195 2841972546 405
3379 3300009174 Ga0105241_10092620 Ga0105241_100926202 406
3380 3300021321 Ga0214542_1001948 Ga0214542_100194835 406
3381 3300021324 Ga0214545_1000914 Ga0214545_10009147 406
3382 3300021327 Ga0214543_1001723 Ga0214543_10017238 406
3383 3300009553 Ga0105249_10003222 Ga0105249_1000322212 407
3384 3300049823 Ga0501044_0013317 Ga0501044_0013317_2776_4221 407
3385 3300006178 Ga0075367_10128923 Ga0075367_101289232 408
3386 3300048921 Ga0496118_0046575 Ga0496118_0046575_241_1500 408
3387 3300005336 Ga0070680_100029451 Ga0070680_1000294512 410
3388 3300005337 Ga0070682_100003398 Ga0070682_1000033982 410
3389 3300005458 Ga0070681_10024710 Ga0070681_100247103 410
3390 3300005530 Ga0070679_100055061 Ga0070679_1000550613 410
3391 3300005539 Ga0068853_100048714 Ga0068853_1000487143 410
3392 3300005549 Ga0070704_100023471 Ga0070704_1000234713 410
3393 3300005563 Ga0068855_100102739 Ga0068855_1001027392 410
3394 3300005578 Ga0068854_100035197 Ga0068854_1000351972 410
3395 3300007076 Ga0075435_100001457 Ga0075435_10000145711 410
3396 3300009174 Ga0105241_10054529 Ga0105241_100545293 410
3397 3300009553 Ga0105249_10010070 Ga0105249_100100704 410
3398 3300013100 Ga0157373_10043058 Ga0157373_100430582 410
3399 3300013104 Ga0157370_10028544 Ga0157370_100285443 410
3400 3300013307 Ga0157372_10029074 Ga0157372_100290743 410
3401 3300025912 Ga0207707_10007830 Ga0207707_100078303 410
3402 3300025917 Ga0207660_10080478 Ga0207660_100804783 410
3403 3300025921 Ga0207652_10083442 Ga0207652_100834422 410
3404 3300025932 Ga0207690_10061457 Ga0207690_100614572 410
3405 3300025949 Ga0207667_10038375 Ga0207667_100383753 410
3406 3300025961 Ga0207712_10001664 Ga0207712_1000166412 410
3407 3300026041 Ga0207639_10031680 Ga0207639_100316803 410
3408 3300035111 Ga0373923_0000024 Ga0373923_0000024_8164_9399 410
3409 3300035113 Ga0373936_0008271 Ga0373936_0008271_181_1416 410
3410 3300035116 Ga0373945_0001823 Ga0373945_0001823_2762_3997 410
3411 3300035117 Ga0373953_0005320 Ga0373953_0005320_1494_2729 410
3412 3300035118 Ga0373954_0004064 Ga0373954_0004064_735_1970 410
3413 3300035170 Ga0373943_0006405 Ga0373943_0006405_2150_3385 410
3414 3300035171 Ga0373946_0004567 Ga0373946_0004567_1110_2345 410
3415 3300035172 Ga0373955_0000131 Ga0373955_0000131_21227_22462 410
3416 3300035692 Ga0373935_0000315 Ga0373935_0000315_10861_12096 410
3417 3300035724 Ga0373933_0002482 Ga0373933_0002482_887_2122 410
3418 3300035725 Ga0373947_0005224 Ga0373947_0005224_5092_6327 410
3419 3300036401 Ga0373937_0000212 Ga0373937_0000212_14770_16005 410
3420 3300037068 Ga0373925_0000002 Ga0373925_0000002_110407_111642 410
3421 3300046454 Ga0495592_0000265 Ga0495592_0000265_28773_30008 410
3422 3300046459 Ga0495629_0009524 Ga0495629_0009524_4047_5282 410
3423 3300046462 Ga0495651_0002142 Ga0495651_0002142_5301_6536 410
3424 3300046463 Ga0495653_0000006 Ga0495653_0000006_110555_111790 410
3425 3300046477 Ga0495664_0000002 Ga0495664_0000002_146189_147424 410
3426 3300046511 Ga0495608_0000006 Ga0495608_0000006_67122_68357 410
3427 3300046514 Ga0495618_0000264 Ga0495618_0000264_14787_16022 410
3428 3300046516 Ga0495628_0000002 Ga0495628_0000002_110574_111809 410
3429 3300046517 Ga0495630_0000922 Ga0495630_0000922_9977_11212 410
3430 3300046529 Ga0495652_0000004 Ga0495652_0000004_477074_478309 410
3431 3300046533 Ga0495640_0000007 Ga0495640_0000007_14808_16043 410
3432 3300046536 Ga0495587_0000031 Ga0495587_0000031_110574_111809 410
3433 3300046543 Ga0495645_0000003 Ga0495645_0000003_91825_93060 410
3434 3300046559 Ga0495667_0000002 Ga0495667_0000002_325914_327149 410
3435 3300046642 Ga0495634_0000110 Ga0495634_0000110_6790_8025 410
3436 3300046663 Ga0495635_0000022 Ga0495635_0000022_80857_82092 410
3437 3300046675 Ga0495657_0000072 Ga0495657_0000072_68273_69508 410
3438 3300046678 Ga0495599_0000001 Ga0495599_0000001_249252_250487 410
3439 3300046679 Ga0495623_0000001 Ga0495623_0000001_18197_19432 410
3440 3300046680 Ga0495646_0000014 Ga0495646_0000014_12601_13836 410
3441 3300046689 Ga0495613_0019414 Ga0495613_0019414_3352_4587 410
3442 3300046809 Ga0495600_0000125 Ga0495600_0000125_26863_28098 410
3443 3300047317 Ga0495604_0000005 Ga0495604_0000005_136218_137453 410
3444 3300047319 Ga0495674_0000003 Ga0495674_0000003_450317_451552 410
3445 3300047322 Ga0495680_0002522 Ga0495680_0002522_14795_16030 410
3446 3300047444 Ga0495675_0000133 Ga0495675_0000133_36559_37794 410
3447 3300047471 Ga0495684_0000035 Ga0495684_0000035_91727_92962 410
3448 3300048088 Ga0495602_0000029 Ga0495602_0000029_91717_92952 410
3449 3300050513 nmdc:mga0rr50_4773_c1 nmdc:mga0rr50_4773_c1_1235_2548 410
3450 3300053077 Ga0495601_0000008 Ga0495601_0000008_210933_212168 410
3451 3300053078 Ga0495612_0000002 Ga0495612_0000002_22170_23405 410
3452 3300053084 Ga0495595_0000024 Ga0495595_0000024_91834_93069 410
3453 3300053085 Ga0495619_0000002 Ga0495619_0000002_110577_111812 410
3454 3300048929 Ga0496126_0087897 Ga0496126_0087897_843_2150 411
3455 3300049570 Ga0501033_0030633 Ga0501033_0030633_185_1618 411
3456 3300049574 Ga0501038_0025475 Ga0501038_0025475_2826_4259 411
3457 3300049581 Ga0501047_0233998 Ga0501047_0233998_92_1525 411
3458 3300049583 Ga0501067_0005631 Ga0501067_0005631_1020_2453 411
3459 iso_pu_bacteria 2728368998 2728751208 412
3460 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_254375_255688 413
3461 2162886007 SwRhRL2b_contig_2750580 SwRhRL2b_0785.00004710 414
3462 3300005355 Ga0070671_100000463 Ga0070671_10000046312 414
3463 3300009177 Ga0105248_10068639 Ga0105248_100686392 414
3464 3300013306 Ga0163162_10021600 Ga0163162_100216001 414
3465 3300048905 Ga0496102_0001659 Ga0496102_0001659_12720_13964 414
3466 3300048906 Ga0496103_0000614 Ga0496103_0000614_5581_6825 414
3467 3300048907 Ga0496104_0000438 Ga0496104_0000438_13072_14316 414
3468 3300048908 Ga0496105_0000288 Ga0496105_0000288_15792_17036 414
3469 3300048915 Ga0496112_0046408 Ga0496112_0046408_1217_2461 414
3470 3300048920 Ga0496117_0000739 Ga0496117_0000739_6819_8063 414
3471 3300048921 Ga0496118_0000862 Ga0496118_0000862_3571_4815 414
3472 3300048922 Ga0496119_0001063 Ga0496119_0001063_19156_20400 414
3473 3300048923 Ga0496120_0001546 Ga0496120_0001546_5718_6962 414
3474 3300048924 Ga0496121_0005324 Ga0496121_0005324_1597_2841 414
3475 3300048925 Ga0496122_0014786 Ga0496122_0014786_1458_2702 414
3476 3300048927 Ga0496124_0007638 Ga0496124_0007638_5951_7195 414
3477 3300048929 Ga0496126_0000934 Ga0496126_0000934_5876_7120 414

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

271

393

0.99

PF00108

Thiolase_N

Thiolase, N-terminal domain

1

235

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o1g-assembly1.cif.gz_D structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a-h462a, beta-c92a mutant 0.9779 15 414
7o1l-assembly1.cif.gz_D-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-h462a mutant 0.9756 15 414
4b3h-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex 0.9745 15 414
4b3j-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase and thiolase active sites 0.9733 13 414
7o4v-assembly1.cif.gz_D structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide 0.9726 13 414
ID Description Score Start End Superfamily
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9839 299 408 3.40.47.10
af_O53871_3_403_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9817 16 414 3.50.30.50
af_O53871_3_403_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9744 16 414 3.50.30.50
af_O53871_2_286_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9738 15 294 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.97 299 408 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A364V6N9-F1-model_v4 Acetyl-CoA C-acetyltransferase 0.9832 11 414 GO:0016747
AF-A0A0D0QC54-F1-model_v4 Acetyl-CoA acetyltransferase (EC 2.3.1.9) 0.9829 67 414 GO:0003985
AF-A0A652L8T8-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 0.9827 247 414 GO:0003985
AF-A0A3M1ND41-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9817 171 414 GO:0003988
AF-A0A6G2V5A0-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9813 13 371 GO:0003985

Feature Viewer

pLDDT pTM Quality
92.53 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map