F497204

General Info

Members Datasets Scaffolds Average Seq Length
3046 959 2833 208

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0178065|Ga0501070_0178065_714_1439
Length 241
Sequence MADRVIRGILGTKLGMTQVFDENNRVVPVTVVKAGPCVVTQVRSADPDGYSAVQLAYGDIDPRKVPKPLRGHFEKAGVTPRRHLVELRTLDASAYTVGLELTAQVFTPGSVVDVIGTSKGKGNAGVMKRHGFKGLGASHGVEKKHRSPGSIGGCATPGRVFKGVRMAGRMGHERTTTLNLVVQAVDSERGLLLVRGAIPGPDGGLVMVRSAAKRVAPGAFEPGAAADDAGARNDASEGSEQ

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
5 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
6 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
7 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
8 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
9 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
10 2517572101 Frankia sp. DC12 Isolate Nodule
11 2527291629 Frankia sp. BMG5.23 Isolate Nodule
12 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
13 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
14 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
15 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
16 2576861822 Frankia sp. CeD Isolate Nodule
17 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
18 2582580736 Prauserella sp. Am3 Isolate Unclassified
19 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
20 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
21 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
22 2619618881 Frankia sp. ACN1ag Isolate Unclassified
23 2619619003 Frankia sp. CpI1-P Isolate Nodule
24 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
25 2626541554 Frankia sp. AvcI.1 Isolate Nodule
26 2643221548 Streptomyces sp. Root55 Isolate Unclassified
27 2643221578 Streptomyces sp. Root63 Isolate Unclassified
28 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
29 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
30 2643221647 Streptomyces sp. Root369 Isolate Unclassified
31 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
32 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
33 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
34 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
35 2643221714 Streptomyces sp. Root264 Isolate Unclassified
36 2671180195 Frankia sp. CcI49 Isolate Nodule
37 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
38 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
39 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
40 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
41 2684623036 Frankia sp. CgIM4 Isolate Nodule
42 2687453737 Frankia sp. BMG5.36 Isolate Nodule
43 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
44 2710264753 Frankia sp. KB5 Isolate Nodule
45 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
46 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
47 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
48 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
49 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
50 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
51 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
52 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
53 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
54 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
55 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
56 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
57 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
58 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
59 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
60 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
61 2773857922 Frankia sp. CcI49 Isolate Nodule
62 2773857924 Frankia sp. CgIS1 Isolate Nodule
63 2773857933 Frankia sp. BMG5.30 Isolate Nodule
64 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
65 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
66 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
67 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
68 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
69 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
70 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
71 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
72 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
73 2808606394 Promicromonospora sp. C35 Isolate Unclassified
74 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
75 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
76 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
77 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
78 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
79 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
80 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
81 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
82 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
83 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
84 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
85 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
86 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
87 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
88 2855683550 Micromonospora sp. RP3T Isolate Unclassified
89 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
90 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
91 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
92 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
93 2858868258 Micromonospora sp. MH33 Isolate Unclassified
94 2858882152 Micromonospora noduli MED15 Isolate Nodule
95 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
96 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
97 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
98 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
99 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
100 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
101 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
102 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
103 2862574272 Streptomyces sp. AcE210 Isolate Nodule
104 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
105 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
106 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
107 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
108 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
109 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
110 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
111 2867428634 Streptomyces sp. RP5T Isolate Unclassified
112 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
113 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
114 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
115 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
116 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
117 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
118 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
119 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
120 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
121 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
122 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
123 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
124 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
125 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
126 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
127 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
128 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
129 2891562705 Microbispora tritici MT50 Isolate Unclassified
130 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
131 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
132 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
133 2902582711 Micromonospora sp. AP08 Isolate Unclassified
134 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
135 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
136 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
137 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
138 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
139 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
140 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
141 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
142 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
143 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
144 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
145 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
146 2922554459 Rhodococcus sp. 66b Isolate Unclassified
147 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
148 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
149 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
150 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
151 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
152 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
153 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
154 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
155 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
156 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
157 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
158 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
159 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
160 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
161 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
162 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
163 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
164 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
165 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
166 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
167 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
168 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
169 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
170 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
171 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
172 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
173 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
174 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
175 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
176 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
177 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
178 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
179 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
180 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
181 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
182 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
183 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
184 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
185 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
186 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
187 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
188 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
189 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
190 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
191 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
192 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
193 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
194 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
196 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
197 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
198 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
199 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
200 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
201 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
202 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
203 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
204 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
205 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
206 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
207 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
208 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
209 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
211 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
212 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
213 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
214 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
215 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
217 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
219 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
221 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
222 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
223 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
224 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
225 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
226 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
227 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
228 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
229 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
230 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
231 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
232 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
233 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
234 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
235 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
236 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
237 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
238 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
239 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
240 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
241 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
242 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
243 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
244 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
245 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
246 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
247 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
248 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
249 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
250 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
251 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
252 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
253 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
254 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
255 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
256 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
257 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
258 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
259 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
260 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
261 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
262 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
263 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
264 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
265 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
266 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
267 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
268 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
269 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
270 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
271 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
272 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
273 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
274 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
275 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
276 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
277 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
278 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
279 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
280 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
281 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
282 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
283 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
284 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
285 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
286 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
287 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
288 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
289 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
290 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
291 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
292 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
293 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
294 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
295 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
296 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
297 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
298 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
299 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
300 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
301 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
302 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
303 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
304 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
305 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
306 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
307 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
308 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
309 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
310 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
311 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
312 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
313 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
314 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
315 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
316 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
317 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
318 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
319 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
320 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
321 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
322 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
323 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
324 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
325 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
326 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
327 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
328 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
329 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
330 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
331 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
332 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
333 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
334 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
335 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
336 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
337 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
338 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
339 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
340 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
341 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
342 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
343 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
344 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
345 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
346 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
347 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
348 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
349 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
352 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
353 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
354 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
355 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
356 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
357 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
358 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
359 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
360 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
361 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
362 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
363 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
364 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
365 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
366 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
367 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
368 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
369 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
370 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
371 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
372 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
373 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
374 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
375 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
376 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
377 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
378 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
379 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
381 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
382 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
383 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
384 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
385 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
386 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
387 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
388 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
389 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
390 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
391 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
392 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
464 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
465 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
466 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
467 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
469 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
473 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
474 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
475 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
476 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
477 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
478 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
479 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
480 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
481 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
482 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
483 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
484 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
485 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
486 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
487 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
488 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
490 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
491 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
492 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
493 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
494 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
495 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
496 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
497 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
498 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
499 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
500 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
501 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
502 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
503 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
504 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
505 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
506 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
507 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
508 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
509 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
510 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
512 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
513 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
515 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
516 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
517 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
518 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
519 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
520 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
521 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
522 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
523 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
524 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
525 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
526 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
527 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
528 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
529 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
530 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
531 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
532 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
533 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
534 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
535 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
536 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
537 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
538 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
539 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
540 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
541 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
542 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
543 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
544 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
546 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
547 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
548 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
549 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
550 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
551 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
552 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
553 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
554 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
555 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
556 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
557 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
558 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
559 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
560 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
561 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
562 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
563 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
564 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
565 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
566 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
567 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
568 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
569 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
570 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
571 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
572 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
573 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
574 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
575 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
576 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
577 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
578 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
579 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
580 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
581 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
582 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
583 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
584 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
585 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
586 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
587 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
588 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
589 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
590 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
591 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
592 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
593 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
594 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
595 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
596 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
597 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
598 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
599 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
600 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
601 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
602 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
603 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
604 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
605 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
606 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
607 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
608 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
609 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
610 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
611 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
612 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
613 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
614 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
615 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
616 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
617 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
618 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
619 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
620 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
621 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
622 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
623 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
624 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
625 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
626 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
627 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
628 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
629 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
630 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
631 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
632 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
633 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
634 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
635 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
636 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
637 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
638 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
639 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
640 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
641 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
642 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
643 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
644 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
645 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
646 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
647 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
648 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
649 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
650 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
651 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
652 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
653 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
654 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
655 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
656 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
657 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
658 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
659 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
660 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
661 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
662 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
663 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
664 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
665 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
666 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
667 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
668 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
669 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
670 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
671 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
672 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
673 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
674 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
675 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
676 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
677 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
678 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
679 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
680 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
681 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
682 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
683 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
684 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
685 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
686 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
687 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
688 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
689 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
690 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
691 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
692 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
693 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
694 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
695 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
696 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
697 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
698 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
699 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
700 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
701 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
702 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
703 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
704 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
705 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
706 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
707 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
708 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
709 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
710 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
711 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
712 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
713 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
714 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
715 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
716 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
717 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
718 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
719 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
720 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
721 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
722 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
723 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
724 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
725 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
726 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
727 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
728 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
729 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
730 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
731 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
732 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
733 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
734 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
735 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
736 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
737 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
738 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
739 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
740 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
741 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
742 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
743 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
744 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
745 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
746 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
747 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
748 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
749 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
750 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
751 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
752 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
753 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
754 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
755 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
756 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
757 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
758 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
759 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
760 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
761 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
762 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
763 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
764 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
765 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
766 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
767 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
768 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
769 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
770 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
771 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
772 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
773 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
774 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
775 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
776 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
779 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
780 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
781 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
782 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
783 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
784 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
785 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
786 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
787 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
788 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
789 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
790 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
793 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
794 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
795 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
796 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
797 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
798 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
799 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
800 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
801 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
802 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
803 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
804 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
805 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
806 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
807 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
808 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
809 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
810 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
811 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
812 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
813 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
814 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
815 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
816 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
817 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
818 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
819 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
820 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
821 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
822 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
823 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
824 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
825 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
826 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
827 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
828 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
829 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
830 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
831 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
832 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
833 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
834 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
835 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
836 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
837 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
838 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
839 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
840 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
841 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
842 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
843 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
844 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
845 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
846 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
847 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
848 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
849 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
850 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
851 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
852 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
853 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
854 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
855 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
856 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
857 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
858 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
859 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
860 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
861 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
862 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
863 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
864 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
865 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
866 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
867 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
868 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
869 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
870 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
871 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
872 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
873 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
874 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
875 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
876 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
877 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
878 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
879 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
880 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
881 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
882 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
883 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
884 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
885 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
886 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
887 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
888 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
889 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
890 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
891 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
892 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
893 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
894 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
895 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
896 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
897 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
898 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
899 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
900 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
901 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
902 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
903 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
904 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
905 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
906 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
907 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
908 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
909 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
910 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
911 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
912 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
913 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
914 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
915 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
916 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
917 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
918 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
919 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
920 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
921 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
922 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
923 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
924 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
925 637000116 Frankia casuarinae CcI3 Isolate Nodule
926 649633069 Micromonospora sp. L5 Isolate Unclassified
927 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
928 8002784119 Frankia sp. AgB1.9 Isolate Nodule
929 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
930 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
931 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
932 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
933 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
934 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
935 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
936 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
937 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
938 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
939 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
940 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
941 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
942 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
943 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
944 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
945 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
946 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
947 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
948 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
949 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
950 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
951 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
952 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
953 8054920844 Frankia tisae Agncl-8 Isolate Nodule
954 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
955 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
956 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
957 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
958 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
959 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.47
Metatranscriptomes 10.54
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.03
Bulb 0
Endosphere 2.99
Nodule 1.02
Rhizoplane 6.2
Rhizosphere 82.67
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c001648 3300000041 Bacteria 2196
2 bgg_mtDRAFT_1030653 3300000305 Bacteria 1554
3 JGI24752J21851_1005251 3300001976 Bacteria 1693
4 JGI24740J21852_10008288 3300001979 Bacteria 4151
5 JGI24740J21852_10040891 3300001979 Bacteria 1401
6 JGI24740J21852_10057899 3300001979 Bacteria 1080
7 JGI24739J22299_10006670 3300001989 Bacteria 4344
8 JGI24739J22299_10015093 3300001989 Bacteria 2808
9 JGI24739J22299_10029107 3300001989 Bacteria 1923
10 JGI24737J22298_10001920 3300001990 Bacteria 7427
11 JGI24737J22298_10014722 3300001990 Bacteria 2537
12 JGI24735J21928_10017393 3300002067 Bacteria 2225
13 JGI24735J21928_10042822 3300002067 Bacteria 1318
14 JGI24735J21928_10068389 3300002067 Bacteria 1018
15 JGI24745J21846_1002158 3300002073 Bacteria 1981
16 JGI24738J21930_10005555 3300002075 Bacteria 3009
17 JGI24738J21930_10013650 3300002075 Bacteria 1752
18 JGI24744J21845_10003031 3300002077 Bacteria 3445
19 JGI24035J26624_1002342 3300002126 Bacteria 1767
20 JGI24751J29686_10036240 3300002459 Bacteria 1023
21 Ga0006765J45826_107321 3300003161 Bacteria 1228
22 Ga0006778J45830_1010146 3300003162 Bacteria 1510
23 Ga0006778J45830_1018467 3300003162 Bacteria 1051
24 Ga0006778J45830_1055943 3300003162 Bacteria 904
25 Ga0006759J45824_1010225 3300003163 Bacteria 1180
26 Ga0006759J45824_1012090 3300003163 Bacteria 2293
27 JGI25406J46586_10008422 3300003203 Bacteria 4672
28 JGI25406J46586_10080928 3300003203 Bacteria 996
29 Ga0007423J48922_100012 3300003285 Bacteria 7510
30 Ga0006758J48902_1007969 3300003300 Bacteria 812
31 Ga0006770J48903_1022427 3300003305 Bacteria 2131
32 Ga0006777J48905_1014619 3300003308 Bacteria 1519
33 Ga0006777J48905_1019249 3300003308 Bacteria 2480
34 Ga0006777J48905_1028950 3300003308 Bacteria 770
35 rootH2_10057508 3300003320 Bacteria 1950
36 JGI25407J50210_10023670 3300003373 Bacteria 1594
37 Ga0007417J51691_1010885 3300003544 Bacteria 1318
38 Ga0007417J51691_1012477 3300003544 Bacteria 2832
39 Ga0007417J51691_1018541 3300003544 Bacteria 1135
40 Ga0007417J51691_1023818 3300003544 Bacteria 1137
41 Ga0007427J51700_105815 3300003559 Bacteria 1303
42 Ga0006781J51513_1010437 3300003568 Bacteria 1499
43 Ga0007410J51695_1012990 3300003574 Bacteria 2931
44 Ga0007410J51695_1018802 3300003574 Bacteria 1046
45 Ga0007410J51695_1049944 3300003574 Bacteria 961
46 Ga0007409J51694_1010921 3300003575 Bacteria 1481
47 Ga0007409J51694_1011191 3300003575 Bacteria 864
48 Ga0007409J51694_1018435 3300003575 Bacteria 863
49 Ga0007416J51690_1008818 3300003577 Bacteria 1381
50 Ga0007416J51690_1019290 3300003577 Bacteria 1180
51 Ga0007416J51690_1035660 3300003577 Bacteria 1508
52 Ga0007429J51699_1011252 3300003579 Bacteria 2045
53 Ga0007429J51699_1012547 3300003579 Bacteria 1106
54 Ga0007429J51699_1013064 3300003579 Bacteria 1288
55 Ga0007429J51699_1030894 3300003579 Bacteria 1680
56 Ga0007429J51699_1064416 3300003579 Bacteria 1060
57 Ga0007429J51699_1095228 3300003579 Bacteria 925
58 JGI25404J52841_10006168 3300003659 Bacteria 2498
59 Ga0032354_1004260 3300003693 Bacteria 2489
60 Ga0032354_1019065 3300003693 Bacteria 1242
61 Ga0006780_1006289 3300003735 Bacteria 2011
62 Ga0006780_1007202 3300003735 Bacteria 1394
63 Ga0055542_1001700 3300003762 Bacteria 9580
64 Ga0055528_1028040 3300003790 Bacteria 1564
65 Ga0055540_1032500 3300003792 Bacteria 1190
66 JGI25405J52794_10014488 3300003911 Bacteria 1541
67 Ga0058858_1046418 3300004785 Bacteria 5114
68 Ga0058859_10056829 3300004798 Bacteria 1507
69 Ga0058859_10145872 3300004798 Bacteria 1242
70 Ga0058863_10052868 3300004799 Bacteria 1567
71 Ga0058863_10053663 3300004799 Bacteria 792
72 Ga0058863_10068171 3300004799 Bacteria 1931
73 Ga0058863_10080822 3300004799 Bacteria 1141
74 Ga0058860_10090712 3300004801 Bacteria 1009
75 Ga0058860_10095871 3300004801 Bacteria 2228
76 Ga0058862_10009112 3300004803 Bacteria 745
77 Ga0058862_10069452 3300004803 Bacteria 1509
78 Ga0058862_10128907 3300004803 Bacteria 1192
79 Ga0058862_10135468 3300004803 Bacteria 1056
80 Ga0065704_10020984 3300005289 Bacteria 1509
81 Ga0065712_10047772 3300005290 Bacteria 896
82 Ga0065715_10188434 3300005293 Bacteria 1430
83 Ga0070658_10042114 3300005327 Bacteria 3686
84 Ga0070658_10086158 3300005327 Bacteria 2584
85 Ga0070658_10174822 3300005327 Bacteria 1805
86 Ga0070658_10218725 3300005327 Bacteria 1610
87 Ga0070658_10636092 3300005327 Bacteria 925
88 Ga0070676_10094123 3300005328 Bacteria 1840
89 Ga0070676_10135021 3300005328 Bacteria 1564
90 Ga0070676_10410980 3300005328 Bacteria 944
91 Ga0070683_100045429 3300005329 Bacteria 4053
92 Ga0070683_100185557 3300005329 Bacteria 1974
93 Ga0070683_100384042 3300005329 Bacteria 1338
94 Ga0070683_100433319 3300005329 Bacteria 1254
95 Ga0070683_100467086 3300005329 Bacteria 1205
96 Ga0070683_100650003 3300005329 Bacteria 1010
97 Ga0070683_100650117 3300005329 Bacteria 1009
98 Ga0070670_100006072 3300005331 Bacteria 10217
99 Ga0070670_100025823 3300005331 Bacteria 5054
100 Ga0070670_100037598 3300005331 Bacteria 4164
101 Ga0070670_100307323 3300005331 Bacteria 1388
102 Ga0070670_100324920 3300005331 Bacteria 1348
103 Ga0070670_100362577 3300005331 Bacteria 1275
104 Ga0068869_100005700 3300005334 Bacteria 7856
105 Ga0068869_100046622 3300005334 Bacteria 3125
106 Ga0068869_100140579 3300005334 Bacteria 1864
107 Ga0068869_100170379 3300005334 Bacteria 1700
108 Ga0068869_100170391 3300005334 Bacteria 1700
109 Ga0068869_100226862 3300005334 Bacteria 1483
110 Ga0070666_10004188 3300005335 Bacteria 8754
111 Ga0070666_10204789 3300005335 Bacteria 1388
112 Ga0070680_100031712 3300005336 Bacteria 4249
113 Ga0070680_100373950 3300005336 Bacteria 1213
114 Ga0070680_100562669 3300005336 Bacteria 977
115 Ga0070682_100024938 3300005337 Bacteria 3565
116 Ga0070682_100033996 3300005337 Bacteria 3101
117 Ga0070682_100088892 3300005337 Bacteria 2017
118 Ga0070682_100258332 3300005337 Bacteria 1259
119 Ga0070682_100421510 3300005337 Bacteria 1014
120 Ga0068868_100000735 3300005338 Bacteria 22181
121 Ga0068868_100037198 3300005338 Bacteria 3772
122 Ga0068868_100220544 3300005338 Bacteria 1587
123 Ga0068868_100532979 3300005338 Bacteria 1032
124 Ga0068868_100880714 3300005338 Bacteria 812
125 Ga0068868_100945587 3300005338 Bacteria 786
126 Ga0070660_100018220 3300005339 Bacteria 5127
127 Ga0070660_100026612 3300005339 Bacteria 4309
128 Ga0070689_100176864 3300005340 Bacteria 1731
129 Ga0070689_100269402 3300005340 Bacteria 1409
130 Ga0070691_10022947 3300005341 Bacteria 2896
131 Ga0070691_10030800 3300005341 Bacteria 2513
132 Ga0070691_10120663 3300005341 Bacteria 1320
133 Ga0070687_100042062 3300005343 Bacteria 2313
134 Ga0070687_100047013 3300005343 Bacteria 2212
135 Ga0070687_100225679 3300005343 Bacteria 1150
136 Ga0070661_100005438 3300005344 Bacteria 8781
137 Ga0070661_100079586 3300005344 Bacteria 2419
138 Ga0070661_100319418 3300005344 Bacteria 1212
139 Ga0070692_10000540 3300005345 Bacteria 11756
140 Ga0070692_10049505 3300005345 Bacteria 2179
141 Ga0070692_10051941 3300005345 Bacteria 2133
142 Ga0070692_10149875 3300005345 Bacteria 1328
143 Ga0070692_10323661 3300005345 Bacteria 949
144 Ga0070668_100043401 3300005347 Bacteria 3448
145 Ga0070668_100063720 3300005347 Bacteria 2857
146 Ga0070668_100243737 3300005347 Bacteria 1490
147 Ga0070669_100102325 3300005353 Bacteria 2163
148 Ga0070669_100680056 3300005353 Bacteria 868
149 Ga0070675_100004178 3300005354 Bacteria 10967
150 Ga0070675_100084224 3300005354 Bacteria 2655
151 Ga0070675_100269185 3300005354 Bacteria 1495
152 Ga0070675_100531827 3300005354 Bacteria 1061
153 Ga0070675_100554364 3300005354 Bacteria 1040
154 Ga0070675_100831947 3300005354 Bacteria 844
155 Ga0070671_100023520 3300005355 Bacteria 5043
156 Ga0070671_100048691 3300005355 Bacteria 3525
157 Ga0070671_100352832 3300005355 Bacteria 1255
158 Ga0070674_100018733 3300005356 Bacteria 4384
159 Ga0070674_100041274 3300005356 Bacteria 3125
160 Ga0070674_100088901 3300005356 Bacteria 2224
161 Ga0070674_100135002 3300005356 Bacteria 1844
162 Ga0070674_100166369 3300005356 Bacteria 1677
163 Ga0070674_100286706 3300005356 Bacteria 1307
164 Ga0070673_100059473 3300005364 Bacteria 3025
165 Ga0070673_100399598 3300005364 Bacteria 1229
166 Ga0070673_100656108 3300005364 Bacteria 961
167 Ga0070688_100122842 3300005365 Bacteria 1741
168 Ga0070688_100452195 3300005365 Bacteria 960
169 Ga0070659_100010814 3300005366 Bacteria 6730
170 Ga0070659_100026205 3300005366 Bacteria 4484
171 Ga0070659_100086347 3300005366 Bacteria 2510
172 Ga0070659_100224452 3300005366 Bacteria 1551
173 Ga0070659_100451498 3300005366 Bacteria 1090
174 Ga0070659_100719183 3300005366 Bacteria 864
175 Ga0070667_100005984 3300005367 Bacteria 10104
176 Ga0070667_100016592 3300005367 Bacteria 6094
177 Ga0070667_100077020 3300005367 Bacteria 2847
178 Ga0070667_100220900 3300005367 Bacteria 1687
179 Ga0070667_100246680 3300005367 Bacteria 1596
180 Ga0070667_100281806 3300005367 Bacteria 1492
181 Ga0070667_100885275 3300005367 Bacteria 831
182 Ga0070709_10621797 3300005434 Bacteria 833
183 Ga0070714_100001124 3300005435 Bacteria 19227
184 Ga0070714_100015080 3300005435 Bacteria 6213
185 Ga0070714_100065446 3300005435 Bacteria 3130
186 Ga0070714_100177988 3300005435 Bacteria 1934
187 Ga0070714_100841703 3300005435 Bacteria 889
188 Ga0070714_101081186 3300005435 Bacteria 781
189 Ga0070713_100004669 3300005436 Bacteria 9248
190 Ga0070713_100040206 3300005436 Bacteria 3801
191 Ga0070713_100044010 3300005436 Bacteria 3652
192 Ga0070713_100937751 3300005436 Bacteria 833
193 Ga0070713_101090554 3300005436 Bacteria 771
194 Ga0070710_10000376 3300005437 Bacteria 20895
195 Ga0070710_10051230 3300005437 Bacteria 2317
196 Ga0070710_10227488 3300005437 Bacteria 1189
197 Ga0070710_10415813 3300005437 Bacteria 904
198 Ga0070701_10018401 3300005438 Bacteria 3282
199 Ga0070701_10079227 3300005438 Bacteria 1774
200 Ga0070701_10132441 3300005438 Bacteria 1418
201 Ga0070701_10169019 3300005438 Bacteria 1272
202 Ga0070711_100054866 3300005439 Bacteria 2751
203 Ga0070711_100095091 3300005439 Bacteria 2156
204 Ga0070711_100754614 3300005439 Bacteria 822
205 Ga0070705_100131670 3300005440 Bacteria 1632
206 Ga0070705_100184048 3300005440 Bacteria 1418
207 Ga0070705_100195335 3300005440 Bacteria 1383
208 Ga0070705_100241954 3300005440 Bacteria 1261
209 Ga0070700_100028068 3300005441 Bacteria 3344
210 Ga0070700_100029955 3300005441 Bacteria 3248
211 Ga0070700_100594167 3300005441 Bacteria 866
212 Ga0070694_100092972 3300005444 Bacteria 2119
213 Ga0070694_100161251 3300005444 Bacteria 1645
214 Ga0070694_100252084 3300005444 Bacteria 1336
215 Ga0070708_100004548 3300005445 Bacteria 10921
216 Ga0070708_100151231 3300005445 Bacteria 2159
217 Ga0070708_100450132 3300005445 Bacteria 1215
218 Ga0070663_100003713 3300005455 Bacteria 8850
219 Ga0070663_100013761 3300005455 Bacteria 5173
220 Ga0070663_100018387 3300005455 Bacteria 4582
221 Ga0070663_100168177 3300005455 Bacteria 1693
222 Ga0070663_100189116 3300005455 Bacteria 1601
223 Ga0070663_100277419 3300005455 Bacteria 1335
224 Ga0070663_100290473 3300005455 Bacteria 1306
225 Ga0070663_100669351 3300005455 Bacteria 880
226 Ga0070678_100045409 3300005456 Bacteria 3143
227 Ga0070678_100061339 3300005456 Bacteria 2771
228 Ga0070678_100139403 3300005456 Bacteria 1938
229 Ga0070678_100155183 3300005456 Bacteria 1848
230 Ga0070678_100172790 3300005456 Bacteria 1761
231 Ga0070678_100189376 3300005456 Bacteria 1690
232 Ga0070678_100514553 3300005456 Bacteria 1058
233 Ga0070678_100900508 3300005456 Bacteria 809
234 Ga0070662_100029774 3300005457 Bacteria 3813
235 Ga0070662_100129509 3300005457 Bacteria 1944
236 Ga0070662_100176821 3300005457 Bacteria 1680
237 Ga0070662_100181760 3300005457 Bacteria 1658
238 Ga0070662_100253905 3300005457 Bacteria 1414
239 Ga0070662_100354667 3300005457 Bacteria 1202
240 Ga0070681_10034186 3300005458 Bacteria 5105
241 Ga0070681_10043340 3300005458 Bacteria 4508
242 Ga0070681_10157605 3300005458 Bacteria 2194
243 Ga0070681_10196265 3300005458 Bacteria 1937
244 Ga0068867_100038719 3300005459 Bacteria 3472
245 Ga0068867_100116417 3300005459 Bacteria 2060
246 Ga0068867_100271482 3300005459 Bacteria 1387
247 Ga0068867_100749052 3300005459 Bacteria 867
248 Ga0070685_10139310 3300005466 Bacteria 1525
249 Ga0070685_10144471 3300005466 Bacteria 1501
250 Ga0070706_100002451 3300005467 Bacteria 18706
251 Ga0070706_100021333 3300005467 Bacteria 5966
252 Ga0070706_100045657 3300005467 Bacteria 4046
253 Ga0070706_100264790 3300005467 Bacteria 1604
254 Ga0070706_100726726 3300005467 Bacteria 920
255 Ga0070707_100051699 3300005468 Bacteria 3938
256 Ga0070707_100059543 3300005468 Bacteria 3663
257 Ga0070707_100137219 3300005468 Bacteria 2379
258 Ga0070707_100288576 3300005468 Bacteria 1594
259 Ga0070707_100329126 3300005468 Bacteria 1484
260 Ga0070698_100001064 3300005471 Bacteria 30146
261 Ga0070698_100090705 3300005471 Bacteria 3039
262 Ga0070698_100139268 3300005471 Bacteria 2379
263 Ga0070698_100142295 3300005471 Bacteria 2349
264 Ga0070698_100200884 3300005471 Bacteria 1929
265 Ga0070698_100379331 3300005471 Bacteria 1346
266 Ga0070699_100097370 3300005518 Bacteria 2577
267 Ga0070679_100102028 3300005530 Bacteria 2855
268 Ga0070679_100163794 3300005530 Bacteria 2198
269 Ga0070679_100518836 3300005530 Bacteria 1135
270 Ga0070679_100864746 3300005530 Bacteria 848
271 Ga0070684_100020206 3300005535 Bacteria 5525
272 Ga0070684_100284428 3300005535 Bacteria 1515
273 Ga0070684_100305734 3300005535 Bacteria 1460
274 Ga0070684_100571952 3300005535 Bacteria 1049
275 Ga0070697_100016947 3300005536 Bacteria 5728
276 Ga0070697_100051511 3300005536 Bacteria 3344
277 Ga0070697_100188972 3300005536 Bacteria 1748
278 Ga0068853_100081935 3300005539 Bacteria 2826
279 Ga0068853_100091261 3300005539 Bacteria 2679
280 Ga0068853_100334731 3300005539 Bacteria 1405
281 Ga0068853_100399305 3300005539 Bacteria 1286
282 Ga0070672_100035129 3300005543 Bacteria 3808
283 Ga0070672_100073373 3300005543 Bacteria 2727
284 Ga0070672_100136242 3300005543 Bacteria 2022
285 Ga0070672_100234158 3300005543 Bacteria 1543
286 Ga0070672_100299135 3300005543 Bacteria 1364
287 Ga0070672_100403195 3300005543 Bacteria 1172
288 Ga0070686_100012170 3300005544 Bacteria 4894
289 Ga0070686_100042607 3300005544 Bacteria 2844
290 Ga0070686_100098390 3300005544 Bacteria 1971
291 Ga0070686_100575705 3300005544 Bacteria 884
292 Ga0070686_100633434 3300005544 Bacteria 846
293 Ga0070695_100029836 3300005545 Bacteria 3391
294 Ga0070695_100077745 3300005545 Bacteria 2187
295 Ga0070695_100489981 3300005545 Bacteria 949
296 Ga0070696_100054255 3300005546 Bacteria 2792
297 Ga0070696_100544841 3300005546 Bacteria 929
298 Ga0070693_100026519 3300005547 Bacteria 3129
299 Ga0070693_100057097 3300005547 Bacteria 2255
300 Ga0070693_100102732 3300005547 Bacteria 1744
301 Ga0070665_100001905 3300005548 Bacteria 23586
302 Ga0070665_100053131 3300005548 Bacteria 4063
303 Ga0070665_100074736 3300005548 Bacteria 3394
304 Ga0070665_100122209 3300005548 Bacteria 2606
305 Ga0070665_100129811 3300005548 Bacteria 2522
306 Ga0070665_100282026 3300005548 Bacteria 1663
307 Ga0070665_100282934 3300005548 Bacteria 1660
308 Ga0070665_100527599 3300005548 Bacteria 1192
309 Ga0070665_100664690 3300005548 Bacteria 1055
310 Ga0070665_100816215 3300005548 Bacteria 946
311 Ga0070665_100851907 3300005548 Bacteria 924
312 Ga0070704_100013016 3300005549 Bacteria 5150
313 Ga0070704_100360714 3300005549 Bacteria 1229
314 Ga0068855_100001896 3300005563 Bacteria 25943
315 Ga0068855_100033356 3300005563 Bacteria 6144
316 Ga0068855_100038609 3300005563 Bacteria 5673
317 Ga0068855_100137809 3300005563 Bacteria 2783
318 Ga0068855_100352574 3300005563 Bacteria 1621
319 Ga0070664_100343908 3300005564 Bacteria 1355
320 Ga0068857_100023375 3300005577 Bacteria 5441
321 Ga0068857_100804083 3300005577 Bacteria 898
322 Ga0068854_100020506 3300005578 Bacteria 4473
323 Ga0068854_100030118 3300005578 Bacteria 3762
324 Ga0068854_100064950 3300005578 Bacteria 2653
325 Ga0068854_100353723 3300005578 Bacteria 1203
326 Ga0068854_100507471 3300005578 Bacteria 1016
327 Ga0068856_100032899 3300005614 Bacteria 5078
328 Ga0068856_100063697 3300005614 Bacteria 3642
329 Ga0068856_100080780 3300005614 Bacteria 3225
330 Ga0068856_100157717 3300005614 Bacteria 2279
331 Ga0068856_100308380 3300005614 Bacteria 1600
332 Ga0068856_100363591 3300005614 Bacteria 1465
333 Ga0068856_100396727 3300005614 Bacteria 1399
334 Ga0068856_100742220 3300005614 Bacteria 1002
335 Ga0068856_100867931 3300005614 Bacteria 921
336 Ga0070702_100005992 3300005615 Bacteria 5720
337 Ga0070702_100061558 3300005615 Bacteria 2186
338 Ga0068852_100025908 3300005616 Bacteria 4759
339 Ga0068852_100063129 3300005616 Bacteria 3225
340 Ga0068852_100177559 3300005616 Bacteria 2000
341 Ga0068852_100201114 3300005616 Bacteria 1885
342 Ga0068852_100352992 3300005616 Bacteria 1436
343 Ga0068852_100538807 3300005616 Bacteria 1166
344 Ga0068859_100075833 3300005617 Bacteria 3403
345 Ga0068859_100100264 3300005617 Bacteria 2951
346 Ga0068859_100320278 3300005617 Bacteria 1645
347 Ga0068859_100514228 3300005617 Bacteria 1292
348 Ga0068859_100628244 3300005617 Bacteria 1166
349 Ga0068864_100019158 3300005618 Bacteria 5720
350 Ga0068864_100167660 3300005618 Bacteria 2000
351 Ga0068864_100212901 3300005618 Bacteria 1780
352 Ga0068864_100769382 3300005618 Bacteria 945
353 Ga0068866_10006852 3300005718 Bacteria 4757
354 Ga0068866_10178141 3300005718 Bacteria 1253
355 Ga0068866_10221914 3300005718 Bacteria 1141
356 Ga0068861_100035902 3300005719 Bacteria 3675
357 Ga0068861_100059235 3300005719 Bacteria 2931
358 Ga0068861_100162109 3300005719 Bacteria 1845
359 Ga0068861_100246310 3300005719 Bacteria 1523
360 Ga0068861_100626684 3300005719 Bacteria 990
361 Ga0068851_10021454 3300005834 Bacteria 3136
362 Ga0068851_10025951 3300005834 Bacteria 2876
363 Ga0068870_10002912 3300005840 Bacteria 7207
364 Ga0068870_10006791 3300005840 Bacteria 5071
365 Ga0068870_10008502 3300005840 Bacteria 4621
366 Ga0068870_10129390 3300005840 Bacteria 1465
367 Ga0068870_10132749 3300005840 Bacteria 1448
368 Ga0068863_100002199 3300005841 Bacteria 19365
369 Ga0068863_100009657 3300005841 Bacteria 9414
370 Ga0068863_100254325 3300005841 Bacteria 1697
371 Ga0068863_100310967 3300005841 Bacteria 1529
372 Ga0068863_100334237 3300005841 Bacteria 1473
373 Ga0068863_100667747 3300005841 Bacteria 1031
374 Ga0068858_100000010 3300005842 Bacteria 234748
375 Ga0068858_100000013 3300005842 Bacteria 216466
376 Ga0068858_100006254 3300005842 Bacteria 11602
377 Ga0068858_100162412 3300005842 Bacteria 2103
378 Ga0068858_100714882 3300005842 Bacteria 975
379 Ga0068858_101033687 3300005842 Bacteria 806
380 Ga0068858_101166816 3300005842 Bacteria 757
381 Ga0068860_100084657 3300005843 Bacteria 3016
382 Ga0068860_100193897 3300005843 Bacteria 1966
383 Ga0068860_100209752 3300005843 Bacteria 1889
384 Ga0068860_100347319 3300005843 Bacteria 1459
385 Ga0068862_100000836 3300005844 Bacteria 30459
386 Ga0068862_100018672 3300005844 Bacteria 5776
387 Ga0068862_100126613 3300005844 Bacteria 2256
388 Ga0068862_100128392 3300005844 Bacteria 2240
389 Ga0068862_100136123 3300005844 Bacteria 2177
390 Ga0068862_100283191 3300005844 Bacteria 1520
391 Ga0068862_100308618 3300005844 Bacteria 1457
392 Ga0068862_100485041 3300005844 Bacteria 1171
393 Ga0081455_10000358 3300005937 Bacteria 60189
394 Ga0081455_10000532 3300005937 Bacteria 49342
395 Ga0081455_10001741 3300005937 Bacteria 26305
396 Ga0081455_10010015 3300005937 Bacteria 9686
397 Ga0081455_10022468 3300005937 Bacteria 5894
398 Ga0081455_10033409 3300005937 Bacteria 4623
399 Ga0081455_10061103 3300005937 Bacteria 3172
400 Ga0081455_10062816 3300005937 Bacteria 3120
401 Ga0081455_10077239 3300005937 Bacteria 2740
402 Ga0081455_10106856 3300005937 Bacteria 2232
403 Ga0081455_10116192 3300005937 Bacteria 2116
404 Ga0081455_10124867 3300005937 Bacteria 2022
405 Ga0081455_10136232 3300005937 Bacteria 1913
406 Ga0081455_10364371 3300005937 Bacteria 1015
407 Ga0081538_10001252 3300005981 Bacteria 26483
408 Ga0081538_10096062 3300005981 Bacteria 1511
409 Ga0081540_1000341 3300005983 Bacteria 47794
410 Ga0081540_1001718 3300005983 Bacteria 18540
411 Ga0081540_1003318 3300005983 Bacteria 12761
412 Ga0081540_1019731 3300005983 Bacteria 4083
413 Ga0081540_1065468 3300005983 Bacteria 1709
414 Ga0081539_10000132 3300005985 Bacteria 175454
415 Ga0081539_10001286 3300005985 Bacteria 44180
416 Ga0081539_10008334 3300005985 Bacteria 9059
417 Ga0081539_10023237 3300005985 Bacteria 4068
418 Ga0081539_10043682 3300005985 Bacteria 2595
419 Ga0081539_10134883 3300005985 Bacteria 1208
420 Ga0081539_10186000 3300005985 Bacteria 971
421 Ga0081539_10195026 3300005985 Bacteria 940
422 Ga0070717_10009172 3300006028 Bacteria 7434
423 Ga0070717_10038990 3300006028 Bacteria 3864
424 Ga0070717_10063532 3300006028 Bacteria 3065
425 Ga0070717_10253764 3300006028 Bacteria 1554
426 Ga0070717_10441088 3300006028 Bacteria 1172
427 Ga0070717_10643313 3300006028 Bacteria 962
428 Ga0075365_10131428 3300006038 Bacteria 1732
429 Ga0075365_10352554 3300006038 Bacteria 1037
430 Ga0075365_10386264 3300006038 Bacteria 988
431 Ga0075365_10399513 3300006038 Bacteria 970
432 Ga0075368_10021194 3300006042 Bacteria 2467
433 Ga0075363_100000106 3300006048 Bacteria 18994
434 Ga0075363_100127920 3300006048 Bacteria 1423
435 Ga0075364_10000119 3300006051 Bacteria 32513
436 Ga0075364_10166705 3300006051 Bacteria 1488
437 Ga0075432_10002369 3300006058 Bacteria 6284
438 Ga0075432_10005539 3300006058 Bacteria 4300
439 Ga0075432_10005901 3300006058 Bacteria 4165
440 Ga0075432_10172945 3300006058 Bacteria 841
441 Ga0070715_10012155 3300006163 Bacteria 3123
442 Ga0070715_10108496 3300006163 Bacteria 1306
443 Ga0070715_10232931 3300006163 Bacteria 953
444 Ga0070716_100016479 3300006173 Bacteria 3815
445 Ga0070716_100328774 3300006173 Bacteria 1074
446 Ga0070712_100060728 3300006175 Bacteria 2667
447 Ga0070712_100096938 3300006175 Bacteria 2172
448 Ga0070712_100271045 3300006175 Bacteria 1364
449 Ga0070712_100590110 3300006175 Bacteria 939
450 Ga0075362_10246590 3300006177 Bacteria 878
451 Ga0075367_10001061 3300006178 Bacteria 11348
452 Ga0075367_10169555 3300006178 Bacteria 1359
453 Ga0075367_10217001 3300006178 Bacteria 1197
454 Ga0075369_10003472 3300006186 Bacteria 5738
455 Ga0075369_10006299 3300006186 Bacteria 4480
456 Ga0075366_10061582 3300006195 Bacteria 2230
457 Ga0097621_100011407 3300006237 Bacteria 6543
458 Ga0097621_100297014 3300006237 Bacteria 1426
459 Ga0097621_100509710 3300006237 Bacteria 1091
460 Ga0075370_10014981 3300006353 Bacteria 4143
461 Ga0075370_10045395 3300006353 Bacteria 2485
462 Ga0075370_10107719 3300006353 Bacteria 1616
463 Ga0075370_10308570 3300006353 Bacteria 942
464 Ga0068871_100032984 3300006358 Bacteria 4095
465 Ga0068871_100033157 3300006358 Bacteria 4086
466 Ga0068871_100065721 3300006358 Bacteria 2971
467 Ga0068871_100162309 3300006358 Bacteria 1912
468 Ga0068871_100240491 3300006358 Bacteria 1574
469 Ga0075428_100002175 3300006844 Bacteria 21200
470 Ga0075428_100027125 3300006844 Bacteria 6341
471 Ga0075428_100160595 3300006844 Bacteria 2439
472 Ga0075428_101038683 3300006844 Bacteria 867
473 Ga0075430_100005226 3300006846 Bacteria 10945
474 Ga0075431_100001734 3300006847 Bacteria 20513
475 Ga0075431_100014269 3300006847 Bacteria 8034
476 Ga0075431_100903503 3300006847 Bacteria 853
477 Ga0075433_10000978 3300006852 Bacteria 20308
478 Ga0075433_10021719 3300006852 Bacteria 5384
479 Ga0075433_10026281 3300006852 Bacteria 4927
480 Ga0075433_10032299 3300006852 Bacteria 4483
481 Ga0075433_10038355 3300006852 Bacteria 4137
482 Ga0075433_10203409 3300006852 Bacteria 1760
483 Ga0075433_10361927 3300006852 Bacteria 1281
484 Ga0075434_100003585 3300006871 Bacteria 13870
485 Ga0075434_100011038 3300006871 Bacteria 8499
486 Ga0075434_100024070 3300006871 Bacteria 5948
487 Ga0075434_100046122 3300006871 Bacteria 4325
488 Ga0075434_100817323 3300006871 Bacteria 948
489 Ga0075429_100001160 3300006880 Bacteria 21254
490 Ga0075429_100067708 3300006880 Bacteria 3107
491 Ga0075429_100071803 3300006880 Bacteria 3014
492 Ga0075429_100139794 3300006880 Bacteria 2120
493 Ga0075429_100636218 3300006880 Bacteria 935
494 Ga0068865_100005424 3300006881 Bacteria 7732
495 Ga0068865_100009916 3300006881 Bacteria 5920
496 Ga0068865_100050893 3300006881 Bacteria 2864
497 Ga0068865_100115905 3300006881 Bacteria 1984
498 Ga0068865_100121108 3300006881 Bacteria 1946
499 Ga0068865_100418903 3300006881 Bacteria 1101
500 Ga0068865_100445483 3300006881 Bacteria 1069
501 Ga0075436_100004373 3300006914 Bacteria 9696
502 Ga0075436_100028312 3300006914 Bacteria 3854
503 Ga0075436_100068778 3300006914 Bacteria 2446
504 Ga0075436_100146206 3300006914 Bacteria 1662
505 Ga0075436_100232807 3300006914 Bacteria 1309
506 Ga0075436_100431184 3300006914 Bacteria 958
507 Ga0097620_100075837 3300006931 Bacteria 3403
508 Ga0097620_100100268 3300006931 Bacteria 2951
509 Ga0097620_100320262 3300006931 Bacteria 1645
510 Ga0097620_100514210 3300006931 Bacteria 1292
511 Ga0097620_100628221 3300006931 Bacteria 1166
512 Ga0075435_100002118 3300007076 Bacteria 13070
513 Ga0075435_100018681 3300007076 Bacteria 5279
514 Ga0075435_100031095 3300007076 Bacteria 4203
515 Ga0075435_100143793 3300007076 Bacteria 2002
516 Ga0075435_100271186 3300007076 Bacteria 1447
517 Ga0075435_100651950 3300007076 Bacteria 914
518 Ga0105251_10003051 3300009011 Bacteria 12465
519 Ga0105251_10033501 3300009011 Bacteria 2549
520 Ga0105251_10079288 3300009011 Bacteria 1519
521 Ga0105251_10106002 3300009011 Bacteria 1283
522 Ga0105244_10093723 3300009036 Bacteria 1475
523 Ga0105244_10116959 3300009036 Bacteria 1293
524 Ga0105240_10039358 3300009093 Bacteria 6055
525 Ga0105240_10046258 3300009093 Bacteria 5515
526 Ga0105240_10051043 3300009093 Bacteria 5208
527 Ga0105240_10212030 3300009093 Bacteria 2262
528 Ga0105240_10503952 3300009093 Bacteria 1346
529 Ga0105240_10771411 3300009093 Bacteria 1044
530 Ga0105240_11104473 3300009093 Bacteria 844
531 Ga0105240_11127350 3300009093 Bacteria 833
532 Ga0111539_10005852 3300009094 Bacteria 15894
533 Ga0111539_10027942 3300009094 Bacteria 6889
534 Ga0111539_10039176 3300009094 Bacteria 5713
535 Ga0111539_10042172 3300009094 Bacteria 5483
536 Ga0111539_10058800 3300009094 Bacteria 4560
537 Ga0111539_10410442 3300009094 Bacteria 1577
538 Ga0111539_10901749 3300009094 Bacteria 1028
539 Ga0105245_10013039 3300009098 Bacteria 7242
540 Ga0105245_10059566 3300009098 Bacteria 3438
541 Ga0105245_10087484 3300009098 Bacteria 2860
542 Ga0105245_10092368 3300009098 Bacteria 2787
543 Ga0105245_10113779 3300009098 Bacteria 2520
544 Ga0105245_10138060 3300009098 Bacteria 2293
545 Ga0105245_10176435 3300009098 Bacteria 2038
546 Ga0105245_10333831 3300009098 Bacteria 1497
547 Ga0105245_10427509 3300009098 Bacteria 1329
548 Ga0105245_10502978 3300009098 Bacteria 1228
549 Ga0105245_10631373 3300009098 Bacteria 1100
550 Ga0105245_10886189 3300009098 Bacteria 933
551 Ga0105245_10890212 3300009098 Bacteria 931
552 Ga0105245_11248534 3300009098 Bacteria 791
553 Ga0105247_10000016 3300009101 Bacteria 263389
554 Ga0105247_10000616 3300009101 Bacteria 28650
555 Ga0105247_10017322 3300009101 Bacteria 4324
556 Ga0105247_10100783 3300009101 Bacteria 1846
557 Ga0105247_10152628 3300009101 Bacteria 1523
558 Ga0105247_10174972 3300009101 Bacteria 1429
559 Ga0105247_10274696 3300009101 Bacteria 1160
560 Ga0114129_10000234 3300009147 Bacteria 61922
561 Ga0114129_10001031 3300009147 Bacteria 36419
562 Ga0114129_10074616 3300009147 Bacteria 4725
563 Ga0114129_10178916 3300009147 Bacteria 2887
564 Ga0114129_10193234 3300009147 Bacteria 2762
565 Ga0114129_10269952 3300009147 Bacteria 2276
566 Ga0114129_10670423 3300009147 Bacteria 1336
567 Ga0105243_10018664 3300009148 Bacteria 5256
568 Ga0105243_10043934 3300009148 Bacteria 3504
569 Ga0105243_10092563 3300009148 Bacteria 2493
570 Ga0105243_10157054 3300009148 Bacteria 1957
571 Ga0105243_10261231 3300009148 Bacteria 1550
572 Ga0105243_10280358 3300009148 Bacteria 1501
573 Ga0105243_10309566 3300009148 Bacteria 1435
574 Ga0105243_10319982 3300009148 Bacteria 1413
575 Ga0105243_10486471 3300009148 Bacteria 1166
576 Ga0105241_10000758 3300009174 Bacteria 24538
577 Ga0105241_10062476 3300009174 Bacteria 2871
578 Ga0105241_10074305 3300009174 Bacteria 2647
579 Ga0105241_10175091 3300009174 Bacteria 1775
580 Ga0105241_10239480 3300009174 Bacteria 1533
581 Ga0105241_10570710 3300009174 Bacteria 1018
582 Ga0105242_10105857 3300009176 Bacteria 2390
583 Ga0105242_10134747 3300009176 Bacteria 2136
584 Ga0105242_10188548 3300009176 Bacteria 1824
585 Ga0105242_10237560 3300009176 Bacteria 1637
586 Ga0105242_10515822 3300009176 Bacteria 1139
587 Ga0105248_10000035 3300009177 Bacteria 187578
588 Ga0105248_10002899 3300009177 Bacteria 19028
589 Ga0105248_10063860 3300009177 Bacteria 4133
590 Ga0105248_10096561 3300009177 Bacteria 3329
591 Ga0105248_10131299 3300009177 Bacteria 2826
592 Ga0105248_10150854 3300009177 Bacteria 2622
593 Ga0105248_10655312 3300009177 Bacteria 1185
594 Ga0105248_10818465 3300009177 Bacteria 1051
595 Ga0105237_10110784 3300009545 Bacteria 2737
596 Ga0105237_10111038 3300009545 Bacteria 2733
597 Ga0105237_10248848 3300009545 Bacteria 1779
598 Ga0105237_10382633 3300009545 Bacteria 1412
599 Ga0105237_10393797 3300009545 Bacteria 1390
600 Ga0105237_10569523 3300009545 Bacteria 1139
601 Ga0105237_10620139 3300009545 Bacteria 1088
602 Ga0105238_10067498 3300009551 Bacteria 3577
603 Ga0105238_10208529 3300009551 Bacteria 1930
604 Ga0105238_10256990 3300009551 Bacteria 1726
605 Ga0105238_10359875 3300009551 Bacteria 1444
606 Ga0105238_10464161 3300009551 Bacteria 1264
607 Ga0105238_10823117 3300009551 Bacteria 945
608 Ga0105238_10964209 3300009551 Bacteria 873
609 Ga0105238_11037819 3300009551 Bacteria 841
610 Ga0105238_11131257 3300009551 Bacteria 806
611 Ga0105249_10006301 3300009553 Bacteria 10308
612 Ga0105249_10129759 3300009553 Bacteria 2405
613 Ga0105249_10130017 3300009553 Bacteria 2403
614 Ga0105249_10187341 3300009553 Bacteria 2017
615 Ga0105249_10402819 3300009553 Bacteria 1399
616 Ga0105249_10590824 3300009553 Bacteria 1164
617 Ga0099796_10002533 3300010159 Bacteria 4033
618 Ga0105239_10032495 3300010375 Bacteria 5733
619 Ga0105239_10044933 3300010375 Bacteria 4841
620 Ga0105239_10058109 3300010375 Bacteria 4244
621 Ga0105239_10072305 3300010375 Bacteria 3791
622 Ga0105239_10128882 3300010375 Bacteria 2813
623 Ga0105239_10498573 3300010375 Bacteria 1384
624 Ga0105246_10025484 3300011119 Bacteria 3855
625 Ga0105246_10060007 3300011119 Bacteria 2641
626 Ga0157344_1002022 3300012476 Bacteria 1036
627 Ga0157341_1003388 3300012494 Bacteria 1111
628 Ga0157319_1002784 3300012497 Bacteria 1033
629 Ga0157345_1002226 3300012498 Bacteria 1362
630 Ga0157342_1000500 3300012507 Bacteria 2423
631 Ga0157316_1013657 3300012510 Bacteria 797
632 Ga0157338_1001314 3300012515 Bacteria 1747
633 Ga0157338_1009352 3300012515 Bacteria 969
634 Ga0154014_149893 3300013052 Bacteria 1425
635 Ga0154012_131529 3300013059 Bacteria 2221
636 Ga0154012_177778 3300013059 Bacteria 852
637 Ga0157373_10035320 3300013100 Bacteria 3589
638 Ga0157373_10042038 3300013100 Bacteria 3268
639 Ga0157373_10082365 3300013100 Bacteria 2268
640 Ga0157371_10024599 3300013102 Bacteria 4395
641 Ga0157370_10116123 3300013104 Bacteria 2500
642 Ga0157370_10149009 3300013104 Bacteria 2178
643 Ga0157370_10172213 3300013104 Bacteria 2012
644 Ga0157370_10255139 3300013104 Bacteria 1622
645 Ga0157370_10362689 3300013104 Bacteria 1335
646 Ga0157370_11111278 3300013104 Bacteria 714
647 Ga0157370_11203090 3300013104 Bacteria 684
648 Ga0157369_10066458 3300013105 Bacteria 3879
649 Ga0157369_10141244 3300013105 Bacteria 2548
650 Ga0157369_10311994 3300013105 Bacteria 1635
651 Ga0157369_10391479 3300013105 Bacteria 1442
652 Ga0157369_10521728 3300013105 Bacteria 1229
653 Ga0157369_10526647 3300013105 Bacteria 1222
654 Ga0157369_10535575 3300013105 Bacteria 1211
655 Ga0157369_10917311 3300013105 Bacteria 898
656 Ga0157369_11166739 3300013105 Bacteria 786
657 Ga0157374_10021076 3300013296 Bacteria 5793
658 Ga0157374_10041287 3300013296 Bacteria 4251
659 Ga0157374_10229933 3300013296 Bacteria 1821
660 Ga0157374_10258077 3300013296 Bacteria 1716
661 Ga0157374_10668784 3300013296 Bacteria 1051
662 Ga0157374_10744014 3300013296 Bacteria 995
663 Ga0157378_10114363 3300013297 Bacteria 2479
664 Ga0157378_10133708 3300013297 Bacteria 2298
665 Ga0157378_10248802 3300013297 Bacteria 1701
666 Ga0157378_10531625 3300013297 Bacteria 1179
667 Ga0157378_10585364 3300013297 Bacteria 1125
668 Ga0163162_10018828 3300013306 Bacteria 6769
669 Ga0163162_10044145 3300013306 Bacteria 4464
670 Ga0163162_10051528 3300013306 Bacteria 4130
671 Ga0163162_10091937 3300013306 Bacteria 3117
672 Ga0163162_10346217 3300013306 Bacteria 1619
673 Ga0163162_10406872 3300013306 Bacteria 1493
674 Ga0157372_10084507 3300013307 Bacteria 3598
675 Ga0157372_10406546 3300013307 Bacteria 1586
676 Ga0157372_10697135 3300013307 Bacteria 1182
677 Ga0157372_10790523 3300013307 Bacteria 1103
678 Ga0157375_10016636 3300013308 Bacteria 6614
679 Ga0157375_10154676 3300013308 Bacteria 2431
680 Ga0157375_10321273 3300013308 Bacteria 1713
681 Ga0157375_10393677 3300013308 Bacteria 1552
682 Ga0157375_10436765 3300013308 Bacteria 1475
683 Ga0157375_10495273 3300013308 Bacteria 1386
684 Ga0157375_10511765 3300013308 Bacteria 1364
685 Ga0157375_10645681 3300013308 Bacteria 1215
686 Ga0157375_10864557 3300013308 Bacteria 1050
687 Ga0157375_11351618 3300013308 Bacteria 838
688 Ga0163163_10018482 3300014325 Bacteria 6527
689 Ga0163163_10027334 3300014325 Bacteria 5464
690 Ga0163163_10057195 3300014325 Bacteria 3855
691 Ga0163163_10060806 3300014325 Bacteria 3741
692 Ga0163163_10151780 3300014325 Bacteria 2360
693 Ga0163163_10226042 3300014325 Bacteria 1921
694 Ga0163163_10271964 3300014325 Bacteria 1745
695 Ga0163163_10315025 3300014325 Bacteria 1618
696 Ga0163163_10338066 3300014325 Bacteria 1561
697 Ga0163163_10706685 3300014325 Bacteria 1071
698 Ga0163163_11249781 3300014325 Bacteria 805
699 Ga0163163_11264077 3300014325 Bacteria 800
700 Ga0157380_10001355 3300014326 Bacteria 15948
701 Ga0157380_10079002 3300014326 Bacteria 2686
702 Ga0157380_10191129 3300014326 Bacteria 1807
703 Ga0157380_10403622 3300014326 Bacteria 1297
704 Ga0157380_10457826 3300014326 Bacteria 1227
705 Ga0157380_10513809 3300014326 Bacteria 1167
706 Ga0157380_10543899 3300014326 Bacteria 1138
707 Ga0157380_10794103 3300014326 Bacteria 963
708 Ga0182008_10000952 3300014497 Bacteria 20186
709 Ga0182008_10023005 3300014497 Bacteria 3188
710 Ga0182008_10126201 3300014497 Bacteria 1274
711 Ga0157377_10036715 3300014745 Bacteria 2697
712 Ga0157377_10249092 3300014745 Bacteria 1150
713 Ga0157379_10000012 3300014968 Bacteria 110577
714 Ga0157379_10001533 3300014968 Bacteria 19000
715 Ga0157379_10058917 3300014968 Bacteria 3434
716 Ga0157379_10094230 3300014968 Bacteria 2686
717 Ga0157379_10149073 3300014968 Bacteria 2110
718 Ga0157379_10301850 3300014968 Bacteria 1459
719 Ga0157379_10485124 3300014968 Bacteria 1144
720 Ga0157376_10013732 3300014969 Bacteria 6055
721 Ga0157376_10110820 3300014969 Bacteria 2415
722 Ga0157376_10397076 3300014969 Bacteria 1332
723 Ga0157376_10410804 3300014969 Bacteria 1311
724 Ga0157376_10414501 3300014969 Bacteria 1305
725 Ga0157376_10911667 3300014969 Bacteria 897
726 Ga0157376_11423296 3300014969 Bacteria 725
727 Ga0182006_1100755 3300015261 Bacteria 1025
728 Ga0182007_10002121 3300015262 Bacteria 10146
729 Ga0183367_1002 3300015688 Bacteria 1101531
730 Ga0163161_10006328 3300017792 Bacteria 8196
731 Ga0163161_10017744 3300017792 Bacteria 4986
732 Ga0163161_10190979 3300017792 Bacteria 1574
733 Ga0163161_10345891 3300017792 Bacteria 1181
734 Ga0163161_10349007 3300017792 Bacteria 1176
735 Ga0163161_10750049 3300017792 Bacteria 816
736 Ga0197907_10051383 3300020069 Bacteria 2928
737 Ga0197907_10096039 3300020069 Bacteria 3283
738 Ga0197907_10151707 3300020069 Bacteria 1543
739 Ga0197907_10377945 3300020069 Bacteria 8513
740 Ga0197907_10496978 3300020069 Bacteria 923
741 Ga0197907_10522870 3300020069 Bacteria 3409
742 Ga0197907_10690248 3300020069 Bacteria 960
743 Ga0197907_10814250 3300020069 Bacteria 1354
744 Ga0197907_10959006 3300020069 Bacteria 989
745 Ga0197907_11065209 3300020069 Bacteria 3009
746 Ga0197907_11258934 3300020069 Bacteria 1160
747 Ga0197907_11431500 3300020069 Bacteria 4470
748 Ga0206356_10213503 3300020070 Bacteria 2126
749 Ga0206356_10344010 3300020070 Bacteria 3475
750 Ga0206356_10507565 3300020070 Bacteria 1183
751 Ga0206356_10734286 3300020070 Bacteria 2963
752 Ga0206356_10809245 3300020070 Bacteria 2767
753 Ga0206356_11141088 3300020070 Bacteria 4448
754 Ga0206356_11183308 3300020070 Bacteria 997
755 Ga0206356_11184630 3300020070 Bacteria 2769
756 Ga0206356_11369384 3300020070 Bacteria 4017
757 Ga0206349_1007362 3300020075 Bacteria 1565
758 Ga0206349_1010636 3300020075 Bacteria 944
759 Ga0206349_1010653 3300020075 Bacteria 963
760 Ga0206349_1037049 3300020075 Bacteria 2585
761 Ga0206349_1318543 3300020075 Bacteria 1716
762 Ga0206349_1385460 3300020075 Bacteria 1122
763 Ga0206349_1682960 3300020075 Bacteria 1345
764 Ga0206349_1943264 3300020075 Bacteria 1353
765 Ga0206355_1046697 3300020076 Bacteria 1671
766 Ga0206355_1166077 3300020076 Bacteria 6018
767 Ga0206355_1430284 3300020076 Bacteria 1093
768 Ga0206351_10226257 3300020077 Bacteria 822
769 Ga0206351_10493408 3300020077 Bacteria 2005
770 Ga0206351_10722354 3300020077 Bacteria 2541
771 Ga0206351_10781031 3300020077 Bacteria 873
772 Ga0206351_10994928 3300020077 Bacteria 1664
773 Ga0206351_11001805 3300020077 Bacteria 1499
774 Ga0206352_10334314 3300020078 Bacteria 1312
775 Ga0206352_10359880 3300020078 Bacteria 1642
776 Ga0206352_10680298 3300020078 Bacteria 4046
777 Ga0206352_10711453 3300020078 Bacteria 2807
778 Ga0206352_10955583 3300020078 Bacteria 833
779 Ga0206352_11127486 3300020078 Bacteria 1190
780 Ga0206350_10406489 3300020080 Bacteria 2866
781 Ga0206350_10447285 3300020080 Bacteria 1206
782 Ga0206350_10667397 3300020080 Bacteria 4645
783 Ga0206350_11174700 3300020080 Bacteria 1007
784 Ga0206350_11432577 3300020080 Bacteria 1104
785 Ga0206354_10067186 3300020081 Bacteria 2762
786 Ga0206354_10395367 3300020081 Bacteria 3493
787 Ga0206354_10448514 3300020081 Bacteria 3241
788 Ga0206354_10670181 3300020081 Bacteria 2821
789 Ga0206354_11161385 3300020081 Bacteria 2589
790 Ga0206354_11190231 3300020081 Bacteria 1114
791 Ga0206354_11202439 3300020081 Bacteria 2543
792 Ga0206354_11216941 3300020081 Bacteria 1501
793 Ga0206354_11400321 3300020081 Bacteria 1764
794 Ga0206354_11585391 3300020081 Bacteria 1873
795 Ga0206353_10016499 3300020082 Bacteria 4198
796 Ga0206353_10107063 3300020082 Bacteria 2551
797 Ga0206353_10139517 3300020082 Bacteria 2642
798 Ga0206353_10269172 3300020082 Bacteria 1034
799 Ga0206353_10321684 3300020082 Bacteria 1838
800 Ga0206353_10604234 3300020082 Bacteria 2528
801 Ga0206353_10689809 3300020082 Bacteria 3757
802 Ga0206353_11185955 3300020082 Bacteria 2959
803 Ga0206353_12067668 3300020082 Bacteria 2779
804 Ga0154015_1055748 3300020610 Bacteria 954
805 Ga0154015_1410113 3300020610 Bacteria 832
806 Ga0213874_10036508 3300021377 Bacteria 1449
807 Ga0213876_10022127 3300021384 Bacteria 3363
808 Ga0213876_10069358 3300021384 Bacteria 1862
809 Ga0213876_10190129 3300021384 Bacteria 1092
810 Ga0213876_10193026 3300021384 Bacteria 1083
811 Ga0213875_10000107 3300021388 Bacteria 95120
812 Ga0213875_10000362 3300021388 Bacteria 42266
813 Ga0224712_10000575 3300022467 Bacteria 7470
814 Ga0224712_10000839 3300022467 Bacteria 6537
815 Ga0224712_10003451 3300022467 Bacteria 4109
816 Ga0224712_10006462 3300022467 Bacteria 3346
817 Ga0224712_10023353 3300022467 Bacteria 2146
818 Ga0224712_10033221 3300022467 Bacteria 1886
819 Ga0224712_10059899 3300022467 Bacteria 1513
820 Ga0224712_10063897 3300022467 Bacteria 1475
821 Ga0224712_10341098 3300022467 Bacteria 707
822 Ga0256744_115370 3300023309 Bacteria 1454
823 Ga0256743_115533 3300023436 Bacteria 1506
824 Ga0256720_112709 3300023438 Bacteria 1287
825 Ga0256720_136313 3300023438 Bacteria 930
826 Ga0228598_1008522 3300024227 Bacteria 2068
827 Ga0209673_1014659 3300025273 Bacteria 3023
828 Ga0207673_1001237 3300025290 Bacteria 2751
829 Ga0209758_1000870 3300025297 Bacteria 41550
830 Ga0207426_1018313 3300025302 Bacteria 2469
831 Ga0209051_1006603 3300025303 Bacteria 6506
832 Ga0209051_1022538 3300025303 Bacteria 2648
833 Ga0207697_10194829 3300025315 Bacteria 890
834 Ga0207697_10194869 3300025315 Bacteria 890
835 Ga0207656_10021045 3300025321 Bacteria 2600
836 Ga0207656_10067571 3300025321 Bacteria 1582
837 Ga0207656_10111137 3300025321 Bacteria 1266
838 Ga0207655_1002359 3300025728 Bacteria 15416
839 Ga0207655_1072264 3300025728 Bacteria 1277
840 Ga0207713_1011748 3300025735 Bacteria 4732
841 Ga0207713_1012416 3300025735 Bacteria 4558
842 Ga0207713_1025173 3300025735 Bacteria 2755
843 Ga0207653_10013448 3300025885 Bacteria 2563
844 Ga0207653_10014646 3300025885 Bacteria 2461
845 Ga0207682_10009470 3300025893 Bacteria 3844
846 Ga0207682_10015257 3300025893 Bacteria 2991
847 Ga0207682_10074637 3300025893 Bacteria 1442
848 Ga0207692_10000368 3300025898 Bacteria 15470
849 Ga0207692_10008383 3300025898 Bacteria 4274
850 Ga0207692_10010250 3300025898 Bacteria 3942
851 Ga0207692_10084806 3300025898 Bacteria 1703
852 Ga0207692_10104689 3300025898 Bacteria 1560
853 Ga0207692_10153227 3300025898 Bacteria 1322
854 Ga0207642_10035893 3300025899 Bacteria 2122
855 Ga0207642_10049319 3300025899 Bacteria 1892
856 Ga0207642_10205279 3300025899 Bacteria 1091
857 Ga0207642_10286734 3300025899 Bacteria 949
858 Ga0207642_10587518 3300025899 Bacteria 692
859 Ga0207710_10000017 3300025900 Bacteria 370962
860 Ga0207710_10000048 3300025900 Bacteria 189597
861 Ga0207710_10004294 3300025900 Bacteria 6241
862 Ga0207710_10052237 3300025900 Bacteria 1837
863 Ga0207710_10098472 3300025900 Bacteria 1377
864 Ga0207710_10150970 3300025900 Bacteria 1127
865 Ga0207710_10181273 3300025900 Bacteria 1033
866 Ga0207688_10001159 3300025901 Bacteria 13577
867 Ga0207688_10003298 3300025901 Bacteria 8817
868 Ga0207688_10005072 3300025901 Bacteria 7162
869 Ga0207688_10010344 3300025901 Bacteria 5079
870 Ga0207688_10074071 3300025901 Bacteria 1936
871 Ga0207688_10077764 3300025901 Bacteria 1891
872 Ga0207688_10106007 3300025901 Bacteria 1627
873 Ga0207688_10155612 3300025901 Bacteria 1353
874 Ga0207688_10372142 3300025901 Bacteria 883
875 Ga0207688_10454480 3300025901 Bacteria 799
876 Ga0207680_10078450 3300025903 Bacteria 2068
877 Ga0207680_10182435 3300025903 Bacteria 1420
878 Ga0207647_10000925 3300025904 Bacteria 22625
879 Ga0207647_10004157 3300025904 Bacteria 10738
880 Ga0207647_10005792 3300025904 Bacteria 9011
881 Ga0207647_10018449 3300025904 Bacteria 4718
882 Ga0207647_10053520 3300025904 Bacteria 2487
883 Ga0207647_10113967 3300025904 Bacteria 1597
884 Ga0207647_10170673 3300025904 Bacteria 1266
885 Ga0207647_10208841 3300025904 Bacteria 1128
886 Ga0207647_10244095 3300025904 Bacteria 1031
887 Ga0207647_10310694 3300025904 Bacteria 896
888 Ga0207685_10007676 3300025905 Bacteria 3022
889 Ga0207685_10063364 3300025905 Bacteria 1472
890 Ga0207685_10070568 3300025905 Bacteria 1414
891 Ga0207699_10001668 3300025906 Bacteria 10536
892 Ga0207699_10001977 3300025906 Bacteria 9676
893 Ga0207699_10008367 3300025906 Bacteria 5101
894 Ga0207699_10056081 3300025906 Bacteria 2347
895 Ga0207645_10017870 3300025907 Bacteria 4677
896 Ga0207645_10026924 3300025907 Bacteria 3715
897 Ga0207645_10073765 3300025907 Bacteria 2185
898 Ga0207645_10242996 3300025907 Bacteria 1189
899 Ga0207643_10002089 3300025908 Bacteria 11006
900 Ga0207643_10014701 3300025908 Bacteria 4256
901 Ga0207643_10017241 3300025908 Bacteria 3947
902 Ga0207643_10081556 3300025908 Bacteria 1875
903 Ga0207643_10147289 3300025908 Bacteria 1409
904 Ga0207643_10233032 3300025908 Bacteria 1130
905 Ga0207643_10378551 3300025908 Bacteria 892
906 Ga0207705_10019993 3300025909 Bacteria 4788
907 Ga0207705_10042534 3300025909 Bacteria 3262
908 Ga0207705_10082748 3300025909 Bacteria 2341
909 Ga0207705_10159294 3300025909 Bacteria 1695
910 Ga0207705_10421411 3300025909 Bacteria 1033
911 Ga0207684_10001153 3300025910 Bacteria 29491
912 Ga0207684_10015837 3300025910 Bacteria 6482
913 Ga0207684_10016512 3300025910 Bacteria 6339
914 Ga0207684_10177547 3300025910 Bacteria 1836
915 Ga0207684_10247410 3300025910 Bacteria 1538
916 Ga0207684_10347855 3300025910 Bacteria 1276
917 Ga0207654_10001876 3300025911 Bacteria 10890
918 Ga0207654_10050373 3300025911 Bacteria 2393
919 Ga0207654_10159881 3300025911 Bacteria 1454
920 Ga0207654_10246389 3300025911 Bacteria 1196
921 Ga0207707_10008073 3300025912 Bacteria 9140
922 Ga0207707_10025263 3300025912 Bacteria 5196
923 Ga0207707_10492634 3300025912 Bacteria 1046
924 Ga0207695_10000465 3300025913 Bacteria 87928
925 Ga0207695_10157892 3300025913 Bacteria 2202
926 Ga0207695_10195486 3300025913 Bacteria 1939
927 Ga0207695_10200713 3300025913 Bacteria 1909
928 Ga0207695_10224638 3300025913 Bacteria 1784
929 Ga0207695_10529991 3300025913 Bacteria 1059
930 Ga0207671_10000128 3300025914 Bacteria 117836
931 Ga0207671_10058944 3300025914 Bacteria 2847
932 Ga0207671_10176546 3300025914 Bacteria 1661
933 Ga0207671_10393041 3300025914 Bacteria 1102
934 Ga0207671_10468436 3300025914 Bacteria 1004
935 Ga0207693_10001283 3300025915 Bacteria 22327
936 Ga0207693_10011155 3300025915 Bacteria 7277
937 Ga0207693_10125548 3300025915 Bacteria 2017
938 Ga0207693_10205611 3300025915 Bacteria 1548
939 Ga0207693_10479160 3300025915 Bacteria 972
940 Ga0207663_10039430 3300025916 Bacteria 2862
941 Ga0207663_10110103 3300025916 Bacteria 1867
942 Ga0207663_10136946 3300025916 Bacteria 1700
943 Ga0207663_10242765 3300025916 Bacteria 1322
944 Ga0207663_10720108 3300025916 Bacteria 791
945 Ga0207660_10308643 3300025917 Bacteria 1261
946 Ga0207660_10319617 3300025917 Bacteria 1239
947 Ga0207660_10730198 3300025917 Bacteria 808
948 Ga0207662_10002882 3300025918 Bacteria 8712
949 Ga0207662_10041031 3300025918 Bacteria 2724
950 Ga0207662_10058100 3300025918 Bacteria 2314
951 Ga0207662_10106601 3300025918 Bacteria 1743
952 Ga0207662_10200348 3300025918 Bacteria 1292
953 Ga0207662_10237937 3300025918 Bacteria 1191
954 Ga0207657_10001387 3300025919 Bacteria 25846
955 Ga0207657_10099113 3300025919 Bacteria 2421
956 Ga0207657_10128614 3300025919 Bacteria 2078
957 Ga0207657_10139191 3300025919 Bacteria 1984
958 Ga0207657_10176081 3300025919 Bacteria 1731
959 Ga0207657_10181110 3300025919 Bacteria 1703
960 Ga0207657_10221848 3300025919 Bacteria 1514
961 Ga0207649_10005997 3300025920 Bacteria 6595
962 Ga0207649_10083862 3300025920 Bacteria 2070
963 Ga0207649_10637854 3300025920 Bacteria 822
964 Ga0207652_10017304 3300025921 Bacteria 5898
965 Ga0207652_10168310 3300025921 Bacteria 1966
966 Ga0207652_10186674 3300025921 Bacteria 1864
967 Ga0207652_10335708 3300025921 Bacteria 1365
968 Ga0207652_10572884 3300025921 Bacteria 1014
969 Ga0207646_10011004 3300025922 Bacteria 8788
970 Ga0207646_10067508 3300025922 Bacteria 3193
971 Ga0207646_10089945 3300025922 Bacteria 2748
972 Ga0207646_10121009 3300025922 Bacteria 2351
973 Ga0207646_10282633 3300025922 Bacteria 1500
974 Ga0207681_10008840 3300025923 Bacteria 6154
975 Ga0207681_10243631 3300025923 Bacteria 1400
976 Ga0207681_10648432 3300025923 Bacteria 875
977 Ga0207681_10716074 3300025923 Bacteria 833
978 Ga0207694_10000973 3300025924 Bacteria 25165
979 Ga0207694_10038174 3300025924 Bacteria 3692
980 Ga0207694_10180827 3300025924 Bacteria 1710
981 Ga0207694_10296450 3300025924 Bacteria 1331
982 Ga0207694_10826984 3300025924 Bacteria 782
983 Ga0207650_10002981 3300025925 Bacteria 11677
984 Ga0207650_10019237 3300025925 Bacteria 4795
985 Ga0207650_10243059 3300025925 Bacteria 1455
986 Ga0207650_10318575 3300025925 Bacteria 1273
987 Ga0207650_10657203 3300025925 Bacteria 884
988 Ga0207659_10016950 3300025926 Bacteria 4752
989 Ga0207659_10334276 3300025926 Bacteria 1253
990 Ga0207659_10341559 3300025926 Bacteria 1240
991 Ga0207687_10020152 3300025927 Bacteria 4423
992 Ga0207687_10030714 3300025927 Bacteria 3624
993 Ga0207687_10127057 3300025927 Bacteria 1916
994 Ga0207687_10206501 3300025927 Bacteria 1539
995 Ga0207687_10247405 3300025927 Bacteria 1416
996 Ga0207687_10482845 3300025927 Bacteria 1032
997 Ga0207687_10561760 3300025927 Bacteria 958
998 Ga0207687_10617099 3300025927 Bacteria 915
999 Ga0207700_10007511 3300025928 Bacteria 6668
1000 Ga0207700_10010891 3300025928 Bacteria 5771
1001 Ga0207700_10020037 3300025928 Bacteria 4532
1002 Ga0207700_10027951 3300025928 Bacteria 3957
1003 Ga0207700_10032349 3300025928 Bacteria 3730
1004 Ga0207700_10107939 3300025928 Bacteria 2234
1005 Ga0207700_10119021 3300025928 Bacteria 2138
1006 Ga0207700_10987072 3300025928 Bacteria 754
1007 Ga0207664_10001032 3300025929 Bacteria 18646
1008 Ga0207664_10003003 3300025929 Bacteria 11208
1009 Ga0207664_10018232 3300025929 Bacteria 5161
1010 Ga0207664_10031084 3300025929 Bacteria 4082
1011 Ga0207664_10061533 3300025929 Bacteria 2995
1012 Ga0207664_10062615 3300025929 Bacteria 2971
1013 Ga0207664_10073251 3300025929 Bacteria 2764
1014 Ga0207644_10022904 3300025931 Bacteria 4271
1015 Ga0207644_10027365 3300025931 Bacteria 3938
1016 Ga0207644_10268728 3300025931 Bacteria 1366
1017 Ga0207644_10674845 3300025931 Bacteria 861
1018 Ga0207690_10010116 3300025932 Bacteria 5602
1019 Ga0207690_10017412 3300025932 Bacteria 4386
1020 Ga0207690_10240318 3300025932 Bacteria 1394
1021 Ga0207690_10323138 3300025932 Bacteria 1213
1022 Ga0207690_10501275 3300025932 Bacteria 982
1023 Ga0207706_10013582 3300025933 Bacteria 7398
1024 Ga0207706_10021255 3300025933 Bacteria 5830
1025 Ga0207706_10058113 3300025933 Bacteria 3408
1026 Ga0207706_10205280 3300025933 Bacteria 1728
1027 Ga0207706_10219773 3300025933 Bacteria 1664
1028 Ga0207706_10512805 3300025933 Bacteria 1034
1029 Ga0207686_10196757 3300025934 Bacteria 1441
1030 Ga0207686_10593967 3300025934 Bacteria 870
1031 Ga0207709_10007828 3300025935 Bacteria 5924
1032 Ga0207709_10027907 3300025935 Bacteria 3258
1033 Ga0207709_10127337 3300025935 Bacteria 1730
1034 Ga0207709_10156157 3300025935 Bacteria 1586
1035 Ga0207709_10165993 3300025935 Bacteria 1545
1036 Ga0207709_10285460 3300025935 Bacteria 1221
1037 Ga0207670_10189433 3300025936 Bacteria 1556
1038 Ga0207669_10017561 3300025937 Bacteria 3674
1039 Ga0207669_10033811 3300025937 Bacteria 2890
1040 Ga0207669_10131803 3300025937 Bacteria 1719
1041 Ga0207669_10170472 3300025937 Bacteria 1548
1042 Ga0207669_10269103 3300025937 Bacteria 1279
1043 Ga0207669_10851351 3300025937 Bacteria 759
1044 Ga0207704_10068008 3300025938 Bacteria 2244
1045 Ga0207704_10285805 3300025938 Bacteria 1256
1046 Ga0207704_10407679 3300025938 Bacteria 1074
1047 Ga0207704_10450156 3300025938 Bacteria 1027
1048 Ga0207704_10583975 3300025938 Bacteria 912
1049 Ga0207665_10001427 3300025939 Bacteria 16073
1050 Ga0207665_10123833 3300025939 Bacteria 1829
1051 Ga0207665_10144319 3300025939 Bacteria 1700
1052 Ga0207691_10000326 3300025940 Bacteria 47354
1053 Ga0207691_10097345 3300025940 Bacteria 2630
1054 Ga0207691_10097609 3300025940 Bacteria 2626
1055 Ga0207691_10149114 3300025940 Bacteria 2057
1056 Ga0207691_10185045 3300025940 Bacteria 1819
1057 Ga0207691_10651346 3300025940 Bacteria 890
1058 Ga0207691_10651347 3300025940 Bacteria 890
1059 Ga0207711_10000134 3300025941 Bacteria 77843
1060 Ga0207711_10006894 3300025941 Bacteria 9541
1061 Ga0207711_10027090 3300025941 Bacteria 4812
1062 Ga0207711_10032109 3300025941 Bacteria 4439
1063 Ga0207711_10051995 3300025941 Bacteria 3510
1064 Ga0207711_10088481 3300025941 Bacteria 2719
1065 Ga0207711_10335858 3300025941 Bacteria 1398
1066 Ga0207711_10397173 3300025941 Bacteria 1281
1067 Ga0207711_10778025 3300025941 Bacteria 892
1068 Ga0207689_10002936 3300025942 Bacteria 15743
1069 Ga0207689_10010197 3300025942 Bacteria 8097
1070 Ga0207689_10056722 3300025942 Bacteria 3223
1071 Ga0207689_10062110 3300025942 Bacteria 3072
1072 Ga0207689_10124036 3300025942 Bacteria 2125
1073 Ga0207689_10218131 3300025942 Bacteria 1576
1074 Ga0207689_10378253 3300025942 Bacteria 1179
1075 Ga0207689_10402061 3300025942 Bacteria 1142
1076 Ga0207661_10050176 3300025944 Bacteria 3323
1077 Ga0207661_10073110 3300025944 Bacteria 2807
1078 Ga0207661_10267184 3300025944 Bacteria 1525
1079 Ga0207661_10336965 3300025944 Bacteria 1358
1080 Ga0207661_10503674 3300025944 Bacteria 1106
1081 Ga0207661_10546607 3300025944 Bacteria 1061
1082 Ga0207661_10614217 3300025944 Bacteria 998
1083 Ga0207679_10004482 3300025945 Bacteria 8704
1084 Ga0207679_10077561 3300025945 Bacteria 2528
1085 Ga0207679_10211973 3300025945 Bacteria 1625
1086 Ga0207679_10257003 3300025945 Bacteria 1488
1087 Ga0207667_10023995 3300025949 Bacteria 6708
1088 Ga0207667_10025698 3300025949 Bacteria 6442
1089 Ga0207667_10103267 3300025949 Bacteria 2940
1090 Ga0207667_10156170 3300025949 Bacteria 2347
1091 Ga0207667_10199494 3300025949 Bacteria 2053
1092 Ga0207667_10214120 3300025949 Bacteria 1974
1093 Ga0207667_10481619 3300025949 Bacteria 1260
1094 Ga0207667_10665269 3300025949 Bacteria 1046
1095 Ga0207667_10674748 3300025949 Bacteria 1037
1096 Ga0207667_10859391 3300025949 Bacteria 901
1097 Ga0207651_10639328 3300025960 Bacteria 933
1098 Ga0207651_11088257 3300025960 Bacteria 716
1099 Ga0207712_10037052 3300025961 Bacteria 3325
1100 Ga0207712_10136659 3300025961 Bacteria 1876
1101 Ga0207712_10237550 3300025961 Bacteria 1466
1102 Ga0207712_10312308 3300025961 Bacteria 1294
1103 Ga0207712_10695469 3300025961 Bacteria 887
1104 Ga0207712_10720706 3300025961 Bacteria 872
1105 Ga0207668_10024959 3300025972 Bacteria 3864
1106 Ga0207668_10030370 3300025972 Bacteria 3551
1107 Ga0207668_10050587 3300025972 Bacteria 2865
1108 Ga0207668_10092540 3300025972 Bacteria 2225
1109 Ga0207668_10175228 3300025972 Bacteria 1686
1110 Ga0207668_10290029 3300025972 Bacteria 1346
1111 Ga0207640_10091049 3300025981 Bacteria 2112
1112 Ga0207640_10110526 3300025981 Bacteria 1947
1113 Ga0207640_10160075 3300025981 Bacteria 1664
1114 Ga0207640_10166529 3300025981 Bacteria 1637
1115 Ga0207640_10229183 3300025981 Bacteria 1428
1116 Ga0207640_10291816 3300025981 Bacteria 1286
1117 Ga0207640_10321882 3300025981 Bacteria 1231
1118 Ga0207640_10415684 3300025981 Bacteria 1099
1119 Ga0207640_10583017 3300025981 Bacteria 944
1120 Ga0207640_10711425 3300025981 Bacteria 862
1121 Ga0207640_11129403 3300025981 Bacteria 694
1122 Ga0207658_10011697 3300025986 Bacteria 5975
1123 Ga0207658_10046452 3300025986 Bacteria 3171
1124 Ga0207658_10088255 3300025986 Bacteria 2397
1125 Ga0207658_10090832 3300025986 Bacteria 2368
1126 Ga0207658_10104520 3300025986 Bacteria 2226
1127 Ga0207658_10147248 3300025986 Bacteria 1914
1128 Ga0207658_10463025 3300025986 Bacteria 1124
1129 Ga0207658_10738579 3300025986 Bacteria 891
1130 Ga0207658_10782661 3300025986 Bacteria 865
1131 Ga0207677_10012013 3300026023 Bacteria 4960
1132 Ga0207677_10115473 3300026023 Bacteria 2008
1133 Ga0207677_10178204 3300026023 Bacteria 1669
1134 Ga0207677_10601057 3300026023 Bacteria 965
1135 Ga0207703_10000002 3300026035 Bacteria 600711
1136 Ga0207703_10000009 3300026035 Bacteria 343983
1137 Ga0207703_10007970 3300026035 Bacteria 8372
1138 Ga0207703_10086500 3300026035 Bacteria 2626
1139 Ga0207703_10442752 3300026035 Bacteria 1212
1140 Ga0207639_10135234 3300026041 Bacteria 2046
1141 Ga0207639_10147884 3300026041 Bacteria 1965
1142 Ga0207639_10150732 3300026041 Bacteria 1947
1143 Ga0207639_10202696 3300026041 Bacteria 1703
1144 Ga0207639_10275083 3300026041 Bacteria 1479
1145 Ga0207678_10002587 3300026067 Bacteria 16500
1146 Ga0207678_10010370 3300026067 Bacteria 8179
1147 Ga0207678_10038790 3300026067 Bacteria 4137
1148 Ga0207678_10072330 3300026067 Bacteria 2955
1149 Ga0207678_10081649 3300026067 Bacteria 2767
1150 Ga0207678_10093060 3300026067 Bacteria 2576
1151 Ga0207678_10126588 3300026067 Bacteria 2179
1152 Ga0207678_10131398 3300026067 Bacteria 2136
1153 Ga0207678_10134885 3300026067 Bacteria 2106
1154 Ga0207678_10163083 3300026067 Bacteria 1903
1155 Ga0207678_10169743 3300026067 Bacteria 1863
1156 Ga0207678_10216926 3300026067 Bacteria 1637
1157 Ga0207678_10232913 3300026067 Bacteria 1577
1158 Ga0207678_10349412 3300026067 Bacteria 1275
1159 Ga0207678_10960058 3300026067 Bacteria 756
1160 Ga0207708_10057403 3300026075 Bacteria 2970
1161 Ga0207708_10109965 3300026075 Bacteria 2138
1162 Ga0207708_10127381 3300026075 Bacteria 1988
1163 Ga0207708_10219371 3300026075 Bacteria 1523
1164 Ga0207708_10269709 3300026075 Bacteria 1376
1165 Ga0207708_10375250 3300026075 Bacteria 1172
1166 Ga0207708_10666402 3300026075 Bacteria 887
1167 Ga0207702_10003344 3300026078 Bacteria 14708
1168 Ga0207702_10078088 3300026078 Bacteria 2865
1169 Ga0207702_10161734 3300026078 Bacteria 2045
1170 Ga0207702_10193175 3300026078 Bacteria 1882
1171 Ga0207702_10723946 3300026078 Bacteria 981
1172 Ga0207702_10731395 3300026078 Bacteria 976
1173 Ga0207702_10793105 3300026078 Bacteria 936
1174 Ga0207702_10837666 3300026078 Bacteria 910
1175 Ga0207641_10038878 3300026088 Bacteria 3978
1176 Ga0207641_10100925 3300026088 Bacteria 2542
1177 Ga0207641_10118864 3300026088 Bacteria 2355
1178 Ga0207641_10209662 3300026088 Bacteria 1801
1179 Ga0207641_10317233 3300026088 Bacteria 1477
1180 Ga0207641_10426736 3300026088 Bacteria 1277
1181 Ga0207648_10133353 3300026089 Bacteria 2187
1182 Ga0207648_10142931 3300026089 Bacteria 2110
1183 Ga0207648_10193739 3300026089 Bacteria 1802
1184 Ga0207648_10411029 3300026089 Bacteria 1227
1185 Ga0207648_10421373 3300026089 Bacteria 1212
1186 Ga0207676_10003913 3300026095 Bacteria 10514
1187 Ga0207676_10038313 3300026095 Bacteria 3657
1188 Ga0207676_10191106 3300026095 Bacteria 1801
1189 Ga0207676_10888124 3300026095 Bacteria 874
1190 Ga0207674_10006508 3300026116 Bacteria 13736
1191 Ga0207674_10013764 3300026116 Bacteria 8952
1192 Ga0207674_10860768 3300026116 Bacteria 874
1193 Ga0207675_100002673 3300026118 Bacteria 17594
1194 Ga0207675_100010883 3300026118 Bacteria 8521
1195 Ga0207675_100012489 3300026118 Bacteria 7934
1196 Ga0207675_100015081 3300026118 Bacteria 7210
1197 Ga0207675_100023786 3300026118 Bacteria 5700
1198 Ga0207675_100048408 3300026118 Bacteria 3968
1199 Ga0207675_100102158 3300026118 Bacteria 2702
1200 Ga0207675_100155955 3300026118 Bacteria 2176
1201 Ga0207675_100195079 3300026118 Bacteria 1943
1202 Ga0207675_100857371 3300026118 Bacteria 923
1203 Ga0207683_10000991 3300026121 Bacteria 26020
1204 Ga0207683_10002849 3300026121 Bacteria 15092
1205 Ga0207683_10011673 3300026121 Bacteria 7499
1206 Ga0207683_10021270 3300026121 Bacteria 5551
1207 Ga0207683_10039995 3300026121 Bacteria 4090
1208 Ga0207683_10139388 3300026121 Bacteria 2185
1209 Ga0207683_10176704 3300026121 Bacteria 1935
1210 Ga0207683_10669416 3300026121 Bacteria 962
1211 Ga0207683_10936883 3300026121 Bacteria 804
1212 Ga0207698_10005035 3300026142 Bacteria 8104
1213 Ga0207698_10020585 3300026142 Bacteria 4544
1214 Ga0207698_10022546 3300026142 Bacteria 4378
1215 Ga0207698_10047860 3300026142 Bacteria 3243
1216 Ga0207698_10079597 3300026142 Bacteria 2636
1217 Ga0207698_10705229 3300026142 Bacteria 1004
1218 Ga0207698_10823552 3300026142 Bacteria 932
1219 Ga0209969_1015755 3300027360 Bacteria 1106
1220 Ga0209982_1015063 3300027552 Bacteria 1171
1221 Ga0209983_1005042 3300027665 Bacteria 2754
1222 Ga0209813_10003482 3300027866 Bacteria 3689
1223 Ga0209813_10005010 3300027866 Bacteria 3198
1224 Ga0209974_10142334 3300027876 Bacteria 861
1225 Ga0207428_10001294 3300027907 Bacteria 26662
1226 Ga0207428_10001309 3300027907 Bacteria 26510
1227 Ga0207428_10002902 3300027907 Bacteria 16993
1228 Ga0207428_10020975 3300027907 Bacteria 5539
1229 Ga0207428_10217491 3300027907 Bacteria 1433
1230 Ga0268266_10021808 3300028379 Bacteria 5456
1231 Ga0268266_10027754 3300028379 Bacteria 4813
1232 Ga0268266_10029441 3300028379 Bacteria 4668
1233 Ga0268266_10051652 3300028379 Bacteria 3529
1234 Ga0268266_10280327 3300028379 Bacteria 1549
1235 Ga0268266_10476450 3300028379 Bacteria 1189
1236 Ga0268266_10634765 3300028379 Bacteria 1027
1237 Ga0268265_10000156 3300028380 Bacteria 83798
1238 Ga0268265_10162933 3300028380 Bacteria 1897
1239 Ga0268265_10281348 3300028380 Bacteria 1488
1240 Ga0268265_10412326 3300028380 Bacteria 1252
1241 Ga0268265_11232951 3300028380 Bacteria 746
1242 Ga0268264_10013159 3300028381 Bacteria 6805
1243 Ga0268264_10161422 3300028381 Bacteria 2019
1244 Ga0268264_10184268 3300028381 Bacteria 1898
1245 Ga0268264_10306718 3300028381 Bacteria 1496
1246 Ga0268264_10409105 3300028381 Bacteria 1306
1247 Ga0268264_10521697 3300028381 Bacteria 1161
1248 Ga0268264_10956317 3300028381 Bacteria 862
1249 Ga0307517_10001351 3300028786 Bacteria 41147
1250 Ga0307517_10006905 3300028786 Bacteria 16700
1251 Ga0307517_10192888 3300028786 Bacteria 1289
1252 Ga0307515_10079052 3300028794 Bacteria 4315
1253 Ga0307515_10099588 3300028794 Bacteria 3527
1254 Ga0307515_10137744 3300028794 Bacteria 2640
1255 Ga0307515_10297695 3300028794 Bacteria 1302
1256 Ga0307515_10359566 3300028794 Bacteria 1098
1257 Ga0311001_1058775 3300029277 Bacteria 4151
1258 Ga0310981_1080414 3300029285 Bacteria 2344
1259 Ga0268256_1030242 3300030500 Bacteria 1314
1260 Ga0307511_10019247 3300030521 Bacteria 6499
1261 Ga0307511_10117899 3300030521 Bacteria 1656
1262 Ga0307511_10118899 3300030521 Bacteria 1644
1263 Ga0307511_10138936 3300030521 Bacteria 1435
1264 Ga0307512_10093299 3300030522 Bacteria 2083
1265 Ga0307512_10126911 3300030522 Bacteria 1616
1266 Ga0307512_10164278 3300030522 Bacteria 1291
1267 Ga0307512_10241088 3300030522 Bacteria 914
1268 Ga0316177_1097235 3300030731 Bacteria 2529
1269 Ga0316177_1148380 3300030731 Bacteria 7031
1270 Ga0316176_1004520 3300030732 Bacteria 4782
1271 Ga0316176_1064092 3300030732 Bacteria 3034
1272 Ga0316176_1102741 3300030732 Bacteria 1471
1273 Ga0314311_1026731 3300030733 Bacteria 4337
1274 Ga0314311_1038998 3300030733 Bacteria 3937
1275 Ga0314311_1131795 3300030733 Bacteria 765
1276 Ga0316179_1000692 3300030734 Bacteria 2487
1277 Ga0316179_1040113 3300030734 Bacteria 8997
1278 Ga0316178_1069715 3300030735 Bacteria 3277
1279 Ga0316180_1037118 3300030736 Bacteria 2023
1280 Ga0316180_1043591 3300030736 Bacteria 1943
1281 Ga0316183_1079594 3300030742 Bacteria 1011
1282 Ga0316181_1068685 3300030744 Bacteria 1814
1283 Ga0316181_1205657 3300030744 Bacteria 3203
1284 Ga0316181_1291635 3300030744 Bacteria 1468
1285 Ga0316182_1040762 3300030745 Bacteria 1594
1286 Ga0316182_1069248 3300030745 Bacteria 5194
1287 Ga0316182_1133802 3300030745 Bacteria 1603
1288 Ga0265760_10019592 3300031090 Bacteria 1949
1289 Ga0265340_10009045 3300031247 Bacteria 5361
1290 Ga0265327_10000532 3300031251 Bacteria 65543
1291 Ga0265327_10200237 3300031251 Bacteria 905
1292 Ga0307513_10007812 3300031456 Bacteria 13797
1293 Ga0307513_10011746 3300031456 Bacteria 10859
1294 Ga0307513_10083445 3300031456 Bacteria 3286
1295 Ga0307513_10416362 3300031456 Bacteria 1074
1296 Ga0307509_10012707 3300031507 Bacteria 10038
1297 Ga0307509_10123660 3300031507 Bacteria 2559
1298 Ga0307509_10157431 3300031507 Bacteria 2175
1299 Ga0307509_10194507 3300031507 Bacteria 1874
1300 Ga0307509_10259704 3300031507 Bacteria 1513
1301 Ga0307408_100148178 3300031548 Bacteria 1850
1302 Ga0307408_100184856 3300031548 Bacteria 1674
1303 Ga0307408_100819241 3300031548 Bacteria 846
1304 Ga0307508_10005319 3300031616 Bacteria 12269
1305 Ga0307508_10009349 3300031616 Bacteria 9019
1306 Ga0307508_10012942 3300031616 Bacteria 7628
1307 Ga0307508_10017267 3300031616 Bacteria 6560
1308 Ga0307508_10280681 3300031616 Bacteria 1259
1309 Ga0307508_10389274 3300031616 Bacteria 985
1310 Ga0307514_10032857 3300031649 Bacteria 4145
1311 Ga0307514_10107474 3300031649 Bacteria 1987
1312 Ga0316576_10072130 3300031727 Bacteria 2548
1313 Ga0316578_10032305 3300031728 Bacteria 2989
1314 Ga0316578_10055591 3300031728 Bacteria 2323
1315 Ga0307516_10045595 3300031730 Bacteria 4329
1316 Ga0307516_10058968 3300031730 Bacteria 3734
1317 Ga0307516_10103569 3300031730 Bacteria 2659
1318 Ga0307405_10001911 3300031731 Bacteria 8974
1319 Ga0307405_10023768 3300031731 Bacteria 3489
1320 Ga0307405_10309269 3300031731 Bacteria 1202
1321 Ga0307405_10345678 3300031731 Bacteria 1145
1322 Ga0307405_10506853 3300031731 Bacteria 968
1323 Ga0307413_10002827 3300031824 Bacteria 7153
1324 Ga0307413_10259962 3300031824 Bacteria 1293
1325 Ga0307518_10002439 3300031838 Bacteria 13576
1326 Ga0307518_10101086 3300031838 Bacteria 2064
1327 Ga0307518_10324161 3300031838 Bacteria 917
1328 Ga0307410_10003149 3300031852 Bacteria 8200
1329 Ga0307410_10112918 3300031852 Bacteria 1968
1330 Ga0307410_10212852 3300031852 Bacteria 1482
1331 Ga0307410_10251803 3300031852 Bacteria 1373
1332 Ga0307410_10295251 3300031852 Bacteria 1277
1333 Ga0307410_10411566 3300031852 Bacteria 1095
1334 Ga0307410_10639378 3300031852 Bacteria 891
1335 Ga0307406_10000352 3300031901 Bacteria 26840
1336 Ga0307406_10006213 3300031901 Bacteria 6574
1337 Ga0307406_10014144 3300031901 Bacteria 4585
1338 Ga0307407_10140281 3300031903 Bacteria 1558
1339 Ga0307412_10139142 3300031911 Bacteria 1775
1340 Ga0307412_10406771 3300031911 Bacteria 1109
1341 Ga0307412_10703848 3300031911 Bacteria 867
1342 Ga0307409_100018091 3300031995 Bacteria 4722
1343 Ga0307409_100139811 3300031995 Bacteria 2084
1344 Ga0307409_100149650 3300031995 Bacteria 2024
1345 Ga0307409_100257608 3300031995 Bacteria 1599
1346 Ga0307409_100264215 3300031995 Bacteria 1581
1347 Ga0307409_100535232 3300031995 Bacteria 1147
1348 Ga0307409_100659367 3300031995 Bacteria 1041
1349 Ga0307409_100665939 3300031995 Bacteria 1036
1350 Ga0307409_100794658 3300031995 Bacteria 953
1351 Ga0307416_100000084 3300032002 Bacteria 64599
1352 Ga0307416_100006136 3300032002 Bacteria 7488
1353 Ga0307416_100041177 3300032002 Bacteria 3595
1354 Ga0307416_100276779 3300032002 Bacteria 1652
1355 Ga0307416_101464017 3300032002 Bacteria 789
1356 Ga0307411_10001487 3300032005 Bacteria 9627
1357 Ga0307411_10082097 3300032005 Bacteria 2222
1358 Ga0307411_10199858 3300032005 Bacteria 1534
1359 Ga0307411_10391570 3300032005 Bacteria 1146
1360 Ga0307415_100000047 3300032126 Bacteria 51706
1361 Ga0307415_100036814 3300032126 Bacteria 3210
1362 Ga0307415_100039636 3300032126 Bacteria 3115
1363 Ga0307415_100105419 3300032126 Bacteria 2079
1364 Ga0307415_100112967 3300032126 Bacteria 2019
1365 Ga0307415_100142164 3300032126 Bacteria 1835
1366 Ga0307415_100348369 3300032126 Bacteria 1246
1367 Ga0307415_100538245 3300032126 Bacteria 1028
1368 Ga0307415_100551648 3300032126 Bacteria 1017
1369 Ga0307415_100569857 3300032126 Bacteria 1002
1370 Ga0307415_100703403 3300032126 Bacteria 912
1371 Ga0316593_10131219 3300032168 Bacteria 904
1372 Ga0307507_10000482 3300033179 Bacteria 83990
1373 Ga0307507_10024623 3300033179 Bacteria 6552
1374 Ga0307507_10095870 3300033179 Bacteria 2513
1375 Ga0307510_10095977 3300033180 Bacteria 2783
1376 Ga0307510_10103593 3300033180 Bacteria 2622
1377 Ga0307510_10194354 3300033180 Bacteria 1573
1378 Ga0307510_10243770 3300033180 Bacteria 1289
1379 Ga0316596_1000516 3300033541 Bacteria 6612
1380 Ga0316596_1105485 3300033541 Bacteria 763
1381 Ga0373948_0007027 3300034817 Bacteria 1882
1382 Ga0373948_0114100 3300034817 Bacteria 647
1383 Ga0373950_0010823 3300034818 Bacteria 1480
1384 Ga0373958_0050950 3300034819 Bacteria 874
1385 Ga0373938_0004122 3300034957 Bacteria 2408
1386 Ga0373938_0008257 3300034957 Bacteria 1855
1387 Ga0373934_0000328 3300035086 Bacteria 16740
1388 Ga0373934_0110112 3300035086 Bacteria 1116
1389 Ga0373934_0159858 3300035086 Bacteria 924
1390 Ga0373940_0004722 3300035088 Bacteria 2901
1391 Ga0373940_0108640 3300035088 Bacteria 849
1392 Ga0373949_0007524 3300035090 Bacteria 2385
1393 Ga0373949_0034117 3300035090 Bacteria 1225
1394 Ga0373951_0105975 3300035091 Bacteria 752
1395 Ga0373923_0047870 3300035111 Bacteria 1783
1396 Ga0373923_0066649 3300035111 Bacteria 1539
1397 Ga0373932_0037427 3300035112 Bacteria 1382
1398 Ga0373932_0039400 3300035112 Bacteria 1355
1399 Ga0373939_0004760 3300035114 Bacteria 3218
1400 Ga0373941_0059537 3300035115 Bacteria 1239
1401 Ga0373945_0278168 3300035116 Bacteria 713
1402 Ga0373953_0000262 3300035117 Bacteria 14315
1403 Ga0373954_0045610 3300035118 Bacteria 2048
1404 Ga0373956_0002418 3300035119 Bacteria 7619
1405 Ga0373956_0038265 3300035119 Bacteria 2122
1406 Ga0373957_0000312 3300035120 Bacteria 12205
1407 Ga0373960_0018896 3300035121 Bacteria 1803
1408 Ga0373960_0050109 3300035121 Bacteria 1236
1409 Ga0373960_0086994 3300035121 Bacteria 994
1410 Ga0373955_0000233 3300035172 Bacteria 23155
1411 Ga0373942_0004243 3300035207 Bacteria 3338
1412 Ga0373942_0032129 3300035207 Bacteria 1392
1413 Ga0373961_0021468 3300035241 Bacteria 1717
1414 Ga0373961_0123660 3300035241 Bacteria 860
1415 Ga0373962_0037463 3300035242 Bacteria 1354
1416 Ga0373962_0112036 3300035242 Bacteria 862
1417 Ga0316574_0018440 3300035398 Bacteria 4101
1418 Ga0373924_0005559 3300035410 Bacteria 4469
1419 Ga0373931_0004691 3300035691 Bacteria 6257
1420 Ga0373931_0007826 3300035691 Bacteria 5049
1421 Ga0373931_0109270 3300035691 Bacteria 1566
1422 Ga0373931_0151151 3300035691 Bacteria 1353
1423 Ga0373935_0503624 3300035692 Bacteria 879
1424 Ga0373927_0100065 3300035695 Bacteria 1885
1425 Ga0373927_0145046 3300035695 Bacteria 1554
1426 Ga0373933_0000843 3300035724 Bacteria 18752
1427 Ga0373933_0032699 3300035724 Bacteria 3024
1428 Ga0373933_0087364 3300035724 Bacteria 1920
1429 Ga0373947_0331631 3300035725 Bacteria 1019
1430 Ga0373937_0000112 3300036401 Bacteria 77473
1431 Ga0373937_0036357 3300036401 Bacteria 4487
1432 Ga0373937_0116633 3300036401 Bacteria 2486
1433 Ga0373937_0204282 3300036401 Bacteria 1858
1434 Ga0265778_000068 3300036457 Bacteria 6140
1435 Ga0316584_0055007 3300036712 Bacteria 2980
1436 Ga0373925_0000004 3300037068 Bacteria 361597
1437 Ga0373925_0338300 3300037068 Bacteria 1220
1438 Ga0395899_0004964 3300037312 Bacteria 10353
1439 Ga0395899_0018848 3300037312 Bacteria 5244
1440 Ga0395899_0054104 3300037312 Bacteria 2971
1441 Ga0395900_0018872 3300037418 Bacteria 7034
1442 Ga0395900_0076472 3300037418 Bacteria 3440
1443 Ga0395900_0106616 3300037418 Bacteria 2878
1444 Ga0395900_0229441 3300037418 Bacteria 1868
1445 Ga0395900_0310097 3300037418 Bacteria 1561
1446 Ga0395900_0336318 3300037418 Bacteria 1486
1447 Ga0395900_0789934 3300037418 Bacteria 878
1448 Ga0395898_0012144 3300037466 Bacteria 8913
1449 Ga0395898_0025458 3300037466 Bacteria 5962
1450 Ga0395898_0094766 3300037466 Bacteria 2869
1451 Ga0395898_0122620 3300037466 Bacteria 2490
1452 Ga0395898_0235392 3300037466 Bacteria 1746
1453 Ga0395905_0132322 3300037471 Bacteria 2346
1454 Ga0395905_0449947 3300037471 Bacteria 1186
1455 Ga0436364_0470736 3300037853 Bacteria 17643
1456 Ga0436364_0474963 3300037853 Bacteria 866
1457 Ga0436364_0609479 3300037853 Bacteria 47114
1458 Ga0436364_0804097 3300037853 Bacteria 39998
1459 Ga0436364_1367120 3300037853 Bacteria 3054
1460 Ga0395901_0027464 3300038443 Bacteria 5848
1461 Ga0395901_0125759 3300038443 Bacteria 2694
1462 Ga0395901_0183265 3300038443 Bacteria 2196
1463 Ga0395901_0738808 3300038443 Bacteria 978
1464 Ga0395901_0743827 3300038443 Bacteria 974
1465 Ga0436365_0074439 3300039437 Bacteria 1042
1466 Ga0436365_0224613 3300039437 Bacteria 2825
1467 Ga0436365_0762988 3300039437 Bacteria 12609
1468 Ga0436365_0787829 3300039437 Bacteria 7314
1469 Ga0436365_0905729 3300039437 Bacteria 13103
1470 Ga0436365_1181494 3300039437 Bacteria 917
1471 Ga0436365_1257400 3300039437 Bacteria 59519
1472 Ga0436365_1715394 3300039437 Bacteria 1456
1473 Ga0436363_0618637 3300039450 Bacteria 1794
1474 Ga0436363_0661252 3300039450 Bacteria 1873
1475 Ga0436363_0708393 3300039450 Bacteria 1172
1476 Ga0436363_0811671 3300039450 Bacteria 846
1477 Ga0436363_0979981 3300039450 Bacteria 952
1478 Ga0436362_0281281 3300039453 Bacteria 1619
1479 Ga0436362_0326418 3300039453 Bacteria 977
1480 Ga0436362_1138695 3300039453 Bacteria 75889
1481 Ga0439436_0004725 3300041404 Bacteria 4177
1482 Ga0439436_0015752 3300041404 Bacteria 2271
1483 Ga0439436_0068143 3300041404 Bacteria 992
1484 Ga0439438_017344 3300041405 Bacteria 2074
1485 Ga0439439_0007353 3300041406 Bacteria 2574
1486 Ga0439447_041516 3300041407 Bacteria 1119
1487 Ga0439453_0055657 3300041408 Bacteria 808
1488 Ga0439461_0011703 3300041410 Bacteria 1632
1489 Ga0439466_0001181 3300041411 Bacteria 10165
1490 Ga0439465_0006627 3300041413 Bacteria 3678
1491 Ga0439465_0048230 3300041413 Bacteria 1389
1492 Ga0451789_1121233 3300041443 Bacteria 823
1493 Ga0451790_41903 3300041444 Bacteria 883
1494 Ga0451794_50430 3300041446 Bacteria 1024
1495 Ga0451791_0096474 3300041451 Bacteria 1421
1496 Ga0451793_0048964 3300041452 Bacteria 1727
1497 Ga0451793_0413264 3300041452 Bacteria 3323
1498 Ga0451793_1640064 3300041452 Bacteria 1146
1499 Ga0451797_0614536 3300041453 Bacteria 3726
1500 Ga0451801_15629 3300041455 Bacteria 1451
1501 Ga0451795_0239065 3300041456 Bacteria 1315
1502 Ga0451795_0842912 3300041456 Bacteria 3027
1503 Ga0451798_0003194 3300041458 Bacteria 882
1504 Ga0451800_0561091 3300041459 Bacteria 888
1505 Ga0451802_0247022 3300041460 Bacteria 1105
1506 Ga0451802_1165056 3300041460 Bacteria 1191
1507 Ga0451802_2154649 3300041460 Bacteria 1034
1508 Ga0451807_0377824 3300041486 Bacteria 1418
1509 Ga0451807_1162599 3300041486 Bacteria 967
1510 Ga0451833_0136736 3300041491 Bacteria 823
1511 Ga0451833_1103000 3300041491 Bacteria 2584
1512 Ga0451837_0481824 3300041494 Bacteria 1316
1513 Ga0451837_0699446 3300041494 Bacteria 1480
1514 Ga0451841_0835936 3300041498 Bacteria 1534
1515 Ga0451841_1059095 3300041498 Bacteria 1403
1516 Ga0451849_0755223 3300041505 Bacteria 1307
1517 Ga0451843_0180999 3300041509 Bacteria 1090
1518 Ga0451853_0729236 3300041512 Bacteria 5080
1519 Ga0451853_1425213 3300041512 Bacteria 1020
1520 Ga0451853_1816701 3300041512 Bacteria 873
1521 Ga0451853_2864266 3300041512 Bacteria 944
1522 Ga0451853_3525354 3300041512 Bacteria 2117
1523 Ga0439433_0006437 3300041999 Bacteria 2527
1524 Ga0439433_0011845 3300041999 Bacteria 1911
1525 Ga0439442_000004 3300042002 Bacteria 67479
1526 Ga0439442_018239 3300042002 Bacteria 1451
1527 Ga0439445_0030194 3300042004 Bacteria 1403
1528 Ga0439448_0003887 3300042005 Bacteria 4182
1529 Ga0439448_0014986 3300042005 Bacteria 2344
1530 Ga0439432_018318 3300042006 Bacteria 2341
1531 Ga0439432_087024 3300042006 Bacteria 942
1532 Ga0439449_0003103 3300042007 Bacteria 6473
1533 Ga0439449_0008439 3300042007 Bacteria 3915
1534 Ga0439449_0048241 3300042007 Bacteria 1576
1535 Ga0439449_0169832 3300042007 Bacteria 814
1536 Ga0439450_096246 3300042008 Bacteria 748
1537 Ga0439455_0000823 3300042012 Bacteria 4733
1538 Ga0439455_0006660 3300042012 Bacteria 2409
1539 Ga0439457_002690 3300042014 Bacteria 5005
1540 Ga0439457_004298 3300042014 Bacteria 3742
1541 Ga0439462_0016881 3300042015 Bacteria 1889
1542 Ga0439463_013023 3300042016 Bacteria 2045
1543 Ga0450920_011218 3300042122 Bacteria 1668
1544 Ga0450890_007427 3300042127 Bacteria 1399
1545 Ga0450894_000196 3300042131 Bacteria 10933
1546 Ga0450896_003193 3300042133 Bacteria 2166
1547 Ga0450898_000044 3300042134 Bacteria 10199
1548 Ga0450898_022018 3300042134 Bacteria 1126
1549 Ga0450899_002807 3300042135 Bacteria 1883
1550 Ga0450903_000355 3300042138 Bacteria 10081
1551 Ga0450903_019304 3300042138 Bacteria 1057
1552 Ga0450905_010613 3300042142 Bacteria 1278
1553 Ga0450906_004201 3300042145 Bacteria 3037
1554 Ga0450907_000821 3300042146 Bacteria 7645
1555 Ga0450910_001322 3300042147 Bacteria 3103
1556 Ga0439458_0007633 3300042157 Bacteria 2409
1557 Ga0450908_015720 3300042184 Bacteria 1354
1558 Ga0450908_026050 3300042184 Bacteria 1020
1559 Ga0450909_004209 3300042185 Bacteria 2051
1560 Ga0439434_0008220 3300042435 Bacteria 3059
1561 Ga0439434_0027079 3300042435 Bacteria 1732
1562 Ga0439459_0011964 3300042438 Bacteria 1537
1563 Ga0439459_0045128 3300042438 Bacteria 950
1564 Ga0439464_0007832 3300042439 Bacteria 2794
1565 Ga0439464_0017007 3300042439 Bacteria 1969
1566 Ga0439464_0042735 3300042439 Bacteria 1295
1567 Ga0450918_002600 3300042531 Bacteria 3413
1568 Ga0450918_026208 3300042531 Bacteria 1023
1569 Ga0450901_004049 3300042533 Bacteria 1520
1570 Ga0451577_0967719 3300042876 Bacteria 765
1571 Ga0439440_0014409 3300042993 Bacteria 1707
1572 Ga0439440_0023604 3300042993 Bacteria 1404
1573 Ga0466969_0009929 3300044656 Bacteria 5046
1574 Ga0466969_0018916 3300044656 Bacteria 3586
1575 Ga0466969_0044552 3300044656 Bacteria 2206
1576 Ga0466969_0061937 3300044656 Bacteria 1816
1577 Ga0466969_0101895 3300044656 Bacteria 1350
1578 Ga0466972_0003814 3300044658 Bacteria 7496
1579 Ga0466972_0006214 3300044658 Bacteria 6000
1580 Ga0466972_0029212 3300044658 Bacteria 2714
1581 Ga0466972_0125368 3300044658 Bacteria 1210
1582 Ga0466972_0185212 3300044658 Bacteria 976
1583 Ga0466965_0065280 3300044683 Bacteria 1823
1584 Ga0466965_0112195 3300044683 Bacteria 1402
1585 Ga0466966_0003375 3300044684 Bacteria 10524
1586 Ga0466966_0038019 3300044684 Bacteria 3102
1587 Ga0466966_0043302 3300044684 Bacteria 2886
1588 Ga0466966_0067853 3300044684 Bacteria 2239
1589 Ga0466966_0103302 3300044684 Bacteria 1761
1590 Ga0466966_0115768 3300044684 Bacteria 1650
1591 Ga0466966_0194559 3300044684 Bacteria 1228
1592 Ga0466966_0222754 3300044684 Bacteria 1138
1593 Ga0466966_0238494 3300044684 Bacteria 1096
1594 Ga0466966_0238565 3300044684 Bacteria 1096
1595 Ga0466961_0018714 3300044693 Bacteria 4456
1596 Ga0466961_0023040 3300044693 Bacteria 4005
1597 Ga0466961_0030780 3300044693 Bacteria 3448
1598 Ga0466961_0035151 3300044693 Bacteria 3217
1599 Ga0466961_0037140 3300044693 Bacteria 3125
1600 Ga0466961_0063622 3300044693 Bacteria 2344
1601 Ga0466961_0084014 3300044693 Bacteria 2013
1602 Ga0466961_0092886 3300044693 Bacteria 1904
1603 Ga0466961_0123407 3300044693 Bacteria 1625
1604 Ga0466961_0138192 3300044693 Bacteria 1526
1605 Ga0466961_0147922 3300044693 Bacteria 1468
1606 Ga0466961_0155704 3300044693 Bacteria 1425
1607 Ga0466961_0181410 3300044693 Bacteria 1307
1608 Ga0466961_0210769 3300044693 Bacteria 1199
1609 Ga0466961_0212306 3300044693 Bacteria 1194
1610 Ga0466961_0218045 3300044693 Bacteria 1176
1611 Ga0466961_0268434 3300044693 Bacteria 1046
1612 Ga0466961_0354713 3300044693 Bacteria 892
1613 Ga0466961_0362335 3300044693 Bacteria 882
1614 Ga0466963_0009270 3300044694 Bacteria 5926
1615 Ga0466963_0010998 3300044694 Bacteria 5502
1616 Ga0466963_0012628 3300044694 Bacteria 5173
1617 Ga0466963_0017131 3300044694 Bacteria 4513
1618 Ga0466963_0040644 3300044694 Bacteria 3048
1619 Ga0466963_0041725 3300044694 Bacteria 3010
1620 Ga0466963_0043465 3300044694 Bacteria 2954
1621 Ga0466963_0049392 3300044694 Bacteria 2782
1622 Ga0466963_0093278 3300044694 Bacteria 2052
1623 Ga0466963_0097213 3300044694 Bacteria 2012
1624 Ga0466963_0097246 3300044694 Bacteria 2011
1625 Ga0466963_0114788 3300044694 Bacteria 1850
1626 Ga0466963_0125511 3300044694 Bacteria 1769
1627 Ga0466963_0209048 3300044694 Bacteria 1365
1628 Ga0466963_0228210 3300044694 Bacteria 1304
1629 Ga0466963_0232190 3300044694 Bacteria 1293
1630 Ga0466963_0291090 3300044694 Bacteria 1148
1631 Ga0466963_0332757 3300044694 Bacteria 1069
1632 Ga0466963_0426390 3300044694 Bacteria 935
1633 Ga0466963_0439253 3300044694 Bacteria 920
1634 Ga0466963_0482234 3300044694 Bacteria 875
1635 Ga0466963_0746139 3300044694 Bacteria 691
1636 Ga0466964_0006370 3300044706 Bacteria 4399
1637 Ga0466964_0045118 3300044706 Bacteria 1793
1638 Ga0466964_0061966 3300044706 Bacteria 1559
1639 Ga0466964_0067476 3300044706 Bacteria 1504
1640 Ga0466971_0000675 3300044719 Bacteria 13616
1641 Ga0466971_0001406 3300044719 Bacteria 10109
1642 Ga0466971_0003002 3300044719 Bacteria 7171
1643 Ga0466971_0020494 3300044719 Bacteria 2939
1644 Ga0466971_0027320 3300044719 Bacteria 2556
1645 Ga0466971_0053662 3300044719 Bacteria 1816
1646 Ga0466971_0132108 3300044719 Bacteria 1159
1647 Ga0466971_0157034 3300044719 Bacteria 1063
1648 Ga0466971_0162144 3300044719 Bacteria 1047
1649 Ga0466968_0000486 3300044735 Bacteria 13428
1650 Ga0466968_0004861 3300044735 Bacteria 5030
1651 Ga0466968_0020505 3300044735 Bacteria 2669
1652 Ga0466968_0042015 3300044735 Bacteria 1932
1653 Ga0466968_0051338 3300044735 Bacteria 1762
1654 Ga0466968_0054416 3300044735 Bacteria 1716
1655 Ga0466968_0070302 3300044735 Bacteria 1523
1656 Ga0466968_0130897 3300044735 Bacteria 1141
1657 Ga0466970_0002971 3300044765 Bacteria 8218
1658 Ga0466970_0012873 3300044765 Bacteria 4283
1659 Ga0466970_0015365 3300044765 Bacteria 3935
1660 Ga0466970_0016993 3300044765 Bacteria 3756
1661 Ga0466970_0116012 3300044765 Bacteria 1464
1662 Ga0466970_0356700 3300044765 Bacteria 830
1663 Ga0466957_0014920 3300044842 Bacteria 4532
1664 Ga0466957_0015313 3300044842 Bacteria 4480
1665 Ga0466957_0017768 3300044842 Bacteria 4172
1666 Ga0466957_0032742 3300044842 Bacteria 3114
1667 Ga0466957_0119110 3300044842 Bacteria 1681
1668 Ga0466957_0120742 3300044842 Bacteria 1670
1669 Ga0466957_0212559 3300044842 Bacteria 1274
1670 Ga0466957_0323835 3300044842 Bacteria 1040
1671 Ga0466957_0402621 3300044842 Bacteria 936
1672 Ga0466957_0514271 3300044842 Bacteria 831
1673 Ga0466957_0515119 3300044842 Bacteria 831
1674 Ga0466957_0717613 3300044842 Bacteria 706
1675 Ga0466957_0786198 3300044842 Bacteria 675
1676 Ga0466960_0000533 3300044901 Bacteria 13018
1677 Ga0466960_0005846 3300044901 Bacteria 4903
1678 Ga0466960_0026884 3300044901 Bacteria 2618
1679 Ga0466960_0130626 3300044901 Bacteria 1325
1680 Ga0466960_0172686 3300044901 Bacteria 1167
1681 Ga0466960_0208060 3300044901 Bacteria 1071
1682 Ga0466960_0283163 3300044901 Bacteria 930
1683 Ga0466960_0296161 3300044901 Bacteria 910
1684 Ga0466960_0387824 3300044901 Bacteria 802
1685 Ga0466959_0003800 3300045049 Bacteria 10015
1686 Ga0466959_0020923 3300045049 Bacteria 4822
1687 Ga0466959_0025593 3300045049 Bacteria 4375
1688 Ga0466959_0041912 3300045049 Bacteria 3378
1689 Ga0466959_0044806 3300045049 Bacteria 3258
1690 Ga0466959_0057387 3300045049 Bacteria 2838
1691 Ga0466959_0068627 3300045049 Bacteria 2569
1692 Ga0466959_0098070 3300045049 Bacteria 2099
1693 Ga0466959_0102683 3300045049 Bacteria 2046
1694 Ga0466959_0162707 3300045049 Bacteria 1568
1695 Ga0466959_0163205 3300045049 Bacteria 1565
1696 Ga0466959_0185320 3300045049 Bacteria 1454
1697 Ga0466959_0308355 3300045049 Bacteria 1083
1698 Ga0466959_0326745 3300045049 Bacteria 1048
1699 Ga0466959_0337545 3300045049 Bacteria 1028
1700 Ga0466959_0343267 3300045049 Bacteria 1018
1701 Ga0466959_0396040 3300045049 Bacteria 939
1702 Ga0466959_0450549 3300045049 Bacteria 872
1703 Ga0466959_0474361 3300045049 Bacteria 847
1704 Ga0466958_0000204 3300045836 Bacteria 22007
1705 Ga0466958_0004872 3300045836 Bacteria 7143
1706 Ga0466958_0011830 3300045836 Bacteria 4927
1707 Ga0466958_0015043 3300045836 Bacteria 4426
1708 Ga0466958_0018021 3300045836 Bacteria 4092
1709 Ga0466958_0026511 3300045836 Bacteria 3425
1710 Ga0466958_0035221 3300045836 Bacteria 2990
1711 Ga0466958_0069625 3300045836 Bacteria 2151
1712 Ga0466958_0081408 3300045836 Bacteria 1992
1713 Ga0466958_0121639 3300045836 Bacteria 1634
1714 Ga0466958_0182580 3300045836 Bacteria 1331
1715 Ga0466958_0197048 3300045836 Bacteria 1281
1716 Ga0466958_0237978 3300045836 Bacteria 1163
1717 Ga0466958_0240100 3300045836 Bacteria 1158
1718 Ga0466958_0283433 3300045836 Bacteria 1062
1719 Ga0466958_0309994 3300045836 Bacteria 1014
1720 Ga0466958_0346853 3300045836 Bacteria 955
1721 Ga0466958_0407627 3300045836 Bacteria 878
1722 Ga0466958_0546691 3300045836 Bacteria 752
1723 Ga0466967_0005067 3300045976 Bacteria 9039
1724 Ga0466967_0011609 3300045976 Bacteria 6686
1725 Ga0466967_0011706 3300045976 Bacteria 6666
1726 Ga0466967_0025348 3300045976 Bacteria 4888
1727 Ga0466967_0039654 3300045976 Bacteria 4051
1728 Ga0466967_0044923 3300045976 Bacteria 3836
1729 Ga0466967_0047957 3300045976 Bacteria 3727
1730 Ga0466967_0058209 3300045976 Bacteria 3415
1731 Ga0466967_0064424 3300045976 Bacteria 3259
1732 Ga0466967_0090058 3300045976 Bacteria 2786
1733 Ga0466967_0118248 3300045976 Bacteria 2444
1734 Ga0466967_0135707 3300045976 Bacteria 2288
1735 Ga0466967_0142020 3300045976 Bacteria 2237
1736 Ga0466967_0200257 3300045976 Bacteria 1891
1737 Ga0466967_0250085 3300045976 Bacteria 1693
1738 Ga0466967_0263732 3300045976 Bacteria 1649
1739 Ga0466967_0278076 3300045976 Bacteria 1605
1740 Ga0466967_0363107 3300045976 Bacteria 1403
1741 Ga0466967_0405487 3300045976 Bacteria 1327
1742 Ga0466967_0419223 3300045976 Bacteria 1304
1743 Ga0466967_0697792 3300045976 Bacteria 1005
1744 Ga0466967_0734276 3300045976 Bacteria 979
1745 Ga0466967_0780457 3300045976 Bacteria 948
1746 Ga0466967_0817516 3300045976 Bacteria 925
1747 Ga0466967_0939400 3300045976 Bacteria 860
1748 Ga0466967_0985048 3300045976 Bacteria 839
1749 Ga0466967_1098759 3300045976 Bacteria 792
1750 Ga0466967_1253568 3300045976 Bacteria 738
1751 Ga0495617_031958 3300046452 Bacteria 1766
1752 Ga0495627_027002 3300046453 Bacteria 1846
1753 Ga0495627_043061 3300046453 Bacteria 1381
1754 Ga0495592_0001722 3300046454 Bacteria 15384
1755 Ga0495592_0005017 3300046454 Bacteria 9736
1756 Ga0495592_0007064 3300046454 Bacteria 8400
1757 Ga0495592_0008230 3300046454 Bacteria 7828
1758 Ga0495592_0021133 3300046454 Bacteria 4949
1759 Ga0495592_0033327 3300046454 Bacteria 3885
1760 Ga0495592_0064138 3300046454 Bacteria 2693
1761 Ga0495603_0027551 3300046455 Bacteria 3428
1762 Ga0495603_0043327 3300046455 Bacteria 2687
1763 Ga0495603_0133824 3300046455 Bacteria 1443
1764 Ga0495603_0154560 3300046455 Bacteria 1332
1765 Ga0495590_0024492 3300046457 Bacteria 2126
1766 Ga0495629_0007927 3300046459 Bacteria 7813
1767 Ga0495629_0043246 3300046459 Bacteria 3163
1768 Ga0495629_0060688 3300046459 Bacteria 2642
1769 Ga0495629_0062953 3300046459 Bacteria 2590
1770 Ga0495629_0087459 3300046459 Bacteria 2174
1771 Ga0495629_0099847 3300046459 Bacteria 2025
1772 Ga0495629_0270770 3300046459 Bacteria 1166
1773 Ga0495629_0400215 3300046459 Bacteria 933
1774 Ga0495638_0145415 3300046460 Bacteria 1379
1775 Ga0495641_0068505 3300046461 Bacteria 1595
1776 Ga0495641_0268005 3300046461 Bacteria 768
1777 Ga0495651_0000041 3300046462 Bacteria 94160
1778 Ga0495651_0000169 3300046462 Bacteria 48128
1779 Ga0495651_0001372 3300046462 Bacteria 18867
1780 Ga0495651_0006987 3300046462 Bacteria 8630
1781 Ga0495651_0015125 3300046462 Bacteria 5963
1782 Ga0495651_0179799 3300046462 Bacteria 1498
1783 Ga0495651_0328104 3300046462 Bacteria 1018
1784 Ga0495653_0015129 3300046463 Bacteria 6289
1785 Ga0495653_0018211 3300046463 Bacteria 5707
1786 Ga0495653_0150824 3300046463 Bacteria 1624
1787 Ga0495653_0164354 3300046463 Bacteria 1538
1788 Ga0495653_0181996 3300046463 Bacteria 1441
1789 Ga0495580_0007502 3300046472 Bacteria 8764
1790 Ga0495580_0113683 3300046472 Bacteria 1880
1791 Ga0495582_0065122 3300046473 Bacteria 2013
1792 Ga0495582_0068049 3300046473 Bacteria 1968
1793 Ga0495582_0163862 3300046473 Bacteria 1265
1794 Ga0495582_0469496 3300046473 Bacteria 727
1795 Ga0495605_0021615 3300046474 Bacteria 3404
1796 Ga0495639_0050900 3300046475 Bacteria 1882
1797 Ga0495639_0325291 3300046475 Bacteria 769
1798 Ga0495662_0000096 3300046476 Bacteria 32069
1799 Ga0495662_0005219 3300046476 Bacteria 6511
1800 Ga0495662_0080379 3300046476 Bacteria 1585
1801 Ga0495662_0243369 3300046476 Bacteria 886
1802 Ga0495662_0297871 3300046476 Bacteria 793
1803 Ga0495662_0437943 3300046476 Bacteria 641
1804 Ga0495664_0005941 3300046477 Bacteria 6723
1805 Ga0495664_0030225 3300046477 Bacteria 3172
1806 Ga0495664_0065989 3300046477 Bacteria 2158
1807 Ga0495664_0185632 3300046477 Bacteria 1260
1808 Ga0495584_0028493 3300046491 Bacteria 2830
1809 Ga0495584_0159834 3300046491 Bacteria 1145
1810 Ga0495585_0025882 3300046492 Bacteria 3356
1811 Ga0495585_0059280 3300046492 Bacteria 2109
1812 Ga0495585_0150762 3300046492 Bacteria 1212
1813 Ga0495594_0190608 3300046499 Bacteria 1168
1814 Ga0495594_0212702 3300046499 Bacteria 1102
1815 Ga0495594_0242758 3300046499 Bacteria 1026
1816 Ga0495596_0003837 3300046500 Bacteria 7470
1817 Ga0495596_0067232 3300046500 Bacteria 1393
1818 Ga0495607_0004843 3300046501 Bacteria 9815
1819 Ga0495583_0037058 3300046506 Bacteria 2314
1820 Ga0495606_0069504 3300046507 Bacteria 2223
1821 Ga0495606_0122870 3300046507 Bacteria 1552
1822 Ga0495608_0001767 3300046511 Bacteria 15433
1823 Ga0495608_0002713 3300046511 Bacteria 12721
1824 Ga0495608_0099513 3300046511 Bacteria 1875
1825 Ga0495608_0172425 3300046511 Bacteria 1371
1826 Ga0495608_0233804 3300046511 Bacteria 1150
1827 Ga0495610_0034413 3300046512 Bacteria 2610
1828 Ga0495616_0009267 3300046513 Bacteria 5769
1829 Ga0495616_0050266 3300046513 Bacteria 2086
1830 Ga0495618_0264843 3300046514 Bacteria 1075
1831 Ga0495618_0353657 3300046514 Bacteria 905
1832 Ga0495618_0364016 3300046514 Bacteria 889
1833 Ga0495620_0093171 3300046515 Bacteria 1207
1834 Ga0495628_0002207 3300046516 Bacteria 17611
1835 Ga0495628_0003221 3300046516 Bacteria 14640
1836 Ga0495628_0031279 3300046516 Bacteria 4305
1837 Ga0495628_0040486 3300046516 Bacteria 3723
1838 Ga0495628_0062544 3300046516 Bacteria 2917
1839 Ga0495628_0120589 3300046516 Bacteria 2012
1840 Ga0495630_0002424 3300046517 Bacteria 12922
1841 Ga0495630_0065814 3300046517 Bacteria 2723
1842 Ga0495630_0114932 3300046517 Bacteria 2039
1843 Ga0495630_0134818 3300046517 Bacteria 1876
1844 Ga0495630_0214642 3300046517 Bacteria 1469
1845 Ga0495630_0242669 3300046517 Bacteria 1376
1846 Ga0495630_0402069 3300046517 Bacteria 1049
1847 Ga0495631_0023341 3300046518 Bacteria 2868
1848 Ga0495631_0092119 3300046518 Bacteria 1305
1849 Ga0495631_0096765 3300046518 Bacteria 1271
1850 Ga0495631_0117831 3300046518 Bacteria 1142
1851 Ga0495632_0010084 3300046519 Bacteria 5626
1852 Ga0495637_0023605 3300046520 Bacteria 2792
1853 Ga0495643_0001180 3300046522 Bacteria 25444
1854 Ga0495643_0018269 3300046522 Bacteria 4079
1855 Ga0495643_0183384 3300046522 Bacteria 1015
1856 Ga0495644_0057122 3300046523 Bacteria 1466
1857 Ga0495644_0094966 3300046523 Bacteria 1126
1858 Ga0495644_0153193 3300046523 Bacteria 883
1859 Ga0495648_0119316 3300046524 Bacteria 1420
1860 Ga0495663_0124109 3300046525 Bacteria 867
1861 Ga0495666_0000307 3300046526 Bacteria 21312
1862 Ga0495666_0066017 3300046526 Bacteria 1725
1863 Ga0495666_0156324 3300046526 Bacteria 1059
1864 Ga0495642_0045825 3300046528 Bacteria 1787
1865 Ga0495642_0049217 3300046528 Bacteria 1730
1866 Ga0495652_0001361 3300046529 Bacteria 27215
1867 Ga0495652_0006542 3300046529 Bacteria 10830
1868 Ga0495652_0010757 3300046529 Bacteria 8291
1869 Ga0495652_0013883 3300046529 Bacteria 7245
1870 Ga0495652_0018548 3300046529 Bacteria 6202
1871 Ga0495652_0028460 3300046529 Bacteria 4916
1872 Ga0495652_0214015 3300046529 Bacteria 1452
1873 Ga0495652_0222822 3300046529 Bacteria 1416
1874 Ga0495652_0510191 3300046529 Bacteria 832
1875 Ga0495654_0003279 3300046530 Bacteria 9982
1876 Ga0495654_0069906 3300046530 Bacteria 1666
1877 Ga0495665_0001543 3300046531 Bacteria 12285
1878 Ga0495665_0013489 3300046531 Bacteria 4416
1879 Ga0495665_0042392 3300046531 Bacteria 2422
1880 Ga0495665_0046677 3300046531 Bacteria 2299
1881 Ga0495665_0152647 3300046531 Bacteria 1205
1882 Ga0495665_0271914 3300046531 Bacteria 870
1883 Ga0495640_0002906 3300046533 Bacteria 13796
1884 Ga0495640_0007026 3300046533 Bacteria 8862
1885 Ga0495640_0038290 3300046533 Bacteria 3374
1886 Ga0495640_0107847 3300046533 Bacteria 1822
1887 Ga0495640_0153839 3300046533 Bacteria 1477
1888 Ga0495640_0156515 3300046533 Bacteria 1462
1889 Ga0495640_0235804 3300046533 Bacteria 1149
1890 Ga0495640_0369347 3300046533 Bacteria 883
1891 Ga0495586_0051840 3300046535 Bacteria 2221
1892 Ga0495586_0092727 3300046535 Bacteria 1669
1893 Ga0495587_0000038 3300046536 Bacteria 116118
1894 Ga0495587_0000793 3300046536 Bacteria 21073
1895 Ga0495587_0001703 3300046536 Bacteria 14685
1896 Ga0495587_0004866 3300046536 Bacteria 8809
1897 Ga0495587_0234759 3300046536 Bacteria 1033
1898 Ga0495609_0038187 3300046538 Bacteria 2165
1899 Ga0495621_0011385 3300046539 Bacteria 2750
1900 Ga0495621_0150520 3300046539 Bacteria 915
1901 Ga0495597_0094327 3300046542 Bacteria 1267
1902 Ga0495597_0099888 3300046542 Bacteria 1224
1903 Ga0495597_0121189 3300046542 Bacteria 1090
1904 Ga0495645_0001363 3300046543 Bacteria 16516
1905 Ga0495645_0013381 3300046543 Bacteria 5798
1906 Ga0495645_0035957 3300046543 Bacteria 3611
1907 Ga0495645_0064169 3300046543 Bacteria 2658
1908 Ga0495645_0122656 3300046543 Bacteria 1828
1909 Ga0495645_0264624 3300046543 Bacteria 1137
1910 Ga0495622_0019219 3300046557 Bacteria 3182
1911 Ga0495622_0043855 3300046557 Bacteria 2078
1912 Ga0495622_0050203 3300046557 Bacteria 1936
1913 Ga0495622_0141005 3300046557 Bacteria 1094
1914 Ga0495622_0338923 3300046557 Bacteria 652
1915 Ga0495633_0035752 3300046558 Bacteria 2384
1916 Ga0495633_0048265 3300046558 Bacteria 2010
1917 Ga0495633_0176033 3300046558 Bacteria 985
1918 Ga0495667_0000985 3300046559 Bacteria 18417
1919 Ga0495667_0001586 3300046559 Bacteria 15089
1920 Ga0495667_0002803 3300046559 Bacteria 11641
1921 Ga0495667_0064608 3300046559 Bacteria 2393
1922 Ga0495667_0159602 3300046559 Bacteria 1450
1923 Ga0495667_0253014 3300046559 Bacteria 1121
1924 Ga0495656_0033449 3300046615 Bacteria 2099
1925 Ga0495656_0050822 3300046615 Bacteria 1772
1926 Ga0495656_0109758 3300046615 Bacteria 1288
1927 Ga0495656_0387812 3300046615 Bacteria 729
1928 Ga0495656_0453650 3300046615 Bacteria 676
1929 Ga0495668_0026813 3300046616 Bacteria 3267
1930 Ga0495668_0164850 3300046616 Bacteria 1214
1931 Ga0495634_0003295 3300046642 Bacteria 13019
1932 Ga0495634_0003443 3300046642 Bacteria 12687
1933 Ga0495634_0050304 3300046642 Bacteria 2799
1934 Ga0495634_0118083 3300046642 Bacteria 1700
1935 Ga0495611_0037254 3300046648 Bacteria 2160
1936 Ga0495611_0048818 3300046648 Bacteria 1903
1937 Ga0495611_0049261 3300046648 Bacteria 1895
1938 Ga0495611_0083075 3300046648 Bacteria 1475
1939 Ga0495625_0194559 3300046660 Bacteria 1341
1940 Ga0495625_0264755 3300046660 Bacteria 1111
1941 Ga0495635_0006932 3300046663 Bacteria 7913
1942 Ga0495635_0010690 3300046663 Bacteria 6426
1943 Ga0495635_0025689 3300046663 Bacteria 4103
1944 Ga0495635_0058719 3300046663 Bacteria 2646
1945 Ga0495635_0067763 3300046663 Bacteria 2448
1946 Ga0495635_0086607 3300046663 Bacteria 2143
1947 Ga0495635_0139558 3300046663 Bacteria 1651
1948 Ga0495635_0215892 3300046663 Bacteria 1298
1949 Ga0495635_0362391 3300046663 Bacteria 966
1950 Ga0495659_0001631 3300046664 Bacteria 7534
1951 Ga0495661_0044093 3300046665 Bacteria 2736
1952 Ga0495661_0076707 3300046665 Bacteria 1938
1953 Ga0495588_0007836 3300046674 Bacteria 4877
1954 Ga0495588_0032147 3300046674 Bacteria 2643
1955 Ga0495588_0052361 3300046674 Bacteria 2104
1956 Ga0495588_0053827 3300046674 Bacteria 2076
1957 Ga0495657_0002519 3300046675 Bacteria 15384
1958 Ga0495657_0004038 3300046675 Bacteria 11767
1959 Ga0495657_0010741 3300046675 Bacteria 6881
1960 Ga0495657_0022888 3300046675 Bacteria 4471
1961 Ga0495657_0049723 3300046675 Bacteria 2823
1962 Ga0495657_0284606 3300046675 Bacteria 988
1963 Ga0495599_0000100 3300046678 Bacteria 60814
1964 Ga0495599_0021829 3300046678 Bacteria 3996
1965 Ga0495599_0132360 3300046678 Bacteria 1548
1966 Ga0495599_0218563 3300046678 Bacteria 1167
1967 Ga0495599_0246643 3300046678 Bacteria 1088
1968 Ga0495599_0514771 3300046678 Bacteria 703
1969 Ga0495623_0003245 3300046679 Bacteria 10749
1970 Ga0495623_0004870 3300046679 Bacteria 8804
1971 Ga0495623_0008402 3300046679 Bacteria 6712
1972 Ga0495623_0042461 3300046679 Bacteria 2896
1973 Ga0495623_0043116 3300046679 Bacteria 2871
1974 Ga0495623_0057157 3300046679 Bacteria 2454
1975 Ga0495623_0153942 3300046679 Bacteria 1356
1976 Ga0495623_0214633 3300046679 Bacteria 1100
1977 Ga0495646_0008701 3300046680 Bacteria 6449
1978 Ga0495646_0011394 3300046680 Bacteria 5646
1979 Ga0495646_0013572 3300046680 Bacteria 5180
1980 Ga0495646_0133192 3300046680 Bacteria 1397
1981 Ga0495658_0005541 3300046683 Bacteria 6205
1982 Ga0495658_0008248 3300046683 Bacteria 5160
1983 Ga0495658_0066758 3300046683 Bacteria 2079
1984 Ga0495658_0249368 3300046683 Bacteria 1116
1985 Ga0495658_0391830 3300046683 Bacteria 885
1986 Ga0495669_0049324 3300046684 Bacteria 1884
1987 Ga0495613_0005309 3300046689 Bacteria 9676
1988 Ga0495613_0005971 3300046689 Bacteria 9111
1989 Ga0495613_0035396 3300046689 Bacteria 3706
1990 Ga0495613_0098264 3300046689 Bacteria 2115
1991 Ga0495613_0155313 3300046689 Bacteria 1630
1992 Ga0495613_0284071 3300046689 Bacteria 1148
1993 Ga0495613_0391790 3300046689 Bacteria 949
1994 Ga0495613_0455738 3300046689 Bacteria 866
1995 Ga0495613_0481486 3300046689 Bacteria 837
1996 Ga0495613_0570655 3300046689 Bacteria 755
1997 Ga0495624_0021711 3300046690 Bacteria 4254
1998 Ga0495624_0095115 3300046690 Bacteria 1836
1999 Ga0495624_0322564 3300046690 Bacteria 930
2000 Ga0495624_0377763 3300046690 Bacteria 851
2001 Ga0495670_0007585 3300046691 Bacteria 5334
2002 Ga0495670_0257203 3300046691 Bacteria 931
2003 Ga0495671_0091550 3300046692 Bacteria 1488
2004 Ga0495671_0124447 3300046692 Bacteria 1257
2005 Ga0495671_0151444 3300046692 Bacteria 1129
2006 Ga0495671_0169806 3300046692 Bacteria 1060
2007 Ga0495671_0187744 3300046692 Bacteria 1004
2008 Ga0495649_0124029 3300046694 Bacteria 1364
2009 Ga0495649_0157013 3300046694 Bacteria 1193
2010 Ga0495649_0210333 3300046694 Bacteria 1008
2011 Ga0495589_0080741 3300046794 Bacteria 1582
2012 Ga0495589_0107380 3300046794 Bacteria 1348
2013 Ga0495589_0124392 3300046794 Bacteria 1240
2014 Ga0495589_0156534 3300046794 Bacteria 1086
2015 Ga0495600_0002715 3300046809 Bacteria 10238
2016 Ga0495600_0002790 3300046809 Bacteria 10140
2017 Ga0495600_0006230 3300046809 Bacteria 7239
2018 Ga0495600_0007794 3300046809 Bacteria 6556
2019 Ga0495600_0016586 3300046809 Bacteria 4677
2020 Ga0495600_0039421 3300046809 Bacteria 3076
2021 Ga0495600_0058454 3300046809 Bacteria 2519
2022 Ga0495600_0069095 3300046809 Bacteria 2308
2023 Ga0495600_0095836 3300046809 Bacteria 1934
2024 Ga0495600_0169756 3300046809 Bacteria 1408
2025 Ga0495600_0319663 3300046809 Bacteria 976
2026 Ga0495600_0323517 3300046809 Bacteria 969
2027 Ga0495660_0002768 3300046810 Bacteria 11062
2028 Ga0495660_0019447 3300046810 Bacteria 3899
2029 Ga0495660_0081066 3300046810 Bacteria 1702
2030 Ga0495581_0058469 3300047315 Bacteria 2226
2031 Ga0495581_0080185 3300047315 Bacteria 1889
2032 Ga0495581_0110773 3300047315 Bacteria 1596
2033 Ga0495581_0129320 3300047315 Bacteria 1471
2034 Ga0495581_0148160 3300047315 Bacteria 1370
2035 Ga0495581_0155942 3300047315 Bacteria 1334
2036 Ga0495581_0191755 3300047315 Bacteria 1195
2037 Ga0495581_0271884 3300047315 Bacteria 991
2038 Ga0495604_0000061 3300047317 Bacteria 94158
2039 Ga0495604_0002362 3300047317 Bacteria 15139
2040 Ga0495604_0003218 3300047317 Bacteria 13047
2041 Ga0495604_0003385 3300047317 Bacteria 12717
2042 Ga0495604_0004624 3300047317 Bacteria 10906
2043 Ga0495604_0037193 3300047317 Bacteria 3835
2044 Ga0495604_0116519 3300047317 Bacteria 1939
2045 Ga0495604_0122945 3300047317 Bacteria 1876
2046 Ga0495604_0167487 3300047317 Bacteria 1548
2047 Ga0495636_0066113 3300047318 Bacteria 1536
2048 Ga0495636_0212220 3300047318 Bacteria 886
2049 Ga0495636_0222975 3300047318 Bacteria 866
2050 Ga0495674_0004274 3300047319 Bacteria 13749
2051 Ga0495674_0016349 3300047319 Bacteria 6919
2052 Ga0495674_0047744 3300047319 Bacteria 3793
2053 Ga0495674_0076142 3300047319 Bacteria 2886
2054 Ga0495674_0103819 3300047319 Bacteria 2416
2055 Ga0495674_0195237 3300047319 Bacteria 1681
2056 Ga0495674_0258506 3300047319 Bacteria 1431
2057 Ga0495674_0316423 3300047319 Bacteria 1272
2058 Ga0495674_1013935 3300047319 Bacteria 635
2059 Ga0495672_0044620 3300047320 Bacteria 2658
2060 Ga0495672_0113544 3300047320 Bacteria 1451
2061 Ga0495676_0002701 3300047321 Bacteria 15905
2062 Ga0495676_0015246 3300047321 Bacteria 6851
2063 Ga0495676_0205541 3300047321 Bacteria 1366
2064 Ga0495680_0003514 3300047322 Bacteria 15376
2065 Ga0495680_0007498 3300047322 Bacteria 9992
2066 Ga0495680_0048305 3300047322 Bacteria 3342
2067 Ga0495680_0143163 3300047322 Bacteria 1748
2068 Ga0495680_0238427 3300047322 Bacteria 1292
2069 Ga0495680_0302092 3300047322 Bacteria 1123
2070 Ga0495680_0358258 3300047322 Bacteria 1014
2071 Ga0495680_0460520 3300047322 Bacteria 869
2072 Ga0495680_0656769 3300047322 Bacteria 696
2073 Ga0495683_0013097 3300047323 Bacteria 4342
2074 Ga0495683_0050441 3300047323 Bacteria 2082
2075 Ga0495687_015023 3300047443 Bacteria 3953
2076 Ga0495675_0001497 3300047444 Bacteria 14149
2077 Ga0495675_0003036 3300047444 Bacteria 10088
2078 Ga0495675_0003593 3300047444 Bacteria 9349
2079 Ga0495675_0021385 3300047444 Bacteria 4118
2080 Ga0495675_0029334 3300047444 Bacteria 3508
2081 Ga0495675_0086636 3300047444 Bacteria 1968
2082 Ga0495675_0183304 3300047444 Bacteria 1281
2083 Ga0495675_0203646 3300047444 Bacteria 1204
2084 Ga0495679_019249 3300047446 Bacteria 2403
2085 Ga0495679_115338 3300047446 Bacteria 737
2086 Ga0495685_000455 3300047447 Bacteria 12772
2087 Ga0495685_014150 3300047447 Bacteria 2709
2088 Ga0495685_036799 3300047447 Bacteria 1679
2089 Ga0495685_061200 3300047447 Bacteria 1268
2090 Ga0495685_141204 3300047447 Bacteria 784
2091 Ga0495673_0119306 3300047469 Bacteria 1046
2092 Ga0495681_0001916 3300047470 Bacteria 15254
2093 Ga0495681_0021955 3300047470 Bacteria 3426
2094 Ga0495681_0057172 3300047470 Bacteria 1812
2095 Ga0495681_0081591 3300047470 Bacteria 1442
2096 Ga0495684_0007828 3300047471 Bacteria 8267
2097 Ga0495684_0043414 3300047471 Bacteria 3442
2098 Ga0495684_0051654 3300047471 Bacteria 3137
2099 Ga0495684_0077452 3300047471 Bacteria 2524
2100 Ga0495684_0092382 3300047471 Bacteria 2292
2101 Ga0495684_0190926 3300047471 Bacteria 1514
2102 Ga0495684_0324668 3300047471 Bacteria 1099
2103 Ga0495686_0041778 3300047472 Bacteria 2918
2104 Ga0495686_0068495 3300047472 Bacteria 2189
2105 Ga0495593_0004470 3300047673 Bacteria 8309
2106 Ga0495593_0009356 3300047673 Bacteria 5686
2107 Ga0495593_0010612 3300047673 Bacteria 5312
2108 Ga0495593_0020873 3300047673 Bacteria 3663
2109 Ga0495593_0025598 3300047673 Bacteria 3265
2110 Ga0495593_0033962 3300047673 Bacteria 2776
2111 Ga0495593_0199485 3300047673 Bacteria 1006
2112 Ga0495602_0004271 3300048088 Bacteria 14873
2113 Ga0495602_0061797 3300048088 Bacteria 3254
2114 Ga0495602_0070215 3300048088 Bacteria 2999
2115 Ga0495602_0103068 3300048088 Bacteria 2336
2116 Ga0495602_0139004 3300048088 Bacteria 1925
2117 Ga0495602_0195461 3300048088 Bacteria 1547
2118 Ga0495614_0046356 3300048089 Bacteria 1864
2119 Ga0495615_0035278 3300048090 Bacteria 1222
2120 Ga0495626_0084005 3300048091 Bacteria 1409
2121 Ga0496100_0011716 3300048903 Bacteria 4999
2122 Ga0496100_0091178 3300048903 Bacteria 2079
2123 Ga0496100_0161198 3300048903 Bacteria 1608
2124 Ga0496100_0233846 3300048903 Bacteria 1353
2125 Ga0496100_0309830 3300048903 Bacteria 1183
2126 Ga0496100_0319687 3300048903 Bacteria 1166
2127 Ga0496100_0656067 3300048903 Bacteria 817
2128 Ga0496101_0020119 3300048904 Bacteria 4564
2129 Ga0496101_0041402 3300048904 Bacteria 3284
2130 Ga0496101_0090279 3300048904 Bacteria 2278
2131 Ga0496101_0092145 3300048904 Bacteria 2256
2132 Ga0496101_0100238 3300048904 Bacteria 2166
2133 Ga0496101_0114043 3300048904 Bacteria 2037
2134 Ga0496101_0132391 3300048904 Bacteria 1894
2135 Ga0496101_0468193 3300048904 Bacteria 995
2136 Ga0496101_0567174 3300048904 Bacteria 898
2137 Ga0496101_0928874 3300048904 Bacteria 685
2138 Ga0496102_0014022 3300048905 Bacteria 6959
2139 Ga0496102_0017957 3300048905 Bacteria 6206
2140 Ga0496102_0018425 3300048905 Bacteria 6136
2141 Ga0496102_0067122 3300048905 Bacteria 3289
2142 Ga0496102_0084147 3300048905 Bacteria 2935
2143 Ga0496102_0207752 3300048905 Bacteria 1846
2144 Ga0496102_0362181 3300048905 Bacteria 1365
2145 Ga0496102_0396618 3300048905 Bacteria 1297
2146 Ga0496102_0426820 3300048905 Bacteria 1245
2147 Ga0496102_0435036 3300048905 Bacteria 1231
2148 Ga0496102_0577315 3300048905 Bacteria 1047
2149 Ga0496102_1173814 3300048905 Bacteria 687
2150 Ga0496102_1303053 3300048905 Bacteria 645
2151 Ga0496103_0037518 3300048906 Bacteria 2969
2152 Ga0496103_0060146 3300048906 Bacteria 2361
2153 Ga0496103_0061916 3300048906 Bacteria 2328
2154 Ga0496103_0108772 3300048906 Bacteria 1759
2155 Ga0496103_0113542 3300048906 Bacteria 1722
2156 Ga0496103_0134084 3300048906 Bacteria 1582
2157 Ga0496103_0193005 3300048906 Bacteria 1309
2158 Ga0496103_0317661 3300048906 Bacteria 1002
2159 Ga0496103_0372926 3300048906 Bacteria 917
2160 Ga0496104_0013671 3300048907 Bacteria 7319
2161 Ga0496104_0014968 3300048907 Bacteria 7016
2162 Ga0496104_0027779 3300048907 Bacteria 5237
2163 Ga0496104_0114592 3300048907 Bacteria 2585
2164 Ga0496104_0132690 3300048907 Bacteria 2392
2165 Ga0496104_0331302 3300048907 Bacteria 1435
2166 Ga0496104_0692354 3300048907 Bacteria 927
2167 Ga0496104_0819234 3300048907 Bacteria 837
2168 Ga0496105_0003524 3300048908 Bacteria 11604
2169 Ga0496105_0070498 3300048908 Bacteria 2889
2170 Ga0496105_0097653 3300048908 Bacteria 2426
2171 Ga0496105_0104287 3300048908 Bacteria 2341
2172 Ga0496105_0130704 3300048908 Bacteria 2070
2173 Ga0496105_0178256 3300048908 Bacteria 1740
2174 Ga0496105_0270006 3300048908 Bacteria 1374
2175 Ga0496105_0347481 3300048908 Bacteria 1185
2176 Ga0496105_0358234 3300048908 Bacteria 1164
2177 Ga0496105_0500155 3300048908 Bacteria 954
2178 Ga0496106_0008748 3300048909 Bacteria 7485
2179 Ga0496106_0015391 3300048909 Bacteria 5662
2180 Ga0496106_0017817 3300048909 Bacteria 5251
2181 Ga0496106_0085258 3300048909 Bacteria 2432
2182 Ga0496106_0086126 3300048909 Bacteria 2419
2183 Ga0496106_0128495 3300048909 Bacteria 1986
2184 Ga0496106_0198919 3300048909 Bacteria 1594
2185 Ga0496106_0229561 3300048909 Bacteria 1482
2186 Ga0496106_0316543 3300048909 Bacteria 1252
2187 Ga0496106_0332154 3300048909 Bacteria 1220
2188 Ga0496106_0442082 3300048909 Bacteria 1045
2189 Ga0496106_0481970 3300048909 Bacteria 996
2190 Ga0496107_0003098 3300048910 Bacteria 11049
2191 Ga0496107_0010178 3300048910 Bacteria 6523
2192 Ga0496107_0059749 3300048910 Bacteria 2759
2193 Ga0496107_0083063 3300048910 Bacteria 2336
2194 Ga0496107_0087301 3300048910 Bacteria 2277
2195 Ga0496107_0130564 3300048910 Bacteria 1854
2196 Ga0496107_0262897 3300048910 Bacteria 1284
2197 Ga0496107_0268374 3300048910 Bacteria 1270
2198 Ga0496107_0388153 3300048910 Bacteria 1038
2199 Ga0496107_0506167 3300048910 Bacteria 896
2200 Ga0496108_0001515 3300048911 Bacteria 18387
2201 Ga0496108_0016331 3300048911 Bacteria 6055
2202 Ga0496108_0017703 3300048911 Bacteria 5829
2203 Ga0496108_0024748 3300048911 Bacteria 4944
2204 Ga0496108_0085000 3300048911 Bacteria 2685
2205 Ga0496108_0279877 3300048911 Bacteria 1452
2206 Ga0496108_0295988 3300048911 Bacteria 1409
2207 Ga0496108_0301260 3300048911 Bacteria 1396
2208 Ga0496108_0439987 3300048911 Bacteria 1139
2209 Ga0496108_0455492 3300048911 Bacteria 1117
2210 Ga0496108_0547567 3300048911 Bacteria 1009
2211 Ga0496108_0562238 3300048911 Bacteria 995
2212 Ga0496108_0794929 3300048911 Bacteria 816
2213 Ga0496108_0910509 3300048911 Bacteria 754
2214 Ga0496109_0008123 3300048912 Bacteria 8897
2215 Ga0496109_0008622 3300048912 Bacteria 8680
2216 Ga0496109_0015777 3300048912 Bacteria 6594
2217 Ga0496109_0017785 3300048912 Bacteria 6234
2218 Ga0496109_0058771 3300048912 Bacteria 3512
2219 Ga0496109_0110433 3300048912 Bacteria 2556
2220 Ga0496109_0118627 3300048912 Bacteria 2463
2221 Ga0496109_0138295 3300048912 Bacteria 2277
2222 Ga0496109_0147821 3300048912 Bacteria 2199
2223 Ga0496109_0165475 3300048912 Bacteria 2073
2224 Ga0496109_0174571 3300048912 Bacteria 2017
2225 Ga0496109_0212270 3300048912 Bacteria 1820
2226 Ga0496109_0258896 3300048912 Bacteria 1639
2227 Ga0496109_0338801 3300048912 Bacteria 1420
2228 Ga0496109_0340827 3300048912 Bacteria 1415
2229 Ga0496109_0499666 3300048912 Bacteria 1148
2230 Ga0496109_0891408 3300048912 Bacteria 827
2231 Ga0496110_0001862 3300048913 Bacteria 15584
2232 Ga0496110_0012641 3300048913 Bacteria 6946
2233 Ga0496110_0023063 3300048913 Bacteria 5293
2234 Ga0496110_0026054 3300048913 Bacteria 4999
2235 Ga0496110_0027755 3300048913 Bacteria 4855
2236 Ga0496110_0085776 3300048913 Bacteria 2810
2237 Ga0496110_0139983 3300048913 Bacteria 2187
2238 Ga0496110_0168731 3300048913 Bacteria 1985
2239 Ga0496110_0983434 3300048913 Bacteria 751
2240 Ga0496111_0011991 3300048914 Bacteria 5858
2241 Ga0496111_0012358 3300048914 Bacteria 5777
2242 Ga0496111_0025721 3300048914 Bacteria 4153
2243 Ga0496111_0039375 3300048914 Bacteria 3388
2244 Ga0496111_0041949 3300048914 Bacteria 3284
2245 Ga0496111_0095023 3300048914 Bacteria 2186
2246 Ga0496111_0214321 3300048914 Bacteria 1430
2247 Ga0496111_0355284 3300048914 Bacteria 1085
2248 Ga0496111_0362048 3300048914 Bacteria 1073
2249 Ga0496111_0453728 3300048914 Bacteria 946
2250 Ga0496111_0563106 3300048914 Bacteria 836
2251 Ga0496111_0615323 3300048914 Bacteria 794
2252 Ga0496112_0005193 3300048915 Bacteria 11198
2253 Ga0496112_0011626 3300048915 Bacteria 8051
2254 Ga0496112_0041128 3300048915 Bacteria 4521
2255 Ga0496112_0071181 3300048915 Bacteria 3437
2256 Ga0496112_0093751 3300048915 Bacteria 2972
2257 Ga0496112_0095479 3300048915 Bacteria 2943
2258 Ga0496112_0224577 3300048915 Bacteria 1834
2259 Ga0496112_0303009 3300048915 Bacteria 1543
2260 Ga0496112_0779364 3300048915 Bacteria 881
2261 Ga0496113_0010802 3300048916 Bacteria 6057
2262 Ga0496113_0018053 3300048916 Bacteria 4908
2263 Ga0496113_0057797 3300048916 Bacteria 2916
2264 Ga0496113_0071851 3300048916 Bacteria 2632
2265 Ga0496113_0181865 3300048916 Bacteria 1667
2266 Ga0496113_0194067 3300048916 Bacteria 1612
2267 Ga0496114_0005106 3300048917 Bacteria 10231
2268 Ga0496114_0009605 3300048917 Bacteria 7684
2269 Ga0496114_0018213 3300048917 Bacteria 5675
2270 Ga0496114_0020960 3300048917 Bacteria 5309
2271 Ga0496114_0033898 3300048917 Bacteria 4209
2272 Ga0496114_0037300 3300048917 Bacteria 4019
2273 Ga0496114_0037365 3300048917 Bacteria 4016
2274 Ga0496114_0051031 3300048917 Bacteria 3443
2275 Ga0496114_0082355 3300048917 Bacteria 2720
2276 Ga0496114_0082996 3300048917 Bacteria 2710
2277 Ga0496114_0108333 3300048917 Bacteria 2378
2278 Ga0496114_0134475 3300048917 Bacteria 2137
2279 Ga0496114_0249116 3300048917 Bacteria 1563
2280 Ga0496114_0467647 3300048917 Bacteria 1116
2281 Ga0496114_0808277 3300048917 Bacteria 817
2282 Ga0496115_0019772 3300048918 Bacteria 5186
2283 Ga0496115_0028874 3300048918 Bacteria 4350
2284 Ga0496115_0034249 3300048918 Bacteria 4013
2285 Ga0496115_0175675 3300048918 Bacteria 1771
2286 Ga0496115_0332369 3300048918 Bacteria 1241
2287 Ga0496115_0344752 3300048918 Bacteria 1215
2288 Ga0496115_0410200 3300048918 Bacteria 1098
2289 Ga0496115_0641861 3300048918 Bacteria 840
2290 Ga0496116_0001739 3300048919 Bacteria 23720
2291 Ga0496117_0015135 3300048920 Bacteria 6601
2292 Ga0496118_0011170 3300048921 Bacteria 8795
2293 Ga0496118_0013367 3300048921 Bacteria 7771
2294 Ga0496118_0097951 3300048921 Bacteria 1993
2295 Ga0496119_0000251 3300048922 Bacteria 75958
2296 Ga0496119_0001645 3300048922 Bacteria 26328
2297 Ga0496119_0058045 3300048922 Bacteria 2334
2298 Ga0496119_0081550 3300048922 Bacteria 1862
2299 Ga0496119_0083516 3300048922 Bacteria 1834
2300 Ga0496120_0000372 3300048923 Bacteria 72951
2301 Ga0496120_0041312 3300048923 Bacteria 2703
2302 Ga0496121_0004211 3300048924 Bacteria 19621
2303 Ga0496121_0012636 3300048924 Bacteria 9173
2304 Ga0496121_0071494 3300048924 Bacteria 2790
2305 Ga0496121_0254217 3300048924 Bacteria 1217
2306 Ga0496123_0220556 3300048926 Bacteria 957
2307 Ga0496124_0173749 3300048927 Bacteria 1665
2308 Ga0496124_0206032 3300048927 Bacteria 1492
2309 Ga0496124_0239128 3300048927 Bacteria 1352
2310 Ga0496124_0258294 3300048927 Bacteria 1284
2311 Ga0496124_0294085 3300048927 Bacteria 1177
2312 Ga0496124_0500902 3300048927 Bacteria 814
2313 Ga0496125_0019644 3300048928 Bacteria 6364
2314 Ga0496125_0145814 3300048928 Bacteria 1636
2315 Ga0496126_0000075 3300048929 Bacteria 235121
2316 Ga0496126_0000246 3300048929 Bacteria 116854
2317 Ga0496126_0052475 3300048929 Bacteria 3705
2318 Ga0496126_0082956 3300048929 Bacteria 2830
2319 Ga0496126_0102990 3300048929 Bacteria 2495
2320 Ga0496126_0365010 3300048929 Bacteria 1178
2321 Ga0496126_0409080 3300048929 Bacteria 1099
2322 Ga0496126_0522907 3300048929 Bacteria 945
2323 Ga0501306_001679 3300049127 Bacteria 2146
2324 Ga0501306_001772 3300049127 Bacteria 2101
2325 Ga0501306_007992 3300049127 Bacteria 1280
2326 Ga0501306_011356 3300049127 Bacteria 1134
2327 Ga0501306_018194 3300049127 Bacteria 959
2328 Ga0501306_024065 3300049127 Bacteria 868
2329 Ga0501308_000349 3300049128 Bacteria 2905
2330 Ga0501308_003415 3300049128 Bacteria 1469
2331 Ga0501308_004720 3300049128 Bacteria 1328
2332 Ga0501308_023397 3300049128 Bacteria 788
2333 Ga0501309_000092 3300049129 Bacteria 5150
2334 Ga0501309_000841 3300049129 Bacteria 2735
2335 Ga0501309_001681 3300049129 Bacteria 2234
2336 Ga0501309_011160 3300049129 Bacteria 1168
2337 Ga0501309_022011 3300049129 Bacteria 899
2338 Ga0501309_030555 3300049129 Bacteria 793
2339 Ga0501310_000462 3300049130 Bacteria 3561
2340 Ga0501310_000463 3300049130 Bacteria 3553
2341 Ga0501310_000539 3300049130 Bacteria 3339
2342 Ga0501310_000909 3300049130 Bacteria 2635
2343 Ga0501310_019850 3300049130 Bacteria 830
2344 Ga0501341_03506 3300049131 Bacteria 889
2345 Ga0501343_001079 3300049132 Bacteria 1787
2346 Ga0501344_00797 3300049133 Bacteria 1414
2347 Ga0501304_000596 3300049160 Bacteria 1966
2348 Ga0501304_003473 3300049160 Bacteria 1157
2349 Ga0501305_000169 3300049161 Bacteria 4464
2350 Ga0501305_000982 3300049161 Bacteria 2632
2351 Ga0501305_002818 3300049161 Bacteria 1915
2352 Ga0501305_013601 3300049161 Bacteria 1128
2353 Ga0501305_031185 3300049161 Bacteria 831
2354 Ga0501307_001466 3300049162 Bacteria 2000
2355 Ga0501307_010454 3300049162 Bacteria 1074
2356 Ga0501307_025385 3300049162 Bacteria 795
2357 Ga0501307_039704 3300049162 Bacteria 680
2358 Ga0495678_017994 3300049459 Bacteria 3186
2359 Ga0495682_0029547 3300049460 Bacteria 2030
2360 Ga0501292_025890 3300049515 Bacteria 968
2361 Ga0501311_000045 3300049527 Bacteria 5160
2362 Ga0501311_000292 3300049527 Bacteria 3183
2363 Ga0501311_000537 3300049527 Bacteria 2711
2364 Ga0501311_000629 3300049527 Bacteria 2603
2365 Ga0501311_014668 3300049527 Bacteria 1003
2366 Ga0501312_000107 3300049528 Bacteria 4953
2367 Ga0501313_001184 3300049529 Bacteria 2175
2368 Ga0501313_004172 3300049529 Bacteria 1473
2369 Ga0501314_000586 3300049530 Bacteria 2303
2370 Ga0501314_001487 3300049530 Bacteria 1704
2371 Ga0501314_007740 3300049530 Bacteria 958
2372 Ga0501315_001208 3300049531 Bacteria 2136
2373 Ga0501315_002651 3300049531 Bacteria 1709
2374 Ga0501315_009959 3300049531 Bacteria 1133
2375 Ga0501315_010313 3300049531 Bacteria 1121
2376 Ga0501315_016432 3300049531 Bacteria 958
2377 Ga0501316_000240 3300049532 Bacteria 3382
2378 Ga0501316_003331 3300049532 Bacteria 1551
2379 Ga0501316_004139 3300049532 Bacteria 1443
2380 Ga0501316_006918 3300049532 Bacteria 1220
2381 Ga0501316_011167 3300049532 Bacteria 1032
2382 Ga0501316_016154 3300049532 Bacteria 905
2383 Ga0501317_000189 3300049533 Bacteria 3667
2384 Ga0501317_000890 3300049533 Bacteria 2362
2385 Ga0501317_000953 3300049533 Bacteria 2320
2386 Ga0501317_000984 3300049533 Bacteria 2300
2387 Ga0501317_001609 3300049533 Bacteria 1982
2388 Ga0501317_026053 3300049533 Bacteria 823
2389 Ga0501317_028116 3300049533 Bacteria 802
2390 Ga0501317_043931 3300049533 Bacteria 691
2391 Ga0501317_045044 3300049533 Bacteria 685
2392 Ga0501318_000316 3300049534 Bacteria 2853
2393 Ga0501318_002104 3300049534 Bacteria 1680
2394 Ga0501318_002278 3300049534 Bacteria 1642
2395 Ga0501318_002680 3300049534 Bacteria 1569
2396 Ga0501318_025319 3300049534 Bacteria 777
2397 Ga0501319_000230 3300049535 Bacteria 2365
2398 Ga0501319_001021 3300049535 Bacteria 1525
2399 Ga0501319_007056 3300049535 Bacteria 843
2400 Ga0501320_000053 3300049536 Bacteria 5126
2401 Ga0501320_001218 3300049536 Bacteria 1820
2402 Ga0501320_003092 3300049536 Bacteria 1385
2403 Ga0501320_007299 3300049536 Bacteria 1060
2404 Ga0501320_021752 3300049536 Bacteria 747
2405 Ga0501320_022482 3300049536 Bacteria 740
2406 Ga0501321_000834 3300049537 Bacteria 2214
2407 Ga0501321_001097 3300049537 Bacteria 2051
2408 Ga0501321_004026 3300049537 Bacteria 1383
2409 Ga0501321_004657 3300049537 Bacteria 1321
2410 Ga0501321_006061 3300049537 Bacteria 1217
2411 Ga0501321_007751 3300049537 Bacteria 1122
2412 Ga0501321_028650 3300049537 Bacteria 733
2413 Ga0501321_035183 3300049537 Bacteria 685
2414 Ga0501321_043418 3300049537 Bacteria 639
2415 Ga0501322_001076 3300049538 Bacteria 1459
2416 Ga0501323_000010 3300049539 Bacteria 9499
2417 Ga0501323_000408 3300049539 Bacteria 3122
2418 Ga0501323_001381 3300049539 Bacteria 2135
2419 Ga0501323_003056 3300049539 Bacteria 1680
2420 Ga0501323_009843 3300049539 Bacteria 1131
2421 Ga0501323_040574 3300049539 Bacteria 681
2422 Ga0501324_000023 3300049540 Bacteria 5418
2423 Ga0501324_001485 3300049540 Bacteria 1570
2424 Ga0501324_016267 3300049540 Bacteria 728
2425 Ga0501325_001205 3300049541 Bacteria 1531
2426 Ga0501325_001702 3300049541 Bacteria 1402
2427 Ga0501325_002087 3300049541 Bacteria 1327
2428 Ga0501326_02729 3300049542 Bacteria 879
2429 Ga0501327_00527 3300049543 Bacteria 1565
2430 Ga0501328_00655 3300049544 Bacteria 1212
2431 Ga0501329_00099 3300049545 Bacteria 2112
2432 Ga0501330_000685 3300049546 Bacteria 1546
2433 Ga0501331_02015 3300049547 Bacteria 1037
2434 Ga0501332_01153 3300049548 Bacteria 1338
2435 Ga0501333_000298 3300049549 Bacteria 2125
2436 Ga0501334_00062 3300049550 Bacteria 3370
2437 Ga0501336_000681 3300049552 Bacteria 1800
2438 Ga0501338_00832 3300049554 Bacteria 1517
2439 Ga0501339_00025 3300049555 Bacteria 1851
2440 Ga0501340_000299 3300049556 Bacteria 1994
2441 Ga0501031_0003261 3300049568 Bacteria 10426
2442 Ga0501031_0021767 3300049568 Bacteria 4178
2443 Ga0501031_0125198 3300049568 Bacteria 1679
2444 Ga0501031_0136645 3300049568 Bacteria 1601
2445 Ga0501032_0001225 3300049569 Bacteria 20568
2446 Ga0501032_0001347 3300049569 Bacteria 19514
2447 Ga0501032_0034251 3300049569 Bacteria 3478
2448 Ga0501032_0040679 3300049569 Bacteria 3159
2449 Ga0501032_0049093 3300049569 Bacteria 2848
2450 Ga0501032_0172331 3300049569 Bacteria 1418
2451 Ga0501032_0187833 3300049569 Bacteria 1351
2452 Ga0501033_0005545 3300049570 Bacteria 9978
2453 Ga0501033_0041015 3300049570 Bacteria 3455
2454 Ga0501033_0042339 3300049570 Bacteria 3395
2455 Ga0501033_0568872 3300049570 Bacteria 779
2456 Ga0501034_0011756 3300049571 Bacteria 9058
2457 Ga0501034_0018792 3300049571 Bacteria 7083
2458 Ga0501034_0030255 3300049571 Bacteria 5503
2459 Ga0501034_0074273 3300049571 Bacteria 3408
2460 Ga0501034_0101342 3300049571 Bacteria 2873
2461 Ga0501034_0177975 3300049571 Bacteria 2092
2462 Ga0501034_0336784 3300049571 Bacteria 1439
2463 Ga0501034_0867811 3300049571 Bacteria 792
2464 Ga0501036_0037401 3300049572 Bacteria 4106
2465 Ga0501036_0057534 3300049572 Bacteria 3293
2466 Ga0501036_0074674 3300049572 Bacteria 2867
2467 Ga0501036_0078506 3300049572 Bacteria 2792
2468 Ga0501036_0145571 3300049572 Bacteria 1998
2469 Ga0501036_0632479 3300049572 Bacteria 886
2470 Ga0501037_0004030 3300049573 Bacteria 10649
2471 Ga0501037_0023627 3300049573 Bacteria 4545
2472 Ga0501037_0197034 3300049573 Bacteria 1424
2473 Ga0501037_0223059 3300049573 Bacteria 1325
2474 Ga0501037_0380679 3300049573 Bacteria 970
2475 Ga0501037_0397239 3300049573 Bacteria 946
2476 Ga0501037_0491193 3300049573 Bacteria 833
2477 Ga0501038_0000144 3300049574 Bacteria 61149
2478 Ga0501038_0007465 3300049574 Bacteria 10087
2479 Ga0501038_0021480 3300049574 Bacteria 5792
2480 Ga0501038_0021516 3300049574 Bacteria 5787
2481 Ga0501038_0032655 3300049574 Bacteria 4590
2482 Ga0501038_0040267 3300049574 Bacteria 4083
2483 Ga0501038_0130009 3300049574 Bacteria 2068
2484 Ga0501038_0155865 3300049574 Bacteria 1859
2485 Ga0501038_0399363 3300049574 Bacteria 1064
2486 Ga0501038_0417549 3300049574 Bacteria 1036
2487 Ga0501038_0448345 3300049574 Bacteria 992
2488 Ga0501039_0003016 3300049575 Bacteria 12590
2489 Ga0501039_0005992 3300049575 Bacteria 9215
2490 Ga0501039_0032587 3300049575 Bacteria 4018
2491 Ga0501039_0086786 3300049575 Bacteria 2437
2492 Ga0501039_0395022 3300049575 Bacteria 1086
2493 Ga0501039_0412800 3300049575 Bacteria 1060
2494 Ga0501039_0788505 3300049575 Bacteria 741
2495 Ga0501040_0002706 3300049576 Bacteria 11426
2496 Ga0501040_0094746 3300049576 Bacteria 2077
2497 Ga0501040_0159253 3300049576 Bacteria 1595
2498 Ga0501040_0254396 3300049576 Bacteria 1253
2499 Ga0501041_0002671 3300049577 Bacteria 10179
2500 Ga0501041_0022527 3300049577 Bacteria 3772
2501 Ga0501041_0025229 3300049577 Bacteria 3573
2502 Ga0501042_0073359 3300049578 Bacteria 2448
2503 Ga0501042_0088501 3300049578 Bacteria 2221
2504 Ga0501042_0116740 3300049578 Bacteria 1921
2505 Ga0501042_0239739 3300049578 Bacteria 1308
2506 Ga0501042_0240756 3300049578 Bacteria 1305
2507 Ga0501042_0499774 3300049578 Bacteria 883
2508 Ga0501043_0024981 3300049579 Bacteria 4688
2509 Ga0501043_0028012 3300049579 Bacteria 4421
2510 Ga0501043_0036763 3300049579 Bacteria 3852
2511 Ga0501043_0045847 3300049579 Bacteria 3437
2512 Ga0501046_0002011 3300049580 Bacteria 19297
2513 Ga0501046_0007546 3300049580 Bacteria 9538
2514 Ga0501046_0055522 3300049580 Bacteria 3111
2515 Ga0501046_0099287 3300049580 Bacteria 2235
2516 Ga0501046_0148795 3300049580 Bacteria 1767
2517 Ga0501046_0198737 3300049580 Bacteria 1492
2518 Ga0501046_0670659 3300049580 Bacteria 732
2519 Ga0501046_0839866 3300049580 Bacteria 642
2520 Ga0501047_0000278 3300049581 Bacteria 59271
2521 Ga0501047_0000811 3300049581 Bacteria 32563
2522 Ga0501047_0006173 3300049581 Bacteria 11269
2523 Ga0501047_0008040 3300049581 Bacteria 9951
2524 Ga0501047_0042683 3300049581 Bacteria 4381
2525 Ga0501047_0077887 3300049581 Bacteria 3188
2526 Ga0501047_0113282 3300049581 Bacteria 2594
2527 Ga0501047_0119157 3300049581 Bacteria 2521
2528 Ga0501047_0168941 3300049581 Bacteria 2056
2529 Ga0501047_0438894 3300049581 Bacteria 1136
2530 Ga0501047_0603980 3300049581 Bacteria 918
2531 Ga0501047_0619889 3300049581 Bacteria 902
2532 Ga0501048_0000853 3300049582 Bacteria 22450
2533 Ga0501048_0001026 3300049582 Bacteria 20878
2534 Ga0501048_0032492 3300049582 Bacteria 3770
2535 Ga0501048_0052303 3300049582 Bacteria 2906
2536 Ga0501048_0060350 3300049582 Bacteria 2687
2537 Ga0501048_0200523 3300049582 Bacteria 1414
2538 Ga0501048_0308574 3300049582 Bacteria 1126
2539 Ga0501048_0344474 3300049582 Bacteria 1063
2540 Ga0501048_0700073 3300049582 Bacteria 727
2541 Ga0501067_0000592 3300049583 Bacteria 19503
2542 Ga0501067_0096115 3300049583 Bacteria 1645
2543 Ga0501068_0003271 3300049584 Bacteria 8684
2544 Ga0501068_0156729 3300049584 Bacteria 1434
2545 Ga0501068_0157509 3300049584 Bacteria 1430
2546 Ga0501069_0005589 3300049585 Bacteria 6539
2547 Ga0501069_0075715 3300049585 Bacteria 1891
2548 Ga0501069_0239381 3300049585 Bacteria 1057
2549 Ga0501069_0287536 3300049585 Bacteria 963
2550 Ga0501070_0004123 3300049586 Bacteria 12503
2551 Ga0501070_0023364 3300049586 Bacteria 5179
2552 Ga0501070_0048632 3300049586 Bacteria 3522
2553 Ga0501070_0074271 3300049586 Bacteria 2814
2554 Ga0501070_0092327 3300049586 Bacteria 2505
2555 Ga0501070_0092747 3300049586 Bacteria 2499
2556 Ga0501070_0127041 3300049586 Bacteria 2107
2557 Ga0501070_0178065 3300049586 Bacteria 1750
2558 Ga0501070_0209142 3300049586 Bacteria 1602
2559 Ga0501070_0489176 3300049586 Bacteria 989
2560 Ga0501071_0003704 3300049587 Bacteria 9594
2561 Ga0501071_0045415 3300049587 Bacteria 3153
2562 Ga0501071_0075875 3300049587 Bacteria 2454
2563 Ga0501071_0266736 3300049587 Bacteria 1294
2564 Ga0501072_0001152 3300049588 Bacteria 19660
2565 Ga0501072_0027310 3300049588 Bacteria 4454
2566 Ga0501072_0105438 3300049588 Bacteria 2241
2567 Ga0501072_0153562 3300049588 Bacteria 1836
2568 Ga0501072_0404589 3300049588 Bacteria 1083
2569 Ga0501073_0004460 3300049589 Bacteria 10515
2570 Ga0501073_0070083 3300049589 Bacteria 2443
2571 Ga0501073_0332810 3300049589 Bacteria 1048
2572 Ga0501074_0002804 3300049590 Bacteria 12192
2573 Ga0501074_0003829 3300049590 Bacteria 10704
2574 Ga0501074_0261140 3300049590 Bacteria 1231
2575 Ga0501075_0212740 3300049591 Bacteria 1474
2576 Ga0501076_0010773 3300049592 Bacteria 6796
2577 Ga0501076_0044047 3300049592 Bacteria 3518
2578 Ga0501076_0117097 3300049592 Bacteria 2156
2579 Ga0501076_0226753 3300049592 Bacteria 1527
2580 Ga0501076_0427391 3300049592 Bacteria 1090
2581 Ga0501076_0762052 3300049592 Bacteria 799
2582 Ga0501077_0031876 3300049593 Bacteria 3353
2583 Ga0501211_007722 3300049658 Bacteria 1053
2584 Ga0501240_033537 3300049673 Bacteria 830
2585 Ga0501221_085868 3300049704 Bacteria 763
2586 Ga0501079_0007489 3300049741 Bacteria 8256
2587 Ga0501079_0022088 3300049741 Bacteria 4875
2588 Ga0501079_0099906 3300049741 Bacteria 2249
2589 Ga0501079_0407681 3300049741 Bacteria 1066
2590 Ga0501080_0091006 3300049742 Bacteria 2833
2591 Ga0501080_0389205 3300049742 Bacteria 1255
2592 Ga0501081_0202791 3300049743 Bacteria 1439
2593 Ga0501081_0273878 3300049743 Bacteria 1235
2594 Ga0501081_0538274 3300049743 Bacteria 872
2595 Ga0501081_0556156 3300049743 Bacteria 857
2596 Ga0501083_0000921 3300049744 Bacteria 19506
2597 Ga0501083_0008844 3300049744 Bacteria 7110
2598 Ga0501083_0171938 3300049744 Bacteria 1416
2599 Ga0501268_045477 3300049765 Bacteria 837
2600 Ga0501035_0001420 3300049822 Bacteria 24540
2601 Ga0501035_0004487 3300049822 Bacteria 13250
2602 Ga0501035_0050048 3300049822 Bacteria 3745
2603 Ga0501035_0064312 3300049822 Bacteria 3260
2604 Ga0501035_0073431 3300049822 Bacteria 3026
2605 Ga0501035_0097200 3300049822 Bacteria 2586
2606 Ga0501035_0371666 3300049822 Bacteria 1193
2607 Ga0501035_0857195 3300049822 Bacteria 722
2608 Ga0501044_0010423 3300049823 Bacteria 10087
2609 Ga0501044_0059225 3300049823 Bacteria 3924
2610 Ga0501044_0067971 3300049823 Bacteria 3630
2611 Ga0501044_0081453 3300049823 Bacteria 3277
2612 Ga0501044_0215672 3300049823 Bacteria 1872
2613 Ga0501044_0274880 3300049823 Bacteria 1619
2614 Ga0501044_0434389 3300049823 Bacteria 1221
2615 Ga0501044_0620711 3300049823 Bacteria 972
2616 Ga0501044_0798201 3300049823 Bacteria 823
2617 Ga0501045_0005656 3300049824 Bacteria 8648
2618 Ga0501045_0068686 3300049824 Bacteria 2604
2619 Ga0501045_0123884 3300049824 Bacteria 1919
2620 Ga0501045_0133376 3300049824 Bacteria 1846
2621 Ga0501212_008665 3300049851 Bacteria 1419
2622 nmdc:mga03683_224185_c1 3300050489 Bacteria 868
2623 nmdc:mga03n38_16479_c1 3300050490 Bacteria 2875
2624 nmdc:mga03n38_372_c1 3300050490 Bacteria 11022
2625 nmdc:mga00v17_2711_c1 3300050491 Bacteria 9089
2626 nmdc:mga00v17_463827_c1 3300050491 Bacteria 822
2627 nmdc:mga00v17_629050_c1 3300050491 Bacteria 691
2628 nmdc:mga00v17_79376_c1 3300050491 Bacteria 2047
2629 nmdc:mga0yw44_150406_c1 3300050492 Bacteria 1518
2630 nmdc:mga0yw44_228054_c1 3300050492 Bacteria 1236
2631 nmdc:mga0yw44_338424_c1 3300050492 Bacteria 1012
2632 nmdc:mga0yw44_502554_c1 3300050492 Bacteria 823
2633 nmdc:mga0k408_29434_c2 3300050493 Bacteria 2523
2634 nmdc:mga06z11_1439_c1 3300050494 Bacteria 8846
2635 nmdc:mga06z11_1560_c1 3300050494 Bacteria 8521
2636 nmdc:mga04h51_3706_c1 3300050495 Bacteria 3738
2637 nmdc:mga04h51_5654_c1 3300050495 Bacteria 3197
2638 nmdc:mga07m45_222935_c1 3300050496 Bacteria 1097
2639 nmdc:mga07m45_33523_c1 3300050496 Bacteria 2852
2640 nmdc:mga07m45_336845_c1 3300050496 Bacteria 877
2641 nmdc:mga07m45_5415_c1 3300050496 Bacteria 6350
2642 nmdc:mga05p37_1182_c1 3300050507 Bacteria 30133
2643 nmdc:mga05p37_223511_c1 3300050507 Bacteria 2271
2644 nmdc:mga05p37_25728_c1 3300050507 Bacteria 7158
2645 nmdc:mga05p37_2785_c1 3300050507 Bacteria 20326
2646 nmdc:mga05p37_56839_c1 3300050507 Bacteria 4818
2647 nmdc:mga05p37_742221_c1 3300050507 Bacteria 1083
2648 nmdc:mga05p37_978454_c1 3300050507 Bacteria 902
2649 nmdc:mga09592_1799_c1 3300050508 Bacteria 17199
2650 nmdc:mga09592_342847_c1 3300050508 Bacteria 1293
2651 nmdc:mga09592_61988_c1 3300050508 Bacteria 3163
2652 nmdc:mga09592_81918_c1 3300050508 Bacteria 2750
2653 nmdc:mga09592_84854_c1 3300050508 Bacteria 2701
2654 nmdc:mga0qj67_171363_c1 3300050509 Bacteria 1762
2655 nmdc:mga0qj67_591_c1 3300050509 Bacteria 24706
2656 nmdc:mga06r32_12774_c1 3300050510 Bacteria 7592
2657 nmdc:mga06r32_4895_c1 3300050510 Bacteria 12063
2658 nmdc:mga06r32_75743_c1 3300050510 Bacteria 3266
2659 nmdc:mga08y16_186460_c1 3300050511 Bacteria 2153
2660 nmdc:mga08y16_20496_c1 3300050511 Bacteria 6980
2661 nmdc:mga08y16_375039_c1 3300050511 Bacteria 1459
2662 nmdc:mga08y16_42012_c1 3300050511 Bacteria 4789
2663 nmdc:mga08y16_46306_c1 3300050511 Bacteria 4553
2664 nmdc:mga08y16_716277_c1 3300050511 Bacteria 999
2665 nmdc:mga0n895_1292651_c1 3300050512 Bacteria 701
2666 nmdc:mga0n895_1321_c1 3300050512 Bacteria 18347
2667 nmdc:mga0n895_1323933_c1 3300050512 Bacteria 691
2668 nmdc:mga0n895_158862_c1 3300050512 Bacteria 2292
2669 nmdc:mga0n895_26293_c1 3300050512 Bacteria 5510
2670 nmdc:mga0n895_38777_c1 3300050512 Bacteria 4618
2671 nmdc:mga0n895_441327_c1 3300050512 Bacteria 1315
2672 nmdc:mga0n895_644806_c1 3300050512 Bacteria 1058
2673 nmdc:mga0rr50_1290_c2 3300050513 Bacteria 9760
2674 nmdc:mga0rr50_191893_c1 3300050513 Bacteria 1675
2675 nmdc:mga0rr50_539977_c1 3300050513 Bacteria 993
2676 nmdc:mga0rr50_60041_c1 3300050513 Bacteria 2859
2677 nmdc:mga0rr50_6615_c1 3300050513 Bacteria 7082
2678 nmdc:mga0rr50_92766_c1 3300050513 Bacteria 2355
2679 nmdc:mga08x19_281096_c1 3300050514 Bacteria 1153
2680 nmdc:mga08x19_2822_c1 3300050514 Bacteria 10475
2681 nmdc:mga08x19_4935_c1 3300050514 Bacteria 7878
2682 nmdc:mga08x19_731112_c1 3300050514 Bacteria 703
2683 nmdc:mga08x19_73253_c1 3300050514 Bacteria 2236
2684 nmdc:mga08x19_74851_c1 3300050514 Bacteria 2213
2685 nmdc:mga0a205_21232_c1 3300050515 Bacteria 6141
2686 nmdc:mga0a205_27458_c1 3300050515 Bacteria 5436
2687 nmdc:mga0a205_3656_c1 3300050515 Bacteria 13772
2688 nmdc:mga0a205_43558_c1 3300050515 Bacteria 4328
2689 nmdc:mga0a205_5430_c1 3300050515 Bacteria 11488
2690 nmdc:mga0sz30_57331_c1 3300050516 Bacteria 1660
2691 Ga0495601_0008409 3300053077 Bacteria 6097
2692 Ga0495601_0009788 3300053077 Bacteria 5669
2693 Ga0495601_0059321 3300053077 Bacteria 2426
2694 Ga0495601_0113550 3300053077 Bacteria 1756
2695 Ga0495612_0001114 3300053078 Bacteria 11005
2696 Ga0495612_0004918 3300053078 Bacteria 5528
2697 Ga0495612_0233484 3300053078 Bacteria 816
2698 Ga0495612_0293728 3300053078 Bacteria 728
2699 Ga0500610_0197758 3300053079 Bacteria 971
2700 Ga0495655_0026808 3300053083 Bacteria 1361
2701 Ga0495655_0086354 3300053083 Bacteria 906
2702 Ga0495595_0047173 3300053084 Bacteria 1986
2703 Ga0495619_0039496 3300053085 Bacteria 3081
2704 Ga0495619_0050763 3300053085 Bacteria 2739
2705 Ga0495619_0105078 3300053085 Bacteria 1925
2706 Ga0495619_0211679 3300053085 Bacteria 1342
2707 Ga0495619_0270401 3300053085 Bacteria 1178
2708 Ga0500578_0006009 3300053086 Bacteria 8160
2709 Ga0500643_001399 3300053087 Bacteria 13942
2710 Ga0500583_0033588 3300053092 Bacteria 2272
2711 Ga0500583_0061272 3300053092 Bacteria 1776
2712 Ga0500651_0214064 3300053093 Bacteria 1132
2713 Ga0500566_0095817 3300053094 Bacteria 1634
2714 Ga0500640_002433 3300053095 Bacteria 6153
2715 Ga0500641_0007318 3300053096 Bacteria 3933
2716 Ga0500654_002699 3300053099 Bacteria 12710
2717 Ga0500553_031480 3300053101 Bacteria 2646
2718 Ga0500553_086416 3300053101 Bacteria 1393
2719 Ga0500557_092210 3300053105 Bacteria 1004
2720 Ga0500560_002453 3300053107 Bacteria 3545
2721 Ga0500560_115508 3300053107 Bacteria 900
2722 Ga0500569_000210 3300053109 Bacteria 9330
2723 Ga0500608_033686 3300053122 Bacteria 2439
2724 Ga0500628_012752 3300053129 Bacteria 1554
2725 Ga0500642_0006030 3300053130 Bacteria 3960
2726 Ga0500652_001087 3300053131 Bacteria 8784
2727 Ga0500658_0002819 3300053134 Bacteria 6668
2728 Ga0500658_0115183 3300053134 Bacteria 1187
2729 Ga0500559_0010418 3300053136 Bacteria 3991
2730 Ga0500559_0231483 3300053136 Bacteria 871
2731 Ga0500561_0000167 3300053137 Bacteria 12188
2732 Ga0500568_0032736 3300053139 Bacteria 2136
2733 Ga0500573_0041685 3300053140 Bacteria 2650
2734 Ga0500573_0052432 3300053140 Bacteria 2345
2735 Ga0500577_0020547 3300053142 Bacteria 2161
2736 Ga0500579_024872 3300053143 Bacteria 3870
2737 Ga0500588_0077807 3300053146 Bacteria 1103
2738 Ga0500600_0006438 3300053149 Bacteria 7001
2739 Ga0500616_0000947 3300053153 Bacteria 31587
2740 Ga0500616_0004474 3300053153 Bacteria 9936
2741 Ga0500616_0006073 3300053153 Bacteria 8012
2742 Ga0500627_0154850 3300053158 Bacteria 1035
2743 Ga0500633_0000736 3300053160 Bacteria 5570
2744 Ga0500634_0024229 3300053161 Bacteria 3300
2745 Ga0500634_0030541 3300053161 Bacteria 2937
2746 Ga0500656_000787 3300053732 Bacteria 2505
2747 Ga0501084_0001550 3300054114 Bacteria 18271
2748 Ga0501084_0007241 3300054114 Bacteria 9145
2749 Ga0501084_0042157 3300054114 Bacteria 3817
2750 Ga0501084_0074002 3300054114 Bacteria 2853
2751 Ga0501084_0127622 3300054114 Bacteria 2141
2752 Ga0501084_0437267 3300054114 Bacteria 1106
2753 Ga0590075_015737 3300059424 Bacteria 1857
2754 Ga0590075_023614 3300059424 Bacteria 1542
2755 Ga0590075_035241 3300059424 Bacteria 1274
2756 Ga0587084_009700 3300059477 Bacteria 1250
2757 Ga0587070_038969 3300059491 Bacteria 900
2758 Ga0587073_0003043 3300059492 Bacteria 2249
2759 Ga0587073_0015223 3300059492 Bacteria 1383
2760 Ga0587073_0025384 3300059492 Bacteria 1178
2761 Ga0587080_005354 3300059503 Bacteria 1718
2762 Ga0587080_010714 3300059503 Bacteria 1357
2763 Ga0587082_003001 3300059504 Bacteria 1979
2764 Ga0587082_007662 3300059504 Bacteria 1479
2765 Ga0587085_037794 3300059506 Bacteria 826
2766 Ga0587088_004376 3300059508 Bacteria 1784
2767 Ga0587088_005301 3300059508 Bacteria 1686
2768 Ga0587090_003130 3300059510 Bacteria 1891
2769 Ga0587090_004864 3300059510 Bacteria 1655
2770 Ga0587090_007983 3300059510 Bacteria 1407
2771 Ga0587091_002904 3300059511 Bacteria 2097
2772 Ga0587091_006697 3300059511 Bacteria 1630
2773 Ga0587091_020924 3300059511 Bacteria 1140
2774 Ga0587094_007739 3300059513 Bacteria 1327
2775 Ga0587095_003153 3300059514 Bacteria 1150
2776 Ga0587097_00452 3300059603 Bacteria 1185
2777 Ga0587098_000861 3300059604 Bacteria 2102
2778 Ga0587106_003836 3300059605 Bacteria 1612
2779 Ga0587106_010813 3300059605 Bacteria 1191
2780 Ga0587125_002642 3300059607 Bacteria 1457
2781 Ga0587099_002232 3300059622 Bacteria 1502
2782 Ga0587109_004016 3300059624 Bacteria 2006
2783 Ga0587115_005698 3300059626 Bacteria 1410
2784 Ga0587115_021036 3300059626 Bacteria 909
2785 Ga0587122_000240 3300059628 Bacteria 2592
2786 Ga0587122_021160 3300059628 Bacteria 708
2787 Ga0587062_006133 3300059639 Bacteria 1355
2788 Ga0587067_002953 3300059640 Bacteria 2078
2789 Ga0587067_036323 3300059640 Bacteria 936
2790 Ga0587068_000682 3300059641 Bacteria 3322
2791 Ga0587068_001971 3300059641 Bacteria 2420
2792 Ga0587075_004996 3300059644 Bacteria 1567
2793 Ga0587076_001221 3300059645 Bacteria 2550
2794 Ga0587076_009203 3300059645 Bacteria 1398
2795 Ga0587078_001418 3300059646 Bacteria 2132
2796 Ga0587079_004686 3300059647 Bacteria 1881
2797 Ga0587079_010530 3300059647 Bacteria 1467
2798 Ga0587079_057636 3300059647 Bacteria 833
2799 Ga0587100_009713 3300059648 Bacteria 800
2800 Ga0587105_000564 3300059651 Bacteria 1589
2801 Ga0587105_000641 3300059651 Bacteria 1549
2802 Ga0587108_000409 3300059653 Bacteria 2157
2803 Ga0587114_003370 3300059655 Bacteria 1583
2804 Ga0587114_006887 3300059655 Bacteria 1286
2805 Ga0587116_00573 3300059656 Bacteria 1513
2806 Ga0587116_00733 3300059656 Bacteria 1400
2807 Ga0587120_001210 3300059659 Bacteria 1566
2808 Ga0587124_000838 3300059660 Bacteria 1842
2809 Ga0587096_00920 3300060247 Bacteria 913
2810 Ga0587071_001284 3300060344 Bacteria 3065
2811 Ga0587071_009858 3300060344 Bacteria 1582
2812 Ga0587071_042019 3300060344 Bacteria 919
2813 Ga0587111_0010549 3300060346 Bacteria 1589
2814 Ga0587111_0016345 3300060346 Bacteria 1369
2815 Ga0501082_0005640 3300060353 Bacteria 10866
2816 Ga0501082_0013322 3300060353 Bacteria 7070
2817 Ga0501082_0086191 3300060353 Bacteria 2709
2818 Ga0501082_0399286 3300060353 Bacteria 1200
2819 Ga0466962_0000160 3300061719 Bacteria 28430
2820 Ga0466962_0002136 3300061719 Bacteria 9340
2821 Ga0466962_0002748 3300061719 Bacteria 8360
2822 Ga0466962_0004292 3300061719 Bacteria 6831
2823 Ga0466962_0019238 3300061719 Bacteria 3280
2824 Ga0466962_0157458 3300061719 Bacteria 1103
2825 Ga0466962_0172141 3300061719 Bacteria 1054
2826 Ga0466962_0282498 3300061719 Bacteria 819
2827 Ga0466962_0347548 3300061719 Bacteria 738
2828 Ga0530510_0197048 3300061734 Bacteria 1496
2829 Ga0530510_0205357 3300061734 Bacteria 1464
2830 Ga0530510_0263545 3300061734 Bacteria 1286
2831 Ga0530510_0289927 3300061734 Bacteria 1223
2832 Ga0530510_0437948 3300061734 Bacteria 987
2833 Ga0530510_0566482 3300061734 Bacteria 863

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1181494 Ga0436365_1181494_145_762 159
2 3300034817 Ga0373948_0114100 Ga0373948_0114100_54_632 160
3 3300050491 nmdc:mga00v17_629050_c1 nmdc:mga00v17_629050_c1_113_676 160
4 3300013296 Ga0157374_10744014 Ga0157374_107440142 162
5 3300025911 Ga0207654_10159881 Ga0207654_101598812 162
6 3300041486 Ga0451807_1162599 Ga0451807_1162599_341_952 164
7 3300049574 Ga0501038_0417549 Ga0501038_0417549_427_1014 166
8 3300026067 Ga0207678_10960058 Ga0207678_109600582 167
9 3300045976 Ga0466967_0263732 Ga0466967_0263732_239_922 167
10 3300005617 Ga0068859_100320278 Ga0068859_1003202782 168
11 3300006195 Ga0075366_10061582 Ga0075366_100615823 168
12 3300006931 Ga0097620_100320262 Ga0097620_1003202622 168
13 3300025899 Ga0207642_10286734 Ga0207642_102867342 168
14 3300025923 Ga0207681_10716074 Ga0207681_107160742 168
15 3300025936 Ga0207670_10189433 Ga0207670_101894332 168
16 3300049162 Ga0501307_039704 Ga0501307_039704_39_662 168
17 3300049533 Ga0501317_043931 Ga0501317_043931_25_639 168
18 3300049539 Ga0501323_040574 Ga0501323_040574_39_662 168
19 3300003300 Ga0006758J48902_1007969 Ga0006758J48902_10079691 169
20 3300029285 Ga0310981_1080414 Ga0310981_10804142 169
21 3300030744 Ga0316181_1068685 Ga0316181_10686852 169
22 3300041509 Ga0451843_0180999 Ga0451843_0180999_368_1027 169
23 3300041512 Ga0451853_0729236 Ga0451853_0729236_3103_3762 169
24 3300044842 Ga0466957_0515119 Ga0466957_0515119_32_652 169
25 3300048911 Ga0496108_0562238 Ga0496108_0562238_107_766 169
26 3300049132 Ga0501343_001079 Ga0501343_001079_450_1100 169
27 3300049133 Ga0501344_00797 Ga0501344_00797_599_1249 169
28 3300049533 Ga0501317_000953 Ga0501317_000953_379_1029 169
29 3300049535 Ga0501319_000230 Ga0501319_000230_1124_1774 169
30 3300049537 Ga0501321_000834 Ga0501321_000834_300_950 169
31 3300049542 Ga0501326_02729 Ga0501326_02729_21_671 169
32 3300049545 Ga0501329_00099 Ga0501329_00099_1139_1789 169
33 3300049547 Ga0501331_02015 Ga0501331_02015_49_699 169
34 3300049548 Ga0501332_01153 Ga0501332_01153_48_698 169
35 3300049549 Ga0501333_000298 Ga0501333_000298_659_1309 169
36 3300049550 Ga0501334_00062 Ga0501334_00062_600_1250 169
37 3300049552 Ga0501336_000681 Ga0501336_000681_339_989 169
38 3300049556 Ga0501340_000299 Ga0501340_000299_600_1250 169
39 3300025920 Ga0207649_10637854 Ga0207649_106378541 170
40 3300049536 Ga0501320_003092 Ga0501320_003092_39_662 170
41 3300013307 Ga0157372_10084507 Ga0157372_100845074 171
42 3300048904 Ga0496101_0928874 Ga0496101_0928874_37_669 171
43 iso_pu_bacteria 2884693830 2884694813 171
44 iso_pu_bacteria 2895442618 2895446491 171
45 3300014325 Ga0163163_10315025 Ga0163163_103150252 172
46 3300014326 Ga0157380_10191129 Ga0157380_101911293 172
47 3300020075 Ga0206349_1943264 Ga0206349_19432642 172
48 3300025901 Ga0207688_10155612 Ga0207688_101556122 172
49 3300046615 Ga0495656_0453650 Ga0495656_0453650_46_657 172
50 3300048912 Ga0496109_0338801 Ga0496109_0338801_697_1365 172
51 3300048913 Ga0496110_0983434 Ga0496110_0983434_100_702 172
52 3300003762 Ga0055542_1001700 Ga0055542_100170017 173
53 3300048905 Ga0496102_1303053 Ga0496102_1303053_11_634 173
54 3300053078 Ga0495612_0293728 Ga0495612_0293728_111_716 173
55 3300059640 Ga0587067_002953 Ga0587067_002953_347_997 173
56 3300025918 Ga0207662_10200348 Ga0207662_102003482 174
57 3300046557 Ga0495622_0338923 Ga0495622_0338923_38_640 174
58 3300046678 Ga0495599_0246643 Ga0495599_0246643_471_1070 174
59 3300005530 Ga0070679_100163794 Ga0070679_1001637943 175
60 3300025909 Ga0207705_10159294 Ga0207705_101592942 175
61 3300025937 Ga0207669_10269103 Ga0207669_102691031 175
62 3300046455 Ga0495603_0133824 Ga0495603_0133824_796_1416 175
63 3300046459 Ga0495629_0007927 Ga0495629_0007927_1505_2128 175
64 3300046463 Ga0495653_0150824 Ga0495653_0150824_11_631 175
65 3300046476 Ga0495662_0437943 Ga0495662_0437943_14_616 175
66 3300046533 Ga0495640_0038290 Ga0495640_0038290_1648_2271 175
67 3300046683 Ga0495658_0008248 Ga0495658_0008248_3327_3950 175
68 3300047315 Ga0495581_0080185 Ga0495581_0080185_1114_1737 175
69 3300047319 Ga0495674_0016349 Ga0495674_0016349_3742_4365 175
70 3300047319 Ga0495674_1013935 Ga0495674_1013935_15_617 175
71 3300047322 Ga0495680_0358258 Ga0495680_0358258_172_795 175
72 3300047673 Ga0495593_0009356 Ga0495593_0009356_3920_4543 175
73 3300049161 Ga0501305_031185 Ga0501305_031185_60_671 175
74 3300049537 Ga0501321_043418 Ga0501321_043418_16_627 175
75 3300049580 Ga0501046_0839866 Ga0501046_0839866_11_613 175
76 3300050514 nmdc:mga08x19_731112_c1 nmdc:mga08x19_731112_c1_73_693 175
77 3300053078 Ga0495612_0233484 Ga0495612_0233484_180_800 175
78 3300053084 Ga0495595_0047173 Ga0495595_0047173_1350_1970 175
79 3300042993 Ga0439440_0014409 Ga0439440_0014409_1033_1644 176
80 3300044735 Ga0466968_0000486 Ga0466968_0000486_6551_7159 176
81 3300044735 Ga0466968_0070302 Ga0466968_0070302_47_655 176
82 3300044765 Ga0466970_0012873 Ga0466970_0012873_2639_3247 176
83 3300044842 Ga0466957_0402621 Ga0466957_0402621_106_714 176
84 3300049741 Ga0501079_0407681 Ga0501079_0407681_288_959 176
85 3300005840 Ga0068870_10129390 Ga0068870_101293902 177
86 3300006038 Ga0075365_10352554 Ga0075365_103525542 177
87 3300014969 Ga0157376_10911667 Ga0157376_109116671 177
88 3300037853 Ga0436364_0609479 Ga0436364_0609479_4253_4864 177
89 3300039453 Ga0436362_0326418 Ga0436362_0326418_81_692 177
90 3300044693 Ga0466961_0362335 Ga0466961_0362335_236_847 177
91 3300044694 Ga0466963_0010998 Ga0466963_0010998_1982_2593 177
92 3300044719 Ga0466971_0020494 Ga0466971_0020494_1584_2195 177
93 3300044735 Ga0466968_0042015 Ga0466968_0042015_1134_1745 177
94 3300044842 Ga0466957_0015313 Ga0466957_0015313_436_1047 177
95 3300044901 Ga0466960_0130626 Ga0466960_0130626_646_1293 177
96 3300045049 Ga0466959_0020923 Ga0466959_0020923_760_1371 177
97 3300045049 Ga0466959_0396040 Ga0466959_0396040_32_643 177
98 3300045836 Ga0466958_0000204 Ga0466958_0000204_590_1201 177
99 3300045976 Ga0466967_0011609 Ga0466967_0011609_598_1209 177
100 3300045976 Ga0466967_0405487 Ga0466967_0405487_417_1028 177
101 3300045976 Ga0466967_0734276 Ga0466967_0734276_88_735 177
102 3300046517 Ga0495630_0214642 Ga0495630_0214642_41_658 177
103 3300047319 Ga0495674_0258506 Ga0495674_0258506_446_1063 177
104 3300049571 Ga0501034_0074273 Ga0501034_0074273_1282_1944 177
105 3300049571 Ga0501034_0336784 Ga0501034_0336784_66_728 177
106 3300049589 Ga0501073_0070083 Ga0501073_0070083_967_1629 177
107 3300050492 nmdc:mga0yw44_228054_c1 nmdc:mga0yw44_228054_c1_259_921 177
108 3300053087 Ga0500643_001399 Ga0500643_001399_5708_6334 177
109 3300060353 Ga0501082_0005640 Ga0501082_0005640_656_1318 177
110 3300001989 JGI24739J22299_10015093 JGI24739J22299_100150932 178
111 3300002067 JGI24735J21928_10042822 JGI24735J21928_100428222 178
112 3300005329 Ga0070683_100185557 Ga0070683_1001855574 178
113 3300005337 Ga0070682_100088892 Ga0070682_1000888922 178
114 3300005364 Ga0070673_100399598 Ga0070673_1003995981 178
115 3300005457 Ga0070662_100176821 Ga0070662_1001768212 178
116 3300005564 Ga0070664_100343908 Ga0070664_1003439082 178
117 3300005719 Ga0068861_100246310 Ga0068861_1002463102 178
118 3300005842 Ga0068858_101166816 Ga0068858_1011668162 178
119 3300013104 Ga0157370_11111278 Ga0157370_111112781 178
120 3300013105 Ga0157369_10526647 Ga0157369_105266472 178
121 3300013308 Ga0157375_10511765 Ga0157375_105117652 178
122 3300014325 Ga0163163_10271964 Ga0163163_102719642 178
123 3300014326 Ga0157380_10403622 Ga0157380_104036222 178
124 3300014969 Ga0157376_10110820 Ga0157376_101108201 178
125 3300020077 Ga0206351_10226257 Ga0206351_102262572 178
126 3300020078 Ga0206352_10359880 Ga0206352_103598802 178
127 3300020081 Ga0206354_11190231 Ga0206354_111902312 178
128 3300025931 Ga0207644_10268728 Ga0207644_102687282 178
129 3300025933 Ga0207706_10205280 Ga0207706_102052802 178
130 3300025937 Ga0207669_10851351 Ga0207669_108513511 178
131 3300025944 Ga0207661_10073110 Ga0207661_100731103 178
132 3300025945 Ga0207679_10257003 Ga0207679_102570032 178
133 3300025960 Ga0207651_11088257 Ga0207651_110882571 178
134 3300026118 Ga0207675_100048408 Ga0207675_1000484082 178
135 3300031507 Ga0307509_10123660 Ga0307509_101236604 178
136 3300035695 Ga0373927_0145046 Ga0373927_0145046_186_803 178
137 3300035725 Ga0373947_0331631 Ga0373947_0331631_329_946 178
138 3300039437 Ga0436365_0762988 Ga0436365_0762988_11244_11861 178
139 3300041451 Ga0451791_0096474 Ga0451791_0096474_402_1061 178
140 3300041459 Ga0451800_0561091 Ga0451800_0561091_171_830 178
141 3300041460 Ga0451802_2154649 Ga0451802_2154649_211_870 178
142 3300041494 Ga0451837_0481824 Ga0451837_0481824_77_736 178
143 3300041498 Ga0451841_0835936 Ga0451841_0835936_510_1169 178
144 3300042876 Ga0451577_0967719 Ga0451577_0967719_95_715 178
145 3300044684 Ga0466966_0238565 Ga0466966_0238565_252_902 178
146 3300044693 Ga0466961_0354713 Ga0466961_0354713_205_855 178
147 3300044719 Ga0466971_0027320 Ga0466971_0027320_88_738 178
148 3300045049 Ga0466959_0337545 Ga0466959_0337545_183_833 178
149 3300045836 Ga0466958_0283433 Ga0466958_0283433_180_830 178
150 3300046683 Ga0495658_0066758 Ga0495658_0066758_726_1343 178
151 3300048911 Ga0496108_0910509 Ga0496108_0910509_95_712 178
152 3300048917 Ga0496114_0020960 Ga0496114_0020960_4341_5000 178
153 3300049586 Ga0501070_0092747 Ga0501070_0092747_424_1077 178
154 3300049823 Ga0501044_0274880 Ga0501044_0274880_698_1345 178
155 3300061719 Ga0466962_0282498 Ga0466962_0282498_24_674 178
156 3300005544 Ga0070686_100098390 Ga0070686_1000983901 180
157 3300005937 Ga0081455_10116192 Ga0081455_101161922 180
158 3300014325 Ga0163163_10338066 Ga0163163_103380663 180
159 3300014326 Ga0157380_10543899 Ga0157380_105438992 180
160 3300024227 Ga0228598_1008522 Ga0228598_10085223 180
161 3300031251 Ga0265327_10200237 Ga0265327_102002371 180
162 3300049533 Ga0501317_028116 Ga0501317_028116_12_683 180
163 3300000305 bgg_mtDRAFT_1030653 bgg_mtDRAFT_10306532 181
164 3300003574 Ga0007410J51695_1049944 Ga0007410J51695_10499442 181
165 3300005354 Ga0070675_100554364 Ga0070675_1005543641 181
166 3300005937 Ga0081455_10000358 Ga0081455_1000035875 181
167 3300020075 Ga0206349_1010653 Ga0206349_10106532 181
168 3300022467 Ga0224712_10000839 Ga0224712_100008397 181
169 3300026067 Ga0207678_10232913 Ga0207678_102329132 181
170 3300026095 Ga0207676_10888124 Ga0207676_108881242 181
171 3300044693 Ga0466961_0212306 Ga0466961_0212306_137_799 181
172 3300044901 Ga0466960_0172686 Ga0466960_0172686_26_688 181
173 3300046517 Ga0495630_0242669 Ga0495630_0242669_261_887 181
174 3300046525 Ga0495663_0124109 Ga0495663_0124109_156_824 181
175 3300046539 Ga0495621_0150520 Ga0495621_0150520_153_821 181
176 3300046615 Ga0495656_0387812 Ga0495656_0387812_10_678 181
177 3300049531 Ga0501315_002651 Ga0501315_002651_400_1062 181
178 3300049580 Ga0501046_0670659 Ga0501046_0670659_48_710 181
179 3300005337 Ga0070682_100258332 Ga0070682_1002583321 182
180 3300006175 Ga0070712_100271045 Ga0070712_1002710452 182
181 3300009148 Ga0105243_10280358 Ga0105243_102803582 182
182 3300013308 Ga0157375_10436765 Ga0157375_104367653 182
183 3300025918 Ga0207662_10237937 Ga0207662_102379372 182
184 3300025944 Ga0207661_10503674 Ga0207661_105036742 182
185 3300026041 Ga0207639_10147884 Ga0207639_101478842 182
186 3300026142 Ga0207698_10705229 Ga0207698_107052292 182
187 3300042439 Ga0439464_0042735 Ga0439464_0042735_121_786 182
188 3300044901 Ga0466960_0296161 Ga0466960_0296161_223_888 182
189 3300045976 Ga0466967_0135707 Ga0466967_0135707_1411_2064 182
190 3300048905 Ga0496102_0362181 Ga0496102_0362181_421_1086 182
191 3300048909 Ga0496106_0481970 Ga0496106_0481970_106_771 182
192 3300049582 Ga0501048_0344474 Ga0501048_0344474_224_889 182
193 3300050493 nmdc:mga0k408_29434_c2 nmdc:mga0k408_29434_c2_939_1580 182
194 3300060353 Ga0501082_0399286 Ga0501082_0399286_173_838 182
195 3300004799 Ga0058863_10068171 Ga0058863_100681713 183
196 3300005336 Ga0070680_100562669 Ga0070680_1005626692 183
197 3300005439 Ga0070711_100054866 Ga0070711_1000548661 183
198 3300005467 Ga0070706_100045657 Ga0070706_1000456577 183
199 3300005530 Ga0070679_100518836 Ga0070679_1005188362 183
200 3300005535 Ga0070684_100284428 Ga0070684_1002844281 183
201 3300005616 Ga0068852_100538807 Ga0068852_1005388072 183
202 3300005985 Ga0081539_10195026 Ga0081539_101950262 183
203 3300013307 Ga0157372_10406546 Ga0157372_104065462 183
204 3300025917 Ga0207660_10319617 Ga0207660_103196172 183
205 3300025919 Ga0207657_10099113 Ga0207657_100991132 183
206 3300025921 Ga0207652_10168310 Ga0207652_101683103 183
207 3300025944 Ga0207661_10614217 Ga0207661_106142172 183
208 3300025981 Ga0207640_10711425 Ga0207640_107114251 183
209 3300026078 Ga0207702_10837666 Ga0207702_108376661 183
210 3300039437 Ga0436365_0074439 Ga0436365_0074439_50_763 183
211 3300044658 Ga0466972_0185212 Ga0466972_0185212_66_728 183
212 3300044901 Ga0466960_0208060 Ga0466960_0208060_200_862 183
213 3300045049 Ga0466959_0343267 Ga0466959_0343267_35_697 183
214 3300045836 Ga0466958_0081408 Ga0466958_0081408_1261_1923 183
215 3300045976 Ga0466967_0419223 Ga0466967_0419223_177_839 183
216 3300045976 Ga0466967_0817516 Ga0466967_0817516_230_892 183
217 3300045976 Ga0466967_1098759 Ga0466967_1098759_107_769 183
218 3300045976 Ga0466967_1253568 Ga0466967_1253568_12_674 183
219 3300048914 Ga0496111_0355284 Ga0496111_0355284_365_1027 183
220 3300048915 Ga0496112_0303009 Ga0496112_0303009_472_1134 183
221 3300059640 Ga0587067_036323 Ga0587067_036323_248_910 183
222 iso_pu_bacteria 2832004796 2832006216 183
223 iso_pu_bacteria 2866065130 2866068653 183
224 iso_pu_bacteria 8053945823 8053948646 183
225 3300003203 JGI25406J46586_10080928 JGI25406J46586_100809282 184
226 3300003790 Ga0055528_1028040 Ga0055528_10280402 184
227 3300003792 Ga0055540_1032500 Ga0055540_10325002 184
228 3300005455 Ga0070663_100277419 Ga0070663_1002774192 184
229 3300005548 Ga0070665_100851907 Ga0070665_1008519072 184
230 3300005985 Ga0081539_10008334 Ga0081539_100083343 184
231 3300006038 Ga0075365_10131428 Ga0075365_101314284 184
232 3300006186 Ga0075369_10003472 Ga0075369_100034725 184
233 3300013296 Ga0157374_10258077 Ga0157374_102580771 184
234 3300025273 Ga0209673_1014659 Ga0209673_10146593 184
235 3300025303 Ga0209051_1006603 Ga0209051_10066036 184
236 3300025303 Ga0209051_1022538 Ga0209051_10225384 184
237 3300026067 Ga0207678_10126588 Ga0207678_101265884 184
238 3300031995 Ga0307409_100535232 Ga0307409_1005352322 184
239 3300037853 Ga0436364_0474963 Ga0436364_0474963_135_794 184
240 3300041443 Ga0451789_1121233 Ga0451789_1121233_163_795 184
241 3300041444 Ga0451790_41903 Ga0451790_41903_82_732 184
242 3300041452 Ga0451793_1640064 Ga0451793_1640064_136_786 184
243 3300041456 Ga0451795_0239065 Ga0451795_0239065_301_951 184
244 3300044684 Ga0466966_0222754 Ga0466966_0222754_442_1107 184
245 3300044693 Ga0466961_0084014 Ga0466961_0084014_1327_1992 184
246 3300044694 Ga0466963_0043465 Ga0466963_0043465_2072_2707 184
247 3300044694 Ga0466963_0439253 Ga0466963_0439253_225_890 184
248 3300044706 Ga0466964_0067476 Ga0466964_0067476_630_1295 184
249 3300044719 Ga0466971_0157034 Ga0466971_0157034_305_970 184
250 3300044842 Ga0466957_0323835 Ga0466957_0323835_35_700 184
251 3300045049 Ga0466959_0163205 Ga0466959_0163205_759_1424 184
252 3300045836 Ga0466958_0182580 Ga0466958_0182580_116_781 184
253 3300045976 Ga0466967_0278076 Ga0466967_0278076_485_1120 184
254 3300048904 Ga0496101_0567174 Ga0496101_0567174_47_715 184
255 3300048914 Ga0496111_0453728 Ga0496111_0453728_63_713 184
256 3300048926 Ga0496123_0220556 Ga0496123_0220556_121_771 184
257 3300049538 Ga0501322_001076 Ga0501322_001076_608_1273 184
258 3300049539 Ga0501323_003056 Ga0501323_003056_230_895 184
259 3300049588 Ga0501072_0404589 Ga0501072_0404589_20_694 184
260 3300050492 nmdc:mga0yw44_502554_c1 nmdc:mga0yw44_502554_c1_154_804 184
261 3300050496 nmdc:mga07m45_336845_c1 nmdc:mga07m45_336845_c1_74_724 184
262 3300050516 nmdc:mga0sz30_57331_c1 nmdc:mga0sz30_57331_c1_305_955 184
263 3300053136 Ga0500559_0010418 Ga0500559_0010418_1745_2383 184
264 3300061719 Ga0466962_0157458 Ga0466962_0157458_310_975 184
265 iso_pu_bacteria 2501939600 2501945913 184
266 iso_pu_bacteria 2515154088 2515496700 184
267 iso_pu_bacteria 2515154129 2515718299 184
268 iso_pu_bacteria 2515154137 2515756939 184
269 iso_pu_bacteria 2515154202 2516083541 184
270 iso_pu_bacteria 2515154203 2516089477 184
271 iso_pu_bacteria 2622736626 2623585047 184
272 iso_pu_bacteria 2675903059 2676480121 184
273 iso_pu_bacteria 2751185782 2753265156 184
274 iso_pu_bacteria 2772190715 2772644881 184
275 iso_pu_bacteria 2831935698 2831941125 184
276 iso_pu_bacteria 2855670206 2855673802 184
277 iso_pu_bacteria 2855676851 2855681668 184
278 iso_pu_bacteria 2855683550 2855684509 184
279 iso_pu_bacteria 2856858025 2856858876 184
280 iso_pu_bacteria 2857288857 2857290727 184
281 iso_pu_bacteria 2858848962 2858850633 184
282 iso_pu_bacteria 2858868258 2858875159 184
283 iso_pu_bacteria 2858882152 2858888070 184
284 iso_pu_bacteria 2858888857 2858891000 184
285 iso_pu_bacteria 2858895516 2858897621 184
286 iso_pu_bacteria 2858902515 2858902927 184
287 iso_pu_bacteria 2867302475 2867307175 184
288 iso_pu_bacteria 2867312974 2867319336 184
289 iso_pu_bacteria 2867319477 2867325463 184
290 iso_pu_bacteria 2867507094 2867510869 184
291 iso_pu_bacteria 2869048445 2869050069 184
292 iso_pu_bacteria 2869061728 2869063923 184
293 iso_pu_bacteria 2869068681 2869071877 184
294 iso_pu_bacteria 2880489317 2880495217 184
295 iso_pu_bacteria 2880495981 2880497128 184
296 iso_pu_bacteria 2887478801 2887486664 184
297 iso_pu_bacteria 2902582711 2902583763 184
298 iso_pu_bacteria 2929219909 2929225727 184
299 iso_pu_bacteria 2929226422 2929231296 184
300 iso_pu_bacteria 2996221748 2996223700 184
301 iso_pu_bacteria 649633069 649810784 184
302 iso_pu_bacteria 8001781756 8001785178 184
303 iso_pu_bacteria 8003830390 8003835127 184
304 iso_pu_bacteria 8003856774 8003862004 184
305 iso_pu_bacteria 8003870546 8003872914 184
306 iso_pu_bacteria 8054704163 8054706717 184
307 iso_pu_bacteria 8054727385 8054733676 184
308 iso_pu_bacteria 8054734606 8054740764 184
309 iso_pu_bacteria 8055412473 8055412852 184
310 3300002077 JGI24744J21845_10003031 JGI24744J21845_100030315 185
311 3300005345 Ga0070692_10051941 Ga0070692_100519414 185
312 3300005365 Ga0070688_100452195 Ga0070688_1004521952 185
313 3300005366 Ga0070659_100451498 Ga0070659_1004514982 185
314 3300005436 Ga0070713_100044010 Ga0070713_1000440103 185
315 3300005438 Ga0070701_10079227 Ga0070701_100792272 185
316 3300005439 Ga0070711_100754614 Ga0070711_1007546142 185
317 3300005444 Ga0070694_100092972 Ga0070694_1000929722 185
318 3300005444 Ga0070694_100161251 Ga0070694_1001612513 185
319 3300005445 Ga0070708_100450132 Ga0070708_1004501322 185
320 3300005456 Ga0070678_100139403 Ga0070678_1001394033 185
321 3300005456 Ga0070678_100155183 Ga0070678_1001551832 185
322 3300005457 Ga0070662_100354667 Ga0070662_1003546672 185
323 3300005549 Ga0070704_100360714 Ga0070704_1003607142 185
324 3300005614 Ga0068856_100396727 Ga0068856_1003967272 185
325 3300005718 Ga0068866_10178141 Ga0068866_101781412 185
326 3300005719 Ga0068861_100626684 Ga0068861_1006266842 185
327 3300005844 Ga0068862_100128392 Ga0068862_1001283922 185
328 3300005937 Ga0081455_10001741 Ga0081455_100017414 185
329 3300006175 Ga0070712_100060728 Ga0070712_1000607284 185
330 3300006177 Ga0075362_10246590 Ga0075362_102465902 185
331 3300006237 Ga0097621_100509710 Ga0097621_1005097101 185
332 3300006871 Ga0075434_100817323 Ga0075434_1008173231 185
333 3300006881 Ga0068865_100050893 Ga0068865_1000508934 185
334 3300009147 Ga0114129_10670423 Ga0114129_106704232 185
335 3300009148 Ga0105243_10309566 Ga0105243_103095662 185
336 3300010159 Ga0099796_10002533 Ga0099796_100025337 185
337 3300013105 Ga0157369_10535575 Ga0157369_105355752 185
338 3300025899 Ga0207642_10205279 Ga0207642_102052792 185
339 3300025901 Ga0207688_10003298 Ga0207688_100032989 185
340 3300025904 Ga0207647_10113967 Ga0207647_101139671 185
341 3300025915 Ga0207693_10011155 Ga0207693_100111558 185
342 3300025918 Ga0207662_10106601 Ga0207662_101066012 185
343 3300025928 Ga0207700_10107939 Ga0207700_101079393 185
344 3300025932 Ga0207690_10501275 Ga0207690_105012751 185
345 3300025935 Ga0207709_10127337 Ga0207709_101273373 185
346 3300025939 Ga0207665_10144319 Ga0207665_101443192 185
347 3300025961 Ga0207712_10136659 Ga0207712_101366592 185
348 3300025981 Ga0207640_10110526 Ga0207640_101105262 185
349 3300026067 Ga0207678_10163083 Ga0207678_101630832 185
350 3300026118 Ga0207675_100155955 Ga0207675_1001559552 185
351 3300026121 Ga0207683_10176704 Ga0207683_101767043 185
352 3300030522 Ga0307512_10126911 Ga0307512_101269112 185
353 3300031251 Ga0265327_10000532 Ga0265327_1000053259 185
354 3300032126 Ga0307415_100569857 Ga0307415_1005698572 185
355 3300034819 Ga0373958_0050950 Ga0373958_0050950_53_706 185
356 3300035086 Ga0373934_0159858 Ga0373934_0159858_82_717 185
357 3300035090 Ga0373949_0034117 Ga0373949_0034117_438_1091 185
358 3300035091 Ga0373951_0105975 Ga0373951_0105975_42_695 185
359 3300035112 Ga0373932_0039400 Ga0373932_0039400_301_954 185
360 3300036457 Ga0265778_000068 Ga0265778_000068_5238_5945 185
361 3300037068 Ga0373925_0000004 Ga0373925_0000004_297878_298513 185
362 3300037853 Ga0436364_0804097 Ga0436364_0804097_3185_3823 185
363 3300041411 Ga0439466_0001181 Ga0439466_0001181_7754_8407 185
364 3300041413 Ga0439465_0006627 Ga0439465_0006627_2708_3361 185
365 3300041460 Ga0451802_1165056 Ga0451802_1165056_392_1063 185
366 3300042002 Ga0439442_018239 Ga0439442_018239_708_1361 185
367 3300042435 Ga0439434_0027079 Ga0439434_0027079_651_1304 185
368 3300044656 Ga0466969_0044552 Ga0466969_0044552_1412_2065 185
369 3300044658 Ga0466972_0003814 Ga0466972_0003814_1489_2142 185
370 3300044658 Ga0466972_0125368 Ga0466972_0125368_459_1112 185
371 3300044693 Ga0466961_0023040 Ga0466961_0023040_2228_2881 185
372 3300044694 Ga0466963_0009270 Ga0466963_0009270_4728_5372 185
373 3300044706 Ga0466964_0045118 Ga0466964_0045118_511_1164 185
374 3300044719 Ga0466971_0053662 Ga0466971_0053662_24_677 185
375 3300044735 Ga0466968_0020505 Ga0466968_0020505_267_920 185
376 3300044765 Ga0466970_0015365 Ga0466970_0015365_328_981 185
377 3300044765 Ga0466970_0356700 Ga0466970_0356700_45_689 185
378 3300044842 Ga0466957_0119110 Ga0466957_0119110_765_1418 185
379 3300044842 Ga0466957_0514271 Ga0466957_0514271_14_646 185
380 3300045049 Ga0466959_0098070 Ga0466959_0098070_24_677 185
381 3300045836 Ga0466958_0004872 Ga0466958_0004872_3625_4269 185
382 3300045836 Ga0466958_0069625 Ga0466958_0069625_15_668 185
383 3300045976 Ga0466967_0011706 Ga0466967_0011706_4338_4982 185
384 3300045976 Ga0466967_0025348 Ga0466967_0025348_375_1043 185
385 3300045976 Ga0466967_0058209 Ga0466967_0058209_2213_2866 185
386 3300046515 Ga0495620_0093171 Ga0495620_0093171_443_1096 185
387 3300048904 Ga0496101_0132391 Ga0496101_0132391_535_1188 185
388 3300048905 Ga0496102_0426820 Ga0496102_0426820_266_919 185
389 3300048905 Ga0496102_0435036 Ga0496102_0435036_177_821 185
390 3300048908 Ga0496105_0270006 Ga0496105_0270006_542_1225 185
391 3300048908 Ga0496105_0500155 Ga0496105_0500155_39_683 185
392 3300048909 Ga0496106_0198919 Ga0496106_0198919_218_871 185
393 3300048910 Ga0496107_0083063 Ga0496107_0083063_436_1089 185
394 3300048911 Ga0496108_0016331 Ga0496108_0016331_597_1280 185
395 3300048912 Ga0496109_0015777 Ga0496109_0015777_2129_2812 185
396 3300048913 Ga0496110_0012641 Ga0496110_0012641_2320_3003 185
397 3300048914 Ga0496111_0615323 Ga0496111_0615323_86_769 185
398 3300048915 Ga0496112_0005193 Ga0496112_0005193_963_1616 185
399 3300048918 Ga0496115_0410200 Ga0496115_0410200_285_968 185
400 3300048918 Ga0496115_0641861 Ga0496115_0641861_176_811 185
401 3300048922 Ga0496119_0000251 Ga0496119_0000251_34026_34670 185
402 3300048923 Ga0496120_0041312 Ga0496120_0041312_381_1025 185
403 3300048929 Ga0496126_0365010 Ga0496126_0365010_527_1162 185
404 3300049127 Ga0501306_001772 Ga0501306_001772_763_1428 185
405 3300049129 Ga0501309_022011 Ga0501309_022011_64_699 185
406 3300049534 Ga0501318_002278 Ga0501318_002278_702_1367 185
407 3300049537 Ga0501321_004026 Ga0501321_004026_650_1306 185
408 3300049586 Ga0501070_0489176 Ga0501070_0489176_130_765 185
409 3300050489 nmdc:mga03683_224185_c1 nmdc:mga03683_224185_c1_190_843 185
410 3300050507 nmdc:mga05p37_742221_c1 nmdc:mga05p37_742221_c1_166_828 185
411 3300050512 nmdc:mga0n895_644806_c1 nmdc:mga0n895_644806_c1_214_876 185
412 3300053083 Ga0495655_0026808 Ga0495655_0026808_568_1221 185
413 3300059626 Ga0587115_005698 Ga0587115_005698_638_1285 185
414 3300059647 Ga0587079_057636 Ga0587079_057636_38_691 185
415 3300061719 Ga0466962_0019238 Ga0466962_0019238_1956_2600 185
416 iso_pu_bacteria 2547132111 2547411384 185
417 iso_pu_bacteria 2554235005 2554256786 185
418 iso_pu_bacteria 2582581313 2585306364 185
419 iso_pu_bacteria 2582581314 2585319597 185
420 iso_pu_bacteria 2616644814 2616696786 185
421 iso_pu_bacteria 2643221548 2643764762 185
422 iso_pu_bacteria 2643221578 2643902932 185
423 iso_pu_bacteria 2643221601 2644014455 185
424 iso_pu_bacteria 2643221631 2644175892 185
425 iso_pu_bacteria 2643221647 2644261597 185
426 iso_pu_bacteria 2643221673 2644404558 185
427 iso_pu_bacteria 2643221678 2644439340 185
428 iso_pu_bacteria 2643221682 2644462147 185
429 iso_pu_bacteria 2643221714 2644633285 185
430 iso_pu_bacteria 2675903060 2676494454 185
431 iso_pu_bacteria 2738543005 2739202790 185
432 iso_pu_bacteria 2767802112 2768644101 185
433 iso_pu_bacteria 2784746763 2785341870 185
434 iso_pu_bacteria 2784746768 2785370773 185
435 iso_pu_bacteria 2786546132 2786671957 185
436 iso_pu_bacteria 2791355406 2793976330 185
437 iso_pu_bacteria 2802429296 2804845543 185
438 iso_pu_bacteria 2808606359 2808843341 185
439 iso_pu_bacteria 2808606375 2808912923 185
440 iso_pu_bacteria 2808606982 2811845102 185
441 iso_pu_bacteria 2811994879 2812356704 185
442 iso_pu_bacteria 2811994917 2812479417 185
443 iso_pu_bacteria 2818991463 2819695228 185
444 iso_pu_bacteria 2818991472 2819742256 185
445 iso_pu_bacteria 2852635781 2852643148 185
446 iso_pu_bacteria 2861520306 2861525592 185
447 iso_pu_bacteria 2862178590 2862185322 185
448 iso_pu_bacteria 2862281513 2862287006 185
449 iso_pu_bacteria 2862290372 2862292119 185
450 iso_pu_bacteria 2862382967 2862391271 185
451 iso_pu_bacteria 2862574272 2862578179 185
452 iso_pu_bacteria 2862705112 2862709736 185
453 iso_pu_bacteria 2863404153 2863411557 185
454 iso_pu_bacteria 2867346516 2867349898 185
455 iso_pu_bacteria 2867428634 2867429988 185
456 iso_pu_bacteria 2873314349 2873322147 185
457 iso_pu_bacteria 2875391855 2875396038 185
458 iso_pu_bacteria 2877676314 2877679805 185
459 iso_pu_bacteria 2895427314 2895432708 185
460 iso_pu_bacteria 2912715099 2912718453 185
461 iso_pu_bacteria 2912723979 2912730779 185
462 iso_pu_bacteria 2912757875 2912762124 185
463 iso_pu_bacteria 2919468124 2919470241 185
464 iso_pu_bacteria 2935390628 2935395209 185
465 iso_pu_bacteria 2946045630 2946048593 185
466 iso_pu_bacteria 2946064051 2946069167 185
467 iso_pu_bacteria 2946072368 2946077116 185
468 iso_pu_bacteria 2947224130 2947227769 185
469 iso_pu_bacteria 2954002825 2954003124 185
470 iso_pu_bacteria 2954380949 2954384735 185
471 iso_pu_bacteria 2954673503 2954678229 185
472 iso_pu_bacteria 2954682443 2954685928 185
473 iso_pu_bacteria 2954691527 2954695579 185
474 iso_pu_bacteria 2954701450 2954710773 185
475 iso_pu_bacteria 2954711539 2954715002 185
476 iso_pu_bacteria 2954721474 2954724944 185
477 iso_pu_bacteria 2954731030 2954736874 185
478 iso_pu_bacteria 2954740390 2954743870 185
479 iso_pu_bacteria 2954749733 2954755722 185
480 iso_pu_bacteria 2954759201 2954762823 185
481 iso_pu_bacteria 2966598605 2966601447 185
482 iso_pu_bacteria 2990044586 2990044834 185
483 iso_pu_bacteria 2990059506 2990062313 185
484 iso_pu_bacteria 2995463766 2995468519 185
485 iso_pu_bacteria 2997600082 2997606148 185
486 iso_pu_bacteria 3006321560 3006326221 185
487 iso_pu_bacteria 3006425503 3006427941 185
488 iso_pu_bacteria 3006486233 3006490546 185
489 iso_pu_bacteria 3006493962 3006498829 185
490 iso_pu_bacteria 8008485437 8008490495 185
491 iso_pu_bacteria 8008558824 8008566556 185
492 iso_pu_bacteria 8008574985 8008577805 185
493 iso_pu_bacteria 8025413630 8025417245 185
494 iso_pu_bacteria 8025478263 8025486087 185
495 iso_pu_bacteria 8025524527 8025529797 185
496 iso_pu_bacteria 8025530807 8025532327 185
497 iso_pu_bacteria 8047893842 8047896981 185
498 iso_pu_bacteria 8048127548 8048132577 185
499 iso_pu_bacteria 8048356638 8048361971 185
500 iso_pu_bacteria 8048369669 8048373966 185
501 iso_pu_bacteria 8048379754 8048384261 185
502 iso_pu_bacteria 8048406513 8048413835 185
503 iso_pu_bacteria 8056447290 8056447905 185
504 iso_pu_bacteria 8056667051 8056673138 185
505 iso_pu_bacteria 8056829672 8056837612 185
506 iso_pu_bacteria 8057568493 8057570116 185
507 3300003579 Ga0007429J51699_1095228 Ga0007429J51699_10952281 186
508 3300005328 Ga0070676_10094123 Ga0070676_100941232 186
509 3300005329 Ga0070683_100650117 Ga0070683_1006501172 186
510 3300005331 Ga0070670_100006072 Ga0070670_10000607221 186
511 3300005334 Ga0068869_100140579 Ga0068869_1001405793 186
512 3300005343 Ga0070687_100225679 Ga0070687_1002256792 186
513 3300005354 Ga0070675_100531827 Ga0070675_1005318271 186
514 3300005356 Ga0070674_100286706 Ga0070674_1002867063 186
515 3300005364 Ga0070673_100656108 Ga0070673_1006561082 186
516 3300005366 Ga0070659_100026205 Ga0070659_1000262053 186
517 3300005366 Ga0070659_100224452 Ga0070659_1002244522 186
518 3300005367 Ga0070667_100246680 Ga0070667_1002466803 186
519 3300005455 Ga0070663_100290473 Ga0070663_1002904732 186
520 3300005456 Ga0070678_100061339 Ga0070678_1000613392 186
521 3300005456 Ga0070678_100900508 Ga0070678_1009005081 186
522 3300005457 Ga0070662_100253905 Ga0070662_1002539052 186
523 3300005459 Ga0068867_100038719 Ga0068867_1000387194 186
524 3300005543 Ga0070672_100035129 Ga0070672_1000351293 186
525 3300005544 Ga0070686_100633434 Ga0070686_1006334341 186
526 3300005548 Ga0070665_100053131 Ga0070665_1000531317 186
527 3300005616 Ga0068852_100025908 Ga0068852_1000259083 186
528 3300005618 Ga0068864_100212901 Ga0068864_1002129012 186
529 3300005718 Ga0068866_10221914 Ga0068866_102219142 186
530 3300005840 Ga0068870_10008502 Ga0068870_100085023 186
531 3300005842 Ga0068858_100000010 Ga0068858_100000010128 186
532 3300005843 Ga0068860_100084657 Ga0068860_1000846573 186
533 3300005844 Ga0068862_100018672 Ga0068862_1000186729 186
534 3300005937 Ga0081455_10010015 Ga0081455_100100152 186
535 3300006038 Ga0075365_10399513 Ga0075365_103995132 186
536 3300006048 Ga0075363_100000106 Ga0075363_10000010622 186
537 3300006051 Ga0075364_10000119 Ga0075364_1000011932 186
538 3300006186 Ga0075369_10006299 Ga0075369_100062997 186
539 3300006353 Ga0075370_10014981 Ga0075370_100149817 186
540 3300006881 Ga0068865_100005424 Ga0068865_1000054249 186
541 3300009094 Ga0111539_10058800 Ga0111539_100588003 186
542 3300009101 Ga0105247_10000616 Ga0105247_1000061626 186
543 3300009174 Ga0105241_10074305 Ga0105241_100743052 186
544 3300009545 Ga0105237_10620139 Ga0105237_106201392 186
545 3300013306 Ga0163162_10051528 Ga0163162_100515283 186
546 3300013308 Ga0157375_10321273 Ga0157375_103212732 186
547 3300013308 Ga0157375_10393677 Ga0157375_103936772 186
548 3300014325 Ga0163163_10226042 Ga0163163_102260422 186
549 3300014326 Ga0157380_10001355 Ga0157380_100013553 186
550 3300014968 Ga0157379_10001533 Ga0157379_1000153312 186
551 3300017792 Ga0163161_10750049 Ga0163161_107500492 186
552 3300021384 Ga0213876_10069358 Ga0213876_100693582 186
553 3300025893 Ga0207682_10074637 Ga0207682_100746372 186
554 3300025900 Ga0207710_10000048 Ga0207710_1000004835 186
555 3300025907 Ga0207645_10073765 Ga0207645_100737653 186
556 3300025908 Ga0207643_10017241 Ga0207643_100172414 186
557 3300025918 Ga0207662_10002882 Ga0207662_100028823 186
558 3300025919 Ga0207657_10221848 Ga0207657_102218482 186
559 3300025925 Ga0207650_10243059 Ga0207650_102430592 186
560 3300025932 Ga0207690_10240318 Ga0207690_102403182 186
561 3300025932 Ga0207690_10323138 Ga0207690_103231382 186
562 3300025933 Ga0207706_10013582 Ga0207706_1001358216 186
563 3300025938 Ga0207704_10068008 Ga0207704_100680084 186
564 3300025940 Ga0207691_10000326 Ga0207691_1000032653 186
565 3300025942 Ga0207689_10402061 Ga0207689_104020612 186
566 3300025960 Ga0207651_10639328 Ga0207651_106393282 186
567 3300025961 Ga0207712_10237550 Ga0207712_102375502 186
568 3300025981 Ga0207640_10091049 Ga0207640_100910494 186
569 3300025986 Ga0207658_10463025 Ga0207658_104630252 186
570 3300026035 Ga0207703_10000002 Ga0207703_10000002143 186
571 3300026067 Ga0207678_10131398 Ga0207678_101313982 186
572 3300026067 Ga0207678_10169743 Ga0207678_101697433 186
573 3300026089 Ga0207648_10421373 Ga0207648_104213732 186
574 3300026118 Ga0207675_100002673 Ga0207675_10000267331 186
575 3300026142 Ga0207698_10022546 Ga0207698_100225463 186
576 3300028380 Ga0268265_10281348 Ga0268265_102813482 186
577 3300028381 Ga0268264_10161422 Ga0268264_101614222 186
578 3300028381 Ga0268264_10956317 Ga0268264_109563172 186
579 3300031456 Ga0307513_10007812 Ga0307513_1000781224 186
580 3300031995 Ga0307409_100257608 Ga0307409_1002576082 186
581 3300031995 Ga0307409_100794658 Ga0307409_1007946582 186
582 3300032126 Ga0307415_100551648 Ga0307415_1005516482 186
583 3300038443 Ga0395901_0743827 Ga0395901_0743827_81_722 186
584 3300039437 Ga0436365_0905729 Ga0436365_0905729_8679_9332 186
585 3300044693 Ga0466961_0092886 Ga0466961_0092886_886_1539 186
586 3300044694 Ga0466963_0012628 Ga0466963_0012628_4217_4864 186
587 3300044719 Ga0466971_0162144 Ga0466971_0162144_41_694 186
588 3300044901 Ga0466960_0283163 Ga0466960_0283163_84_737 186
589 3300045049 Ga0466959_0057387 Ga0466959_0057387_1848_2501 186
590 3300045976 Ga0466967_0005067 Ga0466967_0005067_8184_8837 186
591 3300045976 Ga0466967_0039654 Ga0466967_0039654_3038_3691 186
592 3300045976 Ga0466967_0118248 Ga0466967_0118248_310_957 186
593 3300045976 Ga0466967_0697792 Ga0466967_0697792_199_840 186
594 3300048905 Ga0496102_0577315 Ga0496102_0577315_86_745 186
595 3300048905 Ga0496102_1173814 Ga0496102_1173814_10_654 186
596 3300048907 Ga0496104_0331302 Ga0496104_0331302_118_795 186
597 3300048909 Ga0496106_0085258 Ga0496106_0085258_266_925 186
598 3300048909 Ga0496106_0316543 Ga0496106_0316543_328_1062 186
599 3300048910 Ga0496107_0262897 Ga0496107_0262897_325_1059 186
600 3300048910 Ga0496107_0388153 Ga0496107_0388153_249_908 186
601 3300048911 Ga0496108_0301260 Ga0496108_0301260_249_890 186
602 3300048912 Ga0496109_0891408 Ga0496109_0891408_74_751 186
603 3300048913 Ga0496110_0023063 Ga0496110_0023063_4289_4966 186
604 3300048917 Ga0496114_0082355 Ga0496114_0082355_1390_2067 186
605 3300048922 Ga0496119_0083516 Ga0496119_0083516_614_1348 186
606 3300048924 Ga0496121_0004211 Ga0496121_0004211_15494_16228 186
607 3300048929 Ga0496126_0000075 Ga0496126_0000075_188547_189203 186
608 3300048929 Ga0496126_0102990 Ga0496126_0102990_13_747 186
609 3300049574 Ga0501038_0399363 Ga0501038_0399363_243_902 186
610 3300049581 Ga0501047_0077887 Ga0501047_0077887_174_827 186
611 3300049585 Ga0501069_0239381 Ga0501069_0239381_176_853 186
612 3300049586 Ga0501070_0209142 Ga0501070_0209142_896_1549 186
613 3300049824 Ga0501045_0068686 Ga0501045_0068686_1478_2125 186
614 3300050490 nmdc:mga03n38_16479_c1 nmdc:mga03n38_16479_c1_1847_2497 186
615 3300050491 nmdc:mga00v17_2711_c1 nmdc:mga00v17_2711_c1_6772_7422 186
616 3300050492 nmdc:mga0yw44_338424_c1 nmdc:mga0yw44_338424_c1_176_826 186
617 3300050496 nmdc:mga07m45_5415_c1 nmdc:mga07m45_5415_c1_2020_2670 186
618 3300053130 Ga0500642_0006030 Ga0500642_0006030_2688_3338 186
619 3300054114 Ga0501084_0127622 Ga0501084_0127622_1083_1730 186
620 3300059492 Ga0587073_0025384 Ga0587073_0025384_194_853 186
621 3300059655 Ga0587114_006887 Ga0587114_006887_41_718 186
622 3300061719 Ga0466962_0347548 Ga0466962_0347548_52_714 186
623 iso_pu_bacteria 2508501039 2508670640 186
624 iso_pu_bacteria 2517572101 2517762533 186
625 iso_pu_bacteria 2565956761 2566992657 186
626 iso_pu_bacteria 2582580736 2583149007 186
627 iso_pu_bacteria 2675902999 2676199482 186
628 iso_pu_bacteria 2687453737 2689960417 186
629 iso_pu_bacteria 2738541308 2738887461 186
630 iso_pu_bacteria 2738543011 2739236883 186
631 iso_pu_bacteria 2739367654 2739607363 186
632 iso_pu_bacteria 2751185725 2753035686 186
633 iso_pu_bacteria 2751185734 2753069931 186
634 iso_pu_bacteria 2751185792 2753326288 186
635 iso_pu_bacteria 2758568522 2760304729 186
636 iso_pu_bacteria 2773857921 2774844060 186
637 iso_pu_bacteria 2795385472 2795795486 186
638 iso_pu_bacteria 2808606394 2809026243 186
639 iso_pu_bacteria 2856741275 2856746635 186
640 iso_pu_bacteria 2870721527 2870727573 186
641 iso_pu_bacteria 2889300758 2889305776 186
642 iso_pu_bacteria 2891326441 2891331517 186
643 iso_pu_bacteria 2891554331 2891560663 186
644 iso_pu_bacteria 2891562705 2891563450 186
645 iso_pu_bacteria 2904535858 2904538388 186
646 iso_pu_bacteria 2915768154 2915768396 186
647 iso_pu_bacteria 2922554459 2922559120 186
648 iso_pu_bacteria 2939743619 2939743912 186
649 iso_pu_bacteria 8002784119 8002784675 186
650 iso_pu_bacteria 8047710418 8047717781 186
651 3300001979 JGI24740J21852_10057899 JGI24740J21852_100578991 187
652 3300003203 JGI25406J46586_10008422 JGI25406J46586_100084222 187
653 3300003579 Ga0007429J51699_1064416 Ga0007429J51699_10644161 187
654 3300004799 Ga0058863_10052868 Ga0058863_100528682 187
655 3300004799 Ga0058863_10053663 Ga0058863_100536632 187
656 3300004803 Ga0058862_10009112 Ga0058862_100091121 187
657 3300004803 Ga0058862_10069452 Ga0058862_100694522 187
658 3300005329 Ga0070683_100045429 Ga0070683_1000454294 187
659 3300005331 Ga0070670_100025823 Ga0070670_1000258236 187
660 3300005334 Ga0068869_100005700 Ga0068869_1000057003 187
661 3300005334 Ga0068869_100046622 Ga0068869_1000466224 187
662 3300005336 Ga0070680_100031712 Ga0070680_1000317127 187
663 3300005337 Ga0070682_100024938 Ga0070682_1000249387 187
664 3300005338 Ga0068868_100037198 Ga0068868_1000371982 187
665 3300005339 Ga0070660_100018220 Ga0070660_1000182204 187
666 3300005340 Ga0070689_100176864 Ga0070689_1001768642 187
667 3300005341 Ga0070691_10030800 Ga0070691_100308001 187
668 3300005343 Ga0070687_100047013 Ga0070687_1000470133 187
669 3300005344 Ga0070661_100005438 Ga0070661_1000054388 187
670 3300005344 Ga0070661_100079586 Ga0070661_1000795861 187
671 3300005345 Ga0070692_10000540 Ga0070692_100005408 187
672 3300005345 Ga0070692_10049505 Ga0070692_100495052 187
673 3300005356 Ga0070674_100166369 Ga0070674_1001663692 187
674 3300005366 Ga0070659_100010814 Ga0070659_1000108146 187
675 3300005366 Ga0070659_100086347 Ga0070659_1000863472 187
676 3300005435 Ga0070714_100001124 Ga0070714_10000112432 187
677 3300005435 Ga0070714_101081186 Ga0070714_1010811861 187
678 3300005436 Ga0070713_100937751 Ga0070713_1009377512 187
679 3300005437 Ga0070710_10227488 Ga0070710_102274882 187
680 3300005437 Ga0070710_10415813 Ga0070710_104158132 187
681 3300005438 Ga0070701_10132441 Ga0070701_101324412 187
682 3300005441 Ga0070700_100029955 Ga0070700_1000299553 187
683 3300005455 Ga0070663_100013761 Ga0070663_1000137612 187
684 3300005455 Ga0070663_100018387 Ga0070663_1000183874 187
685 3300005457 Ga0070662_100129509 Ga0070662_1001295093 187
686 3300005458 Ga0070681_10034186 Ga0070681_100341863 187
687 3300005458 Ga0070681_10157605 Ga0070681_101576053 187
688 3300005458 Ga0070681_10196265 Ga0070681_101962652 187
689 3300005530 Ga0070679_100864746 Ga0070679_1008647461 187
690 3300005539 Ga0068853_100081935 Ga0068853_1000819352 187
691 3300005539 Ga0068853_100399305 Ga0068853_1003993052 187
692 3300005545 Ga0070695_100077745 Ga0070695_1000777454 187
693 3300005547 Ga0070693_100026519 Ga0070693_1000265192 187
694 3300005548 Ga0070665_100074736 Ga0070665_1000747364 187
695 3300005548 Ga0070665_100129811 Ga0070665_1001298112 187
696 3300005563 Ga0068855_100001896 Ga0068855_10000189623 187
697 3300005563 Ga0068855_100038609 Ga0068855_1000386093 187
698 3300005578 Ga0068854_100020506 Ga0068854_1000205066 187
699 3300005578 Ga0068854_100030118 Ga0068854_1000301183 187
700 3300005616 Ga0068852_100063129 Ga0068852_1000631293 187
701 3300005618 Ga0068864_100019158 Ga0068864_1000191584 187
702 3300005719 Ga0068861_100035902 Ga0068861_1000359022 187
703 3300005719 Ga0068861_100162109 Ga0068861_1001621092 187
704 3300005834 Ga0068851_10025951 Ga0068851_100259512 187
705 3300005840 Ga0068870_10002912 Ga0068870_100029126 187
706 3300005841 Ga0068863_100009657 Ga0068863_1000096578 187
707 3300005842 Ga0068858_100162412 Ga0068858_1001624122 187
708 3300005985 Ga0081539_10001286 Ga0081539_1000128635 187
709 3300006048 Ga0075363_100127920 Ga0075363_1001279202 187
710 3300006178 Ga0075367_10169555 Ga0075367_101695552 187
711 3300006358 Ga0068871_100032984 Ga0068871_1000329843 187
712 3300006852 Ga0075433_10021719 Ga0075433_100217197 187
713 3300006871 Ga0075434_100046122 Ga0075434_1000461223 187
714 3300006880 Ga0075429_100071803 Ga0075429_1000718034 187
715 3300006914 Ga0075436_100028312 Ga0075436_1000283122 187
716 3300009011 Ga0105251_10033501 Ga0105251_100335013 187
717 3300009093 Ga0105240_10039358 Ga0105240_1003935811 187
718 3300009093 Ga0105240_10046258 Ga0105240_100462588 187
719 3300009093 Ga0105240_10503952 Ga0105240_105039522 187
720 3300009093 Ga0105240_11104473 Ga0105240_111044731 187
721 3300009093 Ga0105240_11127350 Ga0105240_111273502 187
722 3300009094 Ga0111539_10027942 Ga0111539_100279424 187
723 3300009098 Ga0105245_10333831 Ga0105245_103338312 187
724 3300009101 Ga0105247_10017322 Ga0105247_100173223 187
725 3300009147 Ga0114129_10074616 Ga0114129_100746164 187
726 3300009174 Ga0105241_10000758 Ga0105241_100007589 187
727 3300009176 Ga0105242_10105857 Ga0105242_101058571 187
728 3300009545 Ga0105237_10110784 Ga0105237_101107844 187
729 3300009551 Ga0105238_10067498 Ga0105238_100674982 187
730 3300010375 Ga0105239_10058109 Ga0105239_100581093 187
731 3300010375 Ga0105239_10072305 Ga0105239_100723052 187
732 3300013100 Ga0157373_10035320 Ga0157373_100353202 187
733 3300013100 Ga0157373_10042038 Ga0157373_100420383 187
734 3300013104 Ga0157370_10149009 Ga0157370_101490092 187
735 3300013105 Ga0157369_10066458 Ga0157369_100664582 187
736 3300013105 Ga0157369_10141244 Ga0157369_101412443 187
737 3300013296 Ga0157374_10021076 Ga0157374_100210762 187
738 3300013296 Ga0157374_10041287 Ga0157374_100412874 187
739 3300013297 Ga0157378_10585364 Ga0157378_105853642 187
740 3300013306 Ga0163162_10091937 Ga0163162_100919373 187
741 3300014325 Ga0163163_10151780 Ga0163163_101517804 187
742 3300014497 Ga0182008_10126201 Ga0182008_101262012 187
743 3300014968 Ga0157379_10058917 Ga0157379_100589172 187
744 3300020069 Ga0197907_10096039 Ga0197907_100960394 187
745 3300020069 Ga0197907_10496978 Ga0197907_104969782 187
746 3300020069 Ga0197907_10522870 Ga0197907_105228705 187
747 3300020069 Ga0197907_10690248 Ga0197907_106902482 187
748 3300020069 Ga0197907_11065209 Ga0197907_110652092 187
749 3300020069 Ga0197907_11431500 Ga0197907_114315003 187
750 3300020070 Ga0206356_10213503 Ga0206356_102135032 187
751 3300020070 Ga0206356_11184630 Ga0206356_111846302 187
752 3300020070 Ga0206356_11369384 Ga0206356_113693843 187
753 3300020076 Ga0206355_1430284 Ga0206355_14302842 187
754 3300020077 Ga0206351_10493408 Ga0206351_104934082 187
755 3300020077 Ga0206351_10994928 Ga0206351_109949282 187
756 3300020078 Ga0206352_10711453 Ga0206352_107114532 187
757 3300020081 Ga0206354_10067186 Ga0206354_100671863 187
758 3300020081 Ga0206354_10670181 Ga0206354_106701811 187
759 3300020081 Ga0206354_11161385 Ga0206354_111613853 187
760 3300020081 Ga0206354_11585391 Ga0206354_115853913 187
761 3300020082 Ga0206353_10016499 Ga0206353_100164996 187
762 3300020082 Ga0206353_10139517 Ga0206353_101395174 187
763 3300020082 Ga0206353_11185955 Ga0206353_111859554 187
764 3300020082 Ga0206353_12067668 Ga0206353_120676681 187
765 3300021388 Ga0213875_10000362 Ga0213875_100003627 187
766 3300022467 Ga0224712_10006462 Ga0224712_100064624 187
767 3300022467 Ga0224712_10033221 Ga0224712_100332213 187
768 3300022467 Ga0224712_10059899 Ga0224712_100598991 187
769 3300025321 Ga0207656_10021045 Ga0207656_100210452 187
770 3300025735 Ga0207713_1025173 Ga0207713_10251734 187
771 3300025898 Ga0207692_10153227 Ga0207692_101532272 187
772 3300025900 Ga0207710_10004294 Ga0207710_100042944 187
773 3300025900 Ga0207710_10052237 Ga0207710_100522372 187
774 3300025903 Ga0207680_10182435 Ga0207680_101824352 187
775 3300025904 Ga0207647_10000925 Ga0207647_100009252 187
776 3300025904 Ga0207647_10053520 Ga0207647_100535204 187
777 3300025904 Ga0207647_10310694 Ga0207647_103106942 187
778 3300025906 Ga0207699_10001977 Ga0207699_1000197718 187
779 3300025907 Ga0207645_10026924 Ga0207645_100269243 187
780 3300025908 Ga0207643_10002089 Ga0207643_1000208918 187
781 3300025909 Ga0207705_10019993 Ga0207705_100199935 187
782 3300025909 Ga0207705_10042534 Ga0207705_100425342 187
783 3300025911 Ga0207654_10001876 Ga0207654_1000187620 187
784 3300025912 Ga0207707_10008073 Ga0207707_1000807316 187
785 3300025912 Ga0207707_10025263 Ga0207707_100252636 187
786 3300025913 Ga0207695_10000465 Ga0207695_1000046529 187
787 3300025913 Ga0207695_10200713 Ga0207695_102007131 187
788 3300025914 Ga0207671_10000128 Ga0207671_1000012846 187
789 3300025915 Ga0207693_10479160 Ga0207693_104791601 187
790 3300025916 Ga0207663_10110103 Ga0207663_101101034 187
791 3300025918 Ga0207662_10041031 Ga0207662_100410312 187
792 3300025919 Ga0207657_10139191 Ga0207657_101391913 187
793 3300025920 Ga0207649_10005997 Ga0207649_100059972 187
794 3300025921 Ga0207652_10017304 Ga0207652_100173046 187
795 3300025921 Ga0207652_10335708 Ga0207652_103357083 187
796 3300025924 Ga0207694_10000973 Ga0207694_1000097336 187
797 3300025925 Ga0207650_10002981 Ga0207650_100029817 187
798 3300025929 Ga0207664_10001032 Ga0207664_100010322 187
799 3300025929 Ga0207664_10031084 Ga0207664_100310844 187
800 3300025932 Ga0207690_10017412 Ga0207690_100174124 187
801 3300025933 Ga0207706_10058113 Ga0207706_100581132 187
802 3300025937 Ga0207669_10131803 Ga0207669_101318032 187
803 3300025942 Ga0207689_10010197 Ga0207689_100101973 187
804 3300025944 Ga0207661_10050176 Ga0207661_100501763 187
805 3300025945 Ga0207679_10004482 Ga0207679_100044826 187
806 3300025949 Ga0207667_10023995 Ga0207667_1002399514 187
807 3300025949 Ga0207667_10025698 Ga0207667_100256984 187
808 3300025981 Ga0207640_10291816 Ga0207640_102918162 187
809 3300025986 Ga0207658_10088255 Ga0207658_100882554 187
810 3300026023 Ga0207677_10012013 Ga0207677_100120134 187
811 3300026041 Ga0207639_10202696 Ga0207639_102026962 187
812 3300026067 Ga0207678_10010370 Ga0207678_100103703 187
813 3300026067 Ga0207678_10081649 Ga0207678_100816494 187
814 3300026075 Ga0207708_10269709 Ga0207708_102697091 187
815 3300026078 Ga0207702_10723946 Ga0207702_107239462 187
816 3300026095 Ga0207676_10003913 Ga0207676_100039136 187
817 3300026118 Ga0207675_100010883 Ga0207675_1000108832 187
818 3300026118 Ga0207675_100195079 Ga0207675_1001950793 187
819 3300026121 Ga0207683_10021270 Ga0207683_100212707 187
820 3300026142 Ga0207698_10020585 Ga0207698_100205856 187
821 3300026142 Ga0207698_10047860 Ga0207698_100478603 187
822 3300027866 Ga0209813_10005010 Ga0209813_100050106 187
823 3300027907 Ga0207428_10002902 Ga0207428_100029024 187
824 3300028379 Ga0268266_10029441 Ga0268266_100294414 187
825 3300028379 Ga0268266_10051652 Ga0268266_100516523 187
826 3300028794 Ga0307515_10079052 Ga0307515_100790523 187
827 3300031616 Ga0307508_10389274 Ga0307508_103892742 187
828 3300031727 Ga0316576_10072130 Ga0316576_100721302 187
829 3300031728 Ga0316578_10055591 Ga0316578_100555914 187
830 3300031731 Ga0307405_10506853 Ga0307405_105068532 187
831 3300032005 Ga0307411_10082097 Ga0307411_100820974 187
832 3300033541 Ga0316596_1105485 Ga0316596_11054851 187
833 3300035088 Ga0373940_0108640 Ga0373940_0108640_52_717 187
834 3300035398 Ga0316574_0018440 Ga0316574_0018440_569_1225 187
835 3300037418 Ga0395900_0789934 Ga0395900_0789934_115_801 187
836 3300037853 Ga0436364_1367120 Ga0436364_1367120_1515_2168 187
837 3300038443 Ga0395901_0183265 Ga0395901_0183265_1382_2068 187
838 3300039450 Ga0436363_0661252 Ga0436363_0661252_87_740 187
839 3300039450 Ga0436363_0979981 Ga0436363_0979981_207_860 187
840 3300039453 Ga0436362_1138695 Ga0436362_1138695_11756_12397 187
841 3300044693 Ga0466961_0155704 Ga0466961_0155704_203_850 187
842 3300044694 Ga0466963_0049392 Ga0466963_0049392_1246_1908 187
843 3300044694 Ga0466963_0209048 Ga0466963_0209048_174_827 187
844 3300044694 Ga0466963_0482234 Ga0466963_0482234_79_726 187
845 3300044706 Ga0466964_0061966 Ga0466964_0061966_456_1109 187
846 3300044735 Ga0466968_0054416 Ga0466968_0054416_970_1611 187
847 3300044765 Ga0466970_0016993 Ga0466970_0016993_2485_3132 187
848 3300044842 Ga0466957_0014920 Ga0466957_0014920_1375_2037 187
849 3300044842 Ga0466957_0017768 Ga0466957_0017768_896_1549 187
850 3300044842 Ga0466957_0212559 Ga0466957_0212559_590_1237 187
851 3300045836 Ga0466958_0035221 Ga0466958_0035221_1101_1763 187
852 3300045836 Ga0466958_0197048 Ga0466958_0197048_203_856 187
853 3300045836 Ga0466958_0309994 Ga0466958_0309994_49_705 187
854 3300045836 Ga0466958_0346853 Ga0466958_0346853_181_828 187
855 3300045976 Ga0466967_0064424 Ga0466967_0064424_213_887 187
856 3300046454 Ga0495592_0064138 Ga0495592_0064138_1238_1885 187
857 3300046462 Ga0495651_0001372 Ga0495651_0001372_6221_6868 187
858 3300046462 Ga0495651_0179799 Ga0495651_0179799_811_1458 187
859 3300046516 Ga0495628_0031279 Ga0495628_0031279_1731_2378 187
860 3300046529 Ga0495652_0018548 Ga0495652_0018548_945_1592 187
861 3300046543 Ga0495645_0264624 Ga0495645_0264624_236_883 187
862 3300046557 Ga0495622_0050203 Ga0495622_0050203_337_984 187
863 3300046559 Ga0495667_0253014 Ga0495667_0253014_174_821 187
864 3300046679 Ga0495623_0214633 Ga0495623_0214633_270_917 187
865 3300046809 Ga0495600_0006230 Ga0495600_0006230_3430_4077 187
866 3300047315 Ga0495581_0148160 Ga0495581_0148160_366_1013 187
867 3300047317 Ga0495604_0167487 Ga0495604_0167487_806_1453 187
868 3300047319 Ga0495674_0195237 Ga0495674_0195237_771_1418 187
869 3300048903 Ga0496100_0091178 Ga0496100_0091178_223_888 187
870 3300048904 Ga0496101_0114043 Ga0496101_0114043_1294_1980 187
871 3300048905 Ga0496102_0014022 Ga0496102_0014022_3066_3752 187
872 3300048907 Ga0496104_0692354 Ga0496104_0692354_21_683 187
873 3300048908 Ga0496105_0003524 Ga0496105_0003524_6942_7628 187
874 3300048909 Ga0496106_0086126 Ga0496106_0086126_593_1279 187
875 3300048910 Ga0496107_0059749 Ga0496107_0059749_601_1287 187
876 3300048911 Ga0496108_0024748 Ga0496108_0024748_706_1392 187
877 3300048912 Ga0496109_0138295 Ga0496109_0138295_1087_1773 187
878 3300048913 Ga0496110_0001862 Ga0496110_0001862_13106_13792 187
879 3300048913 Ga0496110_0027755 Ga0496110_0027755_131_817 187
880 3300048914 Ga0496111_0012358 Ga0496111_0012358_1667_2353 187
881 3300048914 Ga0496111_0095023 Ga0496111_0095023_702_1367 187
882 3300048914 Ga0496111_0214321 Ga0496111_0214321_321_1007 187
883 3300048917 Ga0496114_0018213 Ga0496114_0018213_2785_3450 187
884 3300048918 Ga0496115_0019772 Ga0496115_0019772_1619_2263 187
885 3300049568 Ga0501031_0021767 Ga0501031_0021767_395_1039 187
886 3300049569 Ga0501032_0040679 Ga0501032_0040679_2177_2836 187
887 3300049569 Ga0501032_0049093 Ga0501032_0049093_592_1236 187
888 3300049569 Ga0501032_0187833 Ga0501032_0187833_390_1037 187
889 3300049570 Ga0501033_0041015 Ga0501033_0041015_642_1301 187
890 3300049571 Ga0501034_0101342 Ga0501034_0101342_631_1275 187
891 3300049572 Ga0501036_0037401 Ga0501036_0037401_3072_3719 187
892 3300049572 Ga0501036_0057534 Ga0501036_0057534_2271_2930 187
893 3300049572 Ga0501036_0078506 Ga0501036_0078506_198_842 187
894 3300049573 Ga0501037_0197034 Ga0501037_0197034_694_1341 187
895 3300049573 Ga0501037_0380679 Ga0501037_0380679_225_890 187
896 3300049573 Ga0501037_0491193 Ga0501037_0491193_73_717 187
897 3300049574 Ga0501038_0021480 Ga0501038_0021480_4767_5414 187
898 3300049574 Ga0501038_0021516 Ga0501038_0021516_5019_5663 187
899 3300049574 Ga0501038_0040267 Ga0501038_0040267_2773_3432 187
900 3300049575 Ga0501039_0005992 Ga0501039_0005992_1639_2298 187
901 3300049575 Ga0501039_0412800 Ga0501039_0412800_277_924 187
902 3300049576 Ga0501040_0094746 Ga0501040_0094746_764_1423 187
903 3300049577 Ga0501041_0025229 Ga0501041_0025229_2271_2930 187
904 3300049578 Ga0501042_0116740 Ga0501042_0116740_620_1279 187
905 3300049578 Ga0501042_0499774 Ga0501042_0499774_191_853 187
906 3300049579 Ga0501043_0024981 Ga0501043_0024981_3519_4166 187
907 3300049579 Ga0501043_0045847 Ga0501043_0045847_528_1187 187
908 3300049580 Ga0501046_0099287 Ga0501046_0099287_315_959 187
909 3300049580 Ga0501046_0198737 Ga0501046_0198737_648_1307 187
910 3300049581 Ga0501047_0000278 Ga0501047_0000278_55072_55734 187
911 3300049581 Ga0501047_0000811 Ga0501047_0000811_25635_26279 187
912 3300049581 Ga0501047_0042683 Ga0501047_0042683_535_1182 187
913 3300049582 Ga0501048_0000853 Ga0501048_0000853_11271_11915 187
914 3300049582 Ga0501048_0052303 Ga0501048_0052303_558_1205 187
915 3300049582 Ga0501048_0060350 Ga0501048_0060350_1890_2549 187
916 3300049582 Ga0501048_0308574 Ga0501048_0308574_239_901 187
917 3300049584 Ga0501068_0156729 Ga0501068_0156729_140_808 187
918 3300049584 Ga0501068_0157509 Ga0501068_0157509_529_1188 187
919 3300049585 Ga0501069_0075715 Ga0501069_0075715_653_1312 187
920 3300049586 Ga0501070_0074271 Ga0501070_0074271_445_1116 187
921 3300049586 Ga0501070_0092327 Ga0501070_0092327_1239_1883 187
922 3300049586 Ga0501070_0127041 Ga0501070_0127041_461_1120 187
923 3300049587 Ga0501071_0003704 Ga0501071_0003704_4573_5232 187
924 3300049588 Ga0501072_0027310 Ga0501072_0027310_3585_4256 187
925 3300049589 Ga0501073_0332810 Ga0501073_0332810_375_1034 187
926 3300049590 Ga0501074_0002804 Ga0501074_0002804_10974_11621 187
927 3300049591 Ga0501075_0212740 Ga0501075_0212740_646_1305 187
928 3300049592 Ga0501076_0044047 Ga0501076_0044047_1086_1745 187
929 3300049592 Ga0501076_0427391 Ga0501076_0427391_29_676 187
930 3300049741 Ga0501079_0022088 Ga0501079_0022088_605_1264 187
931 3300049744 Ga0501083_0171938 Ga0501083_0171938_331_990 187
932 3300049822 Ga0501035_0050048 Ga0501035_0050048_474_1133 187
933 3300049823 Ga0501044_0067971 Ga0501044_0067971_225_869 187
934 3300049823 Ga0501044_0215672 Ga0501044_0215672_1047_1706 187
935 3300049823 Ga0501044_0798201 Ga0501044_0798201_139_783 187
936 3300049824 Ga0501045_0133376 Ga0501045_0133376_616_1275 187
937 3300050490 nmdc:mga03n38_372_c1 nmdc:mga03n38_372_c1_9008_9679 187
938 3300050494 nmdc:mga06z11_1560_c1 nmdc:mga06z11_1560_c1_6312_6983 187
939 3300050495 nmdc:mga04h51_5654_c1 nmdc:mga04h51_5654_c1_29_700 187
940 3300050507 nmdc:mga05p37_56839_c1 nmdc:mga05p37_56839_c1_1973_2659 187
941 3300050507 nmdc:mga05p37_978454_c1 nmdc:mga05p37_978454_c1_36_695 187
942 3300050508 nmdc:mga09592_61988_c1 nmdc:mga09592_61988_c1_2150_2791 187
943 3300050510 nmdc:mga06r32_75743_c1 nmdc:mga06r32_75743_c1_553_1239 187
944 3300050511 nmdc:mga08y16_20496_c1 nmdc:mga08y16_20496_c1_2534_3220 187
945 3300050512 nmdc:mga0n895_26293_c1 nmdc:mga0n895_26293_c1_3033_3719 187
946 3300050514 nmdc:mga08x19_4935_c1 nmdc:mga08x19_4935_c1_144_830 187
947 3300050515 nmdc:mga0a205_3656_c1 nmdc:mga0a205_3656_c1_3156_3842 187
948 3300053077 Ga0495601_0009788 Ga0495601_0009788_4153_4800 187
949 3300053077 Ga0495601_0113550 Ga0495601_0113550_942_1589 187
950 3300053078 Ga0495612_0004918 Ga0495612_0004918_249_896 187
951 3300053093 Ga0500651_0214064 Ga0500651_0214064_246_896 187
952 3300053140 Ga0500573_0041685 Ga0500573_0041685_1674_2321 187
953 3300054114 Ga0501084_0007241 Ga0501084_0007241_3222_3881 187
954 3300059492 Ga0587073_0015223 Ga0587073_0015223_89_748 187
955 3300059503 Ga0587080_010714 Ga0587080_010714_65_724 187
956 3300059504 Ga0587082_007662 Ga0587082_007662_634_1293 187
957 3300059508 Ga0587088_005301 Ga0587088_005301_765_1424 187
958 3300059510 Ga0587090_004864 Ga0587090_004864_732_1391 187
959 3300059622 Ga0587099_002232 Ga0587099_002232_637_1296 187
960 3300059644 Ga0587075_004996 Ga0587075_004996_639_1298 187
961 3300059655 Ga0587114_003370 Ga0587114_003370_291_950 187
962 3300060344 Ga0587071_001284 Ga0587071_001284_638_1297 187
963 iso_pu_bacteria 2643221690 2644502834 187
964 iso_pu_bacteria 2816332139 2816505581 187
965 iso_pu_bacteria 8004025490 8004028538 187
966 iso_pu_bacteria 8054472261 8054477892 187
967 3300001976 JGI24752J21851_1005251 JGI24752J21851_10052512 188
968 3300002126 JGI24035J26624_1002342 JGI24035J26624_10023422 188
969 3300002459 JGI24751J29686_10036240 JGI24751J29686_100362402 188
970 3300003162 Ga0006778J45830_1018467 Ga0006778J45830_10184672 188
971 3300003163 Ga0006759J45824_1010225 Ga0006759J45824_10102252 188
972 3300003305 Ga0006770J48903_1022427 Ga0006770J48903_10224272 188
973 3300003308 Ga0006777J48905_1019249 Ga0006777J48905_10192492 188
974 3300003544 Ga0007417J51691_1012477 Ga0007417J51691_10124772 188
975 3300003568 Ga0006781J51513_1010437 Ga0006781J51513_10104372 188
976 3300003574 Ga0007410J51695_1012990 Ga0007410J51695_10129902 188
977 3300003575 Ga0007409J51694_1010921 Ga0007409J51694_10109212 188
978 3300003579 Ga0007429J51699_1012547 Ga0007429J51699_10125472 188
979 3300003693 Ga0032354_1004260 Ga0032354_10042602 188
980 3300003735 Ga0006780_1006289 Ga0006780_10062891 188
981 3300004785 Ga0058858_1046418 Ga0058858_104641810 188
982 3300004798 Ga0058859_10145872 Ga0058859_101458722 188
983 3300004801 Ga0058860_10095871 Ga0058860_100958713 188
984 3300004803 Ga0058862_10135468 Ga0058862_101354681 188
985 3300005289 Ga0065704_10020984 Ga0065704_100209842 188
986 3300005290 Ga0065712_10047772 Ga0065712_100477721 188
987 3300005293 Ga0065715_10188434 Ga0065715_101884342 188
988 3300005327 Ga0070658_10086158 Ga0070658_100861582 188
989 3300005328 Ga0070676_10135021 Ga0070676_101350211 188
990 3300005331 Ga0070670_100324920 Ga0070670_1003249201 188
991 3300005335 Ga0070666_10004188 Ga0070666_1000418816 188
992 3300005347 Ga0070668_100063720 Ga0070668_1000637203 188
993 3300005354 Ga0070675_100004178 Ga0070675_1000041786 188
994 3300005355 Ga0070671_100048691 Ga0070671_1000486913 188
995 3300005355 Ga0070671_100352832 Ga0070671_1003528322 188
996 3300005356 Ga0070674_100018733 Ga0070674_1000187334 188
997 3300005364 Ga0070673_100059473 Ga0070673_1000594731 188
998 3300005367 Ga0070667_100005984 Ga0070667_1000059846 188
999 3300005367 Ga0070667_100077020 Ga0070667_1000770204 188
1000 3300005367 Ga0070667_100281806 Ga0070667_1002818062 188
1001 3300005436 Ga0070713_100004669 Ga0070713_1000046695 188
1002 3300005438 Ga0070701_10169019 Ga0070701_101690192 188
1003 3300005439 Ga0070711_100095091 Ga0070711_1000950911 188
1004 3300005440 Ga0070705_100195335 Ga0070705_1001953352 188
1005 3300005441 Ga0070700_100594167 Ga0070700_1005941671 188
1006 3300005455 Ga0070663_100168177 Ga0070663_1001681772 188
1007 3300005539 Ga0068853_100334731 Ga0068853_1003347312 188
1008 3300005543 Ga0070672_100073373 Ga0070672_1000733733 188
1009 3300005543 Ga0070672_100403195 Ga0070672_1004031952 188
1010 3300005544 Ga0070686_100042607 Ga0070686_1000426073 188
1011 3300005546 Ga0070696_100544841 Ga0070696_1005448411 188
1012 3300005548 Ga0070665_100122209 Ga0070665_1001222094 188
1013 3300005563 Ga0068855_100137809 Ga0068855_1001378094 188
1014 3300005578 Ga0068854_100353723 Ga0068854_1003537232 188
1015 3300005614 Ga0068856_100157717 Ga0068856_1001577173 188
1016 3300005614 Ga0068856_100742220 Ga0068856_1007422202 188
1017 3300005614 Ga0068856_100867931 Ga0068856_1008679312 188
1018 3300005615 Ga0070702_100061558 Ga0070702_1000615582 188
1019 3300005617 Ga0068859_100075833 Ga0068859_1000758333 188
1020 3300005617 Ga0068859_100100264 Ga0068859_1001002642 188
1021 3300005841 Ga0068863_100002199 Ga0068863_10000219912 188
1022 3300005841 Ga0068863_100334237 Ga0068863_1003342372 188
1023 3300005842 Ga0068858_100000013 Ga0068858_10000001356 188
1024 3300005842 Ga0068858_100006254 Ga0068858_10000625412 188
1025 3300005842 Ga0068858_100714882 Ga0068858_1007148822 188
1026 3300005842 Ga0068858_101033687 Ga0068858_1010336871 188
1027 3300005843 Ga0068860_100347319 Ga0068860_1003473192 188
1028 3300005844 Ga0068862_100000836 Ga0068862_10000083622 188
1029 3300005844 Ga0068862_100308618 Ga0068862_1003086182 188
1030 3300005937 Ga0081455_10136232 Ga0081455_101362322 188
1031 3300005985 Ga0081539_10134883 Ga0081539_101348832 188
1032 3300006028 Ga0070717_10643313 Ga0070717_106433131 188
1033 3300006051 Ga0075364_10166705 Ga0075364_101667053 188
1034 3300006058 Ga0075432_10005539 Ga0075432_100055393 188
1035 3300006178 Ga0075367_10217001 Ga0075367_102170012 188
1036 3300006353 Ga0075370_10107719 Ga0075370_101077192 188
1037 3300006358 Ga0068871_100162309 Ga0068871_1001623091 188
1038 3300006844 Ga0075428_100160595 Ga0075428_1001605952 188
1039 3300006880 Ga0075429_100139794 Ga0075429_1001397942 188
1040 3300006914 Ga0075436_100232807 Ga0075436_1002328072 188
1041 3300006931 Ga0097620_100075837 Ga0097620_1000758373 188
1042 3300006931 Ga0097620_100100268 Ga0097620_1001002685 188
1043 3300007076 Ga0075435_100143793 Ga0075435_1001437933 188
1044 3300009011 Ga0105251_10003051 Ga0105251_1000305110 188
1045 3300009036 Ga0105244_10116959 Ga0105244_101169592 188
1046 3300009093 Ga0105240_10051043 Ga0105240_100510437 188
1047 3300009093 Ga0105240_10771411 Ga0105240_107714112 188
1048 3300009098 Ga0105245_10087484 Ga0105245_100874842 188
1049 3300009101 Ga0105247_10152628 Ga0105247_101526282 188
1050 3300009147 Ga0114129_10193234 Ga0114129_101932344 188
1051 3300009147 Ga0114129_10269952 Ga0114129_102699523 188
1052 3300009148 Ga0105243_10043934 Ga0105243_100439342 188
1053 3300009148 Ga0105243_10319982 Ga0105243_103199822 188
1054 3300009174 Ga0105241_10175091 Ga0105241_101750912 188
1055 3300009174 Ga0105241_10239480 Ga0105241_102394802 188
1056 3300009176 Ga0105242_10188548 Ga0105242_101885482 188
1057 3300009177 Ga0105248_10000035 Ga0105248_1000003599 188
1058 3300009177 Ga0105248_10063860 Ga0105248_100638607 188
1059 3300009177 Ga0105248_10096561 Ga0105248_100965614 188
1060 3300009177 Ga0105248_10655312 Ga0105248_106553122 188
1061 3300009545 Ga0105237_10111038 Ga0105237_101110383 188
1062 3300009551 Ga0105238_10359875 Ga0105238_103598753 188
1063 3300009551 Ga0105238_10464161 Ga0105238_104641611 188
1064 3300009553 Ga0105249_10187341 Ga0105249_101873413 188
1065 3300013059 Ga0154012_131529 Ga0154012_1315292 188
1066 3300013059 Ga0154012_177778 Ga0154012_1777782 188
1067 3300013100 Ga0157373_10082365 Ga0157373_100823652 188
1068 3300013105 Ga0157369_10391479 Ga0157369_103914793 188
1069 3300013297 Ga0157378_10114363 Ga0157378_101143633 188
1070 3300013306 Ga0163162_10406872 Ga0163162_104068722 188
1071 3300013308 Ga0157375_10495273 Ga0157375_104952732 188
1072 3300014325 Ga0163163_10060806 Ga0163163_100608063 188
1073 3300014325 Ga0163163_11249781 Ga0163163_112497811 188
1074 3300014326 Ga0157380_10457826 Ga0157380_104578262 188
1075 3300014968 Ga0157379_10000012 Ga0157379_1000001265 188
1076 3300014969 Ga0157376_10397076 Ga0157376_103970761 188
1077 3300017792 Ga0163161_10017744 Ga0163161_100177443 188
1078 3300020070 Ga0206356_10344010 Ga0206356_103440102 188
1079 3300020070 Ga0206356_11141088 Ga0206356_111410882 188
1080 3300020076 Ga0206355_1046697 Ga0206355_10466972 188
1081 3300020077 Ga0206351_10781031 Ga0206351_107810312 188
1082 3300020080 Ga0206350_10447285 Ga0206350_104472852 188
1083 3300020080 Ga0206350_11174700 Ga0206350_111747002 188
1084 3300020081 Ga0206354_10395367 Ga0206354_103953677 188
1085 3300020081 Ga0206354_10448514 Ga0206354_104485144 188
1086 3300020082 Ga0206353_10604234 Ga0206353_106042342 188
1087 3300020082 Ga0206353_10689809 Ga0206353_106898092 188
1088 3300020610 Ga0154015_1410113 Ga0154015_14101132 188
1089 3300021384 Ga0213876_10193026 Ga0213876_101930262 188
1090 3300022467 Ga0224712_10023353 Ga0224712_100233532 188
1091 3300022467 Ga0224712_10063897 Ga0224712_100638972 188
1092 3300025290 Ga0207673_1001237 Ga0207673_10012374 188
1093 3300025315 Ga0207697_10194829 Ga0207697_101948292 188
1094 3300025315 Ga0207697_10194869 Ga0207697_101948691 188
1095 3300025728 Ga0207655_1002359 Ga0207655_100235923 188
1096 3300025728 Ga0207655_1072264 Ga0207655_10722642 188
1097 3300025735 Ga0207713_1012416 Ga0207713_10124162 188
1098 3300025893 Ga0207682_10009470 Ga0207682_100094707 188
1099 3300025898 Ga0207692_10104689 Ga0207692_101046892 188
1100 3300025901 Ga0207688_10010344 Ga0207688_1001034410 188
1101 3300025901 Ga0207688_10454480 Ga0207688_104544802 188
1102 3300025903 Ga0207680_10078450 Ga0207680_100784502 188
1103 3300025904 Ga0207647_10170673 Ga0207647_101706732 188
1104 3300025904 Ga0207647_10208841 Ga0207647_102088412 188
1105 3300025906 Ga0207699_10056081 Ga0207699_100560813 188
1106 3300025907 Ga0207645_10017870 Ga0207645_100178702 188
1107 3300025908 Ga0207643_10081556 Ga0207643_100815563 188
1108 3300025908 Ga0207643_10378551 Ga0207643_103785511 188
1109 3300025909 Ga0207705_10421411 Ga0207705_104214112 188
1110 3300025913 Ga0207695_10224638 Ga0207695_102246383 188
1111 3300025913 Ga0207695_10529991 Ga0207695_105299912 188
1112 3300025914 Ga0207671_10468436 Ga0207671_104684362 188
1113 3300025916 Ga0207663_10242765 Ga0207663_102427652 188
1114 3300025919 Ga0207657_10181110 Ga0207657_101811102 188
1115 3300025923 Ga0207681_10008840 Ga0207681_1000884010 188
1116 3300025924 Ga0207694_10296450 Ga0207694_102964502 188
1117 3300025925 Ga0207650_10019237 Ga0207650_100192377 188
1118 3300025926 Ga0207659_10016950 Ga0207659_100169503 188
1119 3300025928 Ga0207700_10020037 Ga0207700_100200374 188
1120 3300025929 Ga0207664_10018232 Ga0207664_100182322 188
1121 3300025931 Ga0207644_10027365 Ga0207644_100273653 188
1122 3300025931 Ga0207644_10674845 Ga0207644_106748452 188
1123 3300025935 Ga0207709_10007828 Ga0207709_1000782810 188
1124 3300025935 Ga0207709_10165993 Ga0207709_101659932 188
1125 3300025937 Ga0207669_10170472 Ga0207669_101704723 188
1126 3300025940 Ga0207691_10097609 Ga0207691_100976092 188
1127 3300025940 Ga0207691_10651346 Ga0207691_106513461 188
1128 3300025940 Ga0207691_10651347 Ga0207691_106513471 188
1129 3300025941 Ga0207711_10000134 Ga0207711_1000013452 188
1130 3300025941 Ga0207711_10006894 Ga0207711_100068949 188
1131 3300025941 Ga0207711_10778025 Ga0207711_107780252 188
1132 3300025942 Ga0207689_10378253 Ga0207689_103782532 188
1133 3300025949 Ga0207667_10103267 Ga0207667_101032674 188
1134 3300025949 Ga0207667_10665269 Ga0207667_106652691 188
1135 3300025972 Ga0207668_10092540 Ga0207668_100925403 188
1136 3300025981 Ga0207640_10229183 Ga0207640_102291832 188
1137 3300025986 Ga0207658_10011697 Ga0207658_1001169710 188
1138 3300025986 Ga0207658_10046452 Ga0207658_100464524 188
1139 3300025986 Ga0207658_10782661 Ga0207658_107826611 188
1140 3300026035 Ga0207703_10000009 Ga0207703_1000000956 188
1141 3300026035 Ga0207703_10007970 Ga0207703_100079704 188
1142 3300026067 Ga0207678_10349412 Ga0207678_103494122 188
1143 3300026075 Ga0207708_10666402 Ga0207708_106664022 188
1144 3300026078 Ga0207702_10078088 Ga0207702_100780883 188
1145 3300026078 Ga0207702_10793105 Ga0207702_107931052 188
1146 3300026088 Ga0207641_10038878 Ga0207641_100388786 188
1147 3300026088 Ga0207641_10426736 Ga0207641_104267362 188
1148 3300026089 Ga0207648_10193739 Ga0207648_101937392 188
1149 3300026121 Ga0207683_10000991 Ga0207683_1000099110 188
1150 3300027360 Ga0209969_1015755 Ga0209969_10157551 188
1151 3300027552 Ga0209982_1015063 Ga0209982_10150632 188
1152 3300027665 Ga0209983_1005042 Ga0209983_10050424 188
1153 3300027876 Ga0209974_10142334 Ga0209974_101423342 188
1154 3300027907 Ga0207428_10020975 Ga0207428_100209759 188
1155 3300028379 Ga0268266_10634765 Ga0268266_106347652 188
1156 3300028380 Ga0268265_10000156 Ga0268265_1000015613 188
1157 3300029277 Ga0311001_1058775 Ga0311001_10587752 188
1158 3300030521 Ga0307511_10117899 Ga0307511_101178992 188
1159 3300030732 Ga0316176_1102741 Ga0316176_11027412 188
1160 3300030735 Ga0316178_1069715 Ga0316178_10697153 188
1161 3300030742 Ga0316183_1079594 Ga0316183_10795942 188
1162 3300030745 Ga0316182_1040762 Ga0316182_10407622 188
1163 3300031507 Ga0307509_10012707 Ga0307509_100127073 188
1164 3300031548 Ga0307408_100148178 Ga0307408_1001481782 188
1165 3300031548 Ga0307408_100184856 Ga0307408_1001848561 188
1166 3300031616 Ga0307508_10017267 Ga0307508_100172672 188
1167 3300031728 Ga0316578_10032305 Ga0316578_100323054 188
1168 3300031731 Ga0307405_10345678 Ga0307405_103456781 188
1169 3300031852 Ga0307410_10112918 Ga0307410_101129183 188
1170 3300031852 Ga0307410_10295251 Ga0307410_102952512 188
1171 3300031901 Ga0307406_10014144 Ga0307406_100141443 188
1172 3300031911 Ga0307412_10406771 Ga0307412_104067712 188
1173 3300031911 Ga0307412_10703848 Ga0307412_107038482 188
1174 3300031995 Ga0307409_100139811 Ga0307409_1001398112 188
1175 3300031995 Ga0307409_100149650 Ga0307409_1001496503 188
1176 3300032002 Ga0307416_100041177 Ga0307416_1000411773 188
1177 3300032005 Ga0307411_10391570 Ga0307411_103915702 188
1178 3300032126 Ga0307415_100000047 Ga0307415_10000004762 188
1179 3300032126 Ga0307415_100348369 Ga0307415_1003483692 188
1180 3300033179 Ga0307507_10000482 Ga0307507_1000048224 188
1181 3300033180 Ga0307510_10095977 Ga0307510_100959772 188
1182 3300033180 Ga0307510_10194354 Ga0307510_101943541 188
1183 3300033541 Ga0316596_1000516 Ga0316596_10005166 188
1184 3300035116 Ga0373945_0278168 Ga0373945_0278168_21_665 188
1185 3300036712 Ga0316584_0055007 Ga0316584_0055007_602_1267 188
1186 3300037312 Ga0395899_0018848 Ga0395899_0018848_2697_3347 188
1187 3300037312 Ga0395899_0054104 Ga0395899_0054104_826_1476 188
1188 3300037418 Ga0395900_0018872 Ga0395900_0018872_3152_3802 188
1189 3300037418 Ga0395900_0106616 Ga0395900_0106616_607_1257 188
1190 3300037418 Ga0395900_0310097 Ga0395900_0310097_720_1370 188
1191 3300037466 Ga0395898_0025458 Ga0395898_0025458_3726_4376 188
1192 3300037466 Ga0395898_0122620 Ga0395898_0122620_1156_1806 188
1193 3300037466 Ga0395898_0235392 Ga0395898_0235392_971_1621 188
1194 3300038443 Ga0395901_0027464 Ga0395901_0027464_1383_2033 188
1195 3300038443 Ga0395901_0125759 Ga0395901_0125759_1778_2428 188
1196 3300039437 Ga0436365_0787829 Ga0436365_0787829_2133_2777 188
1197 3300039437 Ga0436365_1715394 Ga0436365_1715394_401_1045 188
1198 3300041404 Ga0439436_0004725 Ga0439436_0004725_2606_3256 188
1199 3300041405 Ga0439438_017344 Ga0439438_017344_1047_1697 188
1200 3300041407 Ga0439447_041516 Ga0439447_041516_458_1108 188
1201 3300041413 Ga0439465_0048230 Ga0439465_0048230_670_1320 188
1202 3300041446 Ga0451794_50430 Ga0451794_50430_131_781 188
1203 3300041999 Ga0439433_0011845 Ga0439433_0011845_1229_1879 188
1204 3300042002 Ga0439442_000004 Ga0439442_000004_30406_31056 188
1205 3300042004 Ga0439445_0030194 Ga0439445_0030194_641_1291 188
1206 3300042006 Ga0439432_087024 Ga0439432_087024_61_711 188
1207 3300042007 Ga0439449_0003103 Ga0439449_0003103_5643_6293 188
1208 3300042007 Ga0439449_0169832 Ga0439449_0169832_147_797 188
1209 3300042014 Ga0439457_004298 Ga0439457_004298_1904_2554 188
1210 3300042015 Ga0439462_0016881 Ga0439462_0016881_288_938 188
1211 3300042122 Ga0450920_011218 Ga0450920_011218_974_1624 188
1212 3300042134 Ga0450898_022018 Ga0450898_022018_370_1020 188
1213 3300042145 Ga0450906_004201 Ga0450906_004201_1080_1730 188
1214 3300042146 Ga0450907_000821 Ga0450907_000821_4759_5409 188
1215 3300042147 Ga0450910_001322 Ga0450910_001322_694_1344 188
1216 3300042184 Ga0450908_015720 Ga0450908_015720_684_1334 188
1217 3300042185 Ga0450909_004209 Ga0450909_004209_73_723 188
1218 3300042435 Ga0439434_0008220 Ga0439434_0008220_2237_2887 188
1219 3300042439 Ga0439464_0007832 Ga0439464_0007832_230_898 188
1220 3300042531 Ga0450918_002600 Ga0450918_002600_356_1006 188
1221 3300042993 Ga0439440_0023604 Ga0439440_0023604_639_1307 188
1222 3300044656 Ga0466969_0018916 Ga0466969_0018916_285_926 188
1223 3300044656 Ga0466969_0061937 Ga0466969_0061937_203_844 188
1224 3300044684 Ga0466966_0043302 Ga0466966_0043302_1979_2620 188
1225 3300044684 Ga0466966_0103302 Ga0466966_0103302_680_1321 188
1226 3300044684 Ga0466966_0115768 Ga0466966_0115768_358_1002 188
1227 3300044693 Ga0466961_0018714 Ga0466961_0018714_2858_3499 188
1228 3300044693 Ga0466961_0030780 Ga0466961_0030780_1741_2382 188
1229 3300044693 Ga0466961_0063622 Ga0466961_0063622_1556_2200 188
1230 3300044693 Ga0466961_0123407 Ga0466961_0123407_306_950 188
1231 3300044693 Ga0466961_0218045 Ga0466961_0218045_168_812 188
1232 3300044694 Ga0466963_0041725 Ga0466963_0041725_855_1499 188
1233 3300044694 Ga0466963_0093278 Ga0466963_0093278_308_976 188
1234 3300044694 Ga0466963_0097213 Ga0466963_0097213_1013_1657 188
1235 3300044694 Ga0466963_0097246 Ga0466963_0097246_376_1020 188
1236 3300044694 Ga0466963_0228210 Ga0466963_0228210_188_829 188
1237 3300044694 Ga0466963_0746139 Ga0466963_0746139_28_672 188
1238 3300044706 Ga0466964_0006370 Ga0466964_0006370_323_967 188
1239 3300044719 Ga0466971_0000675 Ga0466971_0000675_1784_2425 188
1240 3300044719 Ga0466971_0001406 Ga0466971_0001406_8866_9510 188
1241 3300044719 Ga0466971_0132108 Ga0466971_0132108_316_960 188
1242 3300044735 Ga0466968_0130897 Ga0466968_0130897_28_669 188
1243 3300044765 Ga0466970_0116012 Ga0466970_0116012_528_1172 188
1244 3300044842 Ga0466957_0120742 Ga0466957_0120742_151_795 188
1245 3300044901 Ga0466960_0026884 Ga0466960_0026884_245_889 188
1246 3300045049 Ga0466959_0003800 Ga0466959_0003800_2786_3427 188
1247 3300045049 Ga0466959_0025593 Ga0466959_0025593_3052_3693 188
1248 3300045049 Ga0466959_0326745 Ga0466959_0326745_365_1009 188
1249 3300045049 Ga0466959_0474361 Ga0466959_0474361_169_813 188
1250 3300045836 Ga0466958_0011830 Ga0466958_0011830_2692_3333 188
1251 3300045836 Ga0466958_0018021 Ga0466958_0018021_3227_3871 188
1252 3300045836 Ga0466958_0026511 Ga0466958_0026511_1113_1754 188
1253 3300045836 Ga0466958_0237978 Ga0466958_0237978_272_916 188
1254 3300045836 Ga0466958_0240100 Ga0466958_0240100_154_798 188
1255 3300045836 Ga0466958_0407627 Ga0466958_0407627_179_829 188
1256 3300045836 Ga0466958_0546691 Ga0466958_0546691_40_684 188
1257 3300045976 Ga0466967_0090058 Ga0466967_0090058_1832_2476 188
1258 3300045976 Ga0466967_0200257 Ga0466967_0200257_651_1295 188
1259 3300045976 Ga0466967_0939400 Ga0466967_0939400_35_679 188
1260 3300045976 Ga0466967_0985048 Ga0466967_0985048_38_682 188
1261 3300046454 Ga0495592_0008230 Ga0495592_0008230_2708_3349 188
1262 3300046459 Ga0495629_0043246 Ga0495629_0043246_1719_2369 188
1263 3300046462 Ga0495651_0000169 Ga0495651_0000169_19325_19966 188
1264 3300046462 Ga0495651_0328104 Ga0495651_0328104_80_730 188
1265 3300046475 Ga0495639_0050900 Ga0495639_0050900_325_975 188
1266 3300046477 Ga0495664_0030225 Ga0495664_0030225_2050_2691 188
1267 3300046491 Ga0495584_0159834 Ga0495584_0159834_236_904 188
1268 3300046507 Ga0495606_0122870 Ga0495606_0122870_209_859 188
1269 3300046511 Ga0495608_0233804 Ga0495608_0233804_331_972 188
1270 3300046513 Ga0495616_0050266 Ga0495616_0050266_745_1413 188
1271 3300046516 Ga0495628_0040486 Ga0495628_0040486_2371_3012 188
1272 3300046517 Ga0495630_0134818 Ga0495630_0134818_459_1109 188
1273 3300046518 Ga0495631_0092119 Ga0495631_0092119_604_1272 188
1274 3300046518 Ga0495631_0096765 Ga0495631_0096765_203_853 188
1275 3300046522 Ga0495643_0018269 Ga0495643_0018269_1596_2246 188
1276 3300046523 Ga0495644_0094966 Ga0495644_0094966_115_765 188
1277 3300046526 Ga0495666_0156324 Ga0495666_0156324_188_841 188
1278 3300046528 Ga0495642_0045825 Ga0495642_0045825_1001_1651 188
1279 3300046529 Ga0495652_0001361 Ga0495652_0001361_1992_2633 188
1280 3300046530 Ga0495654_0069906 Ga0495654_0069906_835_1485 188
1281 3300046531 Ga0495665_0013489 Ga0495665_0013489_2013_2663 188
1282 3300046535 Ga0495586_0092727 Ga0495586_0092727_348_998 188
1283 3300046536 Ga0495587_0004866 Ga0495587_0004866_3577_4227 188
1284 3300046539 Ga0495621_0011385 Ga0495621_0011385_1000_1650 188
1285 3300046542 Ga0495597_0121189 Ga0495597_0121189_347_997 188
1286 3300046543 Ga0495645_0001363 Ga0495645_0001363_2089_2739 188
1287 3300046543 Ga0495645_0013381 Ga0495645_0013381_3845_4486 188
1288 3300046543 Ga0495645_0064169 Ga0495645_0064169_781_1431 188
1289 3300046559 Ga0495667_0001586 Ga0495667_0001586_1492_2142 188
1290 3300046615 Ga0495656_0033449 Ga0495656_0033449_1368_2018 188
1291 3300046642 Ga0495634_0050304 Ga0495634_0050304_839_1480 188
1292 3300046663 Ga0495635_0010690 Ga0495635_0010690_3858_4499 188
1293 3300046663 Ga0495635_0067763 Ga0495635_0067763_1419_2069 188
1294 3300046664 Ga0495659_0001631 Ga0495659_0001631_6535_7185 188
1295 3300046665 Ga0495661_0076707 Ga0495661_0076707_1099_1749 188
1296 3300046675 Ga0495657_0022888 Ga0495657_0022888_3470_4120 188
1297 3300046678 Ga0495599_0514771 Ga0495599_0514771_36_686 188
1298 3300046679 Ga0495623_0003245 Ga0495623_0003245_8381_9022 188
1299 3300046679 Ga0495623_0042461 Ga0495623_0042461_660_1310 188
1300 3300046680 Ga0495646_0008701 Ga0495646_0008701_2523_3164 188
1301 3300046684 Ga0495669_0049324 Ga0495669_0049324_886_1536 188
1302 3300046689 Ga0495613_0035396 Ga0495613_0035396_1383_2033 188
1303 3300046691 Ga0495670_0257203 Ga0495670_0257203_210_860 188
1304 3300046692 Ga0495671_0124447 Ga0495671_0124447_365_1015 188
1305 3300046794 Ga0495589_0080741 Ga0495589_0080741_498_1148 188
1306 3300046809 Ga0495600_0016586 Ga0495600_0016586_2674_3324 188
1307 3300046809 Ga0495600_0039421 Ga0495600_0039421_966_1607 188
1308 3300046810 Ga0495660_0081066 Ga0495660_0081066_510_1178 188
1309 3300047315 Ga0495581_0058469 Ga0495581_0058469_1229_1879 188
1310 3300047317 Ga0495604_0122945 Ga0495604_0122945_621_1271 188
1311 3300047318 Ga0495636_0212220 Ga0495636_0212220_165_815 188
1312 3300047319 Ga0495674_0316423 Ga0495674_0316423_79_729 188
1313 3300047322 Ga0495680_0048305 Ga0495680_0048305_2510_3160 188
1314 3300047444 Ga0495675_0003036 Ga0495675_0003036_8805_9455 188
1315 3300047447 Ga0495685_036799 Ga0495685_036799_662_1312 188
1316 3300047470 Ga0495681_0021955 Ga0495681_0021955_1588_2238 188
1317 3300047471 Ga0495684_0051654 Ga0495684_0051654_1657_2307 188
1318 3300047673 Ga0495593_0033962 Ga0495593_0033962_636_1286 188
1319 3300048088 Ga0495602_0070215 Ga0495602_0070215_1454_2095 188
1320 3300048903 Ga0496100_0011716 Ga0496100_0011716_3963_4613 188
1321 3300048904 Ga0496101_0041402 Ga0496101_0041402_2248_2898 188
1322 3300048905 Ga0496102_0084147 Ga0496102_0084147_1859_2509 188
1323 3300048906 Ga0496103_0037518 Ga0496103_0037518_2248_2898 188
1324 3300048906 Ga0496103_0061916 Ga0496103_0061916_1229_1879 188
1325 3300048907 Ga0496104_0027779 Ga0496104_0027779_93_743 188
1326 3300048908 Ga0496105_0178256 Ga0496105_0178256_93_743 188
1327 3300048909 Ga0496106_0017817 Ga0496106_0017817_4509_5159 188
1328 3300048911 Ga0496108_0455492 Ga0496108_0455492_375_1025 188
1329 3300048912 Ga0496109_0017785 Ga0496109_0017785_4901_5551 188
1330 3300048913 Ga0496110_0026054 Ga0496110_0026054_3963_4613 188
1331 3300048914 Ga0496111_0041949 Ga0496111_0041949_387_1037 188
1332 3300048915 Ga0496112_0041128 Ga0496112_0041128_3072_3722 188
1333 3300048915 Ga0496112_0093751 Ga0496112_0093751_803_1453 188
1334 3300048916 Ga0496113_0057797 Ga0496113_0057797_503_1153 188
1335 3300048917 Ga0496114_0051031 Ga0496114_0051031_93_743 188
1336 3300048919 Ga0496116_0001739 Ga0496116_0001739_15215_15913 188
1337 3300048920 Ga0496117_0015135 Ga0496117_0015135_4372_5070 188
1338 3300048921 Ga0496118_0011170 Ga0496118_0011170_7801_8496 188
1339 3300048921 Ga0496118_0013367 Ga0496118_0013367_5308_6006 188
1340 3300048922 Ga0496119_0058045 Ga0496119_0058045_1323_2021 188
1341 3300048922 Ga0496119_0081550 Ga0496119_0081550_1133_1783 188
1342 3300048924 Ga0496121_0012636 Ga0496121_0012636_7931_8629 188
1343 3300048927 Ga0496124_0294085 Ga0496124_0294085_31_729 188
1344 3300048928 Ga0496125_0145814 Ga0496125_0145814_242_892 188
1345 3300048929 Ga0496126_0052475 Ga0496126_0052475_2650_3300 188
1346 3300048929 Ga0496126_0082956 Ga0496126_0082956_1932_2573 188
1347 3300049127 Ga0501306_024065 Ga0501306_024065_38_688 188
1348 3300049128 Ga0501308_000349 Ga0501308_000349_1656_2306 188
1349 3300049129 Ga0501309_001681 Ga0501309_001681_601_1251 188
1350 3300049160 Ga0501304_000596 Ga0501304_000596_731_1381 188
1351 3300049161 Ga0501305_002818 Ga0501305_002818_496_1146 188
1352 3300049515 Ga0501292_025890 Ga0501292_025890_86_736 188
1353 3300049527 Ga0501311_000537 Ga0501311_000537_1755_2405 188
1354 3300049529 Ga0501313_001184 Ga0501313_001184_614_1264 188
1355 3300049530 Ga0501314_000586 Ga0501314_000586_1633_2283 188
1356 3300049531 Ga0501315_001208 Ga0501315_001208_705_1355 188
1357 3300049532 Ga0501316_003331 Ga0501316_003331_873_1523 188
1358 3300049533 Ga0501317_045044 Ga0501317_045044_14_664 188
1359 3300049537 Ga0501321_035183 Ga0501321_035183_14_664 188
1360 3300049539 Ga0501323_001381 Ga0501323_001381_302_952 188
1361 3300049543 Ga0501327_00527 Ga0501327_00527_206_856 188
1362 3300049546 Ga0501330_000685 Ga0501330_000685_738_1388 188
1363 3300049554 Ga0501338_00832 Ga0501338_00832_718_1368 188
1364 3300049555 Ga0501339_00025 Ga0501339_00025_515_1165 188
1365 3300049585 Ga0501069_0287536 Ga0501069_0287536_111_761 188
1366 3300049704 Ga0501221_085868 Ga0501221_085868_97_747 188
1367 3300049743 Ga0501081_0538274 Ga0501081_0538274_27_689 188
1368 3300049765 Ga0501268_045477 Ga0501268_045477_97_747 188
1369 3300049822 Ga0501035_0857195 Ga0501035_0857195_70_711 188
1370 3300050491 nmdc:mga00v17_463827_c1 nmdc:mga00v17_463827_c1_16_666 188
1371 3300050491 nmdc:mga00v17_79376_c1 nmdc:mga00v17_79376_c1_324_1001 188
1372 3300050496 nmdc:mga07m45_222935_c1 nmdc:mga07m45_222935_c1_19_669 188
1373 3300050507 nmdc:mga05p37_223511_c1 nmdc:mga05p37_223511_c1_729_1379 188
1374 3300050513 nmdc:mga0rr50_1290_c2 nmdc:mga0rr50_1290_c2_1937_2605 188
1375 3300050514 nmdc:mga08x19_281096_c1 nmdc:mga08x19_281096_c1_245_895 188
1376 3300053078 Ga0495612_0001114 Ga0495612_0001114_7240_7881 188
1377 3300053085 Ga0495619_0039496 Ga0495619_0039496_1622_2263 188
1378 3300053085 Ga0495619_0270401 Ga0495619_0270401_343_993 188
1379 3300053092 Ga0500583_0033588 Ga0500583_0033588_311_1009 188
1380 3300053153 Ga0500616_0006073 Ga0500616_0006073_7273_7935 188
1381 3300059424 Ga0590075_015737 Ga0590075_015737_1174_1824 188
1382 3300059424 Ga0590075_023614 Ga0590075_023614_740_1390 188
1383 3300059477 Ga0587084_009700 Ga0587084_009700_348_998 188
1384 3300059491 Ga0587070_038969 Ga0587070_038969_46_696 188
1385 3300059492 Ga0587073_0003043 Ga0587073_0003043_1430_2080 188
1386 3300059503 Ga0587080_005354 Ga0587080_005354_347_997 188
1387 3300059504 Ga0587082_003001 Ga0587082_003001_262_912 188
1388 3300059506 Ga0587085_037794 Ga0587085_037794_139_789 188
1389 3300059510 Ga0587090_003130 Ga0587090_003130_169_819 188
1390 3300059511 Ga0587091_002904 Ga0587091_002904_1250_1900 188
1391 3300059511 Ga0587091_006697 Ga0587091_006697_253_903 188
1392 3300059511 Ga0587091_020924 Ga0587091_020924_348_998 188
1393 3300059513 Ga0587094_007739 Ga0587094_007739_32_694 188
1394 3300059514 Ga0587095_003153 Ga0587095_003153_280_930 188
1395 3300059604 Ga0587098_000861 Ga0587098_000861_1283_1933 188
1396 3300059607 Ga0587125_002642 Ga0587125_002642_205_855 188
1397 3300059624 Ga0587109_004016 Ga0587109_004016_347_997 188
1398 3300059626 Ga0587115_021036 Ga0587115_021036_247_897 188
1399 3300059628 Ga0587122_000240 Ga0587122_000240_692_1342 188
1400 3300059639 Ga0587062_006133 Ga0587062_006133_600_1250 188
1401 3300059641 Ga0587068_000682 Ga0587068_000682_2567_3217 188
1402 3300059641 Ga0587068_001971 Ga0587068_001971_121_771 188
1403 3300059645 Ga0587076_001221 Ga0587076_001221_1584_2234 188
1404 3300059646 Ga0587078_001418 Ga0587078_001418_595_1245 188
1405 3300059647 Ga0587079_004686 Ga0587079_004686_931_1581 188
1406 3300059647 Ga0587079_010530 Ga0587079_010530_52_702 188
1407 3300059648 Ga0587100_009713 Ga0587100_009713_11_661 188
1408 3300059651 Ga0587105_000564 Ga0587105_000564_620_1270 188
1409 3300059651 Ga0587105_000641 Ga0587105_000641_301_951 188
1410 3300059653 Ga0587108_000409 Ga0587108_000409_622_1272 188
1411 3300059656 Ga0587116_00573 Ga0587116_00573_539_1189 188
1412 3300059656 Ga0587116_00733 Ga0587116_00733_146_796 188
1413 3300059659 Ga0587120_001210 Ga0587120_001210_673_1323 188
1414 3300059660 Ga0587124_000838 Ga0587124_000838_398_1048 188
1415 3300060247 Ga0587096_00920 Ga0587096_00920_11_661 188
1416 3300060344 Ga0587071_009858 Ga0587071_009858_895_1545 188
1417 3300061719 Ga0466962_0000160 Ga0466962_0000160_6698_7339 188
1418 3300061719 Ga0466962_0002136 Ga0466962_0002136_6430_7074 188
1419 3300061719 Ga0466962_0172141 Ga0466962_0172141_166_807 188
1420 3300061734 Ga0530510_0263545 Ga0530510_0263545_277_927 188
1421 iso_pu_bacteria 2506783011 2506868526 188
1422 iso_pu_bacteria 2527291629 2528212100 188
1423 iso_pu_bacteria 2546825537 2546946901 188
1424 iso_pu_bacteria 2576861822 2579747590 188
1425 iso_pu_bacteria 2579778521 2579853555 188
1426 iso_pu_bacteria 2619618881 2619853764 188
1427 iso_pu_bacteria 2619619003 2620349842 188
1428 iso_pu_bacteria 2626541554 2626634890 188
1429 iso_pu_bacteria 2671180195 2671835745 188
1430 iso_pu_bacteria 2684623035 2686539281 188
1431 iso_pu_bacteria 2684623036 2686543584 188
1432 iso_pu_bacteria 2687453743 2689992347 188
1433 iso_pu_bacteria 2710264753 2710602562 188
1434 iso_pu_bacteria 2731639228 2731908924 188
1435 iso_pu_bacteria 2734482000 2734967857 188
1436 iso_pu_bacteria 2773857922 2774853901 188
1437 iso_pu_bacteria 2773857924 2774867023 188
1438 iso_pu_bacteria 2773857933 2774902907 188
1439 iso_pu_bacteria 2799112218 2799185003 188
1440 iso_pu_bacteria 2895880812 2895884612 188
1441 iso_pu_bacteria 2915358134 2915364899 188
1442 iso_pu_bacteria 637000116 637877915 188
1443 iso_pu_bacteria 8054913762 8054918475 188
1444 iso_pu_bacteria 8054920844 8054922559 188
1445 iso_pu_bacteria 8055157932 8055160597 188
1446 3300001979 JGI24740J21852_10040891 JGI24740J21852_100408912 189
1447 3300001989 JGI24739J22299_10006670 JGI24739J22299_100066704 189
1448 3300001990 JGI24737J22298_10001920 JGI24737J22298_100019204 189
1449 3300002067 JGI24735J21928_10017393 JGI24735J21928_100173932 189
1450 3300002075 JGI24738J21930_10005555 JGI24738J21930_100055554 189
1451 3300003161 Ga0006765J45826_107321 Ga0006765J45826_1073212 189
1452 3300003163 Ga0006759J45824_1012090 Ga0006759J45824_10120902 189
1453 3300003308 Ga0006777J48905_1014619 Ga0006777J48905_10146192 189
1454 3300003308 Ga0006777J48905_1028950 Ga0006777J48905_10289501 189
1455 3300003320 rootH2_10057508 rootH2_100575082 189
1456 3300003373 JGI25407J50210_10023670 JGI25407J50210_100236703 189
1457 3300003544 Ga0007417J51691_1010885 Ga0007417J51691_10108852 189
1458 3300003544 Ga0007417J51691_1023818 Ga0007417J51691_10238182 189
1459 3300003559 Ga0007427J51700_105815 Ga0007427J51700_1058152 189
1460 3300003575 Ga0007409J51694_1018435 Ga0007409J51694_10184352 189
1461 3300003577 Ga0007416J51690_1008818 Ga0007416J51690_10088182 189
1462 3300003577 Ga0007416J51690_1019290 Ga0007416J51690_10192902 189
1463 3300003577 Ga0007416J51690_1035660 Ga0007416J51690_10356603 189
1464 3300003579 Ga0007429J51699_1011252 Ga0007429J51699_10112522 189
1465 3300003579 Ga0007429J51699_1030894 Ga0007429J51699_10308943 189
1466 3300003693 Ga0032354_1019065 Ga0032354_10190652 189
1467 3300003735 Ga0006780_1007202 Ga0006780_10072022 189
1468 3300004798 Ga0058859_10056829 Ga0058859_100568292 189
1469 3300004799 Ga0058863_10080822 Ga0058863_100808221 189
1470 3300004801 Ga0058860_10090712 Ga0058860_100907122 189
1471 3300004803 Ga0058862_10128907 Ga0058862_101289072 189
1472 3300005328 Ga0070676_10410980 Ga0070676_104109801 189
1473 3300005331 Ga0070670_100362577 Ga0070670_1003625772 189
1474 3300005335 Ga0070666_10204789 Ga0070666_102047891 189
1475 3300005336 Ga0070680_100373950 Ga0070680_1003739502 189
1476 3300005337 Ga0070682_100033996 Ga0070682_1000339962 189
1477 3300005338 Ga0068868_100000735 Ga0068868_10000073511 189
1478 3300005341 Ga0070691_10120663 Ga0070691_101206632 189
1479 3300005345 Ga0070692_10323661 Ga0070692_103236611 189
1480 3300005347 Ga0070668_100043401 Ga0070668_1000434015 189
1481 3300005347 Ga0070668_100243737 Ga0070668_1002437372 189
1482 3300005353 Ga0070669_100102325 Ga0070669_1001023252 189
1483 3300005354 Ga0070675_100269185 Ga0070675_1002691851 189
1484 3300005356 Ga0070674_100088901 Ga0070674_1000889013 189
1485 3300005365 Ga0070688_100122842 Ga0070688_1001228423 189
1486 3300005434 Ga0070709_10621797 Ga0070709_106217971 189
1487 3300005435 Ga0070714_100015080 Ga0070714_10001508010 189
1488 3300005435 Ga0070714_100065446 Ga0070714_1000654462 189
1489 3300005435 Ga0070714_100841703 Ga0070714_1008417032 189
1490 3300005436 Ga0070713_100040206 Ga0070713_1000402067 189
1491 3300005436 Ga0070713_101090554 Ga0070713_1010905541 189
1492 3300005437 Ga0070710_10051230 Ga0070710_100512303 189
1493 3300005440 Ga0070705_100131670 Ga0070705_1001316703 189
1494 3300005440 Ga0070705_100184048 Ga0070705_1001840482 189
1495 3300005444 Ga0070694_100252084 Ga0070694_1002520842 189
1496 3300005445 Ga0070708_100004548 Ga0070708_10000454821 189
1497 3300005455 Ga0070663_100669351 Ga0070663_1006693511 189
1498 3300005456 Ga0070678_100045409 Ga0070678_1000454092 189
1499 3300005457 Ga0070662_100029774 Ga0070662_1000297746 189
1500 3300005457 Ga0070662_100181760 Ga0070662_1001817602 189
1501 3300005459 Ga0068867_100271482 Ga0068867_1002714821 189
1502 3300005467 Ga0070706_100002451 Ga0070706_1000024517 189
1503 3300005467 Ga0070706_100021333 Ga0070706_1000213332 189
1504 3300005467 Ga0070706_100264790 Ga0070706_1002647902 189
1505 3300005467 Ga0070706_100726726 Ga0070706_1007267262 189
1506 3300005468 Ga0070707_100051699 Ga0070707_1000516995 189
1507 3300005468 Ga0070707_100059543 Ga0070707_1000595433 189
1508 3300005468 Ga0070707_100137219 Ga0070707_1001372192 189
1509 3300005468 Ga0070707_100288576 Ga0070707_1002885761 189
1510 3300005471 Ga0070698_100001064 Ga0070698_1000010643 189
1511 3300005471 Ga0070698_100139268 Ga0070698_1001392682 189
1512 3300005471 Ga0070698_100142295 Ga0070698_1001422951 189
1513 3300005471 Ga0070698_100200884 Ga0070698_1002008842 189
1514 3300005471 Ga0070698_100379331 Ga0070698_1003793312 189
1515 3300005518 Ga0070699_100097370 Ga0070699_1000973701 189
1516 3300005530 Ga0070679_100102028 Ga0070679_1001020282 189
1517 3300005536 Ga0070697_100016947 Ga0070697_1000169476 189
1518 3300005536 Ga0070697_100051511 Ga0070697_1000515113 189
1519 3300005536 Ga0070697_100188972 Ga0070697_1001889722 189
1520 3300005539 Ga0068853_100091261 Ga0068853_1000912612 189
1521 3300005543 Ga0070672_100234158 Ga0070672_1002341583 189
1522 3300005543 Ga0070672_100299135 Ga0070672_1002991352 189
1523 3300005544 Ga0070686_100012170 Ga0070686_1000121703 189
1524 3300005544 Ga0070686_100575705 Ga0070686_1005757051 189
1525 3300005545 Ga0070695_100029836 Ga0070695_1000298364 189
1526 3300005546 Ga0070696_100054255 Ga0070696_1000542552 189
1527 3300005547 Ga0070693_100057097 Ga0070693_1000570972 189
1528 3300005548 Ga0070665_100527599 Ga0070665_1005275992 189
1529 3300005548 Ga0070665_100664690 Ga0070665_1006646902 189
1530 3300005549 Ga0070704_100013016 Ga0070704_1000130163 189
1531 3300005563 Ga0068855_100033356 Ga0068855_1000333564 189
1532 3300005563 Ga0068855_100352574 Ga0068855_1003525742 189
1533 3300005577 Ga0068857_100804083 Ga0068857_1008040832 189
1534 3300005578 Ga0068854_100064950 Ga0068854_1000649503 189
1535 3300005614 Ga0068856_100032899 Ga0068856_1000328997 189
1536 3300005614 Ga0068856_100063697 Ga0068856_1000636976 189
1537 3300005614 Ga0068856_100080780 Ga0068856_1000807804 189
1538 3300005614 Ga0068856_100308380 Ga0068856_1003083802 189
1539 3300005615 Ga0070702_100005992 Ga0070702_1000059923 189
1540 3300005616 Ga0068852_100177559 Ga0068852_1001775592 189
1541 3300005617 Ga0068859_100628244 Ga0068859_1006282442 189
1542 3300005719 Ga0068861_100059235 Ga0068861_1000592353 189
1543 3300005843 Ga0068860_100209752 Ga0068860_1002097521 189
1544 3300005844 Ga0068862_100126613 Ga0068862_1001266132 189
1545 3300005937 Ga0081455_10022468 Ga0081455_1002246811 189
1546 3300005937 Ga0081455_10061103 Ga0081455_100611032 189
1547 3300005937 Ga0081455_10062816 Ga0081455_100628164 189
1548 3300005937 Ga0081455_10077239 Ga0081455_100772394 189
1549 3300005937 Ga0081455_10124867 Ga0081455_101248673 189
1550 3300005981 Ga0081538_10001252 Ga0081538_1000125225 189
1551 3300005983 Ga0081540_1001718 Ga0081540_100171821 189
1552 3300005983 Ga0081540_1003318 Ga0081540_10033182 189
1553 3300006028 Ga0070717_10009172 Ga0070717_1000917213 189
1554 3300006028 Ga0070717_10038990 Ga0070717_100389907 189
1555 3300006028 Ga0070717_10063532 Ga0070717_100635322 189
1556 3300006028 Ga0070717_10253764 Ga0070717_102537642 189
1557 3300006028 Ga0070717_10441088 Ga0070717_104410882 189
1558 3300006038 Ga0075365_10386264 Ga0075365_103862642 189
1559 3300006042 Ga0075368_10021194 Ga0075368_100211942 189
1560 3300006058 Ga0075432_10002369 Ga0075432_100023697 189
1561 3300006058 Ga0075432_10005901 Ga0075432_100059014 189
1562 3300006163 Ga0070715_10012155 Ga0070715_100121554 189
1563 3300006163 Ga0070715_10232931 Ga0070715_102329311 189
1564 3300006173 Ga0070716_100016479 Ga0070716_1000164796 189
1565 3300006175 Ga0070712_100096938 Ga0070712_1000969382 189
1566 3300006175 Ga0070712_100590110 Ga0070712_1005901102 189
1567 3300006178 Ga0075367_10001061 Ga0075367_1000106110 189
1568 3300006237 Ga0097621_100011407 Ga0097621_1000114076 189
1569 3300006237 Ga0097621_100297014 Ga0097621_1002970142 189
1570 3300006353 Ga0075370_10045395 Ga0075370_100453953 189
1571 3300006358 Ga0068871_100033157 Ga0068871_1000331574 189
1572 3300006358 Ga0068871_100240491 Ga0068871_1002404912 189
1573 3300006844 Ga0075428_100027125 Ga0075428_1000271253 189
1574 3300006844 Ga0075428_101038683 Ga0075428_1010386832 189
1575 3300006847 Ga0075431_100014269 Ga0075431_1000142697 189
1576 3300006852 Ga0075433_10000978 Ga0075433_100009786 189
1577 3300006852 Ga0075433_10026281 Ga0075433_100262817 189
1578 3300006852 Ga0075433_10032299 Ga0075433_100322997 189
1579 3300006852 Ga0075433_10038355 Ga0075433_100383556 189
1580 3300006852 Ga0075433_10203409 Ga0075433_102034092 189
1581 3300006852 Ga0075433_10361927 Ga0075433_103619272 189
1582 3300006871 Ga0075434_100003585 Ga0075434_1000035857 189
1583 3300006871 Ga0075434_100011038 Ga0075434_10001103817 189
1584 3300006871 Ga0075434_100024070 Ga0075434_1000240704 189
1585 3300006880 Ga0075429_100067708 Ga0075429_1000677083 189
1586 3300006881 Ga0068865_100009916 Ga0068865_1000099166 189
1587 3300006881 Ga0068865_100115905 Ga0068865_1001159054 189
1588 3300006914 Ga0075436_100004373 Ga0075436_1000043737 189
1589 3300006914 Ga0075436_100068778 Ga0075436_1000687782 189
1590 3300006914 Ga0075436_100431184 Ga0075436_1004311842 189
1591 3300006931 Ga0097620_100628221 Ga0097620_1006282212 189
1592 3300007076 Ga0075435_100002118 Ga0075435_1000021186 189
1593 3300007076 Ga0075435_100018681 Ga0075435_1000186812 189
1594 3300007076 Ga0075435_100031095 Ga0075435_1000310957 189
1595 3300007076 Ga0075435_100271186 Ga0075435_1002711863 189
1596 3300009011 Ga0105251_10079288 Ga0105251_100792883 189
1597 3300009093 Ga0105240_10212030 Ga0105240_102120303 189
1598 3300009094 Ga0111539_10005852 Ga0111539_100058527 189
1599 3300009094 Ga0111539_10039176 Ga0111539_100391768 189
1600 3300009094 Ga0111539_10042172 Ga0111539_100421727 189
1601 3300009098 Ga0105245_10013039 Ga0105245_100130393 189
1602 3300009098 Ga0105245_10113779 Ga0105245_101137792 189
1603 3300009098 Ga0105245_10176435 Ga0105245_101764353 189
1604 3300009098 Ga0105245_10502978 Ga0105245_105029782 189
1605 3300009101 Ga0105247_10100783 Ga0105247_101007832 189
1606 3300009101 Ga0105247_10174972 Ga0105247_101749722 189
1607 3300009147 Ga0114129_10001031 Ga0114129_1000103128 189
1608 3300009147 Ga0114129_10178916 Ga0114129_101789163 189
1609 3300009148 Ga0105243_10018664 Ga0105243_100186647 189
1610 3300009148 Ga0105243_10261231 Ga0105243_102612313 189
1611 3300009148 Ga0105243_10486471 Ga0105243_104864712 189
1612 3300009174 Ga0105241_10062476 Ga0105241_100624763 189
1613 3300009174 Ga0105241_10570710 Ga0105241_105707101 189
1614 3300009176 Ga0105242_10134747 Ga0105242_101347473 189
1615 3300009176 Ga0105242_10515822 Ga0105242_105158222 189
1616 3300009177 Ga0105248_10131299 Ga0105248_101312994 189
1617 3300009545 Ga0105237_10248848 Ga0105237_102488483 189
1618 3300009545 Ga0105237_10382633 Ga0105237_103826332 189
1619 3300009545 Ga0105237_10393797 Ga0105237_103937972 189
1620 3300009553 Ga0105249_10006301 Ga0105249_1000630112 189
1621 3300009553 Ga0105249_10129759 Ga0105249_101297592 189
1622 3300009553 Ga0105249_10590824 Ga0105249_105908242 189
1623 3300010375 Ga0105239_10032495 Ga0105239_100324953 189
1624 3300010375 Ga0105239_10044933 Ga0105239_100449337 189
1625 3300010375 Ga0105239_10128882 Ga0105239_101288822 189
1626 3300010375 Ga0105239_10498573 Ga0105239_104985732 189
1627 3300011119 Ga0105246_10060007 Ga0105246_100600073 189
1628 3300012494 Ga0157341_1003388 Ga0157341_10033882 189
1629 3300012510 Ga0157316_1013657 Ga0157316_10136571 189
1630 3300013052 Ga0154014_149893 Ga0154014_1498932 189
1631 3300013104 Ga0157370_10116123 Ga0157370_101161233 189
1632 3300013104 Ga0157370_10362689 Ga0157370_103626892 189
1633 3300013104 Ga0157370_11203090 Ga0157370_112030901 189
1634 3300013105 Ga0157369_10521728 Ga0157369_105217282 189
1635 3300013105 Ga0157369_10917311 Ga0157369_109173112 189
1636 3300013296 Ga0157374_10668784 Ga0157374_106687842 189
1637 3300013297 Ga0157378_10133708 Ga0157378_101337082 189
1638 3300013297 Ga0157378_10531625 Ga0157378_105316252 189
1639 3300013306 Ga0163162_10018828 Ga0163162_100188285 189
1640 3300013306 Ga0163162_10044145 Ga0163162_100441454 189
1641 3300013308 Ga0157375_10154676 Ga0157375_101546762 189
1642 3300013308 Ga0157375_10864557 Ga0157375_108645572 189
1643 3300014325 Ga0163163_10027334 Ga0163163_100273347 189
1644 3300014325 Ga0163163_10706685 Ga0163163_107066852 189
1645 3300014326 Ga0157380_10079002 Ga0157380_100790023 189
1646 3300014497 Ga0182008_10000952 Ga0182008_1000095223 189
1647 3300014745 Ga0157377_10036715 Ga0157377_100367153 189
1648 3300014969 Ga0157376_10013732 Ga0157376_100137323 189
1649 3300014969 Ga0157376_10414501 Ga0157376_104145012 189
1650 3300014969 Ga0157376_11423296 Ga0157376_114232961 189
1651 3300015261 Ga0182006_1100755 Ga0182006_11007552 189
1652 3300015262 Ga0182007_10002121 Ga0182007_1000212115 189
1653 3300015688 Ga0183367_1002 Ga0183367_1002769 189
1654 3300017792 Ga0163161_10006328 Ga0163161_100063283 189
1655 3300017792 Ga0163161_10190979 Ga0163161_101909792 189
1656 3300020070 Ga0206356_11183308 Ga0206356_111833082 189
1657 3300020075 Ga0206349_1037049 Ga0206349_10370492 189
1658 3300020075 Ga0206349_1682960 Ga0206349_16829602 189
1659 3300020081 Ga0206354_11216941 Ga0206354_112169412 189
1660 3300020081 Ga0206354_11400321 Ga0206354_114003213 189
1661 3300020082 Ga0206353_10321684 Ga0206353_103216842 189
1662 3300020610 Ga0154015_1055748 Ga0154015_10557481 189
1663 3300022467 Ga0224712_10341098 Ga0224712_103410981 189
1664 3300023309 Ga0256744_115370 Ga0256744_1153702 189
1665 3300023436 Ga0256743_115533 Ga0256743_1155332 189
1666 3300023438 Ga0256720_112709 Ga0256720_1127092 189
1667 3300023438 Ga0256720_136313 Ga0256720_1363132 189
1668 3300025297 Ga0209758_1000870 Ga0209758_100087022 189
1669 3300025302 Ga0207426_1018313 Ga0207426_10183132 189
1670 3300025735 Ga0207713_1011748 Ga0207713_10117482 189
1671 3300025885 Ga0207653_10014646 Ga0207653_100146462 189
1672 3300025898 Ga0207692_10008383 Ga0207692_100083834 189
1673 3300025898 Ga0207692_10010250 Ga0207692_100102504 189
1674 3300025898 Ga0207692_10084806 Ga0207692_100848062 189
1675 3300025899 Ga0207642_10049319 Ga0207642_100493193 189
1676 3300025899 Ga0207642_10587518 Ga0207642_105875181 189
1677 3300025900 Ga0207710_10098472 Ga0207710_100984722 189
1678 3300025900 Ga0207710_10181273 Ga0207710_101812732 189
1679 3300025901 Ga0207688_10005072 Ga0207688_100050722 189
1680 3300025901 Ga0207688_10372142 Ga0207688_103721422 189
1681 3300025904 Ga0207647_10004157 Ga0207647_1000415718 189
1682 3300025905 Ga0207685_10007676 Ga0207685_100076762 189
1683 3300025905 Ga0207685_10070568 Ga0207685_100705682 189
1684 3300025906 Ga0207699_10008367 Ga0207699_100083673 189
1685 3300025907 Ga0207645_10242996 Ga0207645_102429962 189
1686 3300025910 Ga0207684_10001153 Ga0207684_100011537 189
1687 3300025910 Ga0207684_10015837 Ga0207684_100158373 189
1688 3300025910 Ga0207684_10016512 Ga0207684_100165122 189
1689 3300025910 Ga0207684_10247410 Ga0207684_102474103 189
1690 3300025910 Ga0207684_10347855 Ga0207684_103478552 189
1691 3300025911 Ga0207654_10050373 Ga0207654_100503732 189
1692 3300025912 Ga0207707_10492634 Ga0207707_104926342 189
1693 3300025913 Ga0207695_10157892 Ga0207695_101578922 189
1694 3300025914 Ga0207671_10058944 Ga0207671_100589442 189
1695 3300025914 Ga0207671_10393041 Ga0207671_103930411 189
1696 3300025915 Ga0207693_10001283 Ga0207693_100012836 189
1697 3300025915 Ga0207693_10125548 Ga0207693_101255483 189
1698 3300025915 Ga0207693_10205611 Ga0207693_102056113 189
1699 3300025916 Ga0207663_10039430 Ga0207663_100394302 189
1700 3300025916 Ga0207663_10136946 Ga0207663_101369462 189
1701 3300025916 Ga0207663_10720108 Ga0207663_107201081 189
1702 3300025917 Ga0207660_10308643 Ga0207660_103086432 189
1703 3300025917 Ga0207660_10730198 Ga0207660_107301981 189
1704 3300025921 Ga0207652_10186674 Ga0207652_101866742 189
1705 3300025921 Ga0207652_10572884 Ga0207652_105728842 189
1706 3300025922 Ga0207646_10011004 Ga0207646_1001100416 189
1707 3300025922 Ga0207646_10067508 Ga0207646_100675083 189
1708 3300025922 Ga0207646_10089945 Ga0207646_100899451 189
1709 3300025922 Ga0207646_10121009 Ga0207646_101210093 189
1710 3300025923 Ga0207681_10648432 Ga0207681_106484322 189
1711 3300025924 Ga0207694_10180827 Ga0207694_101808272 189
1712 3300025925 Ga0207650_10318575 Ga0207650_103185752 189
1713 3300025925 Ga0207650_10657203 Ga0207650_106572031 189
1714 3300025926 Ga0207659_10334276 Ga0207659_103342761 189
1715 3300025927 Ga0207687_10030714 Ga0207687_100307144 189
1716 3300025927 Ga0207687_10561760 Ga0207687_105617601 189
1717 3300025928 Ga0207700_10010891 Ga0207700_100108914 189
1718 3300025928 Ga0207700_10027951 Ga0207700_100279513 189
1719 3300025928 Ga0207700_10032349 Ga0207700_100323497 189
1720 3300025928 Ga0207700_10119021 Ga0207700_101190212 189
1721 3300025928 Ga0207700_10987072 Ga0207700_109870721 189
1722 3300025929 Ga0207664_10061533 Ga0207664_100615334 189
1723 3300025929 Ga0207664_10062615 Ga0207664_100626153 189
1724 3300025929 Ga0207664_10073251 Ga0207664_100732513 189
1725 3300025932 Ga0207690_10010116 Ga0207690_100101163 189
1726 3300025933 Ga0207706_10021255 Ga0207706_100212557 189
1727 3300025933 Ga0207706_10219773 Ga0207706_102197732 189
1728 3300025935 Ga0207709_10156157 Ga0207709_101561572 189
1729 3300025938 Ga0207704_10285805 Ga0207704_102858052 189
1730 3300025938 Ga0207704_10583975 Ga0207704_105839752 189
1731 3300025939 Ga0207665_10001427 Ga0207665_1000142713 189
1732 3300025939 Ga0207665_10123833 Ga0207665_101238333 189
1733 3300025940 Ga0207691_10149114 Ga0207691_101491142 189
1734 3300025940 Ga0207691_10185045 Ga0207691_101850452 189
1735 3300025941 Ga0207711_10051995 Ga0207711_100519955 189
1736 3300025941 Ga0207711_10088481 Ga0207711_100884812 189
1737 3300025942 Ga0207689_10124036 Ga0207689_101240361 189
1738 3300025944 Ga0207661_10546607 Ga0207661_105466072 189
1739 3300025945 Ga0207679_10211973 Ga0207679_102119731 189
1740 3300025949 Ga0207667_10214120 Ga0207667_102141202 189
1741 3300025949 Ga0207667_10481619 Ga0207667_104816192 189
1742 3300025949 Ga0207667_10674748 Ga0207667_106747482 189
1743 3300025961 Ga0207712_10037052 Ga0207712_100370524 189
1744 3300025961 Ga0207712_10695469 Ga0207712_106954691 189
1745 3300025961 Ga0207712_10720706 Ga0207712_107207061 189
1746 3300025972 Ga0207668_10024959 Ga0207668_100249592 189
1747 3300025972 Ga0207668_10030370 Ga0207668_100303706 189
1748 3300025981 Ga0207640_10415684 Ga0207640_104156842 189
1749 3300025986 Ga0207658_10104520 Ga0207658_101045202 189
1750 3300026023 Ga0207677_10115473 Ga0207677_101154732 189
1751 3300026035 Ga0207703_10086500 Ga0207703_100865002 189
1752 3300026041 Ga0207639_10135234 Ga0207639_101352343 189
1753 3300026041 Ga0207639_10275083 Ga0207639_102750832 189
1754 3300026067 Ga0207678_10038790 Ga0207678_100387904 189
1755 3300026067 Ga0207678_10093060 Ga0207678_100930604 189
1756 3300026075 Ga0207708_10127381 Ga0207708_101273812 189
1757 3300026075 Ga0207708_10375250 Ga0207708_103752501 189
1758 3300026078 Ga0207702_10161734 Ga0207702_101617342 189
1759 3300026078 Ga0207702_10193175 Ga0207702_101931752 189
1760 3300026078 Ga0207702_10731395 Ga0207702_107313951 189
1761 3300026088 Ga0207641_10118864 Ga0207641_101188642 189
1762 3300026088 Ga0207641_10317233 Ga0207641_103172333 189
1763 3300026116 Ga0207674_10860768 Ga0207674_108607681 189
1764 3300026118 Ga0207675_100012489 Ga0207675_1000124893 189
1765 3300026118 Ga0207675_100015081 Ga0207675_1000150814 189
1766 3300026121 Ga0207683_10011673 Ga0207683_100116732 189
1767 3300026121 Ga0207683_10039995 Ga0207683_100399957 189
1768 3300026142 Ga0207698_10079597 Ga0207698_100795972 189
1769 3300026142 Ga0207698_10823552 Ga0207698_108235522 189
1770 3300027866 Ga0209813_10003482 Ga0209813_100034824 189
1771 3300027907 Ga0207428_10001294 Ga0207428_1000129437 189
1772 3300027907 Ga0207428_10001309 Ga0207428_1000130913 189
1773 3300027907 Ga0207428_10217491 Ga0207428_102174912 189
1774 3300028379 Ga0268266_10476450 Ga0268266_104764502 189
1775 3300028380 Ga0268265_11232951 Ga0268265_112329511 189
1776 3300028381 Ga0268264_10184268 Ga0268264_101842682 189
1777 3300028381 Ga0268264_10409105 Ga0268264_104091052 189
1778 3300028786 Ga0307517_10001351 Ga0307517_1000135125 189
1779 3300028786 Ga0307517_10006905 Ga0307517_100069053 189
1780 3300028794 Ga0307515_10099588 Ga0307515_100995882 189
1781 3300028794 Ga0307515_10137744 Ga0307515_101377443 189
1782 3300028794 Ga0307515_10359566 Ga0307515_103595662 189
1783 3300030500 Ga0268256_1030242 Ga0268256_10302422 189
1784 3300030521 Ga0307511_10019247 Ga0307511_100192472 189
1785 3300030521 Ga0307511_10138936 Ga0307511_101389362 189
1786 3300030522 Ga0307512_10093299 Ga0307512_100932994 189
1787 3300030522 Ga0307512_10241088 Ga0307512_102410882 189
1788 3300030731 Ga0316177_1097235 Ga0316177_10972353 189
1789 3300030732 Ga0316176_1064092 Ga0316176_10640925 189
1790 3300030733 Ga0314311_1038998 Ga0314311_10389987 189
1791 3300030734 Ga0316179_1040113 Ga0316179_10401136 189
1792 3300030736 Ga0316180_1043591 Ga0316180_10435912 189
1793 3300031090 Ga0265760_10019592 Ga0265760_100195923 189
1794 3300031247 Ga0265340_10009045 Ga0265340_100090452 189
1795 3300031456 Ga0307513_10083445 Ga0307513_100834453 189
1796 3300031456 Ga0307513_10416362 Ga0307513_104163622 189
1797 3300031507 Ga0307509_10194507 Ga0307509_101945072 189
1798 3300031507 Ga0307509_10259704 Ga0307509_102597042 189
1799 3300031616 Ga0307508_10005319 Ga0307508_1000531923 189
1800 3300031616 Ga0307508_10009349 Ga0307508_100093498 189
1801 3300031616 Ga0307508_10012942 Ga0307508_100129423 189
1802 3300031649 Ga0307514_10032857 Ga0307514_100328575 189
1803 3300031649 Ga0307514_10107474 Ga0307514_101074742 189
1804 3300031730 Ga0307516_10045595 Ga0307516_100455953 189
1805 3300031730 Ga0307516_10058968 Ga0307516_100589684 189
1806 3300031730 Ga0307516_10103569 Ga0307516_101035692 189
1807 3300031731 Ga0307405_10001911 Ga0307405_100019114 189
1808 3300031731 Ga0307405_10023768 Ga0307405_100237682 189
1809 3300031824 Ga0307413_10259962 Ga0307413_102599622 189
1810 3300031838 Ga0307518_10101086 Ga0307518_101010862 189
1811 3300031838 Ga0307518_10324161 Ga0307518_103241612 189
1812 3300031852 Ga0307410_10003149 Ga0307410_100031498 189
1813 3300031852 Ga0307410_10212852 Ga0307410_102128522 189
1814 3300031852 Ga0307410_10411566 Ga0307410_104115662 189
1815 3300031901 Ga0307406_10000352 Ga0307406_1000035211 189
1816 3300031901 Ga0307406_10006213 Ga0307406_100062132 189
1817 3300031903 Ga0307407_10140281 Ga0307407_101402812 189
1818 3300031911 Ga0307412_10139142 Ga0307412_101391422 189
1819 3300031995 Ga0307409_100018091 Ga0307409_1000180917 189
1820 3300031995 Ga0307409_100659367 Ga0307409_1006593672 189
1821 3300032002 Ga0307416_100000084 Ga0307416_10000008447 189
1822 3300032002 Ga0307416_100006136 Ga0307416_1000061362 189
1823 3300032002 Ga0307416_101464017 Ga0307416_1014640172 189
1824 3300032126 Ga0307415_100036814 Ga0307415_1000368144 189
1825 3300032126 Ga0307415_100039636 Ga0307415_1000396362 189
1826 3300032126 Ga0307415_100112967 Ga0307415_1001129673 189
1827 3300032126 Ga0307415_100142164 Ga0307415_1001421644 189
1828 3300033179 Ga0307507_10024623 Ga0307507_100246236 189
1829 3300033179 Ga0307507_10095870 Ga0307507_100958702 189
1830 3300033180 Ga0307510_10103593 Ga0307510_101035933 189
1831 3300033180 Ga0307510_10243770 Ga0307510_102437702 189
1832 3300034818 Ga0373950_0010823 Ga0373950_0010823_271_933 189
1833 3300034957 Ga0373938_0004122 Ga0373938_0004122_955_1617 189
1834 3300034957 Ga0373938_0008257 Ga0373938_0008257_351_998 189
1835 3300035086 Ga0373934_0000328 Ga0373934_0000328_15551_16213 189
1836 3300035088 Ga0373940_0004722 Ga0373940_0004722_920_1582 189
1837 3300035090 Ga0373949_0007524 Ga0373949_0007524_1605_2252 189
1838 3300035111 Ga0373923_0047870 Ga0373923_0047870_354_1022 189
1839 3300035111 Ga0373923_0066649 Ga0373923_0066649_862_1524 189
1840 3300035112 Ga0373932_0037427 Ga0373932_0037427_36_698 189
1841 3300035114 Ga0373939_0004760 Ga0373939_0004760_883_1545 189
1842 3300035115 Ga0373941_0059537 Ga0373941_0059537_248_895 189
1843 3300035117 Ga0373953_0000262 Ga0373953_0000262_7702_8364 189
1844 3300035118 Ga0373954_0045610 Ga0373954_0045610_983_1645 189
1845 3300035119 Ga0373956_0002418 Ga0373956_0002418_28_690 189
1846 3300035119 Ga0373956_0038265 Ga0373956_0038265_507_1166 189
1847 3300035120 Ga0373957_0000312 Ga0373957_0000312_10881_11543 189
1848 3300035121 Ga0373960_0018896 Ga0373960_0018896_381_1043 189
1849 3300035121 Ga0373960_0050109 Ga0373960_0050109_64_711 189
1850 3300035172 Ga0373955_0000233 Ga0373955_0000233_13381_14043 189
1851 3300035207 Ga0373942_0004243 Ga0373942_0004243_2278_2925 189
1852 3300035241 Ga0373961_0021468 Ga0373961_0021468_687_1349 189
1853 3300035241 Ga0373961_0123660 Ga0373961_0123660_93_761 189
1854 3300035242 Ga0373962_0037463 Ga0373962_0037463_342_1004 189
1855 3300035410 Ga0373924_0005559 Ga0373924_0005559_3055_3717 189
1856 3300035691 Ga0373931_0004691 Ga0373931_0004691_1038_1685 189
1857 3300035691 Ga0373931_0007826 Ga0373931_0007826_2201_2863 189
1858 3300035692 Ga0373935_0503624 Ga0373935_0503624_161_823 189
1859 3300035695 Ga0373927_0100065 Ga0373927_0100065_857_1513 189
1860 3300035724 Ga0373933_0000843 Ga0373933_0000843_17366_18028 189
1861 3300035724 Ga0373933_0032699 Ga0373933_0032699_502_1164 189
1862 3300035724 Ga0373933_0087364 Ga0373933_0087364_406_1065 189
1863 3300036401 Ga0373937_0000112 Ga0373937_0000112_28351_29013 189
1864 3300036401 Ga0373937_0036357 Ga0373937_0036357_508_1170 189
1865 3300036401 Ga0373937_0116633 Ga0373937_0116633_219_878 189
1866 3300036401 Ga0373937_0204282 Ga0373937_0204282_51_707 189
1867 3300037068 Ga0373925_0338300 Ga0373925_0338300_120_782 189
1868 3300037312 Ga0395899_0004964 Ga0395899_0004964_778_1422 189
1869 3300037418 Ga0395900_0076472 Ga0395900_0076472_556_1200 189
1870 3300037466 Ga0395898_0012144 Ga0395898_0012144_3830_4474 189
1871 3300037466 Ga0395898_0094766 Ga0395898_0094766_825_1481 189
1872 3300037471 Ga0395905_0132322 Ga0395905_0132322_873_1517 189
1873 3300037853 Ga0436364_0470736 Ga0436364_0470736_14412_15056 189
1874 3300039450 Ga0436363_0708393 Ga0436363_0708393_51_710 189
1875 3300039450 Ga0436363_0811671 Ga0436363_0811671_21_686 189
1876 3300041404 Ga0439436_0015752 Ga0439436_0015752_208_852 189
1877 3300041404 Ga0439436_0068143 Ga0439436_0068143_115_759 189
1878 3300041406 Ga0439439_0007353 Ga0439439_0007353_742_1386 189
1879 3300041408 Ga0439453_0055657 Ga0439453_0055657_65_709 189
1880 3300041410 Ga0439461_0011703 Ga0439461_0011703_118_786 189
1881 3300041452 Ga0451793_0413264 Ga0451793_0413264_878_1555 189
1882 3300041453 Ga0451797_0614536 Ga0451797_0614536_690_1367 189
1883 3300041455 Ga0451801_15629 Ga0451801_15629_641_1285 189
1884 3300041456 Ga0451795_0842912 Ga0451795_0842912_1230_1907 189
1885 3300041486 Ga0451807_0377824 Ga0451807_0377824_528_1190 189
1886 3300041491 Ga0451833_0136736 Ga0451833_0136736_15_659 189
1887 3300041491 Ga0451833_1103000 Ga0451833_1103000_1072_1749 189
1888 3300041505 Ga0451849_0755223 Ga0451849_0755223_86_730 189
1889 3300041512 Ga0451853_1816701 Ga0451853_1816701_198_860 189
1890 3300041512 Ga0451853_3525354 Ga0451853_3525354_1142_1786 189
1891 3300041999 Ga0439433_0006437 Ga0439433_0006437_659_1303 189
1892 3300042005 Ga0439448_0014986 Ga0439448_0014986_1164_1808 189
1893 3300042006 Ga0439432_018318 Ga0439432_018318_616_1260 189
1894 3300042007 Ga0439449_0008439 Ga0439449_0008439_2637_3281 189
1895 3300042012 Ga0439455_0000823 Ga0439455_0000823_3747_4391 189
1896 3300042014 Ga0439457_002690 Ga0439457_002690_1289_1933 189
1897 3300042127 Ga0450890_007427 Ga0450890_007427_56_700 189
1898 3300042131 Ga0450894_000196 Ga0450894_000196_6970_7614 189
1899 3300042133 Ga0450896_003193 Ga0450896_003193_1032_1676 189
1900 3300042134 Ga0450898_000044 Ga0450898_000044_1205_1849 189
1901 3300042135 Ga0450899_002807 Ga0450899_002807_135_779 189
1902 3300042138 Ga0450903_000355 Ga0450903_000355_8143_8787 189
1903 3300042138 Ga0450903_019304 Ga0450903_019304_20_664 189
1904 3300042157 Ga0439458_0007633 Ga0439458_0007633_1532_2176 189
1905 3300042184 Ga0450908_026050 Ga0450908_026050_239_883 189
1906 3300042438 Ga0439459_0045128 Ga0439459_0045128_109_753 189
1907 3300042531 Ga0450918_026208 Ga0450918_026208_244_888 189
1908 3300042533 Ga0450901_004049 Ga0450901_004049_488_1132 189
1909 3300044656 Ga0466969_0009929 Ga0466969_0009929_3690_4334 189
1910 3300044656 Ga0466969_0101895 Ga0466969_0101895_528_1172 189
1911 3300044658 Ga0466972_0029212 Ga0466972_0029212_2015_2659 189
1912 3300044684 Ga0466966_0003375 Ga0466966_0003375_9079_9723 189
1913 3300044684 Ga0466966_0067853 Ga0466966_0067853_335_979 189
1914 3300044684 Ga0466966_0238494 Ga0466966_0238494_239_889 189
1915 3300044693 Ga0466961_0035151 Ga0466961_0035151_2403_3047 189
1916 3300044693 Ga0466961_0037140 Ga0466961_0037140_1048_1692 189
1917 3300044693 Ga0466961_0147922 Ga0466961_0147922_416_1069 189
1918 3300044693 Ga0466961_0181410 Ga0466961_0181410_158_811 189
1919 3300044693 Ga0466961_0210769 Ga0466961_0210769_346_996 189
1920 3300044694 Ga0466963_0017131 Ga0466963_0017131_1234_1884 189
1921 3300044694 Ga0466963_0040644 Ga0466963_0040644_2201_2845 189
1922 3300044694 Ga0466963_0332757 Ga0466963_0332757_55_717 189
1923 3300044719 Ga0466971_0003002 Ga0466971_0003002_44_688 189
1924 3300044765 Ga0466970_0002971 Ga0466970_0002971_44_688 189
1925 3300044842 Ga0466957_0786198 Ga0466957_0786198_21_665 189
1926 3300044901 Ga0466960_0387824 Ga0466960_0387824_115_759 189
1927 3300045049 Ga0466959_0041912 Ga0466959_0041912_1989_2633 189
1928 3300045049 Ga0466959_0044806 Ga0466959_0044806_2571_3215 189
1929 3300045049 Ga0466959_0068627 Ga0466959_0068627_1512_2174 189
1930 3300045049 Ga0466959_0102683 Ga0466959_0102683_1217_1867 189
1931 3300045049 Ga0466959_0185320 Ga0466959_0185320_700_1353 189
1932 3300045049 Ga0466959_0308355 Ga0466959_0308355_241_894 189
1933 3300045836 Ga0466958_0015043 Ga0466958_0015043_284_934 189
1934 3300045836 Ga0466958_0121639 Ga0466958_0121639_947_1591 189
1935 3300045976 Ga0466967_0047957 Ga0466967_0047957_499_1149 189
1936 3300046452 Ga0495617_031958 Ga0495617_031958_691_1335 189
1937 3300046453 Ga0495627_027002 Ga0495627_027002_399_1043 189
1938 3300046454 Ga0495592_0001722 Ga0495592_0001722_753_1415 189
1939 3300046454 Ga0495592_0005017 Ga0495592_0005017_8924_9568 189
1940 3300046454 Ga0495592_0007064 Ga0495592_0007064_4670_5314 189
1941 3300046454 Ga0495592_0021133 Ga0495592_0021133_3921_4565 189
1942 3300046454 Ga0495592_0033327 Ga0495592_0033327_1815_2459 189
1943 3300046455 Ga0495603_0027551 Ga0495603_0027551_372_1016 189
1944 3300046455 Ga0495603_0043327 Ga0495603_0043327_373_1017 189
1945 3300046457 Ga0495590_0024492 Ga0495590_0024492_267_911 189
1946 3300046459 Ga0495629_0060688 Ga0495629_0060688_1845_2489 189
1947 3300046459 Ga0495629_0062953 Ga0495629_0062953_1694_2338 189
1948 3300046459 Ga0495629_0087459 Ga0495629_0087459_1501_2163 189
1949 3300046459 Ga0495629_0099847 Ga0495629_0099847_233_877 189
1950 3300046459 Ga0495629_0270770 Ga0495629_0270770_253_897 189
1951 3300046460 Ga0495638_0145415 Ga0495638_0145415_449_1093 189
1952 3300046461 Ga0495641_0068505 Ga0495641_0068505_471_1133 189
1953 3300046461 Ga0495641_0268005 Ga0495641_0268005_72_719 189
1954 3300046462 Ga0495651_0000041 Ga0495651_0000041_804_1466 189
1955 3300046462 Ga0495651_0006987 Ga0495651_0006987_685_1329 189
1956 3300046462 Ga0495651_0015125 Ga0495651_0015125_650_1294 189
1957 3300046463 Ga0495653_0015129 Ga0495653_0015129_2951_3595 189
1958 3300046463 Ga0495653_0018211 Ga0495653_0018211_134_796 189
1959 3300046463 Ga0495653_0164354 Ga0495653_0164354_778_1440 189
1960 3300046463 Ga0495653_0181996 Ga0495653_0181996_395_1039 189
1961 3300046472 Ga0495580_0007502 Ga0495580_0007502_3479_4123 189
1962 3300046472 Ga0495580_0113683 Ga0495580_0113683_556_1200 189
1963 3300046473 Ga0495582_0065122 Ga0495582_0065122_1239_1883 189
1964 3300046473 Ga0495582_0068049 Ga0495582_0068049_980_1642 189
1965 3300046474 Ga0495605_0021615 Ga0495605_0021615_1537_2181 189
1966 3300046476 Ga0495662_0000096 Ga0495662_0000096_21970_22614 189
1967 3300046476 Ga0495662_0005219 Ga0495662_0005219_691_1353 189
1968 3300046476 Ga0495662_0080379 Ga0495662_0080379_745_1392 189
1969 3300046476 Ga0495662_0243369 Ga0495662_0243369_163_825 189
1970 3300046476 Ga0495662_0297871 Ga0495662_0297871_102_746 189
1971 3300046477 Ga0495664_0005941 Ga0495664_0005941_2048_2692 189
1972 3300046477 Ga0495664_0065989 Ga0495664_0065989_756_1418 189
1973 3300046477 Ga0495664_0185632 Ga0495664_0185632_421_1065 189
1974 3300046491 Ga0495584_0028493 Ga0495584_0028493_52_696 189
1975 3300046492 Ga0495585_0059280 Ga0495585_0059280_216_860 189
1976 3300046492 Ga0495585_0150762 Ga0495585_0150762_171_815 189
1977 3300046499 Ga0495594_0212702 Ga0495594_0212702_121_765 189
1978 3300046499 Ga0495594_0242758 Ga0495594_0242758_167_811 189
1979 3300046500 Ga0495596_0003837 Ga0495596_0003837_6480_7124 189
1980 3300046501 Ga0495607_0004843 Ga0495607_0004843_216_860 189
1981 3300046506 Ga0495583_0037058 Ga0495583_0037058_980_1624 189
1982 3300046507 Ga0495606_0069504 Ga0495606_0069504_1223_1867 189
1983 3300046511 Ga0495608_0001767 Ga0495608_0001767_751_1413 189
1984 3300046511 Ga0495608_0002713 Ga0495608_0002713_9119_9763 189
1985 3300046511 Ga0495608_0099513 Ga0495608_0099513_227_871 189
1986 3300046511 Ga0495608_0172425 Ga0495608_0172425_498_1166 189
1987 3300046513 Ga0495616_0009267 Ga0495616_0009267_2913_3557 189
1988 3300046514 Ga0495618_0264843 Ga0495618_0264843_405_1049 189
1989 3300046514 Ga0495618_0364016 Ga0495618_0364016_70_738 189
1990 3300046516 Ga0495628_0002207 Ga0495628_0002207_8818_9462 189
1991 3300046516 Ga0495628_0003221 Ga0495628_0003221_13281_13943 189
1992 3300046516 Ga0495628_0062544 Ga0495628_0062544_136_780 189
1993 3300046516 Ga0495628_0120589 Ga0495628_0120589_428_1072 189
1994 3300046517 Ga0495630_0002424 Ga0495630_0002424_3461_4105 189
1995 3300046517 Ga0495630_0065814 Ga0495630_0065814_1680_2324 189
1996 3300046517 Ga0495630_0114932 Ga0495630_0114932_1054_1716 189
1997 3300046517 Ga0495630_0402069 Ga0495630_0402069_39_686 189
1998 3300046518 Ga0495631_0023341 Ga0495631_0023341_2062_2706 189
1999 3300046519 Ga0495632_0010084 Ga0495632_0010084_4817_5461 189
2000 3300046520 Ga0495637_0023605 Ga0495637_0023605_733_1377 189
2001 3300046522 Ga0495643_0001180 Ga0495643_0001180_16815_17459 189
2002 3300046522 Ga0495643_0183384 Ga0495643_0183384_178_822 189
2003 3300046523 Ga0495644_0057122 Ga0495644_0057122_63_707 189
2004 3300046524 Ga0495648_0119316 Ga0495648_0119316_495_1139 189
2005 3300046526 Ga0495666_0000307 Ga0495666_0000307_4174_4818 189
2006 3300046526 Ga0495666_0066017 Ga0495666_0066017_50_712 189
2007 3300046528 Ga0495642_0049217 Ga0495642_0049217_795_1439 189
2008 3300046529 Ga0495652_0006542 Ga0495652_0006542_899_1543 189
2009 3300046529 Ga0495652_0010757 Ga0495652_0010757_2251_2895 189
2010 3300046529 Ga0495652_0013883 Ga0495652_0013883_751_1413 189
2011 3300046529 Ga0495652_0028460 Ga0495652_0028460_2695_3339 189
2012 3300046529 Ga0495652_0214015 Ga0495652_0214015_175_819 189
2013 3300046529 Ga0495652_0510191 Ga0495652_0510191_130_789 189
2014 3300046530 Ga0495654_0003279 Ga0495654_0003279_364_1008 189
2015 3300046531 Ga0495665_0001543 Ga0495665_0001543_1618_2262 189
2016 3300046531 Ga0495665_0042392 Ga0495665_0042392_604_1266 189
2017 3300046531 Ga0495665_0046677 Ga0495665_0046677_744_1388 189
2018 3300046533 Ga0495640_0002906 Ga0495640_0002906_10194_10838 189
2019 3300046533 Ga0495640_0007026 Ga0495640_0007026_1271_1915 189
2020 3300046533 Ga0495640_0107847 Ga0495640_0107847_727_1389 189
2021 3300046533 Ga0495640_0156515 Ga0495640_0156515_683_1327 189
2022 3300046533 Ga0495640_0235804 Ga0495640_0235804_463_1125 189
2023 3300046533 Ga0495640_0369347 Ga0495640_0369347_197_841 189
2024 3300046535 Ga0495586_0051840 Ga0495586_0051840_988_1650 189
2025 3300046536 Ga0495587_0000038 Ga0495587_0000038_87106_87768 189
2026 3300046536 Ga0495587_0000793 Ga0495587_0000793_5854_6498 189
2027 3300046536 Ga0495587_0001703 Ga0495587_0001703_650_1294 189
2028 3300046538 Ga0495609_0038187 Ga0495609_0038187_772_1416 189
2029 3300046542 Ga0495597_0094327 Ga0495597_0094327_188_832 189
2030 3300046542 Ga0495597_0099888 Ga0495597_0099888_506_1150 189
2031 3300046543 Ga0495645_0035957 Ga0495645_0035957_866_1528 189
2032 3300046543 Ga0495645_0122656 Ga0495645_0122656_776_1420 189
2033 3300046557 Ga0495622_0019219 Ga0495622_0019219_1430_2074 189
2034 3300046557 Ga0495622_0043855 Ga0495622_0043855_1219_1863 189
2035 3300046557 Ga0495622_0141005 Ga0495622_0141005_364_1008 189
2036 3300046558 Ga0495633_0035752 Ga0495633_0035752_1547_2191 189
2037 3300046558 Ga0495633_0048265 Ga0495633_0048265_369_1013 189
2038 3300046558 Ga0495633_0176033 Ga0495633_0176033_270_914 189
2039 3300046559 Ga0495667_0000985 Ga0495667_0000985_3769_4431 189
2040 3300046559 Ga0495667_0002803 Ga0495667_0002803_1742_2404 189
2041 3300046559 Ga0495667_0064608 Ga0495667_0064608_970_1614 189
2042 3300046559 Ga0495667_0159602 Ga0495667_0159602_212_880 189
2043 3300046615 Ga0495656_0109758 Ga0495656_0109758_524_1168 189
2044 3300046616 Ga0495668_0026813 Ga0495668_0026813_2267_2911 189
2045 3300046616 Ga0495668_0164850 Ga0495668_0164850_413_1081 189
2046 3300046642 Ga0495634_0003295 Ga0495634_0003295_393_1037 189
2047 3300046642 Ga0495634_0003443 Ga0495634_0003443_1829_2473 189
2048 3300046642 Ga0495634_0118083 Ga0495634_0118083_530_1192 189
2049 3300046648 Ga0495611_0037254 Ga0495611_0037254_1301_1945 189
2050 3300046648 Ga0495611_0048818 Ga0495611_0048818_144_788 189
2051 3300046648 Ga0495611_0049261 Ga0495611_0049261_1060_1704 189
2052 3300046660 Ga0495625_0194559 Ga0495625_0194559_270_914 189
2053 3300046663 Ga0495635_0006932 Ga0495635_0006932_421_1065 189
2054 3300046663 Ga0495635_0025689 Ga0495635_0025689_2475_3137 189
2055 3300046663 Ga0495635_0058719 Ga0495635_0058719_879_1541 189
2056 3300046663 Ga0495635_0086607 Ga0495635_0086607_929_1573 189
2057 3300046663 Ga0495635_0139558 Ga0495635_0139558_118_780 189
2058 3300046663 Ga0495635_0215892 Ga0495635_0215892_387_1049 189
2059 3300046665 Ga0495661_0044093 Ga0495661_0044093_1353_1997 189
2060 3300046674 Ga0495588_0007836 Ga0495588_0007836_1308_1952 189
2061 3300046674 Ga0495588_0032147 Ga0495588_0032147_1758_2402 189
2062 3300046674 Ga0495588_0052361 Ga0495588_0052361_308_952 189
2063 3300046674 Ga0495588_0053827 Ga0495588_0053827_494_1156 189
2064 3300046675 Ga0495657_0002519 Ga0495657_0002519_736_1398 189
2065 3300046675 Ga0495657_0004038 Ga0495657_0004038_1739_2383 189
2066 3300046675 Ga0495657_0010741 Ga0495657_0010741_5834_6478 189
2067 3300046675 Ga0495657_0049723 Ga0495657_0049723_681_1343 189
2068 3300046675 Ga0495657_0284606 Ga0495657_0284606_297_941 189
2069 3300046678 Ga0495599_0000100 Ga0495599_0000100_751_1413 189
2070 3300046678 Ga0495599_0021829 Ga0495599_0021829_2703_3347 189
2071 3300046678 Ga0495599_0132360 Ga0495599_0132360_798_1442 189
2072 3300046679 Ga0495623_0004870 Ga0495623_0004870_6866_7513 189
2073 3300046679 Ga0495623_0008402 Ga0495623_0008402_751_1413 189
2074 3300046679 Ga0495623_0043116 Ga0495623_0043116_1578_2222 189
2075 3300046679 Ga0495623_0057157 Ga0495623_0057157_397_1041 189
2076 3300046679 Ga0495623_0153942 Ga0495623_0153942_323_985 189
2077 3300046680 Ga0495646_0011394 Ga0495646_0011394_4264_4908 189
2078 3300046680 Ga0495646_0013572 Ga0495646_0013572_3087_3731 189
2079 3300046680 Ga0495646_0133192 Ga0495646_0133192_421_1065 189
2080 3300046683 Ga0495658_0005541 Ga0495658_0005541_726_1388 189
2081 3300046683 Ga0495658_0249368 Ga0495658_0249368_124_768 189
2082 3300046689 Ga0495613_0005309 Ga0495613_0005309_650_1294 189
2083 3300046689 Ga0495613_0005971 Ga0495613_0005971_8274_8918 189
2084 3300046689 Ga0495613_0098264 Ga0495613_0098264_420_1082 189
2085 3300046689 Ga0495613_0155313 Ga0495613_0155313_357_1001 189
2086 3300046689 Ga0495613_0284071 Ga0495613_0284071_421_1065 189
2087 3300046689 Ga0495613_0455738 Ga0495613_0455738_95_739 189
2088 3300046689 Ga0495613_0481486 Ga0495613_0481486_146_790 189
2089 3300046689 Ga0495613_0570655 Ga0495613_0570655_69_713 189
2090 3300046690 Ga0495624_0095115 Ga0495624_0095115_867_1529 189
2091 3300046690 Ga0495624_0377763 Ga0495624_0377763_14_658 189
2092 3300046691 Ga0495670_0007585 Ga0495670_0007585_2436_3080 189
2093 3300046692 Ga0495671_0091550 Ga0495671_0091550_46_690 189
2094 3300046692 Ga0495671_0169806 Ga0495671_0169806_393_1037 189
2095 3300046694 Ga0495649_0124029 Ga0495649_0124029_30_674 189
2096 3300046694 Ga0495649_0157013 Ga0495649_0157013_520_1164 189
2097 3300046794 Ga0495589_0107380 Ga0495589_0107380_327_971 189
2098 3300046794 Ga0495589_0124392 Ga0495589_0124392_520_1164 189
2099 3300046794 Ga0495589_0156534 Ga0495589_0156534_43_687 189
2100 3300046809 Ga0495600_0002715 Ga0495600_0002715_777_1421 189
2101 3300046809 Ga0495600_0002790 Ga0495600_0002790_3671_4315 189
2102 3300046809 Ga0495600_0007794 Ga0495600_0007794_4312_4956 189
2103 3300046809 Ga0495600_0058454 Ga0495600_0058454_361_1005 189
2104 3300046809 Ga0495600_0095836 Ga0495600_0095836_543_1205 189
2105 3300046809 Ga0495600_0169756 Ga0495600_0169756_272_934 189
2106 3300046809 Ga0495600_0323517 Ga0495600_0323517_99_743 189
2107 3300046810 Ga0495660_0002768 Ga0495660_0002768_9285_9929 189
2108 3300046810 Ga0495660_0019447 Ga0495660_0019447_357_1001 189
2109 3300047315 Ga0495581_0110773 Ga0495581_0110773_777_1421 189
2110 3300047315 Ga0495581_0129320 Ga0495581_0129320_415_1059 189
2111 3300047315 Ga0495581_0155942 Ga0495581_0155942_488_1150 189
2112 3300047315 Ga0495581_0191755 Ga0495581_0191755_420_1064 189
2113 3300047317 Ga0495604_0000061 Ga0495604_0000061_92695_93357 189
2114 3300047317 Ga0495604_0002362 Ga0495604_0002362_8818_9462 189
2115 3300047317 Ga0495604_0003218 Ga0495604_0003218_11983_12627 189
2116 3300047317 Ga0495604_0003385 Ga0495604_0003385_9375_10019 189
2117 3300047317 Ga0495604_0004624 Ga0495604_0004624_8800_9447 189
2118 3300047317 Ga0495604_0037193 Ga0495604_0037193_2301_2963 189
2119 3300047317 Ga0495604_0116519 Ga0495604_0116519_29_673 189
2120 3300047318 Ga0495636_0066113 Ga0495636_0066113_267_911 189
2121 3300047318 Ga0495636_0222975 Ga0495636_0222975_28_672 189
2122 3300047319 Ga0495674_0004274 Ga0495674_0004274_2951_3595 189
2123 3300047319 Ga0495674_0047744 Ga0495674_0047744_1012_1674 189
2124 3300047319 Ga0495674_0076142 Ga0495674_0076142_648_1292 189
2125 3300047319 Ga0495674_0103819 Ga0495674_0103819_998_1660 189
2126 3300047320 Ga0495672_0044620 Ga0495672_0044620_1139_1783 189
2127 3300047321 Ga0495676_0002701 Ga0495676_0002701_1571_2215 189
2128 3300047321 Ga0495676_0015246 Ga0495676_0015246_4472_5116 189
2129 3300047321 Ga0495676_0205541 Ga0495676_0205541_26_688 189
2130 3300047322 Ga0495680_0003514 Ga0495680_0003514_13962_14624 189
2131 3300047322 Ga0495680_0007498 Ga0495680_0007498_4138_4800 189
2132 3300047322 Ga0495680_0238427 Ga0495680_0238427_221_865 189
2133 3300047323 Ga0495683_0013097 Ga0495683_0013097_1968_2612 189
2134 3300047323 Ga0495683_0050441 Ga0495683_0050441_1223_1867 189
2135 3300047443 Ga0495687_015023 Ga0495687_015023_3094_3738 189
2136 3300047444 Ga0495675_0001497 Ga0495675_0001497_5357_6004 189
2137 3300047444 Ga0495675_0003593 Ga0495675_0003593_7940_8602 189
2138 3300047444 Ga0495675_0021385 Ga0495675_0021385_780_1424 189
2139 3300047444 Ga0495675_0029334 Ga0495675_0029334_261_923 189
2140 3300047444 Ga0495675_0086636 Ga0495675_0086636_770_1414 189
2141 3300047444 Ga0495675_0203646 Ga0495675_0203646_301_945 189
2142 3300047446 Ga0495679_019249 Ga0495679_019249_668_1312 189
2143 3300047446 Ga0495679_115338 Ga0495679_115338_74_718 189
2144 3300047447 Ga0495685_000455 Ga0495685_000455_11910_12554 189
2145 3300047447 Ga0495685_014150 Ga0495685_014150_117_761 189
2146 3300047447 Ga0495685_061200 Ga0495685_061200_197_841 189
2147 3300047447 Ga0495685_141204 Ga0495685_141204_64_708 189
2148 3300047469 Ga0495673_0119306 Ga0495673_0119306_267_911 189
2149 3300047470 Ga0495681_0001916 Ga0495681_0001916_1483_2127 189
2150 3300047470 Ga0495681_0057172 Ga0495681_0057172_345_989 189
2151 3300047470 Ga0495681_0081591 Ga0495681_0081591_752_1396 189
2152 3300047471 Ga0495684_0007828 Ga0495684_0007828_4921_5565 189
2153 3300047471 Ga0495684_0043414 Ga0495684_0043414_414_1058 189
2154 3300047471 Ga0495684_0077452 Ga0495684_0077452_323_985 189
2155 3300047471 Ga0495684_0092382 Ga0495684_0092382_530_1192 189
2156 3300047471 Ga0495684_0190926 Ga0495684_0190926_442_1110 189
2157 3300047471 Ga0495684_0324668 Ga0495684_0324668_102_746 189
2158 3300047472 Ga0495686_0041778 Ga0495686_0041778_2041_2685 189
2159 3300047472 Ga0495686_0068495 Ga0495686_0068495_1385_2029 189
2160 3300047673 Ga0495593_0004470 Ga0495593_0004470_2102_2746 189
2161 3300047673 Ga0495593_0010612 Ga0495593_0010612_421_1065 189
2162 3300047673 Ga0495593_0020873 Ga0495593_0020873_292_936 189
2163 3300047673 Ga0495593_0025598 Ga0495593_0025598_2064_2726 189
2164 3300048088 Ga0495602_0004271 Ga0495602_0004271_14021_14683 189
2165 3300048088 Ga0495602_0061797 Ga0495602_0061797_418_1077 189
2166 3300048088 Ga0495602_0103068 Ga0495602_0103068_780_1424 189
2167 3300048088 Ga0495602_0195461 Ga0495602_0195461_633_1277 189
2168 3300048089 Ga0495614_0046356 Ga0495614_0046356_509_1171 189
2169 3300048091 Ga0495626_0084005 Ga0495626_0084005_75_719 189
2170 3300048903 Ga0496100_0309830 Ga0496100_0309830_342_1004 189
2171 3300048903 Ga0496100_0656067 Ga0496100_0656067_30_674 189
2172 3300048904 Ga0496101_0020119 Ga0496101_0020119_3712_4374 189
2173 3300048904 Ga0496101_0090279 Ga0496101_0090279_623_1270 189
2174 3300048904 Ga0496101_0468193 Ga0496101_0468193_189_833 189
2175 3300048905 Ga0496102_0017957 Ga0496102_0017957_53_700 189
2176 3300048905 Ga0496102_0207752 Ga0496102_0207752_811_1464 189
2177 3300048905 Ga0496102_0396618 Ga0496102_0396618_237_899 189
2178 3300048906 Ga0496103_0108772 Ga0496103_0108772_801_1448 189
2179 3300048906 Ga0496103_0134084 Ga0496103_0134084_696_1358 189
2180 3300048907 Ga0496104_0114592 Ga0496104_0114592_1168_1830 189
2181 3300048908 Ga0496105_0070498 Ga0496105_0070498_2213_2875 189
2182 3300048908 Ga0496105_0097653 Ga0496105_0097653_119_766 189
2183 3300048908 Ga0496105_0130704 Ga0496105_0130704_398_1042 189
2184 3300048908 Ga0496105_0347481 Ga0496105_0347481_16_669 189
2185 3300048909 Ga0496106_0008748 Ga0496106_0008748_593_1255 189
2186 3300048909 Ga0496106_0015391 Ga0496106_0015391_4574_5221 189
2187 3300048910 Ga0496107_0003098 Ga0496107_0003098_8897_9559 189
2188 3300048910 Ga0496107_0087301 Ga0496107_0087301_669_1316 189
2189 3300048910 Ga0496107_0506167 Ga0496107_0506167_196_840 189
2190 3300048911 Ga0496108_0017703 Ga0496108_0017703_4316_4978 189
2191 3300048911 Ga0496108_0279877 Ga0496108_0279877_91_735 189
2192 3300048911 Ga0496108_0295988 Ga0496108_0295988_458_1135 189
2193 3300048912 Ga0496109_0008123 Ga0496109_0008123_7976_8623 189
2194 3300048912 Ga0496109_0118627 Ga0496109_0118627_1181_1843 189
2195 3300048912 Ga0496109_0174571 Ga0496109_0174571_217_894 189
2196 3300048912 Ga0496109_0212270 Ga0496109_0212270_236_880 189
2197 3300048912 Ga0496109_0258896 Ga0496109_0258896_621_1268 189
2198 3300048913 Ga0496110_0139983 Ga0496110_0139983_1039_1686 189
2199 3300048914 Ga0496111_0025721 Ga0496111_0025721_3302_3949 189
2200 3300048914 Ga0496111_0563106 Ga0496111_0563106_104_766 189
2201 3300048915 Ga0496112_0071181 Ga0496112_0071181_1449_2096 189
2202 3300048915 Ga0496112_0095479 Ga0496112_0095479_1518_2180 189
2203 3300048915 Ga0496112_0224577 Ga0496112_0224577_101_745 189
2204 3300048916 Ga0496113_0010802 Ga0496113_0010802_235_882 189
2205 3300048916 Ga0496113_0071851 Ga0496113_0071851_1539_2201 189
2206 3300048917 Ga0496114_0005106 Ga0496114_0005106_780_1427 189
2207 3300048917 Ga0496114_0134475 Ga0496114_0134475_342_1004 189
2208 3300048917 Ga0496114_0249116 Ga0496114_0249116_823_1467 189
2209 3300048918 Ga0496115_0028874 Ga0496115_0028874_992_1639 189
2210 3300048918 Ga0496115_0034249 Ga0496115_0034249_2560_3222 189
2211 3300048918 Ga0496115_0344752 Ga0496115_0344752_328_981 189
2212 3300048921 Ga0496118_0097951 Ga0496118_0097951_485_1144 189
2213 3300048924 Ga0496121_0254217 Ga0496121_0254217_284_928 189
2214 3300048927 Ga0496124_0206032 Ga0496124_0206032_233_877 189
2215 3300049127 Ga0501306_001679 Ga0501306_001679_192_836 189
2216 3300049127 Ga0501306_007992 Ga0501306_007992_376_1068 189
2217 3300049127 Ga0501306_011356 Ga0501306_011356_167_835 189
2218 3300049127 Ga0501306_018194 Ga0501306_018194_121_765 189
2219 3300049128 Ga0501308_004720 Ga0501308_004720_214_858 189
2220 3300049128 Ga0501308_023397 Ga0501308_023397_25_717 189
2221 3300049129 Ga0501309_000092 Ga0501309_000092_3800_4444 189
2222 3300049129 Ga0501309_000841 Ga0501309_000841_1440_2084 189
2223 3300049129 Ga0501309_011160 Ga0501309_011160_410_1078 189
2224 3300049129 Ga0501309_030555 Ga0501309_030555_21_713 189
2225 3300049130 Ga0501310_000462 Ga0501310_000462_702_1346 189
2226 3300049130 Ga0501310_000539 Ga0501310_000539_656_1300 189
2227 3300049130 Ga0501310_000909 Ga0501310_000909_57_701 189
2228 3300049130 Ga0501310_019850 Ga0501310_019850_107_799 189
2229 3300049131 Ga0501341_03506 Ga0501341_03506_24_668 189
2230 3300049160 Ga0501304_003473 Ga0501304_003473_461_1105 189
2231 3300049161 Ga0501305_000169 Ga0501305_000169_3203_3847 189
2232 3300049161 Ga0501305_000982 Ga0501305_000982_704_1348 189
2233 3300049162 Ga0501307_001466 Ga0501307_001466_669_1313 189
2234 3300049162 Ga0501307_010454 Ga0501307_010454_108_776 189
2235 3300049162 Ga0501307_025385 Ga0501307_025385_77_769 189
2236 3300049459 Ga0495678_017994 Ga0495678_017994_843_1487 189
2237 3300049460 Ga0495682_0029547 Ga0495682_0029547_125_769 189
2238 3300049527 Ga0501311_000045 Ga0501311_000045_3739_4383 189
2239 3300049527 Ga0501311_000292 Ga0501311_000292_676_1320 189
2240 3300049527 Ga0501311_000629 Ga0501311_000629_1771_2415 189
2241 3300049527 Ga0501311_014668 Ga0501311_014668_33_725 189
2242 3300049528 Ga0501312_000107 Ga0501312_000107_3790_4434 189
2243 3300049529 Ga0501313_004172 Ga0501313_004172_191_835 189
2244 3300049530 Ga0501314_001487 Ga0501314_001487_92_736 189
2245 3300049531 Ga0501315_009959 Ga0501315_009959_268_912 189
2246 3300049531 Ga0501315_010313 Ga0501315_010313_111_803 189
2247 3300049532 Ga0501316_000240 Ga0501316_000240_2036_2680 189
2248 3300049532 Ga0501316_004139 Ga0501316_004139_267_911 189
2249 3300049532 Ga0501316_011167 Ga0501316_011167_36_728 189
2250 3300049532 Ga0501316_016154 Ga0501316_016154_209_853 189
2251 3300049533 Ga0501317_000189 Ga0501317_000189_190_834 189
2252 3300049533 Ga0501317_000890 Ga0501317_000890_192_836 189
2253 3300049533 Ga0501317_000984 Ga0501317_000984_422_1114 189
2254 3300049534 Ga0501318_000316 Ga0501318_000316_2018_2662 189
2255 3300049534 Ga0501318_002104 Ga0501318_002104_477_1145 189
2256 3300049534 Ga0501318_002680 Ga0501318_002680_235_927 189
2257 3300049535 Ga0501319_007056 Ga0501319_007056_21_713 189
2258 3300049536 Ga0501320_000053 Ga0501320_000053_703_1347 189
2259 3300049536 Ga0501320_001218 Ga0501320_001218_192_836 189
2260 3300049536 Ga0501320_021752 Ga0501320_021752_89_736 189
2261 3300049536 Ga0501320_022482 Ga0501320_022482_13_657 189
2262 3300049537 Ga0501321_004657 Ga0501321_004657_331_1023 189
2263 3300049537 Ga0501321_006061 Ga0501321_006061_536_1180 189
2264 3300049539 Ga0501323_000010 Ga0501323_000010_7870_8514 189
2265 3300049539 Ga0501323_000408 Ga0501323_000408_2249_2893 189
2266 3300049539 Ga0501323_009843 Ga0501323_009843_280_972 189
2267 3300049540 Ga0501324_000023 Ga0501324_000023_1034_1678 189
2268 3300049540 Ga0501324_001485 Ga0501324_001485_278_922 189
2269 3300049540 Ga0501324_016267 Ga0501324_016267_22_714 189
2270 3300049541 Ga0501325_001205 Ga0501325_001205_703_1347 189
2271 3300049541 Ga0501325_001702 Ga0501325_001702_196_888 189
2272 3300049541 Ga0501325_002087 Ga0501325_002087_496_1164 189
2273 3300049544 Ga0501328_00655 Ga0501328_00655_356_1000 189
2274 3300049568 Ga0501031_0003261 Ga0501031_0003261_1983_2627 189
2275 3300049568 Ga0501031_0136645 Ga0501031_0136645_31_675 189
2276 3300049569 Ga0501032_0001347 Ga0501032_0001347_2015_2659 189
2277 3300049569 Ga0501032_0034251 Ga0501032_0034251_1846_2490 189
2278 3300049569 Ga0501032_0172331 Ga0501032_0172331_102_746 189
2279 3300049570 Ga0501033_0005545 Ga0501033_0005545_1658_2302 189
2280 3300049570 Ga0501033_0042339 Ga0501033_0042339_2083_2727 189
2281 3300049570 Ga0501033_0568872 Ga0501033_0568872_50_694 189
2282 3300049571 Ga0501034_0011756 Ga0501034_0011756_7677_8321 189
2283 3300049571 Ga0501034_0030255 Ga0501034_0030255_129_773 189
2284 3300049571 Ga0501034_0177975 Ga0501034_0177975_1438_2082 189
2285 3300049572 Ga0501036_0074674 Ga0501036_0074674_738_1382 189
2286 3300049572 Ga0501036_0145571 Ga0501036_0145571_35_679 189
2287 3300049572 Ga0501036_0632479 Ga0501036_0632479_50_694 189
2288 3300049573 Ga0501037_0004030 Ga0501037_0004030_7694_8338 189
2289 3300049573 Ga0501037_0223059 Ga0501037_0223059_214_858 189
2290 3300049574 Ga0501038_0007465 Ga0501038_0007465_7682_8326 189
2291 3300049574 Ga0501038_0032655 Ga0501038_0032655_3834_4478 189
2292 3300049574 Ga0501038_0130009 Ga0501038_0130009_1202_1846 189
2293 3300049574 Ga0501038_0155865 Ga0501038_0155865_1177_1821 189
2294 3300049574 Ga0501038_0448345 Ga0501038_0448345_227_871 189
2295 3300049575 Ga0501039_0003016 Ga0501039_0003016_328_972 189
2296 3300049575 Ga0501039_0032587 Ga0501039_0032587_3165_3809 189
2297 3300049575 Ga0501039_0395022 Ga0501039_0395022_214_885 189
2298 3300049575 Ga0501039_0788505 Ga0501039_0788505_69_713 189
2299 3300049576 Ga0501040_0002706 Ga0501040_0002706_2166_2810 189
2300 3300049577 Ga0501041_0002671 Ga0501041_0002671_1590_2234 189
2301 3300049578 Ga0501042_0073359 Ga0501042_0073359_1687_2331 189
2302 3300049578 Ga0501042_0088501 Ga0501042_0088501_220_864 189
2303 3300049578 Ga0501042_0239739 Ga0501042_0239739_566_1210 189
2304 3300049579 Ga0501043_0028012 Ga0501043_0028012_3040_3684 189
2305 3300049580 Ga0501046_0002011 Ga0501046_0002011_738_1382 189
2306 3300049580 Ga0501046_0055522 Ga0501046_0055522_1040_1684 189
2307 3300049581 Ga0501047_0008040 Ga0501047_0008040_7650_8294 189
2308 3300049581 Ga0501047_0113282 Ga0501047_0113282_1209_1853 189
2309 3300049581 Ga0501047_0119157 Ga0501047_0119157_1686_2330 189
2310 3300049581 Ga0501047_0168941 Ga0501047_0168941_682_1326 189
2311 3300049581 Ga0501047_0603980 Ga0501047_0603980_174_818 189
2312 3300049581 Ga0501047_0619889 Ga0501047_0619889_231_875 189
2313 3300049582 Ga0501048_0001026 Ga0501048_0001026_3040_3684 189
2314 3300049582 Ga0501048_0032492 Ga0501048_0032492_126_770 189
2315 3300049582 Ga0501048_0700073 Ga0501048_0700073_19_663 189
2316 3300049583 Ga0501067_0000592 Ga0501067_0000592_1786_2430 189
2317 3300049584 Ga0501068_0003271 Ga0501068_0003271_7713_8357 189
2318 3300049585 Ga0501069_0005589 Ga0501069_0005589_4410_5054 189
2319 3300049586 Ga0501070_0004123 Ga0501070_0004123_220_864 189
2320 3300049586 Ga0501070_0023364 Ga0501070_0023364_210_854 189
2321 3300049587 Ga0501071_0045415 Ga0501071_0045415_2290_2934 189
2322 3300049588 Ga0501072_0001152 Ga0501072_0001152_2019_2663 189
2323 3300049589 Ga0501073_0004460 Ga0501073_0004460_7677_8321 189
2324 3300049590 Ga0501074_0003829 Ga0501074_0003829_738_1382 189
2325 3300049592 Ga0501076_0010773 Ga0501076_0010773_1195_1839 189
2326 3300049592 Ga0501076_0226753 Ga0501076_0226753_259_930 189
2327 3300049593 Ga0501077_0031876 Ga0501077_0031876_833_1477 189
2328 3300049658 Ga0501211_007722 Ga0501211_007722_273_941 189
2329 3300049673 Ga0501240_033537 Ga0501240_033537_152_820 189
2330 3300049741 Ga0501079_0007489 Ga0501079_0007489_2166_2810 189
2331 3300049742 Ga0501080_0091006 Ga0501080_0091006_832_1476 189
2332 3300049743 Ga0501081_0202791 Ga0501081_0202791_370_1014 189
2333 3300049743 Ga0501081_0273878 Ga0501081_0273878_208_879 189
2334 3300049744 Ga0501083_0008844 Ga0501083_0008844_4724_5368 189
2335 3300049822 Ga0501035_0001420 Ga0501035_0001420_19190_19834 189
2336 3300049822 Ga0501035_0064312 Ga0501035_0064312_1264_1908 189
2337 3300049822 Ga0501035_0073431 Ga0501035_0073431_58_702 189
2338 3300049822 Ga0501035_0097200 Ga0501035_0097200_738_1382 189
2339 3300049823 Ga0501044_0010423 Ga0501044_0010423_7682_8326 189
2340 3300049823 Ga0501044_0059225 Ga0501044_0059225_105_749 189
2341 3300049823 Ga0501044_0434389 Ga0501044_0434389_388_1032 189
2342 3300049823 Ga0501044_0620711 Ga0501044_0620711_122_766 189
2343 3300049824 Ga0501045_0005656 Ga0501045_0005656_7677_8321 189
2344 3300049851 Ga0501212_008665 Ga0501212_008665_720_1364 189
2345 3300050492 nmdc:mga0yw44_150406_c1 nmdc:mga0yw44_150406_c1_547_1191 189
2346 3300050494 nmdc:mga06z11_1439_c1 nmdc:mga06z11_1439_c1_7578_8222 189
2347 3300050495 nmdc:mga04h51_3706_c1 nmdc:mga04h51_3706_c1_413_1057 189
2348 3300050496 nmdc:mga07m45_33523_c1 nmdc:mga07m45_33523_c1_1797_2441 189
2349 3300050507 nmdc:mga05p37_1182_c1 nmdc:mga05p37_1182_c1_4936_5604 189
2350 3300050507 nmdc:mga05p37_25728_c1 nmdc:mga05p37_25728_c1_272_934 189
2351 3300050508 nmdc:mga09592_81918_c1 nmdc:mga09592_81918_c1_1416_2084 189
2352 3300050509 nmdc:mga0qj67_171363_c1 nmdc:mga0qj67_171363_c1_190_858 189
2353 3300050510 nmdc:mga06r32_12774_c1 nmdc:mga06r32_12774_c1_3871_4539 189
2354 3300050511 nmdc:mga08y16_186460_c1 nmdc:mga08y16_186460_c1_633_1301 189
2355 3300050511 nmdc:mga08y16_42012_c1 nmdc:mga08y16_42012_c1_2913_3581 189
2356 3300050511 nmdc:mga08y16_46306_c1 nmdc:mga08y16_46306_c1_423_1085 189
2357 3300050512 nmdc:mga0n895_1292651_c1 nmdc:mga0n895_1292651_c1_25_687 189
2358 3300050512 nmdc:mga0n895_1321_c1 nmdc:mga0n895_1321_c1_4895_5563 189
2359 3300050512 nmdc:mga0n895_158862_c1 nmdc:mga0n895_158862_c1_314_976 189
2360 3300050512 nmdc:mga0n895_38777_c1 nmdc:mga0n895_38777_c1_3848_4516 189
2361 3300050512 nmdc:mga0n895_441327_c1 nmdc:mga0n895_441327_c1_307_954 189
2362 3300050513 nmdc:mga0rr50_191893_c1 nmdc:mga0rr50_191893_c1_315_977 189
2363 3300050513 nmdc:mga0rr50_539977_c1 nmdc:mga0rr50_539977_c1_65_727 189
2364 3300050513 nmdc:mga0rr50_60041_c1 nmdc:mga0rr50_60041_c1_461_1123 189
2365 3300050513 nmdc:mga0rr50_6615_c1 nmdc:mga0rr50_6615_c1_2492_3160 189
2366 3300050514 nmdc:mga08x19_2822_c1 nmdc:mga08x19_2822_c1_879_1547 189
2367 3300050514 nmdc:mga08x19_74851_c1 nmdc:mga08x19_74851_c1_863_1525 189
2368 3300050515 nmdc:mga0a205_21232_c1 nmdc:mga0a205_21232_c1_4999_5667 189
2369 3300050515 nmdc:mga0a205_27458_c1 nmdc:mga0a205_27458_c1_799_1446 189
2370 3300050515 nmdc:mga0a205_43558_c1 nmdc:mga0a205_43558_c1_3214_3876 189
2371 3300050515 nmdc:mga0a205_5430_c1 nmdc:mga0a205_5430_c1_3593_4261 189
2372 3300053077 Ga0495601_0008409 Ga0495601_0008409_3475_4119 189
2373 3300053077 Ga0495601_0059321 Ga0495601_0059321_1105_1767 189
2374 3300053079 Ga0500610_0197758 Ga0500610_0197758_252_896 189
2375 3300053085 Ga0495619_0050763 Ga0495619_0050763_2036_2680 189
2376 3300053085 Ga0495619_0211679 Ga0495619_0211679_25_687 189
2377 3300053086 Ga0500578_0006009 Ga0500578_0006009_6206_6850 189
2378 3300053092 Ga0500583_0061272 Ga0500583_0061272_271_915 189
2379 3300053094 Ga0500566_0095817 Ga0500566_0095817_213_857 189
2380 3300053095 Ga0500640_002433 Ga0500640_002433_2162_2806 189
2381 3300053096 Ga0500641_0007318 Ga0500641_0007318_2260_2904 189
2382 3300053099 Ga0500654_002699 Ga0500654_002699_1129_1773 189
2383 3300053101 Ga0500553_031480 Ga0500553_031480_1714_2358 189
2384 3300053101 Ga0500553_086416 Ga0500553_086416_123_767 189
2385 3300053107 Ga0500560_002453 Ga0500560_002453_43_687 189
2386 3300053107 Ga0500560_115508 Ga0500560_115508_13_657 189
2387 3300053109 Ga0500569_000210 Ga0500569_000210_789_1433 189
2388 3300053122 Ga0500608_033686 Ga0500608_033686_1257_1901 189
2389 3300053129 Ga0500628_012752 Ga0500628_012752_243_887 189
2390 3300053131 Ga0500652_001087 Ga0500652_001087_3075_3719 189
2391 3300053134 Ga0500658_0002819 Ga0500658_0002819_1150_1794 189
2392 3300053134 Ga0500658_0115183 Ga0500658_0115183_78_722 189
2393 3300053136 Ga0500559_0231483 Ga0500559_0231483_135_779 189
2394 3300053137 Ga0500561_0000167 Ga0500561_0000167_10581_11225 189
2395 3300053140 Ga0500573_0052432 Ga0500573_0052432_183_827 189
2396 3300053143 Ga0500579_024872 Ga0500579_024872_191_835 189
2397 3300053146 Ga0500588_0077807 Ga0500588_0077807_184_828 189
2398 3300053149 Ga0500600_0006438 Ga0500600_0006438_4747_5391 189
2399 3300053153 Ga0500616_0004474 Ga0500616_0004474_4546_5190 189
2400 3300053158 Ga0500627_0154850 Ga0500627_0154850_74_718 189
2401 3300053160 Ga0500633_0000736 Ga0500633_0000736_2330_2974 189
2402 3300053161 Ga0500634_0024229 Ga0500634_0024229_1346_1990 189
2403 3300053161 Ga0500634_0030541 Ga0500634_0030541_1720_2364 189
2404 3300053732 Ga0500656_000787 Ga0500656_000787_668_1312 189
2405 3300054114 Ga0501084_0001550 Ga0501084_0001550_1248_1892 189
2406 3300054114 Ga0501084_0074002 Ga0501084_0074002_1106_1777 189
2407 3300059508 Ga0587088_004376 Ga0587088_004376_365_1009 189
2408 3300059605 Ga0587106_003836 Ga0587106_003836_692_1339 189
2409 3300059605 Ga0587106_010813 Ga0587106_010813_356_1003 189
2410 3300059645 Ga0587076_009203 Ga0587076_009203_587_1231 189
2411 3300060353 Ga0501082_0013322 Ga0501082_0013322_758_1402 189
2412 3300061719 Ga0466962_0002748 Ga0466962_0002748_2179_2823 189
2413 3300061734 Ga0530510_0197048 Ga0530510_0197048_679_1323 189
2414 3300061734 Ga0530510_0205357 Ga0530510_0205357_557_1228 189
2415 3300061734 Ga0530510_0437948 Ga0530510_0437948_322_966 189
2416 iso_pu_bacteria 2738543034 2739363094 189
2417 iso_pu_bacteria 2744054611 2744955819 189
2418 iso_pu_bacteria 2816332119 2816421168 189
2419 iso_pu_bacteria 2904765812 2904766149 189
2420 iso_pu_bacteria 2904770941 2904773360 189
2421 iso_pu_bacteria 2908811453 2908812088 189
2422 iso_pu_bacteria 2919420072 2919421425 189
2423 iso_pu_bacteria 2919432681 2919432817 189
2424 iso_pu_bacteria 2974315732 2974316186 189
2425 iso_pu_bacteria 2984523437 2984524349 189
2426 3300003162 Ga0006778J45830_1010146 Ga0006778J45830_10101462 190
2427 3300003544 Ga0007417J51691_1018541 Ga0007417J51691_10185412 190
2428 3300003575 Ga0007409J51694_1011191 Ga0007409J51694_10111911 190
2429 3300003579 Ga0007429J51699_1013064 Ga0007429J51699_10130641 190
2430 3300003659 JGI25404J52841_10006168 JGI25404J52841_100061684 190
2431 3300005327 Ga0070658_10218725 Ga0070658_102187251 190
2432 3300005329 Ga0070683_100384042 Ga0070683_1003840422 190
2433 3300005329 Ga0070683_100433319 Ga0070683_1004333192 190
2434 3300005338 Ga0068868_100945587 Ga0068868_1009455871 190
2435 3300005339 Ga0070660_100026612 Ga0070660_1000266122 190
2436 3300005341 Ga0070691_10022947 Ga0070691_100229474 190
2437 3300005344 Ga0070661_100319418 Ga0070661_1003194182 190
2438 3300005367 Ga0070667_100016592 Ga0070667_10001659210 190
2439 3300005435 Ga0070714_100177988 Ga0070714_1001779883 190
2440 3300005437 Ga0070710_10000376 Ga0070710_1000037620 190
2441 3300005438 Ga0070701_10018401 Ga0070701_100184012 190
2442 3300005440 Ga0070705_100241954 Ga0070705_1002419542 190
2443 3300005441 Ga0070700_100028068 Ga0070700_1000280683 190
2444 3300005445 Ga0070708_100151231 Ga0070708_1001512312 190
2445 3300005455 Ga0070663_100003713 Ga0070663_10000371316 190
2446 3300005456 Ga0070678_100172790 Ga0070678_1001727901 190
2447 3300005458 Ga0070681_10043340 Ga0070681_100433403 190
2448 3300005459 Ga0068867_100116417 Ga0068867_1001164174 190
2449 3300005459 Ga0068867_100749052 Ga0068867_1007490522 190
2450 3300005535 Ga0070684_100020206 Ga0070684_1000202062 190
2451 3300005535 Ga0070684_100305734 Ga0070684_1003057342 190
2452 3300005543 Ga0070672_100136242 Ga0070672_1001362423 190
2453 3300005577 Ga0068857_100023375 Ga0068857_1000233757 190
2454 3300005617 Ga0068859_100514228 Ga0068859_1005142283 190
2455 3300005618 Ga0068864_100769382 Ga0068864_1007693822 190
2456 3300005718 Ga0068866_10006852 Ga0068866_100068528 190
2457 3300005840 Ga0068870_10006791 Ga0068870_1000679110 190
2458 3300005840 Ga0068870_10132749 Ga0068870_101327492 190
2459 3300005841 Ga0068863_100667747 Ga0068863_1006677472 190
2460 3300005937 Ga0081455_10106856 Ga0081455_101068564 190
2461 3300005937 Ga0081455_10364371 Ga0081455_103643712 190
2462 3300005983 Ga0081540_1000341 Ga0081540_100034140 190
2463 3300005985 Ga0081539_10043682 Ga0081539_100436823 190
2464 3300006163 Ga0070715_10108496 Ga0070715_101084962 190
2465 3300006173 Ga0070716_100328774 Ga0070716_1003287742 190
2466 3300006353 Ga0075370_10308570 Ga0075370_103085702 190
2467 3300006358 Ga0068871_100065721 Ga0068871_1000657214 190
2468 3300006881 Ga0068865_100121108 Ga0068865_1001211083 190
2469 3300006881 Ga0068865_100418903 Ga0068865_1004189032 190
2470 3300006881 Ga0068865_100445483 Ga0068865_1004454832 190
2471 3300006914 Ga0075436_100146206 Ga0075436_1001462063 190
2472 3300006931 Ga0097620_100514210 Ga0097620_1005142102 190
2473 3300009011 Ga0105251_10106002 Ga0105251_101060022 190
2474 3300009098 Ga0105245_10059566 Ga0105245_100595663 190
2475 3300009098 Ga0105245_10092368 Ga0105245_100923683 190
2476 3300009098 Ga0105245_10886189 Ga0105245_108861892 190
2477 3300009098 Ga0105245_11248534 Ga0105245_112485342 190
2478 3300009101 Ga0105247_10000016 Ga0105247_10000016228 190
2479 3300009101 Ga0105247_10274696 Ga0105247_102746962 190
2480 3300009148 Ga0105243_10092563 Ga0105243_100925633 190
2481 3300009148 Ga0105243_10157054 Ga0105243_101570542 190
2482 3300009176 Ga0105242_10237560 Ga0105242_102375602 190
2483 3300009177 Ga0105248_10002899 Ga0105248_1000289932 190
2484 3300009177 Ga0105248_10150854 Ga0105248_101508542 190
2485 3300009177 Ga0105248_10818465 Ga0105248_108184652 190
2486 3300009551 Ga0105238_10208529 Ga0105238_102085293 190
2487 3300009551 Ga0105238_10256990 Ga0105238_102569902 190
2488 3300009551 Ga0105238_11131257 Ga0105238_111312571 190
2489 3300009553 Ga0105249_10130017 Ga0105249_101300172 190
2490 3300011119 Ga0105246_10025484 Ga0105246_100254842 190
2491 3300012497 Ga0157319_1002784 Ga0157319_10027842 190
2492 3300012498 Ga0157345_1002226 Ga0157345_10022262 190
2493 3300012507 Ga0157342_1000500 Ga0157342_10005002 190
2494 3300012515 Ga0157338_1001314 Ga0157338_10013143 190
2495 3300013102 Ga0157371_10024599 Ga0157371_100245993 190
2496 3300013104 Ga0157370_10172213 Ga0157370_101722134 190
2497 3300013105 Ga0157369_10311994 Ga0157369_103119942 190
2498 3300013296 Ga0157374_10229933 Ga0157374_102299332 190
2499 3300013297 Ga0157378_10248802 Ga0157378_102488022 190
2500 3300013308 Ga0157375_10016636 Ga0157375_100166365 190
2501 3300013308 Ga0157375_10645681 Ga0157375_106456812 190
2502 3300014325 Ga0163163_10018482 Ga0163163_100184822 190
2503 3300014325 Ga0163163_10057195 Ga0163163_100571953 190
2504 3300014325 Ga0163163_11264077 Ga0163163_112640772 190
2505 3300014326 Ga0157380_10513809 Ga0157380_105138091 190
2506 3300014326 Ga0157380_10794103 Ga0157380_107941032 190
2507 3300014497 Ga0182008_10023005 Ga0182008_100230052 190
2508 3300014968 Ga0157379_10094230 Ga0157379_100942303 190
2509 3300014968 Ga0157379_10149073 Ga0157379_101490732 190
2510 3300014968 Ga0157379_10485124 Ga0157379_104851242 190
2511 3300014969 Ga0157376_10410804 Ga0157376_104108042 190
2512 3300017792 Ga0163161_10349007 Ga0163161_103490072 190
2513 3300020069 Ga0197907_10151707 Ga0197907_101517072 190
2514 3300020069 Ga0197907_10814250 Ga0197907_108142502 190
2515 3300020069 Ga0197907_10959006 Ga0197907_109590062 190
2516 3300020070 Ga0206356_10809245 Ga0206356_108092453 190
2517 3300020075 Ga0206349_1385460 Ga0206349_13854602 190
2518 3300020077 Ga0206351_11001805 Ga0206351_110018052 190
2519 3300020078 Ga0206352_11127486 Ga0206352_111274862 190
2520 3300020080 Ga0206350_10667397 Ga0206350_106673973 190
2521 3300020082 Ga0206353_10107063 Ga0206353_101070633 190
2522 3300020082 Ga0206353_10269172 Ga0206353_102691722 190
2523 3300021377 Ga0213874_10036508 Ga0213874_100365082 190
2524 3300025321 Ga0207656_10111137 Ga0207656_101111372 190
2525 3300025885 Ga0207653_10013448 Ga0207653_100134483 190
2526 3300025893 Ga0207682_10015257 Ga0207682_100152573 190
2527 3300025898 Ga0207692_10000368 Ga0207692_1000036820 190
2528 3300025900 Ga0207710_10000017 Ga0207710_10000017105 190
2529 3300025904 Ga0207647_10018449 Ga0207647_100184498 190
2530 3300025905 Ga0207685_10063364 Ga0207685_100633642 190
2531 3300025906 Ga0207699_10001668 Ga0207699_1000166821 190
2532 3300025908 Ga0207643_10014701 Ga0207643_100147017 190
2533 3300025908 Ga0207643_10147289 Ga0207643_101472892 190
2534 3300025919 Ga0207657_10001387 Ga0207657_1000138741 190
2535 3300025924 Ga0207694_10038174 Ga0207694_100381742 190
2536 3300025927 Ga0207687_10020152 Ga0207687_100201527 190
2537 3300025927 Ga0207687_10127057 Ga0207687_101270572 190
2538 3300025927 Ga0207687_10247405 Ga0207687_102474052 190
2539 3300025928 Ga0207700_10007511 Ga0207700_100075117 190
2540 3300025929 Ga0207664_10003003 Ga0207664_100030033 190
2541 3300025934 Ga0207686_10196757 Ga0207686_101967572 190
2542 3300025935 Ga0207709_10027907 Ga0207709_100279073 190
2543 3300025935 Ga0207709_10285460 Ga0207709_102854602 190
2544 3300025938 Ga0207704_10407679 Ga0207704_104076792 190
2545 3300025938 Ga0207704_10450156 Ga0207704_104501562 190
2546 3300025940 Ga0207691_10097345 Ga0207691_100973452 190
2547 3300025941 Ga0207711_10027090 Ga0207711_100270904 190
2548 3300025941 Ga0207711_10032109 Ga0207711_100321097 190
2549 3300025941 Ga0207711_10335858 Ga0207711_103358582 190
2550 3300025941 Ga0207711_10397173 Ga0207711_103971732 190
2551 3300025942 Ga0207689_10002936 Ga0207689_1000293629 190
2552 3300025942 Ga0207689_10056722 Ga0207689_100567222 190
2553 3300025944 Ga0207661_10267184 Ga0207661_102671842 190
2554 3300025945 Ga0207679_10077561 Ga0207679_100775613 190
2555 3300025949 Ga0207667_10199494 Ga0207667_101994943 190
2556 3300025961 Ga0207712_10312308 Ga0207712_103123082 190
2557 3300025981 Ga0207640_10166529 Ga0207640_101665292 190
2558 3300025981 Ga0207640_11129403 Ga0207640_111294031 190
2559 3300026023 Ga0207677_10601057 Ga0207677_106010572 190
2560 3300026035 Ga0207703_10442752 Ga0207703_104427522 190
2561 3300026067 Ga0207678_10002587 Ga0207678_100025877 190
2562 3300026067 Ga0207678_10134885 Ga0207678_101348852 190
2563 3300026075 Ga0207708_10109965 Ga0207708_101099653 190
2564 3300026075 Ga0207708_10219371 Ga0207708_102193712 190
2565 3300026078 Ga0207702_10003344 Ga0207702_100033444 190
2566 3300026089 Ga0207648_10133353 Ga0207648_101333534 190
2567 3300026089 Ga0207648_10411029 Ga0207648_104110292 190
2568 3300026095 Ga0207676_10038313 Ga0207676_100383132 190
2569 3300026116 Ga0207674_10006508 Ga0207674_1000650818 190
2570 3300026121 Ga0207683_10002849 Ga0207683_1000284928 190
2571 3300026121 Ga0207683_10139388 Ga0207683_101393882 190
2572 3300026142 Ga0207698_10005035 Ga0207698_1000503511 190
2573 3300028379 Ga0268266_10027754 Ga0268266_100277543 190
2574 3300028381 Ga0268264_10521697 Ga0268264_105216971 190
2575 3300030731 Ga0316177_1148380 Ga0316177_11483804 190
2576 3300030732 Ga0316176_1004520 Ga0316176_10045206 190
2577 3300030733 Ga0314311_1026731 Ga0314311_10267317 190
2578 3300030733 Ga0314311_1131795 Ga0314311_11317951 190
2579 3300030734 Ga0316179_1000692 Ga0316179_10006922 190
2580 3300030736 Ga0316180_1037118 Ga0316180_10371182 190
2581 3300030744 Ga0316181_1291635 Ga0316181_12916351 190
2582 3300030745 Ga0316182_1069248 Ga0316182_10692484 190
2583 3300030745 Ga0316182_1133802 Ga0316182_11338022 190
2584 3300031507 Ga0307509_10157431 Ga0307509_101574311 190
2585 3300031824 Ga0307413_10002827 Ga0307413_100028273 190
2586 3300031838 Ga0307518_10002439 Ga0307518_1000243910 190
2587 3300031852 Ga0307410_10251803 Ga0307410_102518032 190
2588 3300031995 Ga0307409_100665939 Ga0307409_1006659391 190
2589 3300032005 Ga0307411_10001487 Ga0307411_100014872 190
2590 3300032126 Ga0307415_100105419 Ga0307415_1001054192 190
2591 3300032126 Ga0307415_100703403 Ga0307415_1007034031 190
2592 3300032168 Ga0316593_10131219 Ga0316593_101312192 190
2593 3300034817 Ga0373948_0007027 Ga0373948_0007027_110_775 190
2594 3300035121 Ga0373960_0086994 Ga0373960_0086994_187_849 190
2595 3300035207 Ga0373942_0032129 Ga0373942_0032129_26_691 190
2596 3300035691 Ga0373931_0109270 Ga0373931_0109270_875_1540 190
2597 3300039437 Ga0436365_1257400 Ga0436365_1257400_48315_48983 190
2598 3300039450 Ga0436363_0618637 Ga0436363_0618637_519_1184 190
2599 3300039453 Ga0436362_0281281 Ga0436362_0281281_502_1170 190
2600 3300041452 Ga0451793_0048964 Ga0451793_0048964_113_772 190
2601 3300041512 Ga0451853_1425213 Ga0451853_1425213_342_1001 190
2602 3300044658 Ga0466972_0006214 Ga0466972_0006214_3151_3801 190
2603 3300044683 Ga0466965_0065280 Ga0466965_0065280_1145_1795 190
2604 3300044684 Ga0466966_0038019 Ga0466966_0038019_1807_2460 190
2605 3300044694 Ga0466963_0125511 Ga0466963_0125511_248_901 190
2606 3300044694 Ga0466963_0232190 Ga0466963_0232190_570_1226 190
2607 3300044694 Ga0466963_0291090 Ga0466963_0291090_371_1024 190
2608 3300044694 Ga0466963_0426390 Ga0466963_0426390_76_744 190
2609 3300044735 Ga0466968_0004861 Ga0466968_0004861_926_1576 190
2610 3300044842 Ga0466957_0032742 Ga0466957_0032742_2321_2974 190
2611 3300044901 Ga0466960_0000533 Ga0466960_0000533_3151_3801 190
2612 3300044901 Ga0466960_0005846 Ga0466960_0005846_339_1046 190
2613 3300045049 Ga0466959_0162707 Ga0466959_0162707_578_1231 190
2614 3300045049 Ga0466959_0450549 Ga0466959_0450549_89_751 190
2615 3300045976 Ga0466967_0142020 Ga0466967_0142020_737_1465 190
2616 3300046453 Ga0495627_043061 Ga0495627_043061_199_852 190
2617 3300046455 Ga0495603_0154560 Ga0495603_0154560_92_751 190
2618 3300046459 Ga0495629_0400215 Ga0495629_0400215_172_831 190
2619 3300046499 Ga0495594_0190608 Ga0495594_0190608_272_934 190
2620 3300046500 Ga0495596_0067232 Ga0495596_0067232_455_1114 190
2621 3300046512 Ga0495610_0034413 Ga0495610_0034413_1045_1698 190
2622 3300046514 Ga0495618_0353657 Ga0495618_0353657_181_879 190
2623 3300046518 Ga0495631_0117831 Ga0495631_0117831_29_706 190
2624 3300046531 Ga0495665_0152647 Ga0495665_0152647_503_1180 190
2625 3300046531 Ga0495665_0271914 Ga0495665_0271914_150_812 190
2626 3300046533 Ga0495640_0153839 Ga0495640_0153839_522_1184 190
2627 3300046536 Ga0495587_0234759 Ga0495587_0234759_97_795 190
2628 3300046615 Ga0495656_0050822 Ga0495656_0050822_702_1370 190
2629 3300046663 Ga0495635_0362391 Ga0495635_0362391_26_688 190
2630 3300046678 Ga0495599_0218563 Ga0495599_0218563_450_1112 190
2631 3300046692 Ga0495671_0151444 Ga0495671_0151444_415_1074 190
2632 3300047315 Ga0495581_0271884 Ga0495581_0271884_40_702 190
2633 3300047322 Ga0495680_0143163 Ga0495680_0143163_318_980 190
2634 3300047322 Ga0495680_0656769 Ga0495680_0656769_26_685 190
2635 3300047444 Ga0495675_0183304 Ga0495675_0183304_411_1073 190
2636 3300047673 Ga0495593_0199485 Ga0495593_0199485_92_751 190
2637 3300048090 Ga0495615_0035278 Ga0495615_0035278_89_748 190
2638 3300048903 Ga0496100_0233846 Ga0496100_0233846_535_1197 190
2639 3300048903 Ga0496100_0319687 Ga0496100_0319687_364_1023 190
2640 3300048904 Ga0496101_0092145 Ga0496101_0092145_279_944 190
2641 3300048904 Ga0496101_0100238 Ga0496101_0100238_555_1220 190
2642 3300048905 Ga0496102_0018425 Ga0496102_0018425_4808_5464 190
2643 3300048905 Ga0496102_0067122 Ga0496102_0067122_1359_2024 190
2644 3300048906 Ga0496103_0060146 Ga0496103_0060146_1199_1861 190
2645 3300048906 Ga0496103_0193005 Ga0496103_0193005_411_1067 190
2646 3300048906 Ga0496103_0317661 Ga0496103_0317661_95_817 190
2647 3300048907 Ga0496104_0013671 Ga0496104_0013671_786_1451 190
2648 3300048907 Ga0496104_0014968 Ga0496104_0014968_2131_2793 190
2649 3300048907 Ga0496104_0132690 Ga0496104_0132690_122_787 190
2650 3300048907 Ga0496104_0819234 Ga0496104_0819234_157_822 190
2651 3300048908 Ga0496105_0104287 Ga0496105_0104287_1284_1946 190
2652 3300048908 Ga0496105_0358234 Ga0496105_0358234_310_975 190
2653 3300048909 Ga0496106_0128495 Ga0496106_0128495_1059_1724 190
2654 3300048909 Ga0496106_0229561 Ga0496106_0229561_38_700 190
2655 3300048909 Ga0496106_0332154 Ga0496106_0332154_232_897 190
2656 3300048909 Ga0496106_0442082 Ga0496106_0442082_24_674 190
2657 3300048910 Ga0496107_0010178 Ga0496107_0010178_5832_6497 190
2658 3300048910 Ga0496107_0130564 Ga0496107_0130564_404_1069 190
2659 3300048910 Ga0496107_0268374 Ga0496107_0268374_576_1241 190
2660 3300048911 Ga0496108_0001515 Ga0496108_0001515_14697_15359 190
2661 3300048911 Ga0496108_0085000 Ga0496108_0085000_896_1561 190
2662 3300048911 Ga0496108_0547567 Ga0496108_0547567_122_787 190
2663 3300048911 Ga0496108_0794929 Ga0496108_0794929_20_697 190
2664 3300048912 Ga0496109_0008622 Ga0496109_0008622_1385_2047 190
2665 3300048912 Ga0496109_0058771 Ga0496109_0058771_1214_1879 190
2666 3300048912 Ga0496109_0147821 Ga0496109_0147821_15_677 190
2667 3300048912 Ga0496109_0165475 Ga0496109_0165475_1251_1916 190
2668 3300048912 Ga0496109_0340827 Ga0496109_0340827_204_866 190
2669 3300048912 Ga0496109_0499666 Ga0496109_0499666_233_889 190
2670 3300048913 Ga0496110_0085776 Ga0496110_0085776_1210_1875 190
2671 3300048913 Ga0496110_0168731 Ga0496110_0168731_1225_1890 190
2672 3300048914 Ga0496111_0011991 Ga0496111_0011991_1437_2099 190
2673 3300048914 Ga0496111_0039375 Ga0496111_0039375_1532_2197 190
2674 3300048915 Ga0496112_0011626 Ga0496112_0011626_1665_2330 190
2675 3300048915 Ga0496112_0779364 Ga0496112_0779364_95_760 190
2676 3300048916 Ga0496113_0018053 Ga0496113_0018053_3615_4280 190
2677 3300048916 Ga0496113_0194067 Ga0496113_0194067_350_1015 190
2678 3300048917 Ga0496114_0009605 Ga0496114_0009605_1315_1980 190
2679 3300048917 Ga0496114_0037365 Ga0496114_0037365_2159_2824 190
2680 3300048917 Ga0496114_0082996 Ga0496114_0082996_917_1579 190
2681 3300048917 Ga0496114_0808277 Ga0496114_0808277_33_695 190
2682 3300048918 Ga0496115_0175675 Ga0496115_0175675_73_738 190
2683 3300048918 Ga0496115_0332369 Ga0496115_0332369_284_946 190
2684 3300048922 Ga0496119_0001645 Ga0496119_0001645_25421_26125 190
2685 3300048923 Ga0496120_0000372 Ga0496120_0000372_70653_71357 190
2686 3300048924 Ga0496121_0071494 Ga0496121_0071494_1215_1871 190
2687 3300048927 Ga0496124_0173749 Ga0496124_0173749_291_950 190
2688 3300048927 Ga0496124_0239128 Ga0496124_0239128_117_779 190
2689 3300048929 Ga0496126_0000246 Ga0496126_0000246_105334_106062 190
2690 3300048929 Ga0496126_0409080 Ga0496126_0409080_327_992 190
2691 3300049128 Ga0501308_003415 Ga0501308_003415_776_1426 190
2692 3300049530 Ga0501314_007740 Ga0501314_007740_121_771 190
2693 3300049531 Ga0501315_016432 Ga0501315_016432_216_866 190
2694 3300049534 Ga0501318_025319 Ga0501318_025319_79_729 190
2695 3300049536 Ga0501320_007299 Ga0501320_007299_295_957 190
2696 3300049568 Ga0501031_0125198 Ga0501031_0125198_333_992 190
2697 3300049569 Ga0501032_0001225 Ga0501032_0001225_10233_10892 190
2698 3300049571 Ga0501034_0018792 Ga0501034_0018792_4705_5364 190
2699 3300049573 Ga0501037_0023627 Ga0501037_0023627_1014_1673 190
2700 3300049574 Ga0501038_0000144 Ga0501038_0000144_35911_36570 190
2701 3300049579 Ga0501043_0036763 Ga0501043_0036763_1272_1931 190
2702 3300049580 Ga0501046_0007546 Ga0501046_0007546_682_1341 190
2703 3300049581 Ga0501047_0006173 Ga0501047_0006173_6024_6683 190
2704 3300049583 Ga0501067_0096115 Ga0501067_0096115_681_1340 190
2705 3300049586 Ga0501070_0048632 Ga0501070_0048632_2174_2833 190
2706 3300049586 Ga0501070_0178065 Ga0501070_0178065_714_1439 190
2707 3300049587 Ga0501071_0266736 Ga0501071_0266736_452_1102 190
2708 3300049588 Ga0501072_0153562 Ga0501072_0153562_1067_1717 190
2709 3300049744 Ga0501083_0000921 Ga0501083_0000921_12656_13315 190
2710 3300049822 Ga0501035_0004487 Ga0501035_0004487_8864_9523 190
2711 3300050511 nmdc:mga08y16_716277_c1 nmdc:mga08y16_716277_c1_245_895 190
2712 3300050512 nmdc:mga0n895_1323933_c1 nmdc:mga0n895_1323933_c1_10_675 190
2713 3300050513 nmdc:mga0rr50_92766_c1 nmdc:mga0rr50_92766_c1_1104_1769 190
2714 3300050514 nmdc:mga08x19_73253_c1 nmdc:mga08x19_73253_c1_350_1015 190
2715 3300053083 Ga0495655_0086354 Ga0495655_0086354_228_893 190
2716 3300053105 Ga0500557_092210 Ga0500557_092210_201_851 190
2717 3300053139 Ga0500568_0032736 Ga0500568_0032736_1044_1697 190
2718 3300054114 Ga0501084_0437267 Ga0501084_0437267_210_869 190
2719 3300059424 Ga0590075_035241 Ga0590075_035241_403_1059 190
2720 3300059510 Ga0587090_007983 Ga0587090_007983_134_784 190
2721 3300059603 Ga0587097_00452 Ga0587097_00452_364_1026 190
2722 3300060344 Ga0587071_042019 Ga0587071_042019_250_900 190
2723 3300060346 Ga0587111_0010549 Ga0587111_0010549_636_1286 190
2724 3300060346 Ga0587111_0016345 Ga0587111_0016345_538_1197 190
2725 3300061719 Ga0466962_0004292 Ga0466962_0004292_351_1019 190
2726 iso_pu_bacteria 2870782633 2870783346 190
2727 3300003285 Ga0007423J48922_100012 Ga0007423J48922_1000123 191
2728 3300003911 JGI25405J52794_10014488 JGI25405J52794_100144882 191
2729 3300005327 Ga0070658_10174822 Ga0070658_101748221 191
2730 3300005327 Ga0070658_10636092 Ga0070658_106360922 191
2731 3300005329 Ga0070683_100467086 Ga0070683_1004670862 191
2732 3300005329 Ga0070683_100650003 Ga0070683_1006500032 191
2733 3300005334 Ga0068869_100226862 Ga0068869_1002268622 191
2734 3300005355 Ga0070671_100023520 Ga0070671_1000235209 191
2735 3300005367 Ga0070667_100220900 Ga0070667_1002209002 191
2736 3300005455 Ga0070663_100189116 Ga0070663_1001891162 191
2737 3300005456 Ga0070678_100514553 Ga0070678_1005145531 191
2738 3300005466 Ga0070685_10139310 Ga0070685_101393102 191
2739 3300005468 Ga0070707_100329126 Ga0070707_1003291261 191
2740 3300005471 Ga0070698_100090705 Ga0070698_1000907051 191
2741 3300005535 Ga0070684_100571952 Ga0070684_1005719522 191
2742 3300005547 Ga0070693_100102732 Ga0070693_1001027321 191
2743 3300005548 Ga0070665_100001905 Ga0070665_10000190536 191
2744 3300005548 Ga0070665_100816215 Ga0070665_1008162152 191
2745 3300005578 Ga0068854_100507471 Ga0068854_1005074712 191
2746 3300005616 Ga0068852_100201114 Ga0068852_1002011142 191
2747 3300005841 Ga0068863_100254325 Ga0068863_1002543252 191
2748 3300005843 Ga0068860_100193897 Ga0068860_1001938972 191
2749 3300005844 Ga0068862_100283191 Ga0068862_1002831912 191
2750 3300005937 Ga0081455_10000532 Ga0081455_1000053261 191
2751 3300005985 Ga0081539_10000132 Ga0081539_10000132131 191
2752 3300007076 Ga0075435_100651950 Ga0075435_1006519502 191
2753 3300009094 Ga0111539_10901749 Ga0111539_109017492 191
2754 3300009098 Ga0105245_10427509 Ga0105245_104275092 191
2755 3300009551 Ga0105238_11037819 Ga0105238_110378192 191
2756 3300013105 Ga0157369_11166739 Ga0157369_111667391 191
2757 3300013307 Ga0157372_10790523 Ga0157372_107905232 191
2758 3300020069 Ga0197907_10051383 Ga0197907_100513833 191
2759 3300020069 Ga0197907_11258934 Ga0197907_112589342 191
2760 3300020075 Ga0206349_1007362 Ga0206349_10073622 191
2761 3300020075 Ga0206349_1010636 Ga0206349_10106362 191
2762 3300020075 Ga0206349_1318543 Ga0206349_13185432 191
2763 3300020076 Ga0206355_1166077 Ga0206355_11660772 191
2764 3300020077 Ga0206351_10722354 Ga0206351_107223544 191
2765 3300020078 Ga0206352_10334314 Ga0206352_103343142 191
2766 3300020078 Ga0206352_10680298 Ga0206352_106802982 191
2767 3300020080 Ga0206350_10406489 Ga0206350_104064894 191
2768 3300020080 Ga0206350_11432577 Ga0206350_114325772 191
2769 3300020081 Ga0206354_11202439 Ga0206354_112024393 191
2770 3300022467 Ga0224712_10003451 Ga0224712_100034517 191
2771 3300025901 Ga0207688_10001159 Ga0207688_100011592 191
2772 3300025901 Ga0207688_10074071 Ga0207688_100740712 191
2773 3300025904 Ga0207647_10244095 Ga0207647_102440952 191
2774 3300025909 Ga0207705_10082748 Ga0207705_100827483 191
2775 3300025910 Ga0207684_10177547 Ga0207684_101775474 191
2776 3300025919 Ga0207657_10176081 Ga0207657_101760812 191
2777 3300025922 Ga0207646_10282633 Ga0207646_102826333 191
2778 3300025927 Ga0207687_10206501 Ga0207687_102065013 191
2779 3300025931 Ga0207644_10022904 Ga0207644_100229043 191
2780 3300025933 Ga0207706_10512805 Ga0207706_105128052 191
2781 3300025942 Ga0207689_10062110 Ga0207689_100621102 191
2782 3300025949 Ga0207667_10156170 Ga0207667_101561701 191
2783 3300025972 Ga0207668_10175228 Ga0207668_101752282 191
2784 3300025981 Ga0207640_10583017 Ga0207640_105830172 191
2785 3300025986 Ga0207658_10147248 Ga0207658_101472483 191
2786 3300026088 Ga0207641_10100925 Ga0207641_101009252 191
2787 3300026118 Ga0207675_100102158 Ga0207675_1001021584 191
2788 3300026118 Ga0207675_100857371 Ga0207675_1008573711 191
2789 3300026121 Ga0207683_10669416 Ga0207683_106694162 191
2790 3300028379 Ga0268266_10021808 Ga0268266_100218083 191
2791 3300028380 Ga0268265_10162933 Ga0268265_101629332 191
2792 3300028381 Ga0268264_10013159 Ga0268264_100131594 191
2793 3300030521 Ga0307511_10118899 Ga0307511_101188991 191
2794 3300030522 Ga0307512_10164278 Ga0307512_101642782 191
2795 3300031456 Ga0307513_10011746 Ga0307513_1001174614 191
2796 3300031548 Ga0307408_100819241 Ga0307408_1008192412 191
2797 3300031852 Ga0307410_10639378 Ga0307410_106393782 191
2798 3300031995 Ga0307409_100264215 Ga0307409_1002642152 191
2799 3300032002 Ga0307416_100276779 Ga0307416_1002767792 191
2800 3300032005 Ga0307411_10199858 Ga0307411_101998582 191
2801 3300032126 Ga0307415_100538245 Ga0307415_1005382452 191
2802 3300035086 Ga0373934_0110112 Ga0373934_0110112_111_779 191
2803 3300037418 Ga0395900_0336318 Ga0395900_0336318_383_1036 191
2804 3300041458 Ga0451798_0003194 Ga0451798_0003194_158_829 191
2805 3300041460 Ga0451802_0247022 Ga0451802_0247022_127_798 191
2806 3300041494 Ga0451837_0699446 Ga0451837_0699446_104_775 191
2807 3300041498 Ga0451841_1059095 Ga0451841_1059095_549_1220 191
2808 3300041512 Ga0451853_2864266 Ga0451853_2864266_167_835 191
2809 3300044683 Ga0466965_0112195 Ga0466965_0112195_87_779 191
2810 3300044694 Ga0466963_0114788 Ga0466963_0114788_399_1082 191
2811 3300044735 Ga0466968_0051338 Ga0466968_0051338_718_1386 191
2812 3300044842 Ga0466957_0717613 Ga0466957_0717613_27_686 191
2813 3300045976 Ga0466967_0044923 Ga0466967_0044923_1162_1845 191
2814 3300046473 Ga0495582_0469496 Ga0495582_0469496_13_690 191
2815 3300046523 Ga0495644_0153193 Ga0495644_0153193_192_854 191
2816 3300046529 Ga0495652_0222822 Ga0495652_0222822_609_1277 191
2817 3300046690 Ga0495624_0021711 Ga0495624_0021711_216_893 191
2818 3300046690 Ga0495624_0322564 Ga0495624_0322564_106_774 191
2819 3300046809 Ga0495600_0069095 Ga0495600_0069095_1275_1943 191
2820 3300046809 Ga0495600_0319663 Ga0495600_0319663_136_828 191
2821 3300047322 Ga0495680_0302092 Ga0495680_0302092_414_1082 191
2822 3300047322 Ga0495680_0460520 Ga0495680_0460520_158_832 191
2823 3300048088 Ga0495602_0139004 Ga0495602_0139004_274_942 191
2824 3300048906 Ga0496103_0372926 Ga0496103_0372926_234_896 191
2825 3300048917 Ga0496114_0033898 Ga0496114_0033898_2098_2787 191
2826 3300048917 Ga0496114_0037300 Ga0496114_0037300_450_1127 191
2827 3300048917 Ga0496114_0108333 Ga0496114_0108333_822_1496 191
2828 3300048917 Ga0496114_0467647 Ga0496114_0467647_320_976 191
2829 3300048927 Ga0496124_0258294 Ga0496124_0258294_306_968 191
2830 3300048927 Ga0496124_0500902 Ga0496124_0500902_52_711 191
2831 3300048928 Ga0496125_0019644 Ga0496125_0019644_2291_2950 191
2832 3300048929 Ga0496126_0522907 Ga0496126_0522907_106_765 191
2833 3300049533 Ga0501317_001609 Ga0501317_001609_604_1272 191
2834 3300049535 Ga0501319_001021 Ga0501319_001021_37_750 191
2835 3300049537 Ga0501321_001097 Ga0501321_001097_18_698 191
2836 3300049537 Ga0501321_007751 Ga0501321_007751_309_968 191
2837 3300049537 Ga0501321_028650 Ga0501321_028650_18_686 191
2838 3300049573 Ga0501037_0397239 Ga0501037_0397239_234_902 191
2839 3300049575 Ga0501039_0086786 Ga0501039_0086786_730_1398 191
2840 3300049576 Ga0501040_0159253 Ga0501040_0159253_42_710 191
2841 3300049576 Ga0501040_0254396 Ga0501040_0254396_406_1074 191
2842 3300049577 Ga0501041_0022527 Ga0501041_0022527_2439_3107 191
2843 3300049578 Ga0501042_0240756 Ga0501042_0240756_393_1061 191
2844 3300049580 Ga0501046_0148795 Ga0501046_0148795_295_963 191
2845 3300049581 Ga0501047_0438894 Ga0501047_0438894_426_1079 191
2846 3300049582 Ga0501048_0200523 Ga0501048_0200523_531_1199 191
2847 3300049587 Ga0501071_0075875 Ga0501071_0075875_1514_2182 191
2848 3300049588 Ga0501072_0105438 Ga0501072_0105438_1407_2075 191
2849 3300049590 Ga0501074_0261140 Ga0501074_0261140_67_735 191
2850 3300049592 Ga0501076_0117097 Ga0501076_0117097_205_873 191
2851 3300049741 Ga0501079_0099906 Ga0501079_0099906_44_712 191
2852 3300049742 Ga0501080_0389205 Ga0501080_0389205_16_684 191
2853 3300049743 Ga0501081_0556156 Ga0501081_0556156_41_709 191
2854 3300049822 Ga0501035_0371666 Ga0501035_0371666_264_932 191
2855 3300049823 Ga0501044_0081453 Ga0501044_0081453_1651_2307 191
2856 3300049824 Ga0501045_0123884 Ga0501045_0123884_399_1067 191
2857 3300050508 nmdc:mga09592_84854_c1 nmdc:mga09592_84854_c1_1290_1970 191
2858 3300050511 nmdc:mga08y16_375039_c1 nmdc:mga08y16_375039_c1_605_1276 191
2859 3300053085 Ga0495619_0105078 Ga0495619_0105078_886_1539 191
2860 3300053142 Ga0500577_0020547 Ga0500577_0020547_183_836 191
2861 3300053153 Ga0500616_0000947 Ga0500616_0000947_1778_2449 191
2862 3300054114 Ga0501084_0042157 Ga0501084_0042157_2415_3083 191
2863 3300060353 Ga0501082_0086191 Ga0501082_0086191_1070_1738 191
2864 3300061734 Ga0530510_0289927 Ga0530510_0289927_43_711 191
2865 3300061734 Ga0530510_0566482 Ga0530510_0566482_170_838 191
2866 iso_pu_bacteria 2515154155 2515851613 191
2867 3300005334 Ga0068869_100170379 Ga0068869_1001703791 192
2868 3300005338 Ga0068868_100532979 Ga0068868_1005329792 192
2869 3300005356 Ga0070674_100041274 Ga0070674_1000412744 192
2870 3300005356 Ga0070674_100135002 Ga0070674_1001350023 192
2871 3300005367 Ga0070667_100885275 Ga0070667_1008852751 192
2872 3300005985 Ga0081539_10186000 Ga0081539_101860001 192
2873 3300006844 Ga0075428_100002175 Ga0075428_1000021753 192
2874 3300006846 Ga0075430_100005226 Ga0075430_1000052267 192
2875 3300006847 Ga0075431_100001734 Ga0075431_1000017348 192
2876 3300006847 Ga0075431_100903503 Ga0075431_1009035031 192
2877 3300006880 Ga0075429_100001160 Ga0075429_10000116015 192
2878 3300009036 Ga0105244_10093723 Ga0105244_100937232 192
2879 3300009147 Ga0114129_10000234 Ga0114129_100002344 192
2880 3300012515 Ga0157338_1009352 Ga0157338_10093522 192
2881 3300013307 Ga0157372_10697135 Ga0157372_106971352 192
2882 3300013308 Ga0157375_11351618 Ga0157375_113516182 192
2883 3300021384 Ga0213876_10190129 Ga0213876_101901291 192
2884 3300025927 Ga0207687_10482845 Ga0207687_104828452 192
2885 3300025927 Ga0207687_10617099 Ga0207687_106170991 192
2886 3300025937 Ga0207669_10033811 Ga0207669_100338112 192
2887 3300025986 Ga0207658_10738579 Ga0207658_107385792 192
2888 3300026023 Ga0207677_10178204 Ga0207677_101782042 192
2889 3300031731 Ga0307405_10309269 Ga0307405_103092692 192
2890 3300035691 Ga0373931_0151151 Ga0373931_0151151_513_1190 192
2891 3300039437 Ga0436365_0224613 Ga0436365_0224613_491_1168 192
2892 3300042142 Ga0450905_010613 Ga0450905_010613_261_917 192
2893 3300048914 Ga0496111_0362048 Ga0496111_0362048_366_1043 192
2894 3300049161 Ga0501305_013601 Ga0501305_013601_108_764 192
2895 3300049532 Ga0501316_006918 Ga0501316_006918_216_887 192
2896 3300049533 Ga0501317_026053 Ga0501317_026053_34_711 192
2897 3300049571 Ga0501034_0867811 Ga0501034_0867811_27_686 192
2898 3300049592 Ga0501076_0762052 Ga0501076_0762052_81_740 192
2899 3300050507 nmdc:mga05p37_2785_c1 nmdc:mga05p37_2785_c1_11223_11894 192
2900 3300050508 nmdc:mga09592_1799_c1 nmdc:mga09592_1799_c1_8070_8741 192
2901 3300050509 nmdc:mga0qj67_591_c1 nmdc:mga0qj67_591_c1_2718_3389 192
2902 3300050510 nmdc:mga06r32_4895_c1 nmdc:mga06r32_4895_c1_8198_8869 192
2903 iso_pu_bacteria 2837268691 2837269013 192
2904 iso_pu_bacteria 2868088558 2868090563 192
2905 3300001979 JGI24740J21852_10008288 JGI24740J21852_100082885 193
2906 3300001990 JGI24737J22298_10014722 JGI24737J22298_100147222 193
2907 3300002073 JGI24745J21846_1002158 JGI24745J21846_10021583 193
2908 3300003162 Ga0006778J45830_1055943 Ga0006778J45830_10559432 193
2909 3300003574 Ga0007410J51695_1018802 Ga0007410J51695_10188022 193
2910 3300005327 Ga0070658_10042114 Ga0070658_100421143 193
2911 3300005331 Ga0070670_100037598 Ga0070670_1000375984 193
2912 3300005334 Ga0068869_100170391 Ga0068869_1001703912 193
2913 3300005337 Ga0070682_100421510 Ga0070682_1004215101 193
2914 3300005338 Ga0068868_100220544 Ga0068868_1002205442 193
2915 3300005338 Ga0068868_100880714 Ga0068868_1008807141 193
2916 3300005340 Ga0070689_100269402 Ga0070689_1002694022 193
2917 3300005343 Ga0070687_100042062 Ga0070687_1000420621 193
2918 3300005345 Ga0070692_10149875 Ga0070692_101498752 193
2919 3300005353 Ga0070669_100680056 Ga0070669_1006800561 193
2920 3300005354 Ga0070675_100084224 Ga0070675_1000842243 193
2921 3300005354 Ga0070675_100831947 Ga0070675_1008319471 193
2922 3300005366 Ga0070659_100719183 Ga0070659_1007191831 193
2923 3300005456 Ga0070678_100189376 Ga0070678_1001893762 193
2924 3300005466 Ga0070685_10144471 Ga0070685_101444711 193
2925 3300005545 Ga0070695_100489981 Ga0070695_1004899812 193
2926 3300005548 Ga0070665_100282026 Ga0070665_1002820262 193
2927 3300005614 Ga0068856_100363591 Ga0068856_1003635912 193
2928 3300005616 Ga0068852_100352992 Ga0068852_1003529921 193
2929 3300005618 Ga0068864_100167660 Ga0068864_1001676602 193
2930 3300005834 Ga0068851_10021454 Ga0068851_100214544 193
2931 3300005841 Ga0068863_100310967 Ga0068863_1003109672 193
2932 3300005844 Ga0068862_100136123 Ga0068862_1001361233 193
2933 3300005844 Ga0068862_100485041 Ga0068862_1004850412 193
2934 3300005937 Ga0081455_10033409 Ga0081455_100334097 193
2935 3300005981 Ga0081538_10096062 Ga0081538_100960621 193
2936 3300005983 Ga0081540_1019731 Ga0081540_10197315 193
2937 3300005983 Ga0081540_1065468 Ga0081540_10654683 193
2938 3300005985 Ga0081539_10023237 Ga0081539_100232374 193
2939 3300006058 Ga0075432_10172945 Ga0075432_101729451 193
2940 3300006880 Ga0075429_100636218 Ga0075429_1006362182 193
2941 3300009094 Ga0111539_10410442 Ga0111539_104104422 193
2942 3300009098 Ga0105245_10138060 Ga0105245_101380601 193
2943 3300009098 Ga0105245_10631373 Ga0105245_106313732 193
2944 3300009098 Ga0105245_10890212 Ga0105245_108902122 193
2945 3300009545 Ga0105237_10569523 Ga0105237_105695232 193
2946 3300009551 Ga0105238_10964209 Ga0105238_109642092 193
2947 3300009553 Ga0105249_10402819 Ga0105249_104028192 193
2948 3300013104 Ga0157370_10255139 Ga0157370_102551393 193
2949 3300013306 Ga0163162_10346217 Ga0163162_103462172 193
2950 3300014745 Ga0157377_10249092 Ga0157377_102490922 193
2951 3300014968 Ga0157379_10301850 Ga0157379_103018502 193
2952 3300017792 Ga0163161_10345891 Ga0163161_103458912 193
2953 3300020070 Ga0206356_10507565 Ga0206356_105075652 193
2954 3300025321 Ga0207656_10067571 Ga0207656_100675712 193
2955 3300025899 Ga0207642_10035893 Ga0207642_100358932 193
2956 3300025900 Ga0207710_10150970 Ga0207710_101509702 193
2957 3300025901 Ga0207688_10077764 Ga0207688_100777643 193
2958 3300025901 Ga0207688_10106007 Ga0207688_101060072 193
2959 3300025904 Ga0207647_10005792 Ga0207647_1000579217 193
2960 3300025908 Ga0207643_10233032 Ga0207643_102330322 193
2961 3300025911 Ga0207654_10246389 Ga0207654_102463892 193
2962 3300025913 Ga0207695_10195486 Ga0207695_101954863 193
2963 3300025914 Ga0207671_10176546 Ga0207671_101765462 193
2964 3300025918 Ga0207662_10058100 Ga0207662_100581002 193
2965 3300025919 Ga0207657_10128614 Ga0207657_101286143 193
2966 3300025920 Ga0207649_10083862 Ga0207649_100838622 193
2967 3300025923 Ga0207681_10243631 Ga0207681_102436313 193
2968 3300025924 Ga0207694_10826984 Ga0207694_108269841 193
2969 3300025926 Ga0207659_10341559 Ga0207659_103415591 193
2970 3300025934 Ga0207686_10593967 Ga0207686_105939672 193
2971 3300025937 Ga0207669_10017561 Ga0207669_100175616 193
2972 3300025942 Ga0207689_10218131 Ga0207689_102181312 193
2973 3300025944 Ga0207661_10336965 Ga0207661_103369652 193
2974 3300025949 Ga0207667_10859391 Ga0207667_108593912 193
2975 3300025972 Ga0207668_10290029 Ga0207668_102900293 193
2976 3300025981 Ga0207640_10160075 Ga0207640_101600752 193
2977 3300025986 Ga0207658_10090832 Ga0207658_100908321 193
2978 3300026041 Ga0207639_10150732 Ga0207639_101507323 193
2979 3300026067 Ga0207678_10216926 Ga0207678_102169262 193
2980 3300026075 Ga0207708_10057403 Ga0207708_100574032 193
2981 3300026088 Ga0207641_10209662 Ga0207641_102096622 193
2982 3300026089 Ga0207648_10142931 Ga0207648_101429312 193
2983 3300026095 Ga0207676_10191106 Ga0207676_101911062 193
2984 3300026116 Ga0207674_10013764 Ga0207674_1001376411 193
2985 3300026118 Ga0207675_100023786 Ga0207675_1000237863 193
2986 3300028379 Ga0268266_10280327 Ga0268266_102803272 193
2987 3300028380 Ga0268265_10412326 Ga0268265_104123262 193
2988 3300028381 Ga0268264_10306718 Ga0268264_103067182 193
2989 3300028786 Ga0307517_10192888 Ga0307517_101928882 193
2990 3300030744 Ga0316181_1205657 Ga0316181_12056574 193
2991 3300035242 Ga0373962_0112036 Ga0373962_0112036_42_716 193
2992 3300037418 Ga0395900_0229441 Ga0395900_0229441_770_1426 193
2993 3300037471 Ga0395905_0449947 Ga0395905_0449947_156_812 193
2994 3300042005 Ga0439448_0003887 Ga0439448_0003887_2546_3232 193
2995 3300042007 Ga0439449_0048241 Ga0439449_0048241_143_799 193
2996 3300042008 Ga0439450_096246 Ga0439450_096246_47_724 193
2997 3300042012 Ga0439455_0006660 Ga0439455_0006660_484_1170 193
2998 3300042016 Ga0439463_013023 Ga0439463_013023_605_1291 193
2999 3300042438 Ga0439459_0011964 Ga0439459_0011964_723_1400 193
3000 3300042439 Ga0439464_0017007 Ga0439464_0017007_823_1509 193
3001 3300044693 Ga0466961_0268434 Ga0466961_0268434_216_911 193
3002 3300045976 Ga0466967_0250085 Ga0466967_0250085_267_926 193
3003 3300046473 Ga0495582_0163862 Ga0495582_0163862_517_1173 193
3004 3300046689 Ga0495613_0391790 Ga0495613_0391790_235_891 193
3005 3300046692 Ga0495671_0187744 Ga0495671_0187744_84_740 193
3006 3300047320 Ga0495672_0113544 Ga0495672_0113544_651_1307 193
3007 3300048903 Ga0496100_0161198 Ga0496100_0161198_67_726 193
3008 3300048906 Ga0496103_0113542 Ga0496103_0113542_864_1523 193
3009 3300048911 Ga0496108_0439987 Ga0496108_0439987_444_1100 193
3010 3300048912 Ga0496109_0110433 Ga0496109_0110433_88_747 193
3011 3300049130 Ga0501310_000463 Ga0501310_000463_737_1393 193
3012 3300050508 nmdc:mga09592_342847_c1 nmdc:mga09592_342847_c1_345_1022 193
3013 3300000041 ARcpr5oldR_c001648 ARcpr5oldR_0016483 194
3014 3300001989 JGI24739J22299_10029107 JGI24739J22299_100291072 194
3015 3300002067 JGI24735J21928_10068389 JGI24735J21928_100683892 194
3016 3300002075 JGI24738J21930_10013650 JGI24738J21930_100136502 194
3017 3300005331 Ga0070670_100307323 Ga0070670_1003073232 194
3018 3300005548 Ga0070665_100282934 Ga0070665_1002829342 194
3019 3300009551 Ga0105238_10823117 Ga0105238_108231172 194
3020 3300012476 Ga0157344_1002022 Ga0157344_10020221 194
3021 3300020069 Ga0197907_10377945 Ga0197907_103779453 194
3022 3300020070 Ga0206356_10734286 Ga0206356_107342862 194
3023 3300020078 Ga0206352_10955583 Ga0206352_109555832 194
3024 3300021384 Ga0213876_10022127 Ga0213876_100221272 194
3025 3300021388 Ga0213875_10000107 Ga0213875_1000010759 194
3026 3300022467 Ga0224712_10000575 Ga0224712_1000057513 194
3027 3300025972 Ga0207668_10050587 Ga0207668_100505874 194
3028 3300025981 Ga0207640_10321882 Ga0207640_103218822 194
3029 3300026067 Ga0207678_10072330 Ga0207678_100723302 194
3030 3300026121 Ga0207683_10936883 Ga0207683_109368832 194
3031 3300028794 Ga0307515_10297695 Ga0307515_102976952 194
3032 3300031616 Ga0307508_10280681 Ga0307508_102806812 194
3033 3300038443 Ga0395901_0738808 Ga0395901_0738808_210_869 194
3034 3300044684 Ga0466966_0194559 Ga0466966_0194559_306_1007 194
3035 3300044693 Ga0466961_0138192 Ga0466961_0138192_571_1272 194
3036 3300045976 Ga0466967_0363107 Ga0466967_0363107_553_1233 194
3037 3300045976 Ga0466967_0780457 Ga0466967_0780457_189_869 194
3038 3300046475 Ga0495639_0325291 Ga0495639_0325291_10_669 194
3039 3300046492 Ga0495585_0025882 Ga0495585_0025882_764_1423 194
3040 3300046648 Ga0495611_0083075 Ga0495611_0083075_298_957 194
3041 3300046660 Ga0495625_0264755 Ga0495625_0264755_288_947 194
3042 3300046683 Ga0495658_0391830 Ga0495658_0391830_28_687 194
3043 3300046694 Ga0495649_0210333 Ga0495649_0210333_160_822 194
3044 3300048916 Ga0496113_0181865 Ga0496113_0181865_731_1390 194
3045 3300059628 Ga0587122_021160 Ga0587122_021160_10_669 194
3046 iso_pu_bacteria 2827628540 2827632200 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

90

191

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.944 10 191
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9434 9 190
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9323 9 190
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9271 10 191
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9192 9 190
ID Description Score Start End Superfamily
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9768 40 103 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9625 40 100 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9475 40 100 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9328 40 103 3.30.160.810
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9318 10 188 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A087B7P6-F1-model_v4 deleted 0.9749 6 108
AF-A0A564VPD5-F1-model_v4 deleted 0.9745 6 122
AF-A0A564VPD5-F1-model_v4 deleted 0.9585 6 122
AF-A0A7V2AVU2-F1-model_v4 50S ribosomal protein L3 0.9576 11 108 GO:0003735
GO:0006412
GO:0022625
AF-A0A074TMK2-F1-model_v4 deleted 0.9546 19 103

Feature Viewer

pLDDT pTM Quality
85.42 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map