F497093

General Info

Members Datasets Scaffolds Average Seq Length
2841 1380 2062 468

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054563764|8054568615
Length 464
Sequence LKMTTAIGPVHFVGIGGIGMSGIAEVLHNLGYTVQGSDIAENANVQRLREKGIKVLIGHKAENIAGATVLVVSSAVKRDNPELMAARARLLPVVRRAEMLAELMRLKQAIAVGGTHGKTTTTSLVATLLEAGGLDPTVINGGIINAYGTNARLGEGDWLVAEADESDGTFVKLPADIAIVTNIDPEHLDHYGTFDGVRAAFRQFVENIPFYGFAVMCLDHPEVQAMVGRIEDRRIITYGANPQADVRFIDVDYGPRTTFAVDITDRVTGEHRTIRNLSLPMPGVHNVSNATAAVAVADRLGIDGDAIRRGFEAFRGVKRRFTHVGDWNGVAIFDDYGHHPVEIRAVLAAARQATKGKVIAVVQPHRYSRLQSLFDDFCLCFNDADLVIVTDVYAAGESPIPGADRDALVAGLSVRGHRDSIALENREALAPLIKARAAPGDIVVCLGAGSITQWAATLPDELAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
7 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
8 2509276019 Ensifer aridi TW10 Isolate Nodule
9 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
17 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
18 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
21 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
22 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
23 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
24 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
25 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
26 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
27 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
28 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
29 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
30 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
31 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
32 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
33 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
34 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
35 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
36 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
37 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
38 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
39 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
40 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
41 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
42 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
43 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
44 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
45 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
46 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
47 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
48 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
49 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
50 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
51 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
52 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
53 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
54 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
55 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
56 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
57 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
58 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
59 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
60 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
61 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
62 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
63 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
64 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
65 2519899620 Rhizobium sp. Pop5 Isolate Nodule
66 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
67 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
68 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
69 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
70 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
71 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
72 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
73 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
74 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
75 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
76 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
77 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
78 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
79 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
80 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
81 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
82 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
83 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
84 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
85 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
86 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
87 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
88 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
89 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
90 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
91 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
92 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
93 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
94 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
95 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
96 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
97 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
98 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
99 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
100 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
101 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
102 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
103 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
104 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
105 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
106 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
107 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
108 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
109 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
110 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
111 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
112 2643221568 Rhizobium sp. Root564 Isolate Unclassified
113 2643221582 Rhizobium sp. Root651 Isolate Unclassified
114 2643221599 Rhizobium sp. Root708 Isolate Unclassified
115 2643221607 Rhizobium sp. Root73 Isolate Unclassified
116 2643221618 Ensifer sp. Root231 Isolate Unclassified
117 2643221626 Ensifer sp. Root31 Isolate Unclassified
118 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
119 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
120 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
121 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
122 2643221651 Afipia sp. Root123D2 Isolate Unclassified
123 2643221655 Ensifer sp. Root1252 Isolate Unclassified
124 2643221659 Ensifer sp. Root127 Isolate Unclassified
125 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
126 2643221688 Rhizobium sp. Root482 Isolate Unclassified
127 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
128 2643221693 Rhizobium sp. Root491 Isolate Unclassified
129 2643221698 Ensifer sp. Root142 Isolate Unclassified
130 2643221712 Ensifer sp. Root258 Isolate Unclassified
131 2643221718 Rhizobium sp. Root268 Isolate Unclassified
132 2643221733 Bosea sp. Root381 Isolate Unclassified
133 2643221734 Bosea sp. Root670 Isolate Unclassified
134 2643221736 Bosea sp. Root483D1 Isolate Unclassified
135 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
136 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
137 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
138 2718217927 Rhizobium sp. N324 Isolate Nodule
139 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
140 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
141 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
142 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
143 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
144 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
145 2718218423 Rhizobium sp. N941 Isolate Nodule
146 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
147 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
148 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
149 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
150 2721755809 Rhizobium sp. N541 Isolate Nodule
151 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
152 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
153 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
154 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
155 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
156 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
157 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
158 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
159 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
160 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
161 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
162 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
163 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
164 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
165 2773857925 Microvirga vignae BR3299 Isolate Unclassified
166 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
167 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
168 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
169 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
170 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
171 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
172 2791355199
173 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
174 2791355256 Rhizobium sp. M10 Isolate Nodule
175 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
176 2791355260 Rhizobium sp. L9 Isolate Nodule
177 2791355261 Rhizobium sp. J15 Isolate Nodule
178 2791355262 Rhizobium sp. M1 Isolate Nodule
179 2791355263 Rhizobium chutanense C5 Isolate Nodule
180 2791355265 Rhizobium sp. H4 Isolate Nodule
181 2791355266 Rhizobium sp. L43 Isolate Nodule
182 2791355267 Rhizobium sp. L18 Isolate Nodule
183 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
184 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
185 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
186 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
187 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
188 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
189 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
190 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
191 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
192 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
193 2802429633 Rhizobium anhuiense J3 Isolate Nodule
194 2802429634 Rhizobium anhuiense S10 Isolate Nodule
195 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
196 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
197 2802429637 Rhizobium anhuiense C15 Isolate Nodule
198 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
199 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
200 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
201 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
202 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
203 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
204 2818991467 Bosea vestrisii 3192 Isolate Unclassified
205 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
206 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
207 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
208 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
209 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
210 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
211 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
212 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
213 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
214 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
215 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
216 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
217 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
218 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
219 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
220 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
221 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
222 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
223 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
224 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
225 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
226 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
227 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
228 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
229 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
230 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
231 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
232 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
233 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
234 2838048938 Rhizobium pisi 27/80 Isolate Nodule
235 2838061910 Rhizobium phaseoli L15 Isolate Nodule
236 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
237 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
238 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
239 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
240 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
241 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
242 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
243 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
244 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
245 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
246 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
247 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
248 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
249 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
250 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
251 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
252 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
253 2841760612 Bosea sp. Tri-49 Isolate Nodule
254 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
255 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
256 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
257 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
258 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
259 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
260 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
261 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
262 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
263 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
264 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
265 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
266 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
267 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
268 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
269 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
270 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
271 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
272 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
273 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
274 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
275 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
276 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
277 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
278 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
279 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
280 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
281 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
282 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
283 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
284 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
285 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
286 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
287 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
288 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
289 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
290 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
291 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
292 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
293 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
294 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
295 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
296 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
297 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
298 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
299 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
300 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
301 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
302 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
303 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
304 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
305 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
306 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
307 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
308 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
309 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
310 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
311 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
312 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
313 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
314 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
315 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
316 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
317 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
318 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
319 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
320 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
321 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
322 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
323 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
324 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
325 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
326 2842694124 Methylopila sp. R-72369 Isolate Unclassified
327 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
328 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
329 2844104063 Bosea sp. Tri-39 Isolate Nodule
330 2844163670 Ensifer sp. 1H6 Isolate Unclassified
331 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
332 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
333 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
334 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
335 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
336 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
337 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
338 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
339 2851182111 Bosea sp. Tri-44 Isolate Nodule
340 2851246043 Bosea sp. Tri-54 Isolate Nodule
341 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
342 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
343 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
344 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
345 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
346 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
347 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
348 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
349 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
350 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
351 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
352 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
353 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
354 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
355 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
356 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
357 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
358 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
359 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
360 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
361 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
362 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
363 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
364 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
365 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
366 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
367 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
368 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
369 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
370 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
371 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
372 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
373 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
374 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
375 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
376 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
377 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
378 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
379 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
380 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
381 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
382 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
383 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
384 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
385 2902330777 Methylobacterium sp. 2A Isolate Unclassified
386 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
387 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
388 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
389 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
390 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
391 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
392 2904699407
393 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
394 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
395 2906610324
396 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
397 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
398 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
399 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
400 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
401 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
402 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
403 2909042592 Labrys sp. LIt4 Isolate Nodule
404 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
405 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
406 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
407 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
408 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
409 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
410 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
411 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
412 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
413 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
414 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
415 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
416 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
417 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
418 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
419 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
420 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
421 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
422 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
423 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
424 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
425 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
426 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
427 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
428 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
429 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
430 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
431 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
432 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
433 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
434 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
435 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
436 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
437 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
438 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
439 2922368715
440 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
441 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
442 2922425934
443 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
444 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
445 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
446 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
447 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
448 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
449 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
450 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
451 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
452 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
453 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
454 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
455 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
456 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
457 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
458 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
459 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
460 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
461 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
462 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
463 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
464 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
465 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
466 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
467 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
468 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
469 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
470 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
471 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
472 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
473 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
474 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
475 2933599457 Rhizobium phaseoli M3 Isolate Nodule
476 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
477 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
478 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
479 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
480 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
481 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
482 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
483 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
484 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
485 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
486 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
487 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
488 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
489 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
490 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
491 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
492 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
493 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
494 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
495 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
496 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
497 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
498 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
499 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
500 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
501 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
502 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
503 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
504 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
505 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
506 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
507 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
508 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
509 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
510 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
511 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
512 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
513 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
514 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
515 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
516 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
517 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
518 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
519 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
520 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
521 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
522 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
523 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
524 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
525 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
526 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
527 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
528 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
529 2936381700 Rhizobium chutanense C16 Isolate Unclassified
530 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
531 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
532 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
533 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
534 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
535 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
536 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
537 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
538 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
539 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
540 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
541 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
542 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
543 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
544 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
545 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
546 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
547 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
548 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
549 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
550 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
551 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
552 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
553 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
554 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
555 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
556 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
557 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
558 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
559 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
560 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
561 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
562 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
563 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
564 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
565 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
566 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
567 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
568 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
569 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
570 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
571 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
572 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
573 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
574 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
575 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
576 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
577 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
578 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
579 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
580 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
581 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
582 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
583 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
584 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
585 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
586 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
587 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
588 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
589 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
590 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
591 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
592 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
593 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
594 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
595 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
596 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
597 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
598 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
599 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
600 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
601 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
602 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
603 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
604 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
605 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
606 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
607 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
608 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
609 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
610 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
611 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
612 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
613 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
614 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
615 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
616 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
617 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
618 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
619 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
620 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
621 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
622 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
623 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
624 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
625 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
626 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
627 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
628 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
629 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
630 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
631 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
632 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
633 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
634 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
635 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
636 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
637 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
638 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
639 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
640 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
641 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
642 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
643 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
644 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
645 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
646 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
647 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
648 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
649 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
650 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
651 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
652 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
653 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
654 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
655 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
656 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
657 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
658 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
659 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
660 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
661 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
662 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
663 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
664 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
665 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
666 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
667 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
668 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
669 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
670 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
671 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
672 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
673 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
674 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
675 2996887358 Rhizobium sp. R711 Isolate Nodule
676 2996893221 Rhizobium sp. R635 Isolate Nodule
677 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
678 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
679 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
680 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
681 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
682 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
683 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
684 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
685 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
686 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
687 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
688 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
689 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
690 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
691 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
692 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
693 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
694 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
695 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
696 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
697 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
698 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
699 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
700 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
701 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
702 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
703 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
704 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
705 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
706 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
707 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
708 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
709 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
710 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
711 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
712 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
713 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
714 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
715 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
716 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
717 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
718 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
719 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
720 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
721 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
722 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
723 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
724 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
725 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
726 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
727 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
728 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
729 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
730 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
731 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
732 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
733 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
734 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
735 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
736 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
737 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
738 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
739 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
740 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
741 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
742 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
743 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
744 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
745 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
746 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
747 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
748 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
749 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
750 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
751 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
752 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
753 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
754 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
755 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
756 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
757 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
758 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
759 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
760 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
761 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
762 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
763 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
764 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
765 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
766 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
767 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
768 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
769 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
770 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
771 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
772 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
773 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
774 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
775 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
776 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
777 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
778 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
779 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
780 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
781 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
782 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
783 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
784 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
785 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
786 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
787 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
788 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
789 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
790 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
791 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
792 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
793 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
794 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
795 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
796 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
797 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
798 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
799 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
800 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
801 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
802 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
803 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
804 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
805 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
806 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
807 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
808 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
809 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
810 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
811 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
812 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
813 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
814 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
815 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
816 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
817 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
818 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
819 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
820 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
821 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
822 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
823 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
824 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
825 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
826 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
827 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
828 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
829 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
830 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
831 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
832 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
833 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
834 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
835 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
836 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
837 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
838 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
839 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
840 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
841 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
842 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
843 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
844 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
845 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
846 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
847 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
848 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
849 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
850 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
851 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
852 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
853 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
854 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
855 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
856 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
857 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
858 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
859 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
860 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
861 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
862 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
863 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
864 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
865 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
866 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
867 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
868 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
869 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
870 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
871 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
872 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
873 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
874 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
875 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
876 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
877 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
878 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
879 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
880 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
881 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
882 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
883 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
884 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
885 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
886 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
887 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
888 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
889 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
890 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
891 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
892 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
893 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
894 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
895 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
896 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
897 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
898 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
899 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
900 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
901 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
902 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
903 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
904 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
905 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
906 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
907 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
908 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
909 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
910 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
911 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
912 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
913 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
914 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
915 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
916 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
917 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
918 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
919 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
920 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
921 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
922 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
923 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
924 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
925 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
926 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
927 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
928 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
929 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
943 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
944 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
945 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
946 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
948 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
949 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
950 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
951 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
952 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
953 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
954 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
955 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
956 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
957 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
958 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
959 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
960 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
961 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
962 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
963 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
964 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
965 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
966 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
967 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
968 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
969 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
970 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
971 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
972 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
973 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
974 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
975 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
976 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
977 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
978 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
979 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
980 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
981 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
982 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
983 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
984 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
985 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
986 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
987 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
988 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
989 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
990 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
991 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
992 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
993 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
994 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
995 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
996 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
997 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
998 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
999 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1000 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1001 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1002 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1003 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1004 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1005 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1006 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1007 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1008 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1009 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1010 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1011 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1012 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1013 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1014 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1015 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1016 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1017 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1018 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1019 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
1020 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1021 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1022 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1023 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1024 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1025 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1026 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1027 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1028 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1029 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1030 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1031 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1032 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
1033 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1034 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1035 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1036 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1037 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1038 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1039 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1040 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1041 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1042 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1043 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1044 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1045 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1046 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1047 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1048 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1049 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1050 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1051 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1052 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1053 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1054 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1055 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1056 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1057 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1058 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1059 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1060 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1061 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1062 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1063 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1064 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1065 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1066 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1067 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1068 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1069 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1070 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1071 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1072 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1073 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1074 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1075 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1076 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1077 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1078 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1079 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1080 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1081 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1082 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1083 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1084 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
1085 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1086 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1087 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1088 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1089 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1090 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1091 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1092 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1093 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1094 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1095 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1096 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1097 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1098 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1099 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1252 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1254 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
1255 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1258 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1260 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1261 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1264 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
1267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1272 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1274 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1275 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1276 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1280 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1281 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1283 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1284 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1286 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1287 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1292 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1293 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1294 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1295 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1296 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1297 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1298 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1299 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1300 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1301 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1302 8005258706 Rhizobium sp. R693 Isolate Nodule
1303 8005275841 Rhizobium sp. N4311 Isolate Nodule
1304 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1305 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1306 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1307 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1308 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1309 8005321885 Rhizobium sp. R72 Isolate Nodule
1310 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1311 8005382845 Rhizobium sp. R634 Isolate Nodule
1312 8005395548 Rhizobium sp. R339 Isolate Nodule
1313 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1314 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1315 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1316 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1317 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1318 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1319 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1320 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1321 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1322 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1323 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1324 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1325 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1326 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1327 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1328 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1329 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1330 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1331 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1332 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1333 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1334 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1335 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1336 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1337 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1338 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1339 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1340 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1341 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1342 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1343 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1344 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1345 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1346 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1347 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1348 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1349 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1350 8018176218 Rhizobium sp. N122 Isolate Nodule
1351 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1352 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1353 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1354 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1355 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1356 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1357 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1358 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1359 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1360 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1361 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1362 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1363 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1364 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1365 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1366 8024501048 Rhizobium sp. H4 Isolate Nodule
1367 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1368 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1369 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1370 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1371 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1372 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1373 8056382006 Rhizobium croatiense 13T Isolate Nodule
1374 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1375 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1376 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1377 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1378 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1379 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1380 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.71
Metatranscriptomes 0
Isolates 27.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 9.01
Nodule 21.12
Rhizoplane 4.82
Rhizosphere 55.02
Stem 0
Stem Tuber 0
Unclassified 9.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000516 3300000041 Bacteria 4854
2 ARSoilYngRDRAFT_c00728 3300000042 Bacteria 3012
3 ARcpr5yngRDRAFT_c000549 3300000043 Bacteria 4823
4 ARSoilOldRDRAFT_c000275 3300000044 Bacteria 7322
5 ARCol0yngRDRAFT_1000490 3300000652 Bacteria 4696
6 JGI24746J21847_1000658 3300001977 Bacteria 5289
7 JGI24740J21852_10002709 3300001979 Bacteria 7951
8 JGI24739J22299_10000203 3300001989 Bacteria 19736
9 JGI24737J22298_10003052 3300001990 Bacteria 5933
10 JGI24750J21931_1000206 3300002070 Bacteria 9983
11 JGI24750J21931_1000813 3300002070 Bacteria 4319
12 JGI24745J21846_1000036 3300002073 Bacteria 9023
13 JGI24748J21848_1000461 3300002074 Bacteria 4506
14 JGI24738J21930_10001355 3300002075 Bacteria 6788
15 JGI24749J21850_1001705 3300002076 Bacteria 3116
16 JGI24744J21845_10006569 3300002077 Bacteria 2411
17 JGI24035J26624_1000184 3300002126 Bacteria 5800
18 JGI24034J26672_10001100 3300002239 Bacteria 3524
19 JGI24742J22300_10000210 3300002244 Bacteria 8662
20 JGI24751J29686_10014198 3300002459 Bacteria 1644
21 JGI25156J39149_1000001 3300002705 Bacteria 354557
22 JGI25154J39366_1000122 3300002738 Bacteria 61892
23 JGI25154J39366_1000150 3300002738 Bacteria 54544
24 JGI25158J39367_1000038 3300002739 Bacteria 30017
25 JGI25157J39369_1000044 3300002741 Bacteria 122466
26 JGI25152J39213_1001384 3300002773 Bacteria 10513
27 JGI25150J39212_1000107 3300002774 Bacteria 48306
28 JGI25150J39212_1003225 3300002774 Bacteria 3859
29 JGI25150J39212_1004915 3300002774 Bacteria 2912
30 JGI25159J45721_1000154 3300002987 Bacteria 32025
31 JGI25159J45721_1002735 3300002987 Bacteria 6539
32 JGI25151J46595_10000028 3300003187 Bacteria 208373
33 JGI25151J46595_10000374 3300003187 Bacteria 46807
34 JGI25151J46595_10000839 3300003187 Bacteria 24488
35 JGI25151J46595_10016744 3300003187 Bacteria 3198
36 JGI25151J46595_10029284 3300003187 Bacteria 2182
37 JGI25406J46586_10000392 3300003203 Bacteria 20055
38 JGI25406J46586_10003218 3300003203 Bacteria 7680
39 JGI25165J46597_1001042 3300003214 Bacteria 18102
40 JGI25165J46597_1006320 3300003214 Bacteria 2112
41 JGI25153J46596_10000696 3300003215 Bacteria 20557
42 JGI25153J46596_10003837 3300003215 Bacteria 8280
43 JGI25153J46596_10004141 3300003215 Bacteria 7882
44 JGI25153J46596_10004246 3300003215 Bacteria 7754
45 JGI25153J46596_10006403 3300003215 Bacteria 5958
46 JGI25153J46596_10015480 3300003215 Bacteria 3104
47 JGI25160J50197_1000001 3300003354 Bacteria 782301
48 JGI25160J50197_1001885 3300003354 Bacteria 10064
49 JGI25160J50197_1003307 3300003354 Bacteria 7256
50 JGI25160J50197_1004587 3300003354 Bacteria 5948
51 JGI25160J50197_1008344 3300003354 Bacteria 3953
52 JGI25161J50226_1000001 3300003374 Bacteria 655036
53 JGI25161J50226_1000174 3300003374 Bacteria 43080
54 JGI25404J52841_10002804 3300003659 Bacteria 3356
55 JGI25404J52841_10015585 3300003659 Bacteria 1649
56 Ga0055526_1000597 3300003771 Bacteria 28415
57 Ga0055526_1000802 3300003771 Bacteria 23436
58 Ga0055526_1001522 3300003771 Bacteria 16418
59 Ga0055526_1003626 3300003771 Bacteria 9665
60 Ga0055526_1007634 3300003771 Bacteria 5578
61 Ga0055526_1020097 3300003771 Bacteria 2397
62 Ga0055524_1000020 3300003775 Bacteria 227971
63 Ga0055524_1004279 3300003775 Bacteria 6626
64 Ga0055524_1004359 3300003775 Bacteria 6539
65 Ga0055524_1004387 3300003775 Bacteria 6512
66 Ga0055524_1014554 3300003775 Bacteria 2911
67 Ga0055528_1001199 3300003790 Bacteria 16717
68 Ga0055528_1002181 3300003790 Bacteria 10723
69 Ga0055528_1005051 3300003790 Bacteria 6231
70 Ga0055540_1000929 3300003792 Bacteria 19079
71 Ga0055540_1003312 3300003792 Bacteria 7857
72 Ga0055531_10005281 3300003794 Bacteria 7578
73 Ga0055543_1000003 3300004625 Bacteria 358656
74 Ga0055543_1000350 3300004625 Bacteria 31311
75 Ga0055543_1000500 3300004625 Bacteria 22620
76 Ga0065165_1000068 3300005262 Bacteria 170609
77 Ga0065165_1000141 3300005262 Bacteria 125536
78 Ga0065165_1004626 3300005262 Bacteria 8358
79 Ga0065165_1004931 3300005262 Bacteria 7867
80 Ga0065165_1011468 3300005262 Bacteria 3693
81 Ga0065165_1014773 3300005262 Bacteria 3015
82 Ga0065712_10001033 3300005290 Bacteria 10330
83 Ga0065712_10003647 3300005290 Bacteria 4552
84 Ga0065715_10006009 3300005293 Bacteria 5768
85 Ga0065715_10091317 3300005293 Bacteria 5885
86 Ga0065707_10131552 3300005295 Bacteria 1912
87 Ga0070658_10038187 3300005327 Bacteria 3873
88 Ga0070676_10000499 3300005328 Bacteria 18707
89 Ga0070676_10007528 3300005328 Bacteria 5848
90 Ga0070683_100000265 3300005329 Bacteria 36059
91 Ga0070683_100150071 3300005329 Bacteria 2210
92 Ga0070690_100000718 3300005330 Bacteria 16997
93 Ga0070690_100026323 3300005330 Bacteria 3587
94 Ga0070670_100006298 3300005331 Bacteria 10047
95 Ga0070670_100014626 3300005331 Bacteria 6737
96 Ga0070670_100039987 3300005331 Bacteria 4033
97 Ga0070670_100090453 3300005331 Bacteria 2630
98 Ga0070670_100102718 3300005331 Bacteria 2462
99 Ga0070677_10001854 3300005333 Bacteria 6684
100 Ga0068869_100000792 3300005334 Bacteria 18060
101 Ga0070666_10018983 3300005335 Bacteria 4431
102 Ga0070680_100001359 3300005336 Bacteria 17686
103 Ga0070680_100007344 3300005336 Bacteria 8406
104 Ga0070680_100016152 3300005336 Bacteria 5869
105 Ga0070680_100067602 3300005336 Bacteria 2931
106 Ga0070680_100075252 3300005336 Bacteria 2779
107 Ga0070682_100000745 3300005337 Bacteria 19431
108 Ga0070682_100037232 3300005337 Bacteria 2977
109 Ga0068868_100007218 3300005338 Bacteria 7897
110 Ga0068868_100012356 3300005338 Bacteria 6239
111 Ga0068868_100119237 3300005338 Bacteria 2151
112 Ga0068868_100133070 3300005338 Bacteria 2036
113 Ga0070660_100000136 3300005339 Bacteria 46892
114 Ga0070660_100002003 3300005339 Bacteria 14053
115 Ga0070660_100043329 3300005339 Bacteria 3439
116 Ga0070689_100000722 3300005340 Bacteria 20157
117 Ga0070689_100001379 3300005340 Bacteria 15450
118 Ga0070691_10000148 3300005341 Bacteria 22373
119 Ga0070687_100000080 3300005343 Bacteria 31259
120 Ga0070687_100057571 3300005343 Bacteria 2039
121 Ga0070661_100000425 3300005344 Bacteria 32302
122 Ga0070661_100059571 3300005344 Bacteria 2800
123 Ga0070692_10000893 3300005345 Bacteria 10102
124 Ga0070692_10042477 3300005345 Bacteria 2335
125 Ga0070692_10063725 3300005345 Bacteria 1948
126 Ga0070669_100000276 3300005353 Bacteria 41366
127 Ga0070669_100002660 3300005353 Bacteria 12871
128 Ga0070669_100053883 3300005353 Bacteria 2945
129 Ga0070675_100000271 3300005354 Bacteria 34156
130 Ga0070675_100097097 3300005354 Bacteria 2477
131 Ga0070675_100154622 3300005354 Bacteria 1969
132 Ga0070671_100000389 3300005355 Bacteria 30190
133 Ga0070671_100018200 3300005355 Bacteria 5703
134 Ga0070671_100023087 3300005355 Bacteria 5085
135 Ga0070671_100051379 3300005355 Bacteria 3428
136 Ga0070674_100000928 3300005356 Bacteria 15290
137 Ga0070674_100040050 3300005356 Bacteria 3168
138 Ga0070674_100124249 3300005356 Bacteria 1914
139 Ga0070673_100001722 3300005364 Bacteria 13004
140 Ga0070673_100008972 3300005364 Bacteria 6688
141 Ga0070673_100175780 3300005364 Bacteria 1830
142 Ga0070688_100001551 3300005365 Bacteria 11468
143 Ga0070688_100005937 3300005365 Bacteria 6469
144 Ga0070688_100023145 3300005365 Bacteria 3650
145 Ga0070688_100046475 3300005365 Bacteria 2688
146 Ga0070688_100090147 3300005365 Bacteria 2002
147 Ga0070659_100006384 3300005366 Bacteria 8513
148 Ga0070659_100023831 3300005366 Bacteria 4687
149 Ga0070667_100001569 3300005367 Bacteria 20471
150 Ga0070667_100049567 3300005367 Bacteria 3537
151 Ga0070667_100071904 3300005367 Bacteria 2946
152 Ga0070667_100106790 3300005367 Bacteria 2423
153 Ga0070703_10001527 3300005406 Bacteria 6911
154 Ga0070703_10032910 3300005406 Bacteria 1577
155 Ga0070709_10001417 3300005434 Bacteria 12994
156 Ga0070709_10009235 3300005434 Bacteria 5429
157 Ga0070709_10036252 3300005434 Bacteria 3003
158 Ga0070709_10061585 3300005434 Bacteria 2389
159 Ga0070709_10068113 3300005434 Bacteria 2288
160 Ga0070709_10088435 3300005434 Bacteria 2038
161 Ga0070714_100000678 3300005435 Bacteria 24075
162 Ga0070714_100013931 3300005435 Bacteria 6452
163 Ga0070714_100018262 3300005435 Bacteria 5694
164 Ga0070714_100048804 3300005435 Bacteria 3601
165 Ga0070714_100058991 3300005435 Bacteria 3290
166 Ga0070713_100002582 3300005436 Bacteria 11845
167 Ga0070713_100017559 3300005436 Bacteria 5414
168 Ga0070713_100022313 3300005436 Bacteria 4890
169 Ga0070713_100033799 3300005436 Bacteria 4101
170 Ga0070713_100074835 3300005436 Bacteria 2870
171 Ga0070713_100135610 3300005436 Bacteria 2175
172 Ga0070713_100240790 3300005436 Bacteria 1647
173 Ga0070710_10000633 3300005437 Bacteria 16752
174 Ga0070710_10002407 3300005437 Bacteria 8862
175 Ga0070710_10002708 3300005437 Bacteria 8421
176 Ga0070710_10006364 3300005437 Bacteria 5669
177 Ga0070710_10019478 3300005437 Bacteria 3507
178 Ga0070710_10026128 3300005437 Bacteria 3099
179 Ga0070710_10046292 3300005437 Bacteria 2421
180 Ga0070701_10000457 3300005438 Bacteria 13932
181 Ga0070701_10004482 3300005438 Bacteria 5666
182 Ga0070701_10011127 3300005438 Bacteria 4007
183 Ga0070711_100001478 3300005439 Bacteria 12909
184 Ga0070711_100002216 3300005439 Bacteria 11029
185 Ga0070711_100007229 3300005439 Bacteria 6746
186 Ga0070711_100011186 3300005439 Bacteria 5564
187 Ga0070711_100055922 3300005439 Bacteria 2727
188 Ga0070711_100092586 3300005439 Bacteria 2181
189 Ga0070711_100166193 3300005439 Bacteria 1677
190 Ga0070705_100000579 3300005440 Bacteria 21266
191 Ga0070705_100044359 3300005440 Bacteria 2554
192 Ga0070700_100000515 3300005441 Bacteria 19292
193 Ga0070700_100010386 3300005441 Bacteria 5138
194 Ga0070700_100030563 3300005441 Bacteria 3220
195 Ga0070694_100004976 3300005444 Bacteria 8009
196 Ga0070694_100052391 3300005444 Bacteria 2758
197 Ga0070708_100041592 3300005445 Bacteria 4030
198 Ga0070663_100000580 3300005455 Bacteria 19553
199 Ga0070663_100027924 3300005455 Bacteria 3836
200 Ga0070663_100067369 3300005455 Bacteria 2596
201 Ga0070663_100091152 3300005455 Bacteria 2258
202 Ga0070663_100132571 3300005455 Bacteria 1894
203 Ga0070678_100000016 3300005456 Bacteria 53269
204 Ga0070678_100008371 3300005456 Bacteria 6195
205 Ga0070678_100025343 3300005456 Bacteria 3988
206 Ga0070662_100001325 3300005457 Bacteria 15215
207 Ga0070662_100015684 3300005457 Bacteria 5080
208 Ga0070662_100016017 3300005457 Bacteria 5030
209 Ga0070662_100021879 3300005457 Bacteria 4370
210 Ga0070662_100063250 3300005457 Bacteria 2706
211 Ga0070681_10001764 3300005458 Bacteria 19392
212 Ga0070681_10003323 3300005458 Bacteria 15029
213 Ga0070681_10025407 3300005458 Bacteria 5957
214 Ga0070681_10043509 3300005458 Bacteria 4499
215 Ga0070681_10166077 3300005458 Bacteria 2130
216 Ga0068867_100012945 3300005459 Bacteria 5902
217 Ga0068867_100073028 3300005459 Bacteria 2569
218 Ga0070685_10000344 3300005466 Bacteria 28550
219 Ga0070685_10013452 3300005466 Bacteria 4316
220 Ga0070685_10024049 3300005466 Bacteria 3343
221 Ga0070706_100130741 3300005467 Bacteria 2342
222 Ga0070698_100019627 3300005471 Bacteria 7091
223 Ga0070679_100001267 3300005530 Bacteria 22298
224 Ga0070679_100008695 3300005530 Bacteria 9571
225 Ga0070679_100024858 3300005530 Bacteria 5870
226 Ga0070679_100031436 3300005530 Bacteria 5243
227 Ga0070679_100092503 3300005530 Bacteria 3012
228 Ga0070679_100169723 3300005530 Bacteria 2155
229 Ga0070684_100004054 3300005535 Bacteria 11087
230 Ga0070684_100005206 3300005535 Bacteria 9945
231 Ga0070684_100014119 3300005535 Bacteria 6458
232 Ga0070684_100020270 3300005535 Bacteria 5515
233 Ga0070697_100000413 3300005536 Bacteria 32976
234 Ga0068853_100001111 3300005539 Bacteria 19042
235 Ga0068853_100006219 3300005539 Bacteria 9457
236 Ga0068853_100008362 3300005539 Bacteria 8309
237 Ga0068853_100010311 3300005539 Bacteria 7556
238 Ga0068853_100010423 3300005539 Bacteria 7520
239 Ga0070672_100000233 3300005543 Bacteria 31143
240 Ga0070672_100009467 3300005543 Bacteria 6717
241 Ga0070686_100000699 3300005544 Bacteria 19478
242 Ga0070686_100009615 3300005544 Bacteria 5436
243 Ga0070686_100059868 3300005544 Bacteria 2455
244 Ga0070695_100000624 3300005545 Bacteria 18756
245 Ga0070696_100001198 3300005546 Bacteria 16816
246 Ga0070693_100000594 3300005547 Bacteria 16031
247 Ga0070693_100022952 3300005547 Bacteria 3327
248 Ga0070665_100005019 3300005548 Bacteria 13728
249 Ga0070665_100021991 3300005548 Bacteria 6415
250 Ga0070665_100025615 3300005548 Bacteria 5942
251 Ga0070665_100028235 3300005548 Bacteria 5651
252 Ga0070665_100035418 3300005548 Bacteria 5019
253 Ga0070665_100047437 3300005548 Bacteria 4311
254 Ga0070665_100053711 3300005548 Bacteria 4040
255 Ga0070665_100102127 3300005548 Bacteria 2871
256 Ga0070665_100107111 3300005548 Bacteria 2797
257 Ga0070665_100166239 3300005548 Bacteria 2208
258 Ga0070704_100000112 3300005549 Bacteria 28583
259 Ga0070704_100001736 3300005549 Bacteria 11901
260 Ga0070704_100008535 3300005549 Bacteria 6149
261 Ga0068855_100007243 3300005563 Bacteria 13453
262 Ga0068855_100030914 3300005563 Bacteria 6399
263 Ga0068855_100033133 3300005563 Bacteria 6167
264 Ga0068855_100049698 3300005563 Bacteria 4944
265 Ga0068855_100092034 3300005563 Bacteria 3497
266 Ga0068855_100209747 3300005563 Bacteria 2189
267 Ga0068855_100217628 3300005563 Bacteria 2143
268 Ga0070664_100000924 3300005564 Bacteria 22943
269 Ga0070664_100075219 3300005564 Bacteria 2900
270 Ga0070664_100087965 3300005564 Bacteria 2686
271 Ga0070664_100247502 3300005564 Bacteria 1601
272 Ga0068857_100000371 3300005577 Bacteria 31431
273 Ga0068857_100021812 3300005577 Bacteria 5637
274 Ga0068857_100135199 3300005577 Bacteria 2226
275 Ga0068854_100000735 3300005578 Bacteria 19431
276 Ga0068854_100050602 3300005578 Bacteria 2974
277 Ga0068856_100000091 3300005614 Bacteria 85048
278 Ga0068856_100000520 3300005614 Bacteria 42483
279 Ga0068856_100042057 3300005614 Bacteria 4494
280 Ga0068856_100131878 3300005614 Bacteria 2504
281 Ga0070702_100002320 3300005615 Bacteria 8168
282 Ga0070702_100009804 3300005615 Bacteria 4700
283 Ga0070702_100072947 3300005615 Bacteria 2032
284 Ga0068852_100001599 3300005616 Bacteria 15407
285 Ga0068852_100164473 3300005616 Bacteria 2075
286 Ga0068852_100196972 3300005616 Bacteria 1904
287 Ga0068859_100010201 3300005617 Bacteria 9455
288 Ga0068859_100030056 3300005617 Bacteria 5452
289 Ga0068864_100000333 3300005618 Bacteria 41669
290 Ga0068864_100022846 3300005618 Bacteria 5246
291 Ga0068864_100099199 3300005618 Bacteria 2580
292 Ga0068866_10000143 3300005718 Bacteria 32232
293 Ga0068866_10019797 3300005718 Bacteria 3071
294 Ga0068866_10025614 3300005718 Bacteria 2775
295 Ga0068861_100000417 3300005719 Bacteria 24695
296 Ga0068861_100050057 3300005719 Bacteria 3166
297 Ga0068861_100101383 3300005719 Bacteria 2290
298 Ga0068851_10001608 3300005834 Bacteria 9920
299 Ga0068870_10000113 3300005840 Bacteria 27642
300 Ga0068870_10011422 3300005840 Bacteria 4117
301 Ga0068863_100022133 3300005841 Bacteria 6068
302 Ga0068863_100133244 3300005841 Bacteria 2373
303 Ga0068863_100257570 3300005841 Bacteria 1686
304 Ga0068858_100000975 3300005842 Bacteria 29622
305 Ga0068858_100010175 3300005842 Bacteria 8928
306 Ga0068858_100021103 3300005842 Bacteria 6084
307 Ga0068858_100103476 3300005842 Bacteria 2656
308 Ga0068858_100197856 3300005842 Bacteria 1900
309 Ga0068860_100000254 3300005843 Bacteria 79465
310 Ga0068860_100001740 3300005843 Bacteria 23200
311 Ga0068860_100015730 3300005843 Bacteria 7387
312 Ga0068860_100032250 3300005843 Bacteria 5035
313 Ga0068860_100033225 3300005843 Bacteria 4952
314 Ga0068860_100051464 3300005843 Bacteria 3919
315 Ga0068862_100001457 3300005844 Bacteria 21772
316 Ga0068862_100201283 3300005844 Bacteria 1796
317 Ga0081455_10000110 3300005937 Bacteria 92459
318 Ga0081455_10004210 3300005937 Bacteria 16214
319 Ga0081455_10007679 3300005937 Bacteria 11320
320 Ga0081455_10026261 3300005937 Bacteria 5362
321 Ga0081455_10037122 3300005937 Bacteria 4331
322 Ga0081455_10042135 3300005937 Bacteria 4008
323 Ga0081538_10040034 3300005981 Bacteria 2995
324 Ga0081538_10050519 3300005981 Bacteria 2510
325 Ga0081540_1000414 3300005983 Bacteria 42174
326 Ga0081540_1001143 3300005983 Bacteria 23424
327 Ga0081540_1003272 3300005983 Bacteria 12881
328 Ga0081540_1009836 3300005983 Bacteria 6542
329 Ga0081540_1012356 3300005983 Bacteria 5633
330 Ga0081540_1018061 3300005983 Bacteria 4341
331 Ga0081540_1032645 3300005983 Bacteria 2839
332 Ga0081540_1071123 3300005983 Bacteria 1609
333 Ga0081539_10000191 3300005985 Bacteria 142387
334 Ga0081539_10000321 3300005985 Bacteria 106887
335 Ga0081539_10001091 3300005985 Bacteria 49336
336 Ga0081539_10005255 3300005985 Bacteria 13360
337 Ga0081539_10047810 3300005985 Bacteria 2439
338 Ga0070717_10000355 3300006028 Bacteria 29408
339 Ga0070717_10002936 3300006028 Bacteria 12106
340 Ga0070717_10005443 3300006028 Bacteria 9293
341 Ga0070717_10027278 3300006028 Bacteria 4564
342 Ga0075365_10004585 3300006038 Bacteria 7349
343 Ga0075365_10013658 3300006038 Bacteria 4868
344 Ga0075365_10023762 3300006038 Bacteria 3859
345 Ga0075365_10026332 3300006038 Bacteria 3691
346 Ga0075368_10002184 3300006042 Bacteria 6339
347 Ga0075368_10055946 3300006042 Bacteria 1573
348 Ga0075363_100045637 3300006048 Bacteria 2324
349 Ga0075363_100074545 3300006048 Bacteria 1847
350 Ga0075364_10046742 3300006051 Bacteria 2818
351 Ga0075364_10064038 3300006051 Bacteria 2413
352 Ga0075432_10004478 3300006058 Bacteria 4764
353 Ga0070715_10000078 3300006163 Bacteria 27243
354 Ga0070715_10000694 3300006163 Bacteria 9037
355 Ga0070715_10001339 3300006163 Bacteria 7099
356 Ga0070716_100004734 3300006173 Bacteria 6527
357 Ga0070716_100009188 3300006173 Bacteria 4922
358 Ga0070716_100026212 3300006173 Bacteria 3120
359 Ga0070716_100077810 3300006173 Bacteria 1970
360 Ga0070716_100095048 3300006173 Bacteria 1813
361 Ga0070712_100002213 3300006175 Bacteria 11958
362 Ga0070712_100011086 3300006175 Bacteria 5706
363 Ga0070712_100020143 3300006175 Bacteria 4361
364 Ga0070712_100055443 3300006175 Bacteria 2776
365 Ga0070712_100082881 3300006175 Bacteria 2327
366 Ga0070712_100149373 3300006175 Bacteria 1792
367 Ga0075362_10010631 3300006177 Bacteria 3601
368 Ga0075367_10001860 3300006178 Bacteria 9322
369 Ga0075369_10001434 3300006186 Bacteria 8135
370 Ga0075369_10016884 3300006186 Bacteria 2953
371 Ga0075427_10000813 3300006194 Bacteria 3806
372 Ga0075366_10058476 3300006195 Bacteria 2290
373 Ga0075366_10082098 3300006195 Bacteria 1926
374 Ga0097621_100000203 3300006237 Bacteria 38745
375 Ga0097621_100017219 3300006237 Bacteria 5484
376 Ga0097621_100062009 3300006237 Bacteria 3068
377 Ga0097621_100108603 3300006237 Bacteria 2342
378 Ga0097621_100201177 3300006237 Bacteria 1729
379 Ga0075370_10033371 3300006353 Bacteria 2882
380 Ga0068871_100000575 3300006358 Bacteria 25171
381 Ga0068871_100028379 3300006358 Bacteria 4386
382 Ga0068871_100177992 3300006358 Bacteria 1826
383 Ga0075428_100008481 3300006844 Bacteria 11403
384 Ga0075428_100089794 3300006844 Bacteria 3351
385 Ga0075428_100111243 3300006844 Bacteria 2984
386 Ga0075430_100000012 3300006846 Bacteria 94359
387 Ga0075430_100000778 3300006846 Bacteria 24663
388 Ga0075431_100003622 3300006847 Bacteria 14964
389 Ga0075433_10005842 3300006852 Bacteria 9692
390 Ga0075433_10009181 3300006852 Bacteria 7902
391 Ga0075434_100000114 3300006871 Bacteria 46406
392 Ga0075434_100010989 3300006871 Bacteria 8515
393 Ga0075429_100002694 3300006880 Bacteria 14964
394 Ga0068865_100000654 3300006881 Bacteria 19602
395 Ga0068865_100020024 3300006881 Bacteria 4337
396 Ga0068865_100051878 3300006881 Bacteria 2840
397 Ga0068865_100106538 3300006881 Bacteria 2061
398 Ga0068865_100107012 3300006881 Bacteria 2056
399 Ga0075436_100013589 3300006914 Bacteria 5576
400 Ga0097620_100010201 3300006931 Bacteria 9455
401 Ga0097620_100030056 3300006931 Bacteria 5452
402 Ga0099825_1018997 3300006941 Bacteria 5214
403 Ga0099822_1000022 3300006943 Bacteria 64942
404 Ga0099823_1027652 3300006944 Bacteria 4931
405 Ga0079104_1001253 3300006946 Bacteria 17716
406 Ga0099826_10001254 3300006948 Bacteria 14871
407 Ga0075435_100021841 3300007076 Bacteria 4931
408 Ga0075435_100041943 3300007076 Bacteria 3659
409 Ga0075435_100113929 3300007076 Bacteria 2251
410 Ga0105251_10015950 3300009011 Bacteria 4083
411 Ga0105244_10022702 3300009036 Bacteria 3450
412 Ga0105250_10005564 3300009092 Bacteria 5634
413 Ga0105250_10020816 3300009092 Bacteria 2649
414 Ga0105240_10000076 3300009093 Bacteria 198848
415 Ga0105240_10017201 3300009093 Bacteria 9755
416 Ga0105240_10022325 3300009093 Bacteria 8392
417 Ga0105240_10092446 3300009093 Bacteria 3694
418 Ga0105240_10095268 3300009093 Bacteria 3630
419 Ga0111539_10000581 3300009094 Bacteria 47068
420 Ga0111539_10002232 3300009094 Bacteria 25871
421 Ga0111539_10004022 3300009094 Bacteria 19301
422 Ga0111539_10141164 3300009094 Bacteria 2820
423 Ga0105245_10000230 3300009098 Bacteria 53225
424 Ga0105245_10071520 3300009098 Bacteria 3150
425 Ga0105245_10104265 3300009098 Bacteria 2629
426 Ga0105247_10016289 3300009101 Bacteria 4453
427 Ga0105247_10019830 3300009101 Bacteria 4039
428 Ga0105247_10041342 3300009101 Bacteria 2822
429 Ga0114129_10002372 3300009147 Bacteria 26153
430 Ga0114129_10008877 3300009147 Bacteria 14335
431 Ga0114129_10010926 3300009147 Bacteria 12938
432 Ga0114129_10250894 3300009147 Bacteria 2375
433 Ga0105243_10002755 3300009148 Bacteria 14611
434 Ga0105243_10012152 3300009148 Bacteria 6508
435 Ga0105243_10013810 3300009148 Bacteria 6112
436 Ga0105243_10085562 3300009148 Bacteria 2585
437 Ga0105243_10202847 3300009148 Bacteria 1740
438 Ga0105241_10001308 3300009174 Bacteria 18957
439 Ga0105241_10009439 3300009174 Bacteria 7164
440 Ga0105241_10029800 3300009174 Bacteria 4074
441 Ga0105242_10000696 3300009176 Bacteria 26370
442 Ga0105242_10012804 3300009176 Bacteria 6461
443 Ga0105242_10062111 3300009176 Bacteria 3074
444 Ga0105248_10000015 3300009177 Bacteria 322959
445 Ga0105248_10001593 3300009177 Bacteria 25250
446 Ga0105248_10031210 3300009177 Bacteria 5955
447 Ga0105248_10032633 3300009177 Bacteria 5818
448 Ga0105248_10043884 3300009177 Bacteria 5015
449 Ga0105248_10122049 3300009177 Bacteria 2939
450 Ga0105248_10241696 3300009177 Bacteria 2032
451 Ga0105237_10000226 3300009545 Bacteria 79798
452 Ga0105237_10011347 3300009545 Bacteria 9428
453 Ga0105237_10015378 3300009545 Bacteria 7967
454 Ga0105237_10024176 3300009545 Bacteria 6216
455 Ga0105237_10033806 3300009545 Bacteria 5180
456 Ga0105238_10043849 3300009551 Bacteria 4524
457 Ga0105238_10097424 3300009551 Bacteria 2927
458 Ga0105249_10001642 3300009553 Bacteria 19605
459 Ga0105249_10096005 3300009553 Bacteria 2780
460 Ga0105249_10101988 3300009553 Bacteria 2700
461 Ga0105249_10151667 3300009553 Bacteria 2232
462 Ga0123341_1000007 3300009765 Bacteria 147072
463 Ga0123341_1047554 3300009765 Bacteria 2528
464 Ga0123342_1004784 3300009766 Bacteria 20320
465 Ga0099796_10001922 3300010159 Bacteria 4401
466 Ga0105239_10000641 3300010375 Bacteria 49765
467 Ga0105239_10053854 3300010375 Bacteria 4412
468 Ga0105239_10077673 3300010375 Bacteria 3654
469 Ga0105239_10128804 3300010375 Bacteria 2813
470 Ga0105239_10158078 3300010375 Bacteria 2532
471 Ga0105239_10160874 3300010375 Bacteria 2508
472 Ga0105239_10201375 3300010375 Bacteria 2230
473 Ga0105239_10376400 3300010375 Bacteria 1605
474 Ga0105246_10000550 3300011119 Bacteria 20662
475 Ga0105246_10027908 3300011119 Bacteria 3704
476 Ga0105246_10028278 3300011119 Bacteria 3682
477 Ga0105246_10130207 3300011119 Bacteria 1878
478 Ga0157373_10011236 3300013100 Bacteria 6588
479 Ga0157373_10051657 3300013100 Bacteria 2927
480 Ga0157371_10000017 3300013102 Bacteria 320830
481 Ga0157371_10004510 3300013102 Bacteria 12131
482 Ga0157371_10054681 3300013102 Bacteria 2834
483 Ga0157370_10000455 3300013104 Bacteria 51231
484 Ga0157370_10000461 3300013104 Bacteria 50850
485 Ga0157370_10044331 3300013104 Bacteria 4276
486 Ga0157370_10071190 3300013104 Bacteria 3281
487 Ga0157370_10110355 3300013104 Bacteria 2572
488 Ga0157369_10186475 3300013105 Bacteria 2181
489 Ga0171462_1066 3300013250 Bacteria 14419
490 Ga0157374_10016190 3300013296 Bacteria 6551
491 Ga0157374_10032938 3300013296 Bacteria 4723
492 Ga0157374_10036846 3300013296 Bacteria 4483
493 Ga0157374_10220423 3300013296 Bacteria 1861
494 Ga0157378_10000864 3300013297 Bacteria 28028
495 Ga0157378_10034605 3300013297 Bacteria 4467
496 Ga0163162_10000420 3300013306 Bacteria 39042
497 Ga0163162_10016129 3300013306 Bacteria 7303
498 Ga0163162_10072401 3300013306 Bacteria 3501
499 Ga0163162_10253519 3300013306 Bacteria 1891
500 Ga0157372_10011691 3300013307 Bacteria 9347
501 Ga0157372_10024037 3300013307 Bacteria 6611
502 Ga0157372_10271572 3300013307 Bacteria 1971
503 Ga0157375_10001626 3300013308 Bacteria 19334
504 Ga0157375_10025283 3300013308 Bacteria 5514
505 Ga0157375_10037694 3300013308 Bacteria 4634
506 Ga0163163_10067324 3300014325 Bacteria 3561
507 Ga0163163_10206841 3300014325 Bacteria 2011
508 Ga0157380_10000511 3300014326 Bacteria 23725
509 Ga0157377_10000053 3300014745 Bacteria 89091
510 Ga0157377_10046260 3300014745 Bacteria 2433
511 Ga0157377_10058121 3300014745 Bacteria 2201
512 Ga0157379_10001333 3300014968 Bacteria 20150
513 Ga0157379_10016704 3300014968 Bacteria 6457
514 Ga0157379_10094343 3300014968 Bacteria 2685
515 Ga0157379_10169012 3300014968 Bacteria 1974
516 Ga0157376_10000436 3300014969 Bacteria 26857
517 Ga0157376_10114255 3300014969 Bacteria 2382
518 Ga0182007_10001815 3300015262 Bacteria 11146
519 Ga0182005_1005015 3300015265 Bacteria 4184
520 Ga0163161_10001352 3300017792 Bacteria 18231
521 Ga0163161_10007604 3300017792 Bacteria 7495
522 Ga0163161_10023487 3300017792 Bacteria 4350
523 Ga0214544_1000001 3300021320 Bacteria 783667
524 Ga0214542_1000005 3300021321 Bacteria 389646
525 Ga0214542_1024229 3300021321 Bacteria 3439
526 Ga0214545_1000003 3300021324 Bacteria 720274
527 Ga0214545_1023657 3300021324 Bacteria 3986
528 Ga0214543_1000002 3300021327 Bacteria 712733
529 Ga0214543_1000024 3300021327 Bacteria 235745
530 Ga0214543_1000038 3300021327 Bacteria 182106
531 Ga0214543_1026030 3300021327 Bacteria 3240
532 Ga0213873_10011292 3300021358 Bacteria 1907
533 Ga0213874_10007096 3300021377 Bacteria 2677
534 Ga0213876_10021408 3300021384 Bacteria 3419
535 Ga0213875_10002982 3300021388 Bacteria 9856
536 Ga0213875_10008179 3300021388 Bacteria 5367
537 Ga0228711_1000008 3300022739 Bacteria 169893
538 Ga0228710_1000009 3300022740 Bacteria 169770
539 Ga0224572_1001441 3300024225 Bacteria 3522
540 Ga0228598_1001219 3300024227 Bacteria 5682
541 Ga0209435_100012 3300025206 Bacteria 401621
542 Ga0209436_100150 3300025208 Bacteria 33510
543 Ga0209563_103061 3300025230 Bacteria 3567
544 Ga0209437_100051 3300025233 Bacteria 392523
545 Ga0209437_100098 3300025233 Bacteria 229766
546 Ga0207425_1000075 3300025245 Bacteria 107452
547 Ga0207425_1001337 3300025245 Bacteria 10584
548 Ga0207425_1004121 3300025245 Bacteria 4441
549 Ga0209646_1000026 3300025246 Bacteria 401621
550 Ga0209026_1000014 3300025250 Bacteria 401621
551 Ga0209677_101595 3300025253 Bacteria 9567
552 Ga0209677_102022 3300025253 Bacteria 8058
553 Ga0209148_1000424 3300025254 Bacteria 47087
554 Ga0209759_1000012 3300025256 Bacteria 401621
555 Ga0209129_1000156 3300025258 Bacteria 107484
556 Ga0209129_1000524 3300025258 Bacteria 26835
557 Ga0209129_1000903 3300025258 Bacteria 18159
558 Ga0209129_1001820 3300025258 Bacteria 11302
559 Ga0209129_1001868 3300025258 Bacteria 11120
560 Ga0209129_1002344 3300025258 Bacteria 9373
561 Ga0209129_1004509 3300025258 Bacteria 5399
562 Ga0209233_1000095 3300025261 Bacteria 303783
563 Ga0209233_1000113 3300025261 Bacteria 253455
564 Ga0209233_1000427 3300025261 Bacteria 30799
565 Ga0209233_1001485 3300025261 Bacteria 9233
566 Ga0209233_1002935 3300025261 Bacteria 6096
567 Ga0209233_1004610 3300025261 Bacteria 4661
568 Ga0209233_1006596 3300025261 Bacteria 3730
569 Ga0207666_1000348 3300025271 Bacteria 6343
570 Ga0209455_1003259 3300025272 Bacteria 5843
571 Ga0209455_1003833 3300025272 Bacteria 5147
572 Ga0209673_1000010 3300025273 Bacteria 596656
573 Ga0209673_1000117 3300025273 Bacteria 172081
574 Ga0209673_1000151 3300025273 Bacteria 148103
575 Ga0209673_1000863 3300025273 Bacteria 39346
576 Ga0209673_1001685 3300025273 Bacteria 18869
577 Ga0209673_1002134 3300025273 Bacteria 14747
578 Ga0209673_1026911 3300025273 Bacteria 1880
579 Ga0209130_1000003 3300025284 Bacteria 677988
580 Ga0209130_1000020 3300025284 Bacteria 379297
581 Ga0209130_1000178 3300025284 Bacteria 90293
582 Ga0209130_1010600 3300025284 Bacteria 2524
583 Ga0207673_1000043 3300025290 Bacteria 9962
584 Ga0209675_1001344 3300025291 Bacteria 14518
585 Ga0209675_1011031 3300025291 Bacteria 3030
586 Ga0209025_1000008 3300025294 Bacteria 1130876
587 Ga0209025_1000070 3300025294 Bacteria 287776
588 Ga0209025_1000140 3300025294 Bacteria 184765
589 Ga0209025_1000506 3300025294 Bacteria 74798
590 Ga0209025_1001869 3300025294 Bacteria 24674
591 Ga0209025_1003183 3300025294 Bacteria 15930
592 Ga0209025_1005402 3300025294 Bacteria 10443
593 Ga0209025_1010282 3300025294 Bacteria 6361
594 Ga0209025_1028383 3300025294 Bacteria 2744
595 Ga0209564_1000049 3300025295 Bacteria 362075
596 Ga0209564_1000065 3300025295 Bacteria 315205
597 Ga0209564_1000485 3300025295 Bacteria 66032
598 Ga0209564_1000647 3300025295 Bacteria 52658
599 Ga0209564_1001780 3300025295 Bacteria 19956
600 Ga0209564_1001993 3300025295 Bacteria 17874
601 Ga0209564_1006799 3300025295 Bacteria 6048
602 Ga0209564_1009159 3300025295 Bacteria 4759
603 Ga0209564_1012956 3300025295 Bacteria 3586
604 Ga0209758_1000141 3300025297 Bacteria 172481
605 Ga0209758_1000186 3300025297 Bacteria 138804
606 Ga0209758_1000655 3300025297 Bacteria 52188
607 Ga0209758_1000758 3300025297 Bacteria 46817
608 Ga0209758_1001882 3300025297 Bacteria 22974
609 Ga0209758_1002154 3300025297 Bacteria 20718
610 Ga0209758_1002420 3300025297 Bacteria 19114
611 Ga0209758_1003547 3300025297 Bacteria 14035
612 Ga0209758_1005684 3300025297 Bacteria 9427
613 Ga0209758_1006158 3300025297 Bacteria 8788
614 Ga0209758_1006453 3300025297 Bacteria 8414
615 Ga0209758_1021515 3300025297 Bacteria 3003
616 Ga0209050_1005467 3300025298 Bacteria 7967
617 Ga0209256_1000014 3300025299 Bacteria 687409
618 Ga0209256_1000208 3300025299 Bacteria 110551
619 Ga0209256_1001653 3300025299 Bacteria 21690
620 Ga0209256_1001736 3300025299 Bacteria 20844
621 Ga0209256_1002712 3300025299 Bacteria 13781
622 Ga0209256_1003882 3300025299 Bacteria 9914
623 Ga0209256_1012913 3300025299 Bacteria 3144
624 Ga0209256_1023617 3300025299 Bacteria 1829
625 Ga0207426_1000008 3300025302 Bacteria 848730
626 Ga0207426_1000011 3300025302 Bacteria 791203
627 Ga0207426_1000221 3300025302 Bacteria 134756
628 Ga0207426_1000425 3300025302 Bacteria 69088
629 Ga0207426_1000869 3300025302 Bacteria 31530
630 Ga0207426_1003443 3300025302 Bacteria 8598
631 Ga0207426_1004449 3300025302 Bacteria 6833
632 Ga0207426_1027642 3300025302 Bacteria 1888
633 Ga0209051_1000097 3300025303 Bacteria 167378
634 Ga0209051_1004880 3300025303 Bacteria 8039
635 Ga0209051_1008689 3300025303 Bacteria 5347
636 Ga0209257_1000426 3300025304 Bacteria 81095
637 Ga0209257_1001142 3300025304 Bacteria 33931
638 Ga0209257_1018731 3300025304 Bacteria 2644
639 Ga0207697_10000672 3300025315 Bacteria 19436
640 Ga0207697_10019395 3300025315 Bacteria 2785
641 Ga0207696_1024092 3300025711 Bacteria 1911
642 Ga0207653_10000963 3300025885 Bacteria 9488
643 Ga0207653_10042695 3300025885 Bacteria 1492
644 Ga0207682_10000154 3300025893 Bacteria 31265
645 Ga0207692_10000468 3300025898 Bacteria 14298
646 Ga0207692_10001055 3300025898 Bacteria 10067
647 Ga0207692_10003318 3300025898 Bacteria 6272
648 Ga0207692_10005603 3300025898 Bacteria 5039
649 Ga0207692_10009587 3300025898 Bacteria 4051
650 Ga0207692_10040569 3300025898 Bacteria 2298
651 Ga0207642_10002038 3300025899 Bacteria 6231
652 Ga0207642_10006639 3300025899 Bacteria 3859
653 Ga0207642_10012667 3300025899 Bacteria 3052
654 Ga0207710_10001145 3300025900 Bacteria 13506
655 Ga0207710_10012463 3300025900 Bacteria 3578
656 Ga0207710_10035140 3300025900 Bacteria 2205
657 Ga0207688_10000817 3300025901 Bacteria 15595
658 Ga0207688_10003295 3300025901 Bacteria 8818
659 Ga0207688_10045412 3300025901 Bacteria 2451
660 Ga0207688_10070420 3300025901 Bacteria 1983
661 Ga0207688_10077050 3300025901 Bacteria 1899
662 Ga0207680_10014997 3300025903 Bacteria 4033
663 Ga0207647_10005421 3300025904 Bacteria 9350
664 Ga0207647_10067916 3300025904 Bacteria 2159
665 Ga0207699_10000390 3300025906 Bacteria 22928
666 Ga0207699_10004930 3300025906 Bacteria 6389
667 Ga0207699_10008578 3300025906 Bacteria 5052
668 Ga0207699_10012034 3300025906 Bacteria 4390
669 Ga0207699_10031512 3300025906 Bacteria 2977
670 Ga0207699_10042253 3300025906 Bacteria 2639
671 Ga0207699_10074694 3300025906 Bacteria 2083
672 Ga0207645_10000182 3300025907 Bacteria 50129
673 Ga0207645_10011610 3300025907 Bacteria 6008
674 Ga0207645_10027683 3300025907 Bacteria 3659
675 Ga0207645_10107850 3300025907 Bacteria 1801
676 Ga0207643_10000405 3300025908 Bacteria 28698
677 Ga0207643_10000416 3300025908 Bacteria 28107
678 Ga0207705_10065686 3300025909 Bacteria 2623
679 Ga0207684_10089462 3300025910 Bacteria 2623
680 Ga0207654_10000323 3300025911 Bacteria 28628
681 Ga0207654_10000889 3300025911 Bacteria 16573
682 Ga0207654_10054127 3300025911 Bacteria 2319
683 Ga0207654_10143963 3300025911 Bacteria 1523
684 Ga0207707_10000178 3300025912 Bacteria 66057
685 Ga0207707_10001762 3300025912 Bacteria 19871
686 Ga0207707_10003772 3300025912 Bacteria 13432
687 Ga0207707_10006911 3300025912 Bacteria 9901
688 Ga0207707_10030844 3300025912 Bacteria 4690
689 Ga0207707_10151946 3300025912 Bacteria 2024
690 Ga0207695_10000011 3300025913 Bacteria 910221
691 Ga0207695_10000062 3300025913 Bacteria 351979
692 Ga0207695_10000497 3300025913 Bacteria 83894
693 Ga0207695_10085113 3300025913 Bacteria 3191
694 Ga0207695_10088253 3300025913 Bacteria 3122
695 Ga0207695_10106889 3300025913 Bacteria 2784
696 Ga0207695_10264854 3300025913 Bacteria 1615
697 Ga0207671_10000093 3300025914 Bacteria 138939
698 Ga0207671_10004982 3300025914 Bacteria 12436
699 Ga0207671_10009091 3300025914 Bacteria 8349
700 Ga0207671_10011831 3300025914 Bacteria 7061
701 Ga0207693_10000842 3300025915 Bacteria 27312
702 Ga0207693_10003503 3300025915 Bacteria 13399
703 Ga0207693_10004344 3300025915 Bacteria 11994
704 Ga0207693_10005530 3300025915 Bacteria 10516
705 Ga0207693_10007487 3300025915 Bacteria 8977
706 Ga0207693_10007572 3300025915 Bacteria 8922
707 Ga0207693_10013345 3300025915 Bacteria 6623
708 Ga0207693_10018008 3300025915 Bacteria 5629
709 Ga0207693_10019662 3300025915 Bacteria 5371
710 Ga0207693_10027789 3300025915 Bacteria 4471
711 Ga0207693_10039213 3300025915 Bacteria 3730
712 Ga0207693_10098850 3300025915 Bacteria 2288
713 Ga0207663_10001979 3300025916 Bacteria 9717
714 Ga0207663_10006434 3300025916 Bacteria 6008
715 Ga0207663_10006811 3300025916 Bacteria 5884
716 Ga0207663_10014546 3300025916 Bacteria 4312
717 Ga0207660_10000007 3300025917 Bacteria 102878
718 Ga0207660_10014180 3300025917 Bacteria 5233
719 Ga0207660_10078989 3300025917 Bacteria 2413
720 Ga0207660_10129943 3300025917 Bacteria 1916
721 Ga0207662_10009169 3300025918 Bacteria 5439
722 Ga0207662_10117357 3300025918 Bacteria 1665
723 Ga0207657_10002910 3300025919 Bacteria 18383
724 Ga0207657_10010114 3300025919 Bacteria 9429
725 Ga0207657_10022087 3300025919 Bacteria 5972
726 Ga0207657_10023020 3300025919 Bacteria 5812
727 Ga0207657_10029030 3300025919 Bacteria 5040
728 Ga0207657_10088502 3300025919 Bacteria 2588
729 Ga0207649_10000305 3300025920 Bacteria 37712
730 Ga0207649_10083213 3300025920 Bacteria 2077
731 Ga0207652_10000459 3300025921 Bacteria 42058
732 Ga0207652_10055858 3300025921 Bacteria 3397
733 Ga0207652_10057241 3300025921 Bacteria 3357
734 Ga0207652_10074104 3300025921 Bacteria 2963
735 Ga0207652_10176007 3300025921 Bacteria 1921
736 Ga0207681_10000116 3300025923 Bacteria 67094
737 Ga0207681_10063702 3300025923 Bacteria 2543
738 Ga0207681_10093833 3300025923 Bacteria 2149
739 Ga0207694_10000212 3300025924 Bacteria 56506
740 Ga0207694_10020078 3300025924 Bacteria 5053
741 Ga0207694_10117303 3300025924 Bacteria 2122
742 Ga0207650_10004276 3300025925 Bacteria 9744
743 Ga0207650_10004547 3300025925 Bacteria 9488
744 Ga0207650_10009331 3300025925 Bacteria 6705
745 Ga0207650_10063498 3300025925 Bacteria 2761
746 Ga0207650_10068276 3300025925 Bacteria 2669
747 Ga0207650_10079346 3300025925 Bacteria 2486
748 Ga0207659_10000015 3300025926 Bacteria 168475
749 Ga0207659_10045278 3300025926 Bacteria 3101
750 Ga0207659_10156748 3300025926 Bacteria 1784
751 Ga0207687_10000357 3300025927 Bacteria 30477
752 Ga0207687_10004506 3300025927 Bacteria 9269
753 Ga0207687_10016432 3300025927 Bacteria 4862
754 Ga0207687_10087510 3300025927 Bacteria 2264
755 Ga0207700_10001137 3300025928 Bacteria 15268
756 Ga0207700_10031891 3300025928 Bacteria 3750
757 Ga0207700_10037199 3300025928 Bacteria 3523
758 Ga0207700_10038868 3300025928 Bacteria 3458
759 Ga0207700_10051582 3300025928 Bacteria 3071
760 Ga0207700_10073940 3300025928 Bacteria 2634
761 Ga0207700_10096958 3300025928 Bacteria 2343
762 Ga0207700_10124373 3300025928 Bacteria 2096
763 Ga0207664_10007701 3300025929 Bacteria 7474
764 Ga0207664_10017466 3300025929 Bacteria 5261
765 Ga0207664_10033246 3300025929 Bacteria 3961
766 Ga0207664_10036057 3300025929 Bacteria 3821
767 Ga0207664_10038518 3300025929 Bacteria 3708
768 Ga0207664_10134816 3300025929 Bacteria 2083
769 Ga0207644_10000251 3300025931 Bacteria 36497
770 Ga0207644_10002852 3300025931 Bacteria 11143
771 Ga0207644_10005542 3300025931 Bacteria 8213
772 Ga0207644_10005898 3300025931 Bacteria 7989
773 Ga0207644_10041109 3300025931 Bacteria 3269
774 Ga0207690_10000320 3300025932 Bacteria 32219
775 Ga0207690_10083028 3300025932 Bacteria 2242
776 Ga0207690_10095950 3300025932 Bacteria 2107
777 Ga0207690_10133314 3300025932 Bacteria 1821
778 Ga0207706_10002583 3300025933 Bacteria 17644
779 Ga0207706_10003309 3300025933 Bacteria 15434
780 Ga0207706_10012590 3300025933 Bacteria 7701
781 Ga0207706_10020107 3300025933 Bacteria 6000
782 Ga0207706_10023317 3300025933 Bacteria 5559
783 Ga0207706_10088609 3300025933 Bacteria 2720
784 Ga0207686_10000234 3300025934 Bacteria 42207
785 Ga0207709_10000081 3300025935 Bacteria 164427
786 Ga0207709_10046601 3300025935 Bacteria 2632
787 Ga0207670_10000620 3300025936 Bacteria 19095
788 Ga0207670_10000760 3300025936 Bacteria 16979
789 Ga0207670_10006459 3300025936 Bacteria 6503
790 Ga0207670_10008745 3300025936 Bacteria 5734
791 Ga0207669_10000008 3300025937 Bacteria 168213
792 Ga0207669_10004053 3300025937 Bacteria 6414
793 Ga0207704_10000215 3300025938 Bacteria 28899
794 Ga0207704_10058982 3300025938 Bacteria 2367
795 Ga0207704_10066628 3300025938 Bacteria 2261
796 Ga0207704_10125936 3300025938 Bacteria 1764
797 Ga0207665_10000361 3300025939 Bacteria 31561
798 Ga0207665_10001484 3300025939 Bacteria 15767
799 Ga0207665_10045676 3300025939 Bacteria 2933
800 Ga0207691_10000482 3300025940 Bacteria 39467
801 Ga0207691_10002588 3300025940 Bacteria 17682
802 Ga0207691_10040950 3300025940 Bacteria 4279
803 Ga0207711_10000003 3300025941 Bacteria 1042791
804 Ga0207711_10000005 3300025941 Bacteria 822972
805 Ga0207711_10000009 3300025941 Bacteria 580864
806 Ga0207711_10012426 3300025941 Bacteria 7078
807 Ga0207711_10040725 3300025941 Bacteria 3953
808 Ga0207711_10062352 3300025941 Bacteria 3216
809 Ga0207711_10062950 3300025941 Bacteria 3201
810 Ga0207711_10070788 3300025941 Bacteria 3025
811 Ga0207711_10082864 3300025941 Bacteria 2804
812 Ga0207711_10100986 3300025941 Bacteria 2552
813 Ga0207689_10000749 3300025942 Bacteria 31134
814 Ga0207661_10000170 3300025944 Bacteria 41868
815 Ga0207661_10004270 3300025944 Bacteria 10004
816 Ga0207661_10032345 3300025944 Bacteria 4051
817 Ga0207661_10089875 3300025944 Bacteria 2556
818 Ga0207679_10000046 3300025945 Bacteria 119975
819 Ga0207679_10010295 3300025945 Bacteria 6017
820 Ga0207667_10007538 3300025949 Bacteria 13058
821 Ga0207667_10010820 3300025949 Bacteria 10639
822 Ga0207667_10020500 3300025949 Bacteria 7349
823 Ga0207667_10038259 3300025949 Bacteria 5125
824 Ga0207651_10000200 3300025960 Bacteria 26185
825 Ga0207651_10051209 3300025960 Bacteria 2808
826 Ga0207651_10059710 3300025960 Bacteria 2643
827 Ga0207651_10111193 3300025960 Bacteria 2057
828 Ga0207712_10000495 3300025961 Bacteria 32538
829 Ga0207712_10087561 3300025961 Bacteria 2284
830 Ga0207712_10088828 3300025961 Bacteria 2271
831 Ga0207712_10149277 3300025961 Bacteria 1804
832 Ga0207668_10000133 3300025972 Bacteria 52202
833 Ga0207668_10084712 3300025972 Bacteria 2310
834 Ga0207668_10103475 3300025972 Bacteria 2120
835 Ga0207640_10000191 3300025981 Bacteria 43590
836 Ga0207640_10016944 3300025981 Bacteria 4251
837 Ga0207640_10042013 3300025981 Bacteria 2912
838 Ga0207640_10058017 3300025981 Bacteria 2549
839 Ga0207658_10000535 3300025986 Bacteria 34617
840 Ga0207658_10059229 3300025986 Bacteria 2853
841 Ga0207658_10144152 3300025986 Bacteria 1932
842 Ga0207677_10000806 3300026023 Bacteria 17984
843 Ga0207677_10075864 3300026023 Bacteria 2391
844 Ga0207703_10001617 3300026035 Bacteria 20325
845 Ga0207703_10003074 3300026035 Bacteria 14117
846 Ga0207703_10012070 3300026035 Bacteria 6731
847 Ga0207703_10097783 3300026035 Bacteria 2481
848 Ga0207639_10002809 3300026041 Bacteria 11682
849 Ga0207639_10009638 3300026041 Bacteria 6672
850 Ga0207639_10009726 3300026041 Bacteria 6640
851 Ga0207639_10010472 3300026041 Bacteria 6423
852 Ga0207639_10019773 3300026041 Bacteria 4809
853 Ga0207639_10237420 3300026041 Bacteria 1583
854 Ga0207678_10001859 3300026067 Bacteria 19293
855 Ga0207678_10016738 3300026067 Bacteria 6439
856 Ga0207678_10054411 3300026067 Bacteria 3447
857 Ga0207678_10109849 3300026067 Bacteria 2352
858 Ga0207708_10001031 3300026075 Bacteria 20855
859 Ga0207708_10018880 3300026075 Bacteria 5194
860 Ga0207708_10019057 3300026075 Bacteria 5167
861 Ga0207708_10104329 3300026075 Bacteria 2196
862 Ga0207708_10150977 3300026075 Bacteria 1829
863 Ga0207702_10000003 3300026078 Bacteria 434196
864 Ga0207702_10000041 3300026078 Bacteria 150754
865 Ga0207702_10003065 3300026078 Bacteria 15534
866 Ga0207641_10000593 3300026088 Bacteria 39825
867 Ga0207641_10019300 3300026088 Bacteria 5594
868 Ga0207648_10002417 3300026089 Bacteria 20105
869 Ga0207648_10013629 3300026089 Bacteria 7547
870 Ga0207676_10009283 3300026095 Bacteria 6997
871 Ga0207676_10011206 3300026095 Bacteria 6403
872 Ga0207676_10011983 3300026095 Bacteria 6205
873 Ga0207674_10003381 3300026116 Bacteria 19581
874 Ga0207674_10004756 3300026116 Bacteria 16280
875 Ga0207674_10026464 3300026116 Bacteria 6159
876 Ga0207674_10031482 3300026116 Bacteria 5573
877 Ga0207674_10165937 3300026116 Bacteria 2162
878 Ga0207675_100002182 3300026118 Bacteria 19438
879 Ga0207675_100029789 3300026118 Bacteria 5082
880 Ga0207675_100033143 3300026118 Bacteria 4813
881 Ga0207675_100038306 3300026118 Bacteria 4474
882 Ga0207683_10000002 3300026121 Bacteria 258441
883 Ga0207683_10006919 3300026121 Bacteria 9710
884 Ga0207683_10041959 3300026121 Bacteria 3996
885 Ga0207683_10042740 3300026121 Bacteria 3959
886 Ga0207683_10072340 3300026121 Bacteria 3049
887 Ga0207698_10000545 3300026142 Bacteria 21874
888 Ga0207698_10004110 3300026142 Bacteria 8839
889 Ga0207698_10021924 3300026142 Bacteria 4427
890 Ga0207698_10054008 3300026142 Bacteria 3088
891 Ga0207698_10214656 3300026142 Bacteria 1734
892 Ga0209281_1000106 3300027111 Bacteria 219666
893 Ga0209281_1000318 3300027111 Bacteria 85039
894 Ga0209389_1000004 3300027296 Bacteria 263759
895 Ga0209389_1000023 3300027296 Bacteria 150730
896 Ga0209371_1000022 3300027312 Bacteria 536342
897 Ga0209371_1001019 3300027312 Bacteria 21271
898 Ga0209371_1004133 3300027312 Bacteria 6511
899 Ga0209589_1000006 3300027357 Bacteria 436292
900 Ga0209589_1000010 3300027357 Bacteria 237657
901 Ga0209489_100007 3300027361 Bacteria 436292
902 Ga0209489_100011 3300027361 Bacteria 244710
903 Ga0209489_100295 3300027361 Bacteria 87273
904 Ga0209700_100008 3300027363 Bacteria 436292
905 Ga0209700_100013 3300027363 Bacteria 341906
906 Ga0209179_1002939 3300027512 Bacteria 2382
907 Ga0209282_1000024 3300027666 Bacteria 170348
908 Ga0209282_1000531 3300027666 Bacteria 18489
909 Ga0209966_1000800 3300027695 Bacteria 6283
910 Ga0209966_1004060 3300027695 Bacteria 2472
911 Ga0209998_10015195 3300027717 Bacteria 1610
912 Ga0209813_10002584 3300027866 Bacteria 4157
913 Ga0209813_10032067 3300027866 Bacteria 1555
914 Ga0209974_10000944 3300027876 Bacteria 10160
915 Ga0209974_10009960 3300027876 Bacteria 3215
916 Ga0207428_10000011 3300027907 Bacteria 354388
917 Ga0207428_10000046 3300027907 Bacteria 191032
918 Ga0207428_10000058 3300027907 Bacteria 158579
919 Ga0207428_10001276 3300027907 Bacteria 26949
920 Ga0207428_10032257 3300027907 Bacteria 4310
921 Ga0268266_10004900 3300028379 Bacteria 12695
922 Ga0268266_10006027 3300028379 Bacteria 11179
923 Ga0268266_10008843 3300028379 Bacteria 8918
924 Ga0268266_10013893 3300028379 Bacteria 6934
925 Ga0268266_10019605 3300028379 Bacteria 5762
926 Ga0268266_10039703 3300028379 Bacteria 4009
927 Ga0268266_10124277 3300028379 Bacteria 2300
928 Ga0268265_10010132 3300028380 Bacteria 6365
929 Ga0268265_10011194 3300028380 Bacteria 6062
930 Ga0268265_10060191 3300028380 Bacteria 2909
931 Ga0268265_10232093 3300028380 Bacteria 1622
932 Ga0268264_10000093 3300028381 Bacteria 232057
933 Ga0268264_10000340 3300028381 Bacteria 71850
934 Ga0268264_10013402 3300028381 Bacteria 6748
935 Ga0268264_10016659 3300028381 Bacteria 6018
936 Ga0268264_10102505 3300028381 Bacteria 2490
937 Ga0268264_10140599 3300028381 Bacteria 2152
938 Ga0265336_10005296 3300028666 Bacteria 4775
939 Ga0307517_10000085 3300028786 Bacteria 131200
940 Ga0307517_10098343 3300028786 Bacteria 2329
941 Ga0307515_10001978 3300028794 Bacteria 45366
942 Ga0307515_10007368 3300028794 Bacteria 21770
943 Ga0307515_10030752 3300028794 Bacteria 8997
944 Ga0307515_10039862 3300028794 Bacteria 7450
945 Ga0265338_10000328 3300028800 Bacteria 86546
946 Ga0265338_10030731 3300028800 Bacteria 5281
947 Ga0265338_10033564 3300028800 Bacteria 4977
948 Ga0268256_1000019 3300030500 Bacteria 587949
949 Ga0268256_1003875 3300030500 Bacteria 6511
950 Ga0268256_1016593 3300030500 Bacteria 2103
951 Ga0307511_10057782 3300030521 Bacteria 3010
952 Ga0265330_10016569 3300031235 Bacteria 3399
953 Ga0265330_10034309 3300031235 Bacteria 2267
954 Ga0265332_10011026 3300031238 Bacteria 4016
955 Ga0265328_10000047 3300031239 Bacteria 80006
956 Ga0265328_10004803 3300031239 Bacteria 5836
957 Ga0265328_10011003 3300031239 Bacteria 3627
958 Ga0265320_10000209 3300031240 Bacteria 47757
959 Ga0265320_10028632 3300031240 Bacteria 2890
960 Ga0265325_10000117 3300031241 Bacteria 54546
961 Ga0265325_10000855 3300031241 Bacteria 21943
962 Ga0265325_10005212 3300031241 Bacteria 8068
963 Ga0265325_10011412 3300031241 Bacteria 5106
964 Ga0265325_10013215 3300031241 Bacteria 4704
965 Ga0265325_10036991 3300031241 Bacteria 2582
966 Ga0265325_10046783 3300031241 Bacteria 2242
967 Ga0265329_10036621 3300031242 Bacteria 1581
968 Ga0265340_10002779 3300031247 Bacteria 9978
969 Ga0265340_10006860 3300031247 Bacteria 6227
970 Ga0265340_10007603 3300031247 Bacteria 5880
971 Ga0265340_10008228 3300031247 Bacteria 5636
972 Ga0265340_10009498 3300031247 Bacteria 5218
973 Ga0265340_10017347 3300031247 Bacteria 3723
974 Ga0265339_10000084 3300031249 Bacteria 80035
975 Ga0265339_10000450 3300031249 Bacteria 32195
976 Ga0265339_10021175 3300031249 Bacteria 3788
977 Ga0265331_10000707 3300031250 Bacteria 28439
978 Ga0265331_10013005 3300031250 Bacteria 4485
979 Ga0265331_10014674 3300031250 Bacteria 4163
980 Ga0265327_10015402 3300031251 Bacteria 4938
981 Ga0265316_10002618 3300031344 Bacteria 18560
982 Ga0307513_10010539 3300031456 Bacteria 11570
983 Ga0307513_10077997 3300031456 Bacteria 3428
984 Ga0307513_10082118 3300031456 Bacteria 3319
985 Ga0307513_10228700 3300031456 Bacteria 1674
986 Ga0307408_100056480 3300031548 Bacteria 2847
987 Ga0307408_100145955 3300031548 Bacteria 1862
988 Ga0265313_10000242 3300031595 Bacteria 59524
989 Ga0265313_10000340 3300031595 Bacteria 50703
990 Ga0265313_10005463 3300031595 Bacteria 9345
991 Ga0265313_10009155 3300031595 Bacteria 6462
992 Ga0265313_10064921 3300031595 Bacteria 1696
993 Ga0307508_10000034 3300031616 Bacteria 160115
994 Ga0307508_10047091 3300031616 Bacteria 3847
995 Ga0307508_10057194 3300031616 Bacteria 3451
996 Ga0316579_10007101 3300031691 Bacteria 4609
997 Ga0265314_10001245 3300031711 Bacteria 29069
998 Ga0265314_10005302 3300031711 Bacteria 11664
999 Ga0265314_10067583 3300031711 Bacteria 2406
1000 Ga0265342_10000211 3300031712 Bacteria 65440
1001 Ga0265342_10006824 3300031712 Bacteria 8440
1002 Ga0265342_10009227 3300031712 Bacteria 6978
1003 Ga0265342_10022614 3300031712 Bacteria 3994
1004 Ga0265342_10076179 3300031712 Bacteria 1945
1005 Ga0307405_10067890 3300031731 Bacteria 2280
1006 Ga0307413_10046953 3300031824 Bacteria 2572
1007 Ga0307406_10092557 3300031901 Bacteria 2039
1008 Ga0315914_1000012 3300031967 Bacteria 169896
1009 Ga0307409_100020095 3300031995 Bacteria 4543
1010 Ga0307409_100057238 3300031995 Bacteria 3020
1011 Ga0307414_10058321 3300032004 Bacteria 2719
1012 Ga0307415_100156342 3300032126 Bacteria 1761
1013 Ga0316583_10002698 3300032133 Bacteria 6201
1014 Ga0307510_10004348 3300033180 Bacteria 16677
1015 Ga0307510_10036621 3300033180 Bacteria 5458
1016 Ga0315913_1000006 3300033430 Bacteria 169893
1017 Ga0315911_1000010 3300033442 Bacteria 322197
1018 Ga0315915_1000010 3300033464 Bacteria 240214
1019 Ga0373930_0003116 3300034816 Bacteria 2611
1020 Ga0373930_0010266 3300034816 Bacteria 1671
1021 Ga0373948_0000885 3300034817 Bacteria 3992
1022 Ga0373948_0010641 3300034817 Bacteria 1611
1023 Ga0373950_0001808 3300034818 Bacteria 2854
1024 Ga0373950_0002959 3300034818 Bacteria 2392
1025 Ga0373958_0000097 3300034819 Bacteria 9234
1026 Ga0373959_0000831 3300034820 Bacteria 5274
1027 Ga0373938_0000032 3300034957 Bacteria 17872
1028 Ga0373938_0000454 3300034957 Bacteria 6672
1029 Ga0373938_0005302 3300034957 Bacteria 2189
1030 Ga0373926_0004868 3300035083 Bacteria 4412
1031 Ga0373926_0012760 3300035083 Bacteria 2844
1032 Ga0373929_0001755 3300035085 Bacteria 4076
1033 Ga0373929_0003006 3300035085 Bacteria 3069
1034 Ga0373934_0037578 3300035086 Bacteria 1906
1035 Ga0373949_0001084 3300035090 Bacteria 8306
1036 Ga0373951_0000472 3300035091 Bacteria 11551
1037 Ga0373951_0002239 3300035091 Bacteria 4918
1038 Ga0373952_0000675 3300035092 Bacteria 6046
1039 Ga0373952_0000857 3300035092 Bacteria 5529
1040 Ga0373923_0001236 3300035111 Bacteria 7167
1041 Ga0373923_0002149 3300035111 Bacteria 5975
1042 Ga0373932_0000180 3300035112 Bacteria 18517
1043 Ga0373932_0004968 3300035112 Bacteria 3129
1044 Ga0373936_0005755 3300035113 Bacteria 4673
1045 Ga0373936_0016254 3300035113 Bacteria 2862
1046 Ga0373936_0020061 3300035113 Bacteria 2594
1047 Ga0373939_0000151 3300035114 Bacteria 19559
1048 Ga0373939_0001404 3300035114 Bacteria 5839
1049 Ga0373941_0001811 3300035115 Bacteria 4599
1050 Ga0373941_0002963 3300035115 Bacteria 3797
1051 Ga0373941_0003543 3300035115 Bacteria 3546
1052 Ga0373945_0001892 3300035116 Bacteria 6491
1053 Ga0373945_0014158 3300035116 Bacteria 2668
1054 Ga0373953_0001359 3300035117 Bacteria 7040
1055 Ga0373953_0001859 3300035117 Bacteria 6251
1056 Ga0373954_0001664 3300035118 Bacteria 9102
1057 Ga0373954_0002584 3300035118 Bacteria 7606
1058 Ga0373954_0004556 3300035118 Bacteria 5968
1059 Ga0373954_0023646 3300035118 Bacteria 2796
1060 Ga0373954_0054205 3300035118 Bacteria 1885
1061 Ga0373954_0056759 3300035118 Bacteria 1843
1062 Ga0373956_0034829 3300035119 Bacteria 2218
1063 Ga0373957_0001068 3300035120 Bacteria 7227
1064 Ga0373957_0015263 3300035120 Bacteria 2641
1065 Ga0373960_0000184 3300035121 Bacteria 11160
1066 Ga0373960_0003038 3300035121 Bacteria 3788
1067 Ga0373943_0000072 3300035170 Bacteria 35413
1068 Ga0373943_0006580 3300035170 Bacteria 5212
1069 Ga0373943_0007994 3300035170 Bacteria 4747
1070 Ga0373943_0024755 3300035170 Bacteria 2802
1071 Ga0373943_0046399 3300035170 Bacteria 2120
1072 Ga0373946_0009681 3300035171 Bacteria 3556
1073 Ga0373946_0012729 3300035171 Bacteria 3153
1074 Ga0373946_0035330 3300035171 Bacteria 2022
1075 Ga0373955_0000880 3300035172 Bacteria 12889
1076 Ga0373955_0004332 3300035172 Bacteria 6275
1077 Ga0373955_0006574 3300035172 Bacteria 5302
1078 Ga0373955_0014225 3300035172 Bacteria 3865
1079 Ga0373955_0050101 3300035172 Bacteria 2270
1080 Ga0373955_0054012 3300035172 Bacteria 2195
1081 Ga0373955_0059876 3300035172 Bacteria 2098
1082 Ga0373942_0000288 3300035207 Bacteria 13666
1083 Ga0373942_0005465 3300035207 Bacteria 2947
1084 Ga0373961_0003973 3300035241 Bacteria 3608
1085 Ga0373962_0000113 3300035242 Bacteria 16882
1086 Ga0373962_0000606 3300035242 Bacteria 8091
1087 Ga0373962_0002013 3300035242 Bacteria 4842
1088 Ga0316574_0001675 3300035398 Bacteria 10688
1089 Ga0373924_0002398 3300035410 Bacteria 6306
1090 Ga0373924_0006697 3300035410 Bacteria 4137
1091 Ga0373924_0007407 3300035410 Bacteria 3963
1092 Ga0373931_0000290 3300035691 Bacteria 21067
1093 Ga0373931_0004295 3300035691 Bacteria 6492
1094 Ga0373931_0009129 3300035691 Bacteria 4732
1095 Ga0373931_0053672 3300035691 Bacteria 2151
1096 Ga0373935_0000185 3300035692 Bacteria 29355
1097 Ga0373935_0000259 3300035692 Bacteria 26229
1098 Ga0373935_0007559 3300035692 Bacteria 6506
1099 Ga0373935_0010080 3300035692 Bacteria 5660
1100 Ga0373935_0015153 3300035692 Bacteria 4658
1101 Ga0373935_0018309 3300035692 Bacteria 4258
1102 Ga0373935_0023830 3300035692 Bacteria 3760
1103 Ga0373935_0032229 3300035692 Bacteria 3255
1104 Ga0373935_0035977 3300035692 Bacteria 3093
1105 Ga0373935_0046704 3300035692 Bacteria 2736
1106 Ga0373935_0111083 3300035692 Bacteria 1820
1107 Ga0373927_0000350 3300035695 Bacteria 36173
1108 Ga0373927_0002379 3300035695 Bacteria 13707
1109 Ga0373927_0005383 3300035695 Bacteria 8840
1110 Ga0373927_0009651 3300035695 Bacteria 6471
1111 Ga0373927_0012786 3300035695 Bacteria 5584
1112 Ga0373927_0016655 3300035695 Bacteria 4849
1113 Ga0373927_0040366 3300035695 Bacteria 3027
1114 Ga0373927_0085954 3300035695 Bacteria 2041
1115 Ga0373927_0095089 3300035695 Bacteria 1936
1116 Ga0373933_0000672 3300035724 Bacteria 21195
1117 Ga0373933_0001150 3300035724 Bacteria 15688
1118 Ga0373933_0002191 3300035724 Bacteria 11169
1119 Ga0373933_0008994 3300035724 Bacteria 5449
1120 Ga0373933_0015628 3300035724 Bacteria 4233
1121 Ga0373947_0000217 3300035725 Bacteria 32254
1122 Ga0373947_0002658 3300035725 Bacteria 10739
1123 Ga0373947_0010938 3300035725 Bacteria 5211
1124 Ga0373947_0012207 3300035725 Bacteria 4919
1125 Ga0373947_0012703 3300035725 Bacteria 4828
1126 Ga0373947_0013046 3300035725 Bacteria 4764
1127 Ga0373947_0025550 3300035725 Bacteria 3445
1128 Ga0373947_0060565 3300035725 Bacteria 2299
1129 Ga0373947_0073931 3300035725 Bacteria 2096
1130 Ga0373937_0000068 3300036401 Bacteria 94138
1131 Ga0373937_0003441 3300036401 Bacteria 13290
1132 Ga0373937_0005533 3300036401 Bacteria 10832
1133 Ga0373937_0006578 3300036401 Bacteria 10035
1134 Ga0373937_0019412 3300036401 Bacteria 6084
1135 Ga0373937_0022213 3300036401 Bacteria 5702
1136 Ga0373937_0022578 3300036401 Bacteria 5660
1137 Ga0373937_0048658 3300036401 Bacteria 3882
1138 Ga0373937_0051281 3300036401 Bacteria 3782
1139 Ga0373937_0062102 3300036401 Bacteria 3434
1140 Ga0373937_0154886 3300036401 Bacteria 2147
1141 Ga0373937_0160985 3300036401 Bacteria 2104
1142 Ga0316584_0000295 3300036712 Bacteria 25457
1143 Ga0373925_0002114 3300037068 Bacteria 16302
1144 Ga0373925_0002364 3300037068 Bacteria 15132
1145 Ga0373925_0004501 3300037068 Bacteria 10530
1146 Ga0373925_0012856 3300037068 Bacteria 6063
1147 Ga0373925_0026107 3300037068 Bacteria 4272
1148 Ga0373925_0027981 3300037068 Bacteria 4128
1149 Ga0373925_0032521 3300037068 Bacteria 3840
1150 Ga0373925_0032858 3300037068 Bacteria 3821
1151 Ga0373925_0045644 3300037068 Bacteria 3255
1152 Ga0373925_0055362 3300037068 Bacteria 2969
1153 Ga0373925_0109575 3300037068 Bacteria 2131
1154 Ga0373925_0144718 3300037068 Bacteria 1862
1155 Ga0395899_0011711 3300037312 Bacteria 6714
1156 Ga0395900_0001924 3300037418 Bacteria 23564
1157 Ga0395900_0002400 3300037418 Bacteria 20663
1158 Ga0395900_0006327 3300037418 Bacteria 12346
1159 Ga0395900_0070134 3300037418 Bacteria 3603
1160 Ga0395900_0086570 3300037418 Bacteria 3220
1161 Ga0395898_0007812 3300037466 Bacteria 11355
1162 Ga0395898_0020243 3300037466 Bacteria 6760
1163 Ga0395905_0019046 3300037471 Bacteria 6510
1164 Ga0436364_0351366 3300037853 Bacteria 1852
1165 Ga0436364_0387248 3300037853 Bacteria 1942
1166 Ga0436364_0578778 3300037853 Bacteria 5418
1167 Ga0436364_0719813 3300037853 Bacteria 2276
1168 Ga0436364_0789056 3300037853 Bacteria 7649
1169 Ga0395901_0015985 3300038443 Bacteria 7647
1170 Ga0395901_0021552 3300038443 Bacteria 6602
1171 Ga0395901_0116262 3300038443 Bacteria 2809
1172 Ga0395901_0142816 3300038443 Bacteria 2516
1173 Ga0395901_0161217 3300038443 Bacteria 2355
1174 Ga0436365_0141715 3300039437 Bacteria 19847
1175 Ga0436365_0179847 3300039437 Bacteria 5225
1176 Ga0436365_0247802 3300039437 Bacteria 15036
1177 Ga0436365_1010704 3300039437 Bacteria 15340
1178 Ga0436365_1100914 3300039437 Bacteria 2111
1179 Ga0436365_1359797 3300039437 Bacteria 1773
1180 Ga0436365_1926106 3300039437 Bacteria 2812
1181 Ga0436360_0147860 3300039438 Bacteria 2430
1182 Ga0436360_0973324 3300039438 Bacteria 3801
1183 Ga0436361_0343104 3300039447 Bacteria 1713
1184 Ga0436361_0532916 3300039447 Bacteria 1816
1185 Ga0436361_1025841 3300039447 Bacteria 1837
1186 Ga0436361_1121961 3300039447 Bacteria 4323
1187 Ga0436363_0405250 3300039450 Bacteria 18420
1188 Ga0436363_0602817 3300039450 Bacteria 3182
1189 Ga0436363_0693856 3300039450 Bacteria 1677
1190 Ga0436362_0646134 3300039453 Bacteria 7178
1191 Ga0436362_1096230 3300039453 Bacteria 18621
1192 Ga0451787_254401 3300041441 Bacteria 2856
1193 Ga0451833_0066605 3300041491 Bacteria 3916
1194 Ga0451851_1088920 3300041507 Bacteria 2685
1195 Ga0451843_0599573 3300041509 Bacteria 1959
1196 Ga0439449_0005174 3300042007 Bacteria 5009
1197 Ga0450920_001623 3300042122 Bacteria 3754
1198 Ga0450906_003061 3300042145 Bacteria 3623
1199 Ga0466972_0000520 3300044658 Bacteria 19029
1200 Ga0466972_0004454 3300044658 Bacteria 7005
1201 Ga0466961_0000149 3300044693 Bacteria 47561
1202 Ga0466963_0006409 3300044694 Bacteria 6961
1203 Ga0466963_0006941 3300044694 Bacteria 6737
1204 Ga0466963_0073365 3300044694 Bacteria 2307
1205 Ga0466968_0003374 3300044735 Bacteria 5902
1206 Ga0466968_0026660 3300044735 Bacteria 2373
1207 Ga0466957_0017500 3300044842 Bacteria 4199
1208 Ga0466957_0049612 3300044842 Bacteria 2552
1209 Ga0466957_0050773 3300044842 Bacteria 2524
1210 Ga0466960_0053233 3300044901 Bacteria 1961
1211 Ga0466959_0004087 3300045049 Bacteria 9713
1212 Ga0466959_0026291 3300045049 Bacteria 4314
1213 Ga0466959_0083136 3300045049 Bacteria 2306
1214 Ga0451576_0145916 3300045051 Bacteria 2467
1215 Ga0466958_0005656 3300045836 Bacteria 6750
1216 Ga0466967_0022781 3300045976 Bacteria 5120
1217 Ga0466967_0040762 3300045976 Bacteria 3999
1218 Ga0466967_0073074 3300045976 Bacteria 3076
1219 Ga0495592_0000488 3300046454 Bacteria 28883
1220 Ga0495592_0001276 3300046454 Bacteria 17453
1221 Ga0495592_0008207 3300046454 Bacteria 7841
1222 Ga0495592_0013719 3300046454 Bacteria 6163
1223 Ga0495592_0029636 3300046454 Bacteria 4143
1224 Ga0495592_0035414 3300046454 Bacteria 3761
1225 Ga0495592_0076319 3300046454 Bacteria 2432
1226 Ga0495603_0000352 3300046455 Bacteria 24722
1227 Ga0495603_0019849 3300046455 Bacteria 4070
1228 Ga0495603_0142376 3300046455 Bacteria 1394
1229 Ga0495629_0001536 3300046459 Bacteria 18162
1230 Ga0495629_0002961 3300046459 Bacteria 12929
1231 Ga0495629_0003719 3300046459 Bacteria 11498
1232 Ga0495629_0006765 3300046459 Bacteria 8473
1233 Ga0495629_0011224 3300046459 Bacteria 6505
1234 Ga0495629_0017083 3300046459 Bacteria 5204
1235 Ga0495629_0035281 3300046459 Bacteria 3534
1236 Ga0495629_0047563 3300046459 Bacteria 3009
1237 Ga0495638_0014321 3300046460 Bacteria 5367
1238 Ga0495638_0018200 3300046460 Bacteria 4668
1239 Ga0495641_0005001 3300046461 Bacteria 9146
1240 Ga0495641_0006337 3300046461 Bacteria 7689
1241 Ga0495641_0010439 3300046461 Bacteria 5383
1242 Ga0495641_0041907 3300046461 Bacteria 2125
1243 Ga0495651_0000655 3300046462 Bacteria 26780
1244 Ga0495651_0001053 3300046462 Bacteria 21347
1245 Ga0495651_0002415 3300046462 Bacteria 14429
1246 Ga0495651_0006660 3300046462 Bacteria 8831
1247 Ga0495651_0008150 3300046462 Bacteria 8034
1248 Ga0495651_0009605 3300046462 Bacteria 7433
1249 Ga0495651_0028771 3300046462 Bacteria 4331
1250 Ga0495651_0063230 3300046462 Bacteria 2829
1251 Ga0495653_0000199 3300046463 Bacteria 48763
1252 Ga0495653_0002222 3300046463 Bacteria 15345
1253 Ga0495653_0002829 3300046463 Bacteria 13841
1254 Ga0495653_0012753 3300046463 Bacteria 6862
1255 Ga0495653_0024422 3300046463 Bacteria 4871
1256 Ga0495653_0025837 3300046463 Bacteria 4712
1257 Ga0495653_0041780 3300046463 Bacteria 3577
1258 Ga0495653_0071890 3300046463 Bacteria 2585
1259 Ga0495580_0083053 3300046472 Bacteria 2232
1260 Ga0495582_0000245 3300046473 Bacteria 30263
1261 Ga0495582_0001755 3300046473 Bacteria 12244
1262 Ga0495582_0017971 3300046473 Bacteria 3865
1263 Ga0495582_0024440 3300046473 Bacteria 3306
1264 Ga0495605_0001952 3300046474 Bacteria 13095
1265 Ga0495639_0002472 3300046475 Bacteria 8065
1266 Ga0495639_0015671 3300046475 Bacteria 3287
1267 Ga0495639_0056596 3300046475 Bacteria 1790
1268 Ga0495662_0000872 3300046476 Bacteria 14723
1269 Ga0495662_0001370 3300046476 Bacteria 12055
1270 Ga0495662_0009090 3300046476 Bacteria 4877
1271 Ga0495662_0034272 3300046476 Bacteria 2451
1272 Ga0495662_0088210 3300046476 Bacteria 1511
1273 Ga0495664_0000105 3300046477 Bacteria 41914
1274 Ga0495664_0000848 3300046477 Bacteria 15717
1275 Ga0495664_0002940 3300046477 Bacteria 9201
1276 Ga0495664_0004666 3300046477 Bacteria 7494
1277 Ga0495664_0013868 3300046477 Bacteria 4570
1278 Ga0495664_0019650 3300046477 Bacteria 3887
1279 Ga0495664_0041648 3300046477 Bacteria 2718
1280 Ga0495584_0010859 3300046491 Bacteria 4674
1281 Ga0495584_0055575 3300046491 Bacteria 1992
1282 Ga0495585_0015360 3300046492 Bacteria 4449
1283 Ga0495585_0021569 3300046492 Bacteria 3698
1284 Ga0495585_0050268 3300046492 Bacteria 2313
1285 Ga0495596_0049656 3300046500 Bacteria 1645
1286 Ga0495607_0046374 3300046501 Bacteria 2553
1287 Ga0495607_0058102 3300046501 Bacteria 2214
1288 Ga0495608_0000020 3300046511 Bacteria 169036
1289 Ga0495608_0005839 3300046511 Bacteria 8764
1290 Ga0495608_0006424 3300046511 Bacteria 8349
1291 Ga0495608_0015143 3300046511 Bacteria 5350
1292 Ga0495608_0019409 3300046511 Bacteria 4678
1293 Ga0495608_0025279 3300046511 Bacteria 4053
1294 Ga0495608_0041347 3300046511 Bacteria 3085
1295 Ga0495608_0044765 3300046511 Bacteria 2953
1296 Ga0495608_0063772 3300046511 Bacteria 2417
1297 Ga0495610_0012085 3300046512 Bacteria 5221
1298 Ga0495610_0078313 3300046512 Bacteria 1524
1299 Ga0495616_0035673 3300046513 Bacteria 2571
1300 Ga0495618_0001074 3300046514 Bacteria 18661
1301 Ga0495618_0009256 3300046514 Bacteria 5944
1302 Ga0495618_0014797 3300046514 Bacteria 4759
1303 Ga0495618_0039877 3300046514 Bacteria 2953
1304 Ga0495618_0049512 3300046514 Bacteria 2653
1305 Ga0495620_0020509 3300046515 Bacteria 3227
1306 Ga0495628_0000005 3300046516 Bacteria 420969
1307 Ga0495628_0003193 3300046516 Bacteria 14701
1308 Ga0495628_0005097 3300046516 Bacteria 11546
1309 Ga0495628_0019614 3300046516 Bacteria 5586
1310 Ga0495628_0052582 3300046516 Bacteria 3217
1311 Ga0495628_0058839 3300046516 Bacteria 3019
1312 Ga0495630_0001784 3300046517 Bacteria 15054
1313 Ga0495630_0043306 3300046517 Bacteria 3362
1314 Ga0495630_0043308 3300046517 Bacteria 3362
1315 Ga0495630_0060622 3300046517 Bacteria 2840
1316 Ga0495631_0064912 3300046518 Bacteria 1580
1317 Ga0495643_0002725 3300046522 Bacteria 13593
1318 Ga0495644_0003283 3300046523 Bacteria 6397
1319 Ga0495648_0001680 3300046524 Bacteria 21407
1320 Ga0495648_0044051 3300046524 Bacteria 2789
1321 Ga0495666_0015592 3300046526 Bacteria 3783
1322 Ga0495666_0068918 3300046526 Bacteria 1683
1323 Ga0495652_0000001 3300046529 Bacteria 1045081
1324 Ga0495652_0001783 3300046529 Bacteria 23000
1325 Ga0495652_0007926 3300046529 Bacteria 9749
1326 Ga0495652_0010443 3300046529 Bacteria 8413
1327 Ga0495652_0036021 3300046529 Bacteria 4304
1328 Ga0495652_0036122 3300046529 Bacteria 4297
1329 Ga0495652_0101270 3300046529 Bacteria 2335
1330 Ga0495665_0000361 3300046531 Bacteria 22971
1331 Ga0495665_0016782 3300046531 Bacteria 3942
1332 Ga0495665_0023775 3300046531 Bacteria 3292
1333 Ga0495640_0000027 3300046533 Bacteria 90638
1334 Ga0495640_0002916 3300046533 Bacteria 13760
1335 Ga0495640_0003002 3300046533 Bacteria 13580
1336 Ga0495640_0008459 3300046533 Bacteria 8070
1337 Ga0495640_0008740 3300046533 Bacteria 7936
1338 Ga0495640_0010157 3300046533 Bacteria 7294
1339 Ga0495640_0017400 3300046533 Bacteria 5359
1340 Ga0495640_0018229 3300046533 Bacteria 5214
1341 Ga0495640_0034231 3300046533 Bacteria 3604
1342 Ga0495586_0013373 3300046535 Bacteria 4352
1343 Ga0495587_0000017 3300046536 Bacteria 172923
1344 Ga0495587_0001634 3300046536 Bacteria 14937
1345 Ga0495587_0004533 3300046536 Bacteria 9126
1346 Ga0495587_0011251 3300046536 Bacteria 5673
1347 Ga0495587_0017008 3300046536 Bacteria 4521
1348 Ga0495587_0018218 3300046536 Bacteria 4355
1349 Ga0495587_0059072 3300046536 Bacteria 2252
1350 Ga0495587_0117126 3300046536 Bacteria 1527
1351 Ga0495598_0000989 3300046537 Bacteria 5474
1352 Ga0495645_0000212 3300046543 Bacteria 41774
1353 Ga0495645_0001744 3300046543 Bacteria 14776
1354 Ga0495645_0020761 3300046543 Bacteria 4744
1355 Ga0495645_0023607 3300046543 Bacteria 4455
1356 Ga0495645_0031817 3300046543 Bacteria 3845
1357 Ga0495645_0055550 3300046543 Bacteria 2875
1358 Ga0495645_0140832 3300046543 Bacteria 1683
1359 Ga0495622_0006317 3300046557 Bacteria 5501
1360 Ga0495633_0012648 3300046558 Bacteria 4479
1361 Ga0495633_0016697 3300046558 Bacteria 3778
1362 Ga0495633_0042755 3300046558 Bacteria 2151
1363 Ga0495667_0000031 3300046559 Bacteria 147377
1364 Ga0495667_0002154 3300046559 Bacteria 13133
1365 Ga0495667_0005829 3300046559 Bacteria 8350
1366 Ga0495667_0008100 3300046559 Bacteria 7132
1367 Ga0495667_0008220 3300046559 Bacteria 7081
1368 Ga0495667_0012248 3300046559 Bacteria 5812
1369 Ga0495667_0017063 3300046559 Bacteria 4903
1370 Ga0495656_0000812 3300046615 Bacteria 10072
1371 Ga0495656_0017683 3300046615 Bacteria 2724
1372 Ga0495656_0039808 3300046615 Bacteria 1955
1373 Ga0495668_0020542 3300046616 Bacteria 3797
1374 Ga0495668_0101055 3300046616 Bacteria 1578
1375 Ga0495634_0000006 3300046642 Bacteria 172775
1376 Ga0495634_0000249 3300046642 Bacteria 50835
1377 Ga0495634_0004120 3300046642 Bacteria 11513
1378 Ga0495634_0019062 3300046642 Bacteria 4877
1379 Ga0495634_0102277 3300046642 Bacteria 1850
1380 Ga0495611_0006846 3300046648 Bacteria 4844
1381 Ga0495635_0000154 3300046663 Bacteria 41886
1382 Ga0495635_0000239 3300046663 Bacteria 34889
1383 Ga0495635_0000681 3300046663 Bacteria 21881
1384 Ga0495635_0001492 3300046663 Bacteria 15672
1385 Ga0495635_0003846 3300046663 Bacteria 10429
1386 Ga0495635_0014377 3300046663 Bacteria 5536
1387 Ga0495635_0019133 3300046663 Bacteria 4778
1388 Ga0495635_0031183 3300046663 Bacteria 3703
1389 Ga0495635_0037865 3300046663 Bacteria 3339
1390 Ga0495635_0055286 3300046663 Bacteria 2734
1391 Ga0495635_0082315 3300046663 Bacteria 2202
1392 Ga0495659_0021922 3300046664 Bacteria 2156
1393 Ga0495661_0031412 3300046665 Bacteria 3371
1394 Ga0495588_0002364 3300046674 Bacteria 8071
1395 Ga0495588_0014080 3300046674 Bacteria 3823
1396 Ga0495588_0051178 3300046674 Bacteria 2127
1397 Ga0495588_0098105 3300046674 Bacteria 1538
1398 Ga0495657_0000828 3300046675 Bacteria 27353
1399 Ga0495657_0003492 3300046675 Bacteria 12822
1400 Ga0495657_0004137 3300046675 Bacteria 11618
1401 Ga0495657_0006927 3300046675 Bacteria 8808
1402 Ga0495657_0009432 3300046675 Bacteria 7395
1403 Ga0495657_0137070 3300046675 Bacteria 1528
1404 Ga0495599_0000051 3300046678 Bacteria 81853
1405 Ga0495599_0001556 3300046678 Bacteria 13209
1406 Ga0495599_0001605 3300046678 Bacteria 13038
1407 Ga0495599_0008411 3300046678 Bacteria 6272
1408 Ga0495599_0009208 3300046678 Bacteria 6026
1409 Ga0495599_0021267 3300046678 Bacteria 4047
1410 Ga0495599_0025691 3300046678 Bacteria 3688
1411 Ga0495623_0001078 3300046679 Bacteria 18463
1412 Ga0495623_0002296 3300046679 Bacteria 12741
1413 Ga0495623_0004017 3300046679 Bacteria 9681
1414 Ga0495623_0005074 3300046679 Bacteria 8634
1415 Ga0495623_0009107 3300046679 Bacteria 6440
1416 Ga0495623_0010478 3300046679 Bacteria 6000
1417 Ga0495623_0034442 3300046679 Bacteria 3247
1418 Ga0495646_0000102 3300046680 Bacteria 41798
1419 Ga0495646_0001918 3300046680 Bacteria 12509
1420 Ga0495646_0004146 3300046680 Bacteria 9100
1421 Ga0495646_0005453 3300046680 Bacteria 8043
1422 Ga0495646_0011250 3300046680 Bacteria 5683
1423 Ga0495646_0040366 3300046680 Bacteria 2875
1424 Ga0495647_0001979 3300046681 Bacteria 6401
1425 Ga0495658_0001058 3300046683 Bacteria 14532
1426 Ga0495658_0019298 3300046683 Bacteria 3556
1427 Ga0495658_0046436 3300046683 Bacteria 2441
1428 Ga0495669_0025636 3300046684 Bacteria 2572
1429 Ga0495613_0000929 3300046689 Bacteria 22466
1430 Ga0495613_0003386 3300046689 Bacteria 11918
1431 Ga0495613_0018983 3300046689 Bacteria 5123
1432 Ga0495613_0030472 3300046689 Bacteria 4007
1433 Ga0495613_0032215 3300046689 Bacteria 3893
1434 Ga0495613_0097810 3300046689 Bacteria 2121
1435 Ga0495624_0000538 3300046690 Bacteria 29656
1436 Ga0495624_0005667 3300046690 Bacteria 8960
1437 Ga0495624_0029990 3300046690 Bacteria 3545
1438 Ga0495624_0056485 3300046690 Bacteria 2470
1439 Ga0495624_0058970 3300046690 Bacteria 2409
1440 Ga0495670_0002486 3300046691 Bacteria 9106
1441 Ga0495670_0013147 3300046691 Bacteria 4070
1442 Ga0495649_0012742 3300046694 Bacteria 4878
1443 Ga0495600_0000069 3300046809 Bacteria 58754
1444 Ga0495600_0002229 3300046809 Bacteria 11033
1445 Ga0495600_0007632 3300046809 Bacteria 6624
1446 Ga0495600_0028766 3300046809 Bacteria 3597
1447 Ga0495600_0046092 3300046809 Bacteria 2845
1448 Ga0495600_0049335 3300046809 Bacteria 2747
1449 Ga0495600_0054681 3300046809 Bacteria 2607
1450 Ga0495600_0059314 3300046809 Bacteria 2499
1451 Ga0495581_0001238 3300047315 Bacteria 14050
1452 Ga0495581_0013980 3300047315 Bacteria 4655
1453 Ga0495581_0016881 3300047315 Bacteria 4243
1454 Ga0495581_0033675 3300047315 Bacteria 2965
1455 Ga0495581_0047949 3300047315 Bacteria 2468
1456 Ga0495581_0077776 3300047315 Bacteria 1920
1457 Ga0495604_0000007 3300047317 Bacteria 412174
1458 Ga0495604_0000198 3300047317 Bacteria 54624
1459 Ga0495604_0003926 3300047317 Bacteria 11841
1460 Ga0495604_0005469 3300047317 Bacteria 10075
1461 Ga0495604_0007916 3300047317 Bacteria 8417
1462 Ga0495604_0013426 3300047317 Bacteria 6525
1463 Ga0495604_0126654 3300047317 Bacteria 1840
1464 Ga0495674_0000001 3300047319 Bacteria 778665
1465 Ga0495674_0001854 3300047319 Bacteria 20818
1466 Ga0495674_0004728 3300047319 Bacteria 13095
1467 Ga0495674_0018520 3300047319 Bacteria 6481
1468 Ga0495674_0019302 3300047319 Bacteria 6328
1469 Ga0495674_0020768 3300047319 Bacteria 6080
1470 Ga0495674_0021792 3300047319 Bacteria 5921
1471 Ga0495674_0043222 3300047319 Bacteria 4011
1472 Ga0495674_0060078 3300047319 Bacteria 3317
1473 Ga0495672_0020040 3300047320 Bacteria 4393
1474 Ga0495672_0065823 3300047320 Bacteria 2070
1475 Ga0495676_0027183 3300047321 Bacteria 4911
1476 Ga0495676_0034451 3300047321 Bacteria 4249
1477 Ga0495676_0123474 3300047321 Bacteria 1880
1478 Ga0495680_0001692 3300047322 Bacteria 23414
1479 Ga0495680_0012862 3300047322 Bacteria 7332
1480 Ga0495680_0014111 3300047322 Bacteria 6938
1481 Ga0495680_0014519 3300047322 Bacteria 6818
1482 Ga0495680_0021114 3300047322 Bacteria 5456
1483 Ga0495675_0000216 3300047444 Bacteria 41783
1484 Ga0495675_0003321 3300047444 Bacteria 9678
1485 Ga0495675_0005926 3300047444 Bacteria 7468
1486 Ga0495675_0013295 3300047444 Bacteria 5194
1487 Ga0495675_0112366 3300047444 Bacteria 1700
1488 Ga0495681_0010028 3300047470 Bacteria 5769
1489 Ga0495684_0000009 3300047471 Bacteria 199436
1490 Ga0495684_0000893 3300047471 Bacteria 24119
1491 Ga0495684_0008239 3300047471 Bacteria 8067
1492 Ga0495684_0012532 3300047471 Bacteria 6535
1493 Ga0495684_0018847 3300047471 Bacteria 5316
1494 Ga0495684_0044818 3300047471 Bacteria 3385
1495 Ga0495684_0050814 3300047471 Bacteria 3164
1496 Ga0495686_0002729 3300047472 Bacteria 16131
1497 Ga0495686_0021390 3300047472 Bacteria 4296
1498 Ga0495686_0028426 3300047472 Bacteria 3642
1499 Ga0495593_0000034 3300047673 Bacteria 57993
1500 Ga0495593_0005065 3300047673 Bacteria 7792
1501 Ga0495593_0005088 3300047673 Bacteria 7774
1502 Ga0495593_0010592 3300047673 Bacteria 5319
1503 Ga0495593_0011441 3300047673 Bacteria 5097
1504 Ga0495593_0030123 3300047673 Bacteria 2971
1505 Ga0495593_0041683 3300047673 Bacteria 2467
1506 Ga0495602_0000373 3300048088 Bacteria 41729
1507 Ga0495602_0002340 3300048088 Bacteria 19175
1508 Ga0495602_0010712 3300048088 Bacteria 9507
1509 Ga0495602_0029454 3300048088 Bacteria 5227
1510 Ga0495602_0030283 3300048088 Bacteria 5136
1511 Ga0495614_0012962 3300048089 Bacteria 3655
1512 Ga0496100_0000171 3300048903 Bacteria 35989
1513 Ga0496100_0005513 3300048903 Bacteria 6827
1514 Ga0496100_0005621 3300048903 Bacteria 6772
1515 Ga0496100_0041911 3300048903 Bacteria 2921
1516 Ga0496101_0000246 3300048904 Bacteria 39478
1517 Ga0496101_0002583 3300048904 Bacteria 11123
1518 Ga0496101_0005889 3300048904 Bacteria 7849
1519 Ga0496101_0077962 3300048904 Bacteria 2443
1520 Ga0496102_0003080 3300048905 Bacteria 14123
1521 Ga0496102_0015817 3300048905 Bacteria 6577
1522 Ga0496102_0030603 3300048905 Bacteria 4818
1523 Ga0496102_0047397 3300048905 Bacteria 3905
1524 Ga0496102_0079901 3300048905 Bacteria 3012
1525 Ga0496102_0104172 3300048905 Bacteria 2639
1526 Ga0496102_0190699 3300048905 Bacteria 1931
1527 Ga0496103_0000753 3300048906 Bacteria 23863
1528 Ga0496103_0001814 3300048906 Bacteria 13893
1529 Ga0496103_0019062 3300048906 Bacteria 4120
1530 Ga0496104_0000102 3300048907 Bacteria 81318
1531 Ga0496104_0000159 3300048907 Bacteria 61494
1532 Ga0496104_0000774 3300048907 Bacteria 27343
1533 Ga0496104_0001290 3300048907 Bacteria 21593
1534 Ga0496104_0003304 3300048907 Bacteria 13921
1535 Ga0496104_0004126 3300048907 Bacteria 12614
1536 Ga0496104_0004366 3300048907 Bacteria 12305
1537 Ga0496104_0015916 3300048907 Bacteria 6825
1538 Ga0496104_0040399 3300048907 Bacteria 4372
1539 Ga0496104_0130937 3300048907 Bacteria 2409
1540 Ga0496104_0208411 3300048907 Bacteria 1866
1541 Ga0496105_0000066 3300048908 Bacteria 83056
1542 Ga0496105_0000410 3300048908 Bacteria 28167
1543 Ga0496105_0000660 3300048908 Bacteria 23143
1544 Ga0496105_0002875 3300048908 Bacteria 12614
1545 Ga0496105_0003208 3300048908 Bacteria 12040
1546 Ga0496105_0015677 3300048908 Bacteria 6046
1547 Ga0496105_0017518 3300048908 Bacteria 5746
1548 Ga0496105_0021219 3300048908 Bacteria 5255
1549 Ga0496105_0029545 3300048908 Bacteria 4487
1550 Ga0496105_0048636 3300048908 Bacteria 3500
1551 Ga0496105_0102015 3300048908 Bacteria 2369
1552 Ga0496106_0000183 3300048909 Bacteria 45053
1553 Ga0496106_0000649 3300048909 Bacteria 24884
1554 Ga0496106_0000982 3300048909 Bacteria 20805
1555 Ga0496106_0001165 3300048909 Bacteria 19535
1556 Ga0496106_0003721 3300048909 Bacteria 11376
1557 Ga0496106_0013694 3300048909 Bacteria 5989
1558 Ga0496106_0015146 3300048909 Bacteria 5706
1559 Ga0496106_0046114 3300048909 Bacteria 3276
1560 Ga0496106_0076130 3300048909 Bacteria 2571
1561 Ga0496107_0001430 3300048910 Bacteria 14748
1562 Ga0496107_0008995 3300048910 Bacteria 6922
1563 Ga0496107_0009499 3300048910 Bacteria 6747
1564 Ga0496107_0012532 3300048910 Bacteria 5919
1565 Ga0496107_0015904 3300048910 Bacteria 5278
1566 Ga0496107_0021046 3300048910 Bacteria 4610
1567 Ga0496107_0042322 3300048910 Bacteria 3271
1568 Ga0496107_0066510 3300048910 Bacteria 2613
1569 Ga0496107_0090146 3300048910 Bacteria 2239
1570 Ga0496108_0000436 3300048911 Bacteria 33627
1571 Ga0496108_0000931 3300048911 Bacteria 22844
1572 Ga0496108_0001856 3300048911 Bacteria 16893
1573 Ga0496108_0008443 3300048911 Bacteria 8356
1574 Ga0496108_0041092 3300048911 Bacteria 3859
1575 Ga0496108_0065905 3300048911 Bacteria 3053
1576 Ga0496108_0073828 3300048911 Bacteria 2879
1577 Ga0496108_0137709 3300048911 Bacteria 2102
1578 Ga0496109_0001350 3300048912 Bacteria 20293
1579 Ga0496109_0001766 3300048912 Bacteria 17962
1580 Ga0496109_0003286 3300048912 Bacteria 13499
1581 Ga0496109_0004165 3300048912 Bacteria 12074
1582 Ga0496109_0006221 3300048912 Bacteria 10035
1583 Ga0496109_0015570 3300048912 Bacteria 6631
1584 Ga0496109_0037548 3300048912 Bacteria 4376
1585 Ga0496109_0044561 3300048912 Bacteria 4024
1586 Ga0496109_0050558 3300048912 Bacteria 3785
1587 Ga0496109_0118867 3300048912 Bacteria 2460
1588 Ga0496109_0129340 3300048912 Bacteria 2356
1589 Ga0496110_0001937 3300048913 Bacteria 15340
1590 Ga0496110_0003940 3300048913 Bacteria 11418
1591 Ga0496110_0004370 3300048913 Bacteria 10940
1592 Ga0496110_0006833 3300048913 Bacteria 9070
1593 Ga0496110_0020911 3300048913 Bacteria 5528
1594 Ga0496110_0051830 3300048913 Bacteria 3606
1595 Ga0496110_0056020 3300048913 Bacteria 3469
1596 Ga0496110_0065660 3300048913 Bacteria 3209
1597 Ga0496110_0066495 3300048913 Bacteria 3188
1598 Ga0496110_0107304 3300048913 Bacteria 2506
1599 Ga0496110_0135255 3300048913 Bacteria 2227
1600 Ga0496111_0001107 3300048914 Bacteria 14927
1601 Ga0496111_0001128 3300048914 Bacteria 14799
1602 Ga0496111_0001815 3300048914 Bacteria 12543
1603 Ga0496111_0021291 3300048914 Bacteria 4524
1604 Ga0496111_0031351 3300048914 Bacteria 3786
1605 Ga0496112_0000008 3300048915 Bacteria 310323
1606 Ga0496112_0000735 3300048915 Bacteria 22831
1607 Ga0496112_0002588 3300048915 Bacteria 14615
1608 Ga0496112_0002673 3300048915 Bacteria 14416
1609 Ga0496112_0003217 3300048915 Bacteria 13450
1610 Ga0496112_0015968 3300048915 Bacteria 7020
1611 Ga0496112_0016298 3300048915 Bacteria 6958
1612 Ga0496112_0035334 3300048915 Bacteria 4868
1613 Ga0496112_0050851 3300048915 Bacteria 4064
1614 Ga0496112_0057762 3300048915 Bacteria 3820
1615 Ga0496112_0074587 3300048915 Bacteria 3354
1616 Ga0496112_0124520 3300048915 Bacteria 2548
1617 Ga0496113_0001031 3300048916 Bacteria 15000
1618 Ga0496113_0001697 3300048916 Bacteria 12482
1619 Ga0496113_0005725 3300048916 Bacteria 7785
1620 Ga0496113_0013405 3300048916 Bacteria 5553
1621 Ga0496113_0020676 3300048916 Bacteria 4633
1622 Ga0496113_0032840 3300048916 Bacteria 3773
1623 Ga0496113_0167540 3300048916 Bacteria 1739
1624 Ga0496114_0002224 3300048917 Bacteria 14788
1625 Ga0496114_0028100 3300048917 Bacteria 4613
1626 Ga0496114_0034325 3300048917 Bacteria 4184
1627 Ga0496114_0130075 3300048917 Bacteria 2173
1628 Ga0496114_0228259 3300048917 Bacteria 1635
1629 Ga0496115_0003582 3300048918 Bacteria 11170
1630 Ga0496115_0005349 3300048918 Bacteria 9337
1631 Ga0496115_0007272 3300048918 Bacteria 8144
1632 Ga0496115_0008771 3300048918 Bacteria 7494
1633 Ga0496115_0015832 3300048918 Bacteria 5728
1634 Ga0496115_0107107 3300048918 Bacteria 2295
1635 Ga0496115_0117589 3300048918 Bacteria 2187
1636 Ga0496115_0120660 3300048918 Bacteria 2157
1637 Ga0496115_0131610 3300048918 Bacteria 2062
1638 Ga0496115_0155460 3300048918 Bacteria 1889
1639 Ga0496116_0000142 3300048919 Bacteria 150342
1640 Ga0496116_0003364 3300048919 Bacteria 15879
1641 Ga0496116_0051303 3300048919 Bacteria 2741
1642 Ga0496117_0000002 3300048920 Bacteria 2483758
1643 Ga0496117_0001574 3300048920 Bacteria 32408
1644 Ga0496117_0019627 3300048920 Bacteria 5544
1645 Ga0496117_0020764 3300048920 Bacteria 5344
1646 Ga0496117_0035578 3300048920 Bacteria 3736
1647 Ga0496117_0089219 3300048920 Bacteria 1992
1648 Ga0496117_0098184 3300048920 Bacteria 1863
1649 Ga0496118_0000087 3300048921 Bacteria 176693
1650 Ga0496118_0008894 3300048921 Bacteria 10262
1651 Ga0496118_0043982 3300048921 Bacteria 3503
1652 Ga0496118_0046917 3300048921 Bacteria 3355
1653 Ga0496118_0050959 3300048921 Bacteria 3171
1654 Ga0496118_0061482 3300048921 Bacteria 2781
1655 Ga0496118_0132718 3300048921 Bacteria 1595
1656 Ga0496119_0000903 3300048922 Bacteria 38694
1657 Ga0496119_0001143 3300048922 Bacteria 33302
1658 Ga0496119_0029282 3300048922 Bacteria 3739
1659 Ga0496119_0034940 3300048922 Bacteria 3300
1660 Ga0496120_0000413 3300048923 Bacteria 68125
1661 Ga0496121_0000476 3300048924 Bacteria 78015
1662 Ga0496121_0001497 3300048924 Bacteria 39336
1663 Ga0496121_0001742 3300048924 Bacteria 35564
1664 Ga0496121_0003089 3300048924 Bacteria 24095
1665 Ga0496121_0015642 3300048924 Bacteria 7916
1666 Ga0496121_0017380 3300048924 Bacteria 7352
1667 Ga0496121_0021924 3300048924 Bacteria 6231
1668 Ga0496121_0037277 3300048924 Bacteria 4321
1669 Ga0496121_0038697 3300048924 Bacteria 4216
1670 Ga0496121_0049287 3300048924 Bacteria 3572
1671 Ga0496121_0051164 3300048924 Bacteria 3482
1672 Ga0496121_0134696 3300048924 Bacteria 1842
1673 Ga0496122_0000004 3300048925 Bacteria 645283
1674 Ga0496122_0000190 3300048925 Bacteria 140376
1675 Ga0496122_0004307 3300048925 Bacteria 17825
1676 Ga0496122_0017720 3300048925 Bacteria 6632
1677 Ga0496122_0024662 3300048925 Bacteria 5257
1678 Ga0496122_0029884 3300048925 Bacteria 4582
1679 Ga0496122_0056469 3300048925 Bacteria 2926
1680 Ga0496123_0000007 3300048926 Bacteria 645283
1681 Ga0496123_0000336 3300048926 Bacteria 89161
1682 Ga0496123_0011423 3300048926 Bacteria 7697
1683 Ga0496123_0024244 3300048926 Bacteria 4617
1684 Ga0496123_0027440 3300048926 Bacteria 4241
1685 Ga0496123_0031265 3300048926 Bacteria 3876
1686 Ga0496123_0032300 3300048926 Bacteria 3793
1687 Ga0496123_0042101 3300048926 Bacteria 3157
1688 Ga0496123_0065130 3300048926 Bacteria 2318
1689 Ga0496123_0069502 3300048926 Bacteria 2210
1690 Ga0496124_0001128 3300048927 Bacteria 42017
1691 Ga0496124_0009838 3300048927 Bacteria 9779
1692 Ga0496124_0011540 3300048927 Bacteria 8817
1693 Ga0496124_0037114 3300048927 Bacteria 4241
1694 Ga0496124_0075324 3300048927 Bacteria 2788
1695 Ga0496125_0000154 3300048928 Bacteria 152240
1696 Ga0496125_0000248 3300048928 Bacteria 110840
1697 Ga0496125_0000823 3300048928 Bacteria 50271
1698 Ga0496125_0006049 3300048928 Bacteria 13230
1699 Ga0496125_0015007 3300048928 Bacteria 7523
1700 Ga0496125_0019665 3300048928 Bacteria 6360
1701 Ga0496125_0105364 3300048928 Bacteria 2061
1702 Ga0496125_0143173 3300048928 Bacteria 1658
1703 Ga0496126_0000866 3300048929 Bacteria 53241
1704 Ga0496126_0001294 3300048929 Bacteria 39967
1705 Ga0496126_0002744 3300048929 Bacteria 23267
1706 Ga0496126_0006113 3300048929 Bacteria 13500
1707 Ga0496126_0007435 3300048929 Bacteria 12015
1708 Ga0496126_0009402 3300048929 Bacteria 10385
1709 Ga0496126_0014931 3300048929 Bacteria 7831
1710 Ga0496126_0015910 3300048929 Bacteria 7552
1711 Ga0496126_0020832 3300048929 Bacteria 6418
1712 Ga0496126_0032430 3300048929 Bacteria 4920
1713 Ga0496126_0039244 3300048929 Bacteria 4396
1714 Ga0496126_0049254 3300048929 Bacteria 3847
1715 Ga0496126_0053931 3300048929 Bacteria 3645
1716 Ga0496126_0057046 3300048929 Bacteria 3528
1717 Ga0501031_0009852 3300049568 Bacteria 6221
1718 Ga0501031_0028410 3300049568 Bacteria 3645
1719 Ga0501031_0050735 3300049568 Bacteria 2702
1720 Ga0501032_0003534 3300049569 Bacteria 11926
1721 Ga0501032_0008293 3300049569 Bacteria 7571
1722 Ga0501032_0033503 3300049569 Bacteria 3519
1723 Ga0501032_0085772 3300049569 Bacteria 2093
1724 Ga0501032_0094501 3300049569 Bacteria 1982
1725 Ga0501032_0105845 3300049569 Bacteria 1863
1726 Ga0501033_0000249 3300049570 Bacteria 52045
1727 Ga0501033_0000951 3300049570 Bacteria 26299
1728 Ga0501033_0001862 3300049570 Bacteria 18338
1729 Ga0501033_0036294 3300049570 Bacteria 3693
1730 Ga0501033_0036543 3300049570 Bacteria 3680
1731 Ga0501033_0057802 3300049570 Bacteria 2865
1732 Ga0501033_0078757 3300049570 Bacteria 2418
1733 Ga0501034_0000197 3300049571 Bacteria 114088
1734 Ga0501034_0001938 3300049571 Bacteria 26206
1735 Ga0501034_0003303 3300049571 Bacteria 18422
1736 Ga0501034_0003931 3300049571 Bacteria 16699
1737 Ga0501034_0018261 3300049571 Bacteria 7193
1738 Ga0501034_0029910 3300049571 Bacteria 5536
1739 Ga0501034_0032008 3300049571 Bacteria 5342
1740 Ga0501034_0060787 3300049571 Bacteria 3795
1741 Ga0501034_0063839 3300049571 Bacteria 3696
1742 Ga0501034_0063869 3300049571 Bacteria 3696
1743 Ga0501034_0085798 3300049571 Bacteria 3149
1744 Ga0501034_0103631 3300049571 Bacteria 2838
1745 Ga0501034_0240727 3300049571 Bacteria 1755
1746 Ga0501034_0255686 3300049571 Bacteria 1695
1747 Ga0501036_0001894 3300049572 Bacteria 16266
1748 Ga0501036_0004433 3300049572 Bacteria 11343
1749 Ga0501036_0014718 3300049572 Bacteria 6523
1750 Ga0501036_0020317 3300049572 Bacteria 5577
1751 Ga0501036_0026547 3300049572 Bacteria 4889
1752 Ga0501036_0121562 3300049572 Bacteria 2205
1753 Ga0501036_0128420 3300049572 Bacteria 2140
1754 Ga0501036_0132946 3300049572 Bacteria 2100
1755 Ga0501037_0000112 3300049573 Bacteria 75698
1756 Ga0501037_0004019 3300049573 Bacteria 10664
1757 Ga0501037_0023027 3300049573 Bacteria 4606
1758 Ga0501037_0023753 3300049573 Bacteria 4532
1759 Ga0501037_0025895 3300049573 Bacteria 4332
1760 Ga0501037_0027054 3300049573 Bacteria 4237
1761 Ga0501037_0040501 3300049573 Bacteria 3428
1762 Ga0501038_0000160 3300049574 Bacteria 57443
1763 Ga0501038_0002206 3300049574 Bacteria 18110
1764 Ga0501038_0004382 3300049574 Bacteria 13128
1765 Ga0501038_0019027 3300049574 Bacteria 6196
1766 Ga0501038_0072151 3300049574 Bacteria 2926
1767 Ga0501038_0113818 3300049574 Bacteria 2238
1768 Ga0501038_0144733 3300049574 Bacteria 1941
1769 Ga0501038_0171569 3300049574 Bacteria 1755
1770 Ga0501038_0192297 3300049574 Bacteria 1641
1771 Ga0501039_0003318 3300049575 Bacteria 12039
1772 Ga0501039_0068601 3300049575 Bacteria 2753
1773 Ga0501039_0068838 3300049575 Bacteria 2748
1774 Ga0501039_0109920 3300049575 Bacteria 2155
1775 Ga0501040_0054530 3300049576 Bacteria 2740
1776 Ga0501042_0015592 3300049578 Bacteria 5205
1777 Ga0501043_0000278 3300049579 Bacteria 46214
1778 Ga0501043_0003514 3300049579 Bacteria 12892
1779 Ga0501043_0007295 3300049579 Bacteria 8775
1780 Ga0501043_0008635 3300049579 Bacteria 8029
1781 Ga0501043_0009609 3300049579 Bacteria 7576
1782 Ga0501043_0022578 3300049579 Bacteria 4933
1783 Ga0501043_0022870 3300049579 Bacteria 4901
1784 Ga0501043_0036587 3300049579 Bacteria 3862
1785 Ga0501043_0059303 3300049579 Bacteria 3003
1786 Ga0501046_0000937 3300049580 Bacteria 28581
1787 Ga0501046_0008812 3300049580 Bacteria 8763
1788 Ga0501046_0012556 3300049580 Bacteria 7204
1789 Ga0501046_0050515 3300049580 Bacteria 3285
1790 Ga0501046_0054701 3300049580 Bacteria 3138
1791 Ga0501047_0000275 3300049581 Bacteria 59536
1792 Ga0501047_0000688 3300049581 Bacteria 35266
1793 Ga0501047_0003823 3300049581 Bacteria 14152
1794 Ga0501047_0009938 3300049581 Bacteria 8998
1795 Ga0501047_0012864 3300049581 Bacteria 7930
1796 Ga0501047_0018665 3300049581 Bacteria 6650
1797 Ga0501047_0038155 3300049581 Bacteria 4647
1798 Ga0501047_0040535 3300049581 Bacteria 4504
1799 Ga0501047_0050183 3300049581 Bacteria 4029
1800 Ga0501047_0089000 3300049581 Bacteria 2964
1801 Ga0501047_0115148 3300049581 Bacteria 2571
1802 Ga0501047_0139295 3300049581 Bacteria 2305
1803 Ga0501047_0181313 3300049581 Bacteria 1972
1804 Ga0501047_0196182 3300049581 Bacteria 1881
1805 Ga0501048_0001248 3300049582 Bacteria 19253
1806 Ga0501048_0002575 3300049582 Bacteria 13870
1807 Ga0501048_0011414 3300049582 Bacteria 6626
1808 Ga0501048_0022723 3300049582 Bacteria 4584
1809 Ga0501048_0047682 3300049582 Bacteria 3056
1810 Ga0501048_0123764 3300049582 Bacteria 1828
1811 Ga0501067_0000258 3300049583 Bacteria 28937
1812 Ga0501067_0007852 3300049583 Bacteria 5930
1813 Ga0501067_0037309 3300049583 Bacteria 2699
1814 Ga0501067_0110334 3300049583 Bacteria 1529
1815 Ga0501068_0004146 3300049584 Bacteria 7852
1816 Ga0501068_0013165 3300049584 Bacteria 4703
1817 Ga0501068_0014609 3300049584 Bacteria 4493
1818 Ga0501068_0026245 3300049584 Bacteria 3431
1819 Ga0501069_0014567 3300049585 Bacteria 4204
1820 Ga0501069_0071080 3300049585 Bacteria 1950
1821 Ga0501070_0002548 3300049586 Bacteria 15964
1822 Ga0501070_0006200 3300049586 Bacteria 10187
1823 Ga0501070_0013214 3300049586 Bacteria 6960
1824 Ga0501070_0020554 3300049586 Bacteria 5537
1825 Ga0501070_0022267 3300049586 Bacteria 5309
1826 Ga0501070_0024977 3300049586 Bacteria 5011
1827 Ga0501070_0025040 3300049586 Bacteria 5004
1828 Ga0501070_0142755 3300049586 Bacteria 1977
1829 Ga0501070_0156925 3300049586 Bacteria 1876
1830 Ga0501070_0216337 3300049586 Bacteria 1572
1831 Ga0501071_0011386 3300049587 Bacteria 5993
1832 Ga0501071_0059871 3300049587 Bacteria 2756
1833 Ga0501072_0005621 3300049588 Bacteria 9541
1834 Ga0501072_0066240 3300049588 Bacteria 2849
1835 Ga0501072_0067082 3300049588 Bacteria 2831
1836 Ga0501073_0000103 3300049589 Bacteria 53962
1837 Ga0501073_0057275 3300049589 Bacteria 2725
1838 Ga0501073_0059061 3300049589 Bacteria 2679
1839 Ga0501073_0113520 3300049589 Bacteria 1879
1840 Ga0501073_0147488 3300049589 Bacteria 1630
1841 Ga0501073_0151360 3300049589 Bacteria 1608
1842 Ga0501074_0000456 3300049590 Bacteria 24566
1843 Ga0501074_0001612 3300049590 Bacteria 15274
1844 Ga0501074_0005242 3300049590 Bacteria 9324
1845 Ga0501074_0025367 3300049590 Bacteria 4305
1846 Ga0501074_0029373 3300049590 Bacteria 3982
1847 Ga0501074_0047059 3300049590 Bacteria 3118
1848 Ga0501076_0002639 3300049592 Bacteria 12373
1849 Ga0501076_0089958 3300049592 Bacteria 2468
1850 Ga0501076_0121843 3300049592 Bacteria 2112
1851 Ga0501077_0003492 3300049593 Bacteria 9437
1852 Ga0501079_0000451 3300049741 Bacteria 26871
1853 Ga0501079_0010445 3300049741 Bacteria 7058
1854 Ga0501079_0038416 3300049741 Bacteria 3691
1855 Ga0501079_0042211 3300049741 Bacteria 3523
1856 Ga0501079_0125027 3300049741 Bacteria 2001
1857 Ga0501079_0147849 3300049741 Bacteria 1831
1858 Ga0501080_0000082 3300049742 Bacteria 63972
1859 Ga0501080_0000153 3300049742 Bacteria 49231
1860 Ga0501080_0002998 3300049742 Bacteria 14886
1861 Ga0501080_0011942 3300049742 Bacteria 7955
1862 Ga0501080_0016338 3300049742 Bacteria 6854
1863 Ga0501080_0019550 3300049742 Bacteria 6275
1864 Ga0501080_0034657 3300049742 Bacteria 4714
1865 Ga0501080_0042442 3300049742 Bacteria 4234
1866 Ga0501080_0061381 3300049742 Bacteria 3499
1867 Ga0501080_0064923 3300049742 Bacteria 3396
1868 Ga0501080_0112736 3300049742 Bacteria 2521
1869 Ga0501081_0000145 3300049743 Bacteria 32074
1870 Ga0501083_0003065 3300049744 Bacteria 11615
1871 Ga0501083_0009193 3300049744 Bacteria 6980
1872 Ga0501083_0013677 3300049744 Bacteria 5675
1873 Ga0501083_0024526 3300049744 Bacteria 4178
1874 Ga0501083_0037937 3300049744 Bacteria 3277
1875 Ga0501035_0000584 3300049822 Bacteria 40265
1876 Ga0501035_0000766 3300049822 Bacteria 34513
1877 Ga0501035_0001708 3300049822 Bacteria 22182
1878 Ga0501035_0018251 3300049822 Bacteria 6463
1879 Ga0501035_0026906 3300049822 Bacteria 5258
1880 Ga0501035_0046712 3300049822 Bacteria 3894
1881 Ga0501035_0049300 3300049822 Bacteria 3774
1882 Ga0501035_0054488 3300049822 Bacteria 3573
1883 Ga0501035_0112140 3300049822 Bacteria 2389
1884 Ga0501035_0255715 3300049822 Bacteria 1486
1885 Ga0501044_0000286 3300049823 Bacteria 64389
1886 Ga0501044_0000418 3300049823 Bacteria 52554
1887 Ga0501044_0007955 3300049823 Bacteria 11650
1888 Ga0501044_0013097 3300049823 Bacteria 8978
1889 Ga0501044_0013740 3300049823 Bacteria 8750
1890 Ga0501044_0024381 3300049823 Bacteria 6423
1891 Ga0501044_0028251 3300049823 Bacteria 5921
1892 Ga0501044_0028517 3300049823 Bacteria 5892
1893 Ga0501044_0034063 3300049823 Bacteria 5345
1894 Ga0501044_0051865 3300049823 Bacteria 4229
1895 Ga0501044_0067195 3300049823 Bacteria 3653
1896 Ga0501044_0101689 3300049823 Bacteria 2891
1897 Ga0501044_0102882 3300049823 Bacteria 2871
1898 Ga0501044_0121107 3300049823 Bacteria 2617
1899 Ga0501044_0176428 3300049823 Bacteria 2106
1900 Ga0501044_0188063 3300049823 Bacteria 2029
1901 Ga0501045_0054354 3300049824 Bacteria 2927
1902 Ga0501045_0056551 3300049824 Bacteria 2869
1903 nmdc:mga03683_2117_c1 3300050489 Bacteria 6112
1904 nmdc:mga03n38_1307_c3 3300050490 Bacteria 3308
1905 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
1906 nmdc:mga00v17_62963_c1 3300050491 Bacteria 2283
1907 nmdc:mga00v17_639_c1 3300050491 Bacteria 19367
1908 nmdc:mga0yw44_1397_c1 3300050492 Bacteria 9573
1909 nmdc:mga0yw44_16757_c1 3300050492 Bacteria 3968
1910 nmdc:mga0yw44_291_c1 3300050492 Bacteria 17253
1911 nmdc:mga0yw44_5474_c1 3300050492 Bacteria 6006
1912 nmdc:mga0yw44_64749_c1 3300050492 Bacteria 2250
1913 nmdc:mga0k408_19986_c1 3300050493 Bacteria 2244
1914 nmdc:mga0k408_43409_c1 3300050493 Bacteria 2591
1915 nmdc:mga0k408_54844_c1 3300050493 Bacteria 2310
1916 nmdc:mga06z11_59933_c1 3300050494 Bacteria 1980
1917 nmdc:mga04h51_21673_c1 3300050495 Bacteria 1936
1918 nmdc:mga07m45_33942_c1 3300050496 Bacteria 2835
1919 nmdc:mga05p37_140758_c1 3300050507 Bacteria 2956
1920 nmdc:mga05p37_16389_c1 3300050507 Bacteria 8927
1921 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
1922 nmdc:mga05p37_62404_c1 3300050507 Bacteria 4586
1923 nmdc:mga05p37_66173_c1 3300050507 Bacteria 4445
1924 nmdc:mga05p37_71679_c1 3300050507 Bacteria 4263
1925 nmdc:mga09592_813_c1 3300050508 Bacteria 24096
1926 nmdc:mga0qj67_101_c1 3300050509 Bacteria 57355
1927 nmdc:mga0qj67_1453_c1 3300050509 Bacteria 16598
1928 nmdc:mga08y16_1715_c1 3300050511 Bacteria 22248
1929 nmdc:mga08y16_2882_c1 3300050511 Bacteria 17696
1930 nmdc:mga08y16_42428_c1 3300050511 Bacteria 4765
1931 nmdc:mga0n895_1392_c1 3300050512 Bacteria 18016
1932 nmdc:mga0n895_30575_c1 3300050512 Bacteria 5148
1933 nmdc:mga0n895_58282_c1 3300050512 Bacteria 3807
1934 nmdc:mga0n895_971_c1 3300050512 Bacteria 20812
1935 nmdc:mga0rr50_78964_c1 3300050513 Bacteria 2534
1936 nmdc:mga08x19_25741_c1 3300050514 Bacteria 3667
1937 nmdc:mga08x19_66_c1 3300050514 Bacteria 105609
1938 nmdc:mga0a205_1026_c1 3300050515 Bacteria 23240
1939 nmdc:mga0a205_27448_c1 3300050515 Bacteria 5437
1940 nmdc:mga0a205_687_c1 3300050515 Bacteria 27032
1941 nmdc:mga0sz30_1084_c1 3300050516 Bacteria 9781
1942 nmdc:mga0sz30_47039_c1 3300050516 Bacteria 1823
1943 nmdc:mga0sz30_5454_c1 3300050516 Bacteria 4666
1944 Ga0495601_0000020 3300053077 Bacteria 160011
1945 Ga0495601_0002032 3300053077 Bacteria 11359
1946 Ga0495601_0002166 3300053077 Bacteria 11055
1947 Ga0495601_0009529 3300053077 Bacteria 5749
1948 Ga0495601_0024023 3300053077 Bacteria 3750
1949 Ga0495601_0025589 3300053077 Bacteria 3640
1950 Ga0495612_0000030 3300053078 Bacteria 81917
1951 Ga0495612_0000095 3300053078 Bacteria 38147
1952 Ga0495612_0000616 3300053078 Bacteria 14330
1953 Ga0495612_0005510 3300053078 Bacteria 5231
1954 Ga0495612_0013166 3300053078 Bacteria 3331
1955 Ga0495612_0014874 3300053078 Bacteria 3122
1956 Ga0495612_0015258 3300053078 Bacteria 3080
1957 Ga0495595_0000125 3300053084 Bacteria 33101
1958 Ga0495595_0002085 3300053084 Bacteria 7774
1959 Ga0495595_0003032 3300053084 Bacteria 6641
1960 Ga0495595_0004343 3300053084 Bacteria 5706
1961 Ga0495595_0005397 3300053084 Bacteria 5178
1962 Ga0495595_0012561 3300053084 Bacteria 3562
1963 Ga0495595_0028530 3300053084 Bacteria 2493
1964 Ga0495595_0029769 3300053084 Bacteria 2445
1965 Ga0495619_0000151 3300053085 Bacteria 51364
1966 Ga0495619_0000216 3300053085 Bacteria 41892
1967 Ga0495619_0000419 3300053085 Bacteria 28779
1968 Ga0495619_0000504 3300053085 Bacteria 26022
1969 Ga0495619_0001557 3300053085 Bacteria 15086
1970 Ga0495619_0001606 3300053085 Bacteria 14870
1971 Ga0495619_0005274 3300053085 Bacteria 8189
1972 Ga0495619_0005598 3300053085 Bacteria 7970
1973 Ga0495619_0009643 3300053085 Bacteria 6089
1974 Ga0495619_0010322 3300053085 Bacteria 5877
1975 Ga0495619_0012726 3300053085 Bacteria 5294
1976 Ga0495619_0012816 3300053085 Bacteria 5280
1977 Ga0495619_0065533 3300053085 Bacteria 2423
1978 Ga0500578_0035303 3300053086 Bacteria 3213
1979 Ga0500643_000267 3300053087 Bacteria 46005
1980 Ga0500643_013683 3300053087 Bacteria 2855
1981 Ga0500643_022533 3300053087 Bacteria 2026
1982 Ga0500647_0016593 3300053091 Bacteria 3386
1983 Ga0500651_0000861 3300053093 Bacteria 14855
1984 Ga0500651_0006227 3300053093 Bacteria 6866
1985 Ga0500651_0035377 3300053093 Bacteria 3147
1986 Ga0500651_0081820 3300053093 Bacteria 1999
1987 Ga0500651_0086679 3300053093 Bacteria 1934
1988 Ga0500566_0000157 3300053094 Bacteria 34534
1989 Ga0500566_0000185 3300053094 Bacteria 32171
1990 Ga0500566_0000925 3300053094 Bacteria 16797
1991 Ga0500641_0001160 3300053096 Bacteria 9388
1992 Ga0500641_0006535 3300053096 Bacteria 4135
1993 Ga0500641_0024451 3300053096 Bacteria 2329
1994 Ga0500641_0028182 3300053096 Bacteria 2192
1995 Ga0500554_000718 3300053102 Bacteria 6703
1996 Ga0500556_0000413 3300053104 Bacteria 31142
1997 Ga0500556_0005856 3300053104 Bacteria 3479
1998 Ga0500556_0008713 3300053104 Bacteria 2931
1999 Ga0500557_000041 3300053105 Bacteria 64885
2000 Ga0500560_007025 3300053107 Bacteria 2625
2001 Ga0500562_011056 3300053108 Bacteria 2290
2002 Ga0500572_001865 3300053111 Bacteria 5335
2003 Ga0500572_003851 3300053111 Bacteria 3410
2004 Ga0500592_008834 3300053116 Bacteria 1601
2005 Ga0500595_000024 3300053119 Bacteria 144160
2006 Ga0500595_003935 3300053119 Bacteria 6804
2007 Ga0500595_006228 3300053119 Bacteria 5095
2008 Ga0500595_018179 3300053119 Bacteria 2576
2009 Ga0500595_023855 3300053119 Bacteria 2143
2010 Ga0500614_001219 3300053123 Bacteria 6263
2011 Ga0500618_006718 3300053125 Bacteria 3350
2012 Ga0500642_0000005 3300053130 Bacteria 422725
2013 Ga0500642_0000140 3300053130 Bacteria 32282
2014 Ga0500652_000011 3300053131 Bacteria 160704
2015 Ga0500652_000531 3300053131 Bacteria 13423
2016 Ga0500658_0004847 3300053134 Bacteria 5018
2017 Ga0500559_0002089 3300053136 Bacteria 10664
2018 Ga0500559_0004041 3300053136 Bacteria 7042
2019 Ga0500559_0004212 3300053136 Bacteria 6885
2020 Ga0500561_0000098 3300053137 Bacteria 16671
2021 Ga0500568_0002109 3300053139 Bacteria 12007
2022 Ga0500577_0000693 3300053142 Bacteria 8639
2023 Ga0500590_083058 3300053148 Bacteria 1570
2024 Ga0500603_000277 3300053150 Bacteria 13486
2025 Ga0500603_001226 3300053150 Bacteria 5959
2026 Ga0500604_0019289 3300053151 Bacteria 1908
2027 Ga0500616_0000001 3300053153 Bacteria 1986011
2028 Ga0500616_0000166 3300053153 Bacteria 110141
2029 Ga0500616_0000180 3300053153 Bacteria 106053
2030 Ga0500616_0004617 3300053153 Bacteria 9730
2031 Ga0500616_0009939 3300053153 Bacteria 5726
2032 Ga0500622_0000458 3300053156 Bacteria 38693
2033 Ga0500622_0029561 3300053156 Bacteria 2881
2034 Ga0500622_0037547 3300053156 Bacteria 2530
2035 Ga0500622_0045943 3300053156 Bacteria 2260
2036 Ga0500638_078740 3300053162 Bacteria 1567
2037 Ga0500639_000014 3300053163 Bacteria 122926
2038 Ga0500639_063951 3300053163 Bacteria 1891
2039 Ga0500636_0000180 3300053177 Bacteria 33813
2040 Ga0500636_0001459 3300053177 Bacteria 12853
2041 Ga0500636_0001916 3300053177 Bacteria 11425
2042 Ga0500636_0004158 3300053177 Bacteria 8191
2043 Ga0500637_0002840 3300053178 Bacteria 7802
2044 Ga0500637_0029199 3300053178 Bacteria 3057
2045 Ga0500625_003212 3300053729 Bacteria 6395
2046 Ga0500645_001299 3300053730 Bacteria 12970
2047 Ga0500645_002180 3300053730 Bacteria 8957
2048 Ga0500645_013842 3300053730 Bacteria 2581
2049 Ga0500599_000459 3300053736 Bacteria 4213
2050 Ga0500601_000076 3300053737 Bacteria 20083
2051 Ga0501084_0003972 3300054114 Bacteria 12046
2052 Ga0501084_0073507 3300054114 Bacteria 2863
2053 Ga0501084_0114235 3300054114 Bacteria 2270
2054 Ga0501084_0148146 3300054114 Bacteria 1977
2055 Ga0501082_0001096 3300060353 Bacteria 23952
2056 Ga0501082_0011183 3300060353 Bacteria 7713
2057 Ga0501082_0011925 3300060353 Bacteria 7474
2058 Ga0501082_0040978 3300060353 Bacteria 3993
2059 Ga0501082_0051160 3300060353 Bacteria 3561
2060 Ga0501082_0111109 3300060353 Bacteria 2372
2061 Ga0466962_0032239 3300061719 Bacteria 2508
2062 Ga0530510_0024936 3300061734 Bacteria 4274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0024662 Ga0496122_0024662_212_1456 412
2 iso_pu_bacteria 2964670856 2964676078 415
3 3300049568 Ga0501031_0050735 Ga0501031_0050735_13_1284 422
4 3300009094 Ga0111539_10000581 Ga0111539_1000058113 430
5 3300049586 Ga0501070_0142755 Ga0501070_0142755_195_1616 439
6 iso_pu_bacteria 8019687851 8019694112 439
7 3300049569 Ga0501032_0094501 Ga0501032_0094501_579_1961 444
8 3300035695 Ga0373927_0085954 Ga0373927_0085954_683_2026 447
9 3300046455 Ga0495603_0142376 Ga0495603_0142376_39_1382 447
10 3300047315 Ga0495581_0077776 Ga0495581_0077776_11_1363 447
11 3300048917 Ga0496114_0130075 Ga0496114_0130075_11_1354 447
12 3300049589 Ga0501073_0113520 Ga0501073_0113520_514_1866 447
13 3300026035 Ga0207703_10097783 Ga0207703_100977832 451
14 3300049571 Ga0501034_0032008 Ga0501034_0032008_210_1619 453
15 3300049581 Ga0501047_0012864 Ga0501047_0012864_1606_3015 453
16 3300049823 Ga0501044_0013740 Ga0501044_0013740_1900_3309 453
17 iso_pu_bacteria 2957437181 2957440838 453
18 3300046475 Ga0495639_0002472 Ga0495639_0002472_6502_7905 454
19 3300046517 Ga0495630_0060622 Ga0495630_0060622_111_1514 454
20 3300031240 Ga0265320_10028632 Ga0265320_100286322 456
21 3300031241 Ga0265325_10036991 Ga0265325_100369912 456
22 3300031247 Ga0265340_10008228 Ga0265340_100082285 456
23 3300005436 Ga0070713_100135610 Ga0070713_1001356102 457
24 3300049588 Ga0501072_0005621 Ga0501072_0005621_6194_7603 457
25 3300060353 Ga0501082_0001096 Ga0501082_0001096_18726_20129 457
26 3300039447 Ga0436361_1025841 Ga0436361_1025841_19_1416 458
27 3300005535 Ga0070684_100005206 Ga0070684_1000052066 459
28 3300013105 Ga0157369_10186475 Ga0157369_101864752 459
29 3300025917 Ga0207660_10014180 Ga0207660_100141805 459
30 3300031247 Ga0265340_10007603 Ga0265340_100076032 459
31 3300049571 Ga0501034_0085798 Ga0501034_0085798_955_2382 459
32 iso_pu_bacteria 2508501050 2508729295 461
33 iso_pu_bacteria 2508501114 2509077892 461
34 iso_pu_bacteria 2545555834 2545678990 461
35 iso_pu_bacteria 2595698237 2596374192 461
36 iso_pu_bacteria 2773857925 2774872874 461
37 iso_pu_bacteria 2775506901 2776258754 461
38 iso_pu_bacteria 2835312727 2835312919 461
39 iso_pu_bacteria 2841957949 2841960219 461
40 iso_pu_bacteria 2882456835 2882457970 461
41 iso_pu_bacteria 2884298095 2884300827 461
42 iso_pu_bacteria 2889306138 2889307150 461
43 iso_pu_bacteria 2891048133 2891050865 461
44 iso_pu_bacteria 2902330777 2902333016 461
45 iso_pu_bacteria 2902405164 2902411941 461
46 iso_pu_bacteria 2928125067 2928129777 461
47 iso_pu_bacteria 2995392953 2995393042 461
48 iso_pu_bacteria 3003665799 3003667624 461
49 iso_pu_bacteria 641522639 641646788 461
50 iso_pu_bacteria 643348564 643604996 461
51 3300013307 Ga0157372_10271572 Ga0157372_102715722 462
52 iso_pu_bacteria 2507262055 2507511011 462
53 iso_pu_bacteria 2508501009 2508544832 462
54 iso_pu_bacteria 2508501042 2508696940 462
55 iso_pu_bacteria 2508501122 2509108404 462
56 iso_pu_bacteria 2508501128 2509148874 462
57 iso_pu_bacteria 2509276019 2509376463 462
58 iso_pu_bacteria 2509276021 2509392064 462
59 iso_pu_bacteria 2509276033 2509445655 462
60 iso_pu_bacteria 2509276033 2509447044 462
61 iso_pu_bacteria 2510065019 2510133946 462
62 iso_pu_bacteria 2510065057 2510306447 462
63 iso_pu_bacteria 2510461076 2510895364 462
64 iso_pu_bacteria 2510917028 2511187046 462
65 iso_pu_bacteria 2510917030 2511199020 462
66 iso_pu_bacteria 2511231028 2511395188 462
67 iso_pu_bacteria 2511231052 2511502237 462
68 iso_pu_bacteria 2512047086 2512533610 462
69 iso_pu_bacteria 2512875026 2512970701 462
70 iso_pu_bacteria 2513237084 2513567981 462
71 iso_pu_bacteria 2513237085 2513576933 462
72 iso_pu_bacteria 2513237086 2513584391 462
73 iso_pu_bacteria 2513237087 2513590303 462
74 iso_pu_bacteria 2513237088 2513596466 462
75 iso_pu_bacteria 2513237089 2513604255 462
76 iso_pu_bacteria 2513237091 2513618797 462
77 iso_pu_bacteria 2513237092 2513623485 462
78 iso_pu_bacteria 2513237093 2513633395 462
79 iso_pu_bacteria 2513237094 2513637469 462
80 iso_pu_bacteria 2513237095 2513649681 462
81 iso_pu_bacteria 2513237096 2513655025 462
82 iso_pu_bacteria 2513237098 2513677795 462
83 iso_pu_bacteria 2513237101 2513697432 462
84 iso_pu_bacteria 2513237102 2513699954 462
85 iso_pu_bacteria 2513237103 2513708057 462
86 iso_pu_bacteria 2513237104 2513716917 462
87 iso_pu_bacteria 2513237137 2513861041 462
88 iso_pu_bacteria 2513237138 2513865591 462
89 iso_pu_bacteria 2513237139 2513874651 462
90 iso_pu_bacteria 2513237140 2513884412 462
91 iso_pu_bacteria 2513237141 2513892084 462
92 iso_pu_bacteria 2513237143 2513905002 462
93 iso_pu_bacteria 2513237145 2513915952 462
94 iso_pu_bacteria 2513237146 2513925393 462
95 iso_pu_bacteria 2513237156 2513986832 462
96 iso_pu_bacteria 2513237159 2514001511 462
97 iso_pu_bacteria 2513237160 2514006396 462
98 iso_pu_bacteria 2513237161 2514010633 462
99 iso_pu_bacteria 2513237162 2514020016 462
100 iso_pu_bacteria 2515075009 2515112995 462
101 iso_pu_bacteria 2515154107 2515609013 462
102 iso_pu_bacteria 2515154113 2515638505 462
103 iso_pu_bacteria 2515154114 2515640954 462
104 iso_pu_bacteria 2515154116 2515655364 462
105 iso_pu_bacteria 2515154134 2515739473 462
106 iso_pu_bacteria 2516653046 2516893616 462
107 iso_pu_bacteria 2516653077 2517036695 462
108 iso_pu_bacteria 2516653085 2517077054 462
109 iso_pu_bacteria 2517093000 2517095822 462
110 iso_pu_bacteria 2517093001 2517100590 462
111 iso_pu_bacteria 2517287029 2517407394 462
112 iso_pu_bacteria 2517487022 2517570328 462
113 iso_pu_bacteria 2517572143 2517894743 462
114 iso_pu_bacteria 2519899620 2520377200 462
115 iso_pu_bacteria 2524023205 2524438186 462
116 iso_pu_bacteria 2524023207 2524448563 462
117 iso_pu_bacteria 2524023209 2524459580 462
118 iso_pu_bacteria 2524023210 2524464074 462
119 iso_pu_bacteria 2524023228 2524534491 462
120 iso_pu_bacteria 2528768022 2528849821 462
121 iso_pu_bacteria 2529292951 2530645962 462
122 iso_pu_bacteria 2537561587 2537875442 462
123 iso_pu_bacteria 2551306084 2551674551 462
124 iso_pu_bacteria 2551306084 2551677932 462
125 iso_pu_bacteria 2551306085 2551687745 462
126 iso_pu_bacteria 2551306093 2551741373 462
127 iso_pu_bacteria 2554235003 2554248224 462
128 iso_pu_bacteria 2558860100 2558864470 462
129 iso_pu_bacteria 2558860242 2559295340 462
130 iso_pu_bacteria 2582581283 2585166340 462
131 iso_pu_bacteria 2582581294 2585202279 462
132 iso_pu_bacteria 2582581298 2585222823 462
133 iso_pu_bacteria 2582581304 2585255075 462
134 iso_pu_bacteria 2582581306 2585267432 462
135 iso_pu_bacteria 2582581308 2585277474 462
136 iso_pu_bacteria 2582581315 2585323342 462
137 iso_pu_bacteria 2582581865 2585386500 462
138 iso_pu_bacteria 2582581866 2585393248 462
139 iso_pu_bacteria 2582581867 2585402406 462
140 iso_pu_bacteria 2585427526 2585527434 462
141 iso_pu_bacteria 2585427527 2585535101 462
142 iso_pu_bacteria 2585427528 2585538175 462
143 iso_pu_bacteria 2585427529 2585545406 462
144 iso_pu_bacteria 2585427530 2585555951 462
145 iso_pu_bacteria 2585427590 2585822907 462
146 iso_pu_bacteria 2585427593 2585836124 462
147 iso_pu_bacteria 2585427594 2585843218 462
148 iso_pu_bacteria 2599185156 2599331743 462
149 iso_pu_bacteria 2599185170 2599417309 462
150 iso_pu_bacteria 2599185210 2599601652 462
151 iso_pu_bacteria 2599185236 2599721920 462
152 iso_pu_bacteria 2600255279 2601610088 462
153 iso_pu_bacteria 2600255308 2601746863 462
154 iso_pu_bacteria 2602042107 2603862618 462
155 iso_pu_bacteria 2615840624 2616293373 462
156 iso_pu_bacteria 2615840626 2616308949 462
157 iso_pu_bacteria 2617270735 2617350775 462
158 iso_pu_bacteria 2617270741 2617373144 462
159 iso_pu_bacteria 2643221547 2643755172 462
160 iso_pu_bacteria 2643221568 2643856779 462
161 iso_pu_bacteria 2643221582 2643920352 462
162 iso_pu_bacteria 2643221599 2644003166 462
163 iso_pu_bacteria 2643221607 2644050527 462
164 iso_pu_bacteria 2643221618 2644107287 462
165 iso_pu_bacteria 2643221626 2644150853 462
166 iso_pu_bacteria 2643221634 2644193500 462
167 iso_pu_bacteria 2643221636 2644205755 462
168 iso_pu_bacteria 2643221637 2644209037 462
169 iso_pu_bacteria 2643221643 2644238688 462
170 iso_pu_bacteria 2643221651 2644287347 462
171 iso_pu_bacteria 2643221655 2644308682 462
172 iso_pu_bacteria 2643221659 2644335500 462
173 iso_pu_bacteria 2643221686 2644483445 462
174 iso_pu_bacteria 2643221688 2644492022 462
175 iso_pu_bacteria 2643221689 2644499656 462
176 iso_pu_bacteria 2643221693 2644521966 462
177 iso_pu_bacteria 2643221698 2644539905 462
178 iso_pu_bacteria 2643221712 2644614623 462
179 iso_pu_bacteria 2643221718 2644652567 462
180 iso_pu_bacteria 2643221733 2644732236 462
181 iso_pu_bacteria 2643221734 2644734965 462
182 iso_pu_bacteria 2643221736 2644745373 462
183 iso_pu_bacteria 2657244999 2657681552 462
184 iso_pu_bacteria 2667528174 2671111438 462
185 iso_pu_bacteria 2667528175 2671119156 462
186 iso_pu_bacteria 2718217927 2719386400 462
187 iso_pu_bacteria 2718217997 2719666148 462
188 iso_pu_bacteria 2718218199 2720492568 462
189 iso_pu_bacteria 2718218232 2720614003 462
190 iso_pu_bacteria 2718218233 2720620808 462
191 iso_pu_bacteria 2718218235 2720632133 462
192 iso_pu_bacteria 2718218269 2720775861 462
193 iso_pu_bacteria 2718218423 2721400104 462
194 iso_pu_bacteria 2721755556 2723027465 462
195 iso_pu_bacteria 2721755684 2723561084 462
196 iso_pu_bacteria 2721755685 2723567680 462
197 iso_pu_bacteria 2721755755 2723843077 462
198 iso_pu_bacteria 2721755809 2724038917 462
199 iso_pu_bacteria 2721755819 2724090468 462
200 iso_pu_bacteria 2721755822 2724104945 462
201 iso_pu_bacteria 2721755823 2724110804 462
202 iso_pu_bacteria 2724679232 2725952570 462
203 iso_pu_bacteria 2728368998 2728747602 462
204 iso_pu_bacteria 2728369352 2730108401 462
205 iso_pu_bacteria 2738541281 2738744682 462
206 iso_pu_bacteria 2738541317 2738947343 462
207 iso_pu_bacteria 2738541333 2739032832 462
208 iso_pu_bacteria 2738543032 2739353912 462
209 iso_pu_bacteria 2744054633 2745076932 462
210 iso_pu_bacteria 2751185821 2753462020 462
211 iso_pu_bacteria 2765235942 2766065860 462
212 iso_pu_bacteria 2767802442 2770195434 462
213 iso_pu_bacteria 2775506902 2776270629 462
214 iso_pu_bacteria 2775506904 2776280548 462
215 iso_pu_bacteria 2791355082 2792585135 462
216 iso_pu_bacteria 2791355196 2793064663 462
217 iso_pu_bacteria 2791355197 2793071217 462
218 iso_pu_bacteria 2791355199 2793079516 462
219 iso_pu_bacteria 2791355253 2793280312 462
220 iso_pu_bacteria 2791355256 2793294446 462
221 iso_pu_bacteria 2791355259 2793314552 462
222 iso_pu_bacteria 2791355260 2793320380 462
223 iso_pu_bacteria 2791355261 2793329549 462
224 iso_pu_bacteria 2791355262 2793334481 462
225 iso_pu_bacteria 2791355263 2793339198 462
226 iso_pu_bacteria 2791355265 2793351841 462
227 iso_pu_bacteria 2791355266 2793362593 462
228 iso_pu_bacteria 2791355267 2793368883 462
229 iso_pu_bacteria 2802428858 2802720023 462
230 iso_pu_bacteria 2802428859 2802727044 462
231 iso_pu_bacteria 2802428860 2802731953 462
232 iso_pu_bacteria 2802428861 2802739284 462
233 iso_pu_bacteria 2802428862 2802745735 462
234 iso_pu_bacteria 2802428863 2802752336 462
235 iso_pu_bacteria 2802429268 2804752744 462
236 iso_pu_bacteria 2802429603 2805916648 462
237 iso_pu_bacteria 2802429605 2805928810 462
238 iso_pu_bacteria 2802429606 2805935092 462
239 iso_pu_bacteria 2802429633 2806043812 462
240 iso_pu_bacteria 2802429634 2806050257 462
241 iso_pu_bacteria 2802429635 2806057073 462
242 iso_pu_bacteria 2802429636 2806064455 462
243 iso_pu_bacteria 2802429637 2806071722 462
244 iso_pu_bacteria 2808606387 2808987926 462
245 iso_pu_bacteria 2816332527 2818238152 462
246 iso_pu_bacteria 2818991439 2819559053 462
247 iso_pu_bacteria 2818991448 2819609140 462
248 iso_pu_bacteria 2818991453 2819637632 462
249 iso_pu_bacteria 2818991461 2819684903 462
250 iso_pu_bacteria 2818991467 2819719516 462
251 iso_pu_bacteria 2824600985 2824607729 462
252 iso_pu_bacteria 2824609381 2824617133 462
253 iso_pu_bacteria 2824617872 2824624259 462
254 iso_pu_bacteria 2824626560 2824633059 462
255 iso_pu_bacteria 2824635225 2824643386 462
256 iso_pu_bacteria 2824644064 2824648777 462
257 iso_pu_bacteria 2824653114 2824658710 462
258 iso_pu_bacteria 2824661429 2824668265 462
259 iso_pu_bacteria 2824671348 2824676177 462
260 iso_pu_bacteria 2824679649 2824682886 462
261 iso_pu_bacteria 2824687955 2824692365 462
262 iso_pu_bacteria 2824696289 2824704002 462
263 iso_pu_bacteria 2824704595 2824713586 462
264 iso_pu_bacteria 2824714736 2824722394 462
265 iso_pu_bacteria 2824723954 2824731667 462
266 iso_pu_bacteria 2824732956 2824740351 462
267 iso_pu_bacteria 2824746037 2824751539 462
268 iso_pu_bacteria 2824753945 2824761223 462
269 iso_pu_bacteria 2824763712 2824771852 462
270 iso_pu_bacteria 2824773399 2824780543 462
271 iso_pu_bacteria 2828305725 2828308675 462
272 iso_pu_bacteria 2829745981 2829749745 462
273 iso_pu_bacteria 2837678835 2837683126 462
274 iso_pu_bacteria 2838016132 2838017662 462
275 iso_pu_bacteria 2838022645 2838027537 462
276 iso_pu_bacteria 2838029111 2838029814 462
277 iso_pu_bacteria 2838035591 2838038491 462
278 iso_pu_bacteria 2838042994 2838043959 462
279 iso_pu_bacteria 2838048938 2838054395 462
280 iso_pu_bacteria 2838061910 2838068024 462
281 iso_pu_bacteria 2838068647 2838070152 462
282 iso_pu_bacteria 2838074704 2838076867 462
283 iso_pu_bacteria 2838122688 2838127895 462
284 iso_pu_bacteria 2838661181 2838661598 462
285 iso_pu_bacteria 2838668709 2838670351 462
286 iso_pu_bacteria 2838675328 2838675785 462
287 iso_pu_bacteria 2838680041 2838683477 462
288 iso_pu_bacteria 2838686498 2838687064 462
289 iso_pu_bacteria 2838694306 2838697580 462
290 iso_pu_bacteria 2838701080 2838702722 462
291 iso_pu_bacteria 2838707686 2838710696 462
292 iso_pu_bacteria 2838714209 2838714667 462
293 iso_pu_bacteria 2838719591 2838721532 462
294 iso_pu_bacteria 2838724970 2838725427 462
295 iso_pu_bacteria 2838729681 2838729963 462
296 iso_pu_bacteria 2838742623 2838743022 462
297 iso_pu_bacteria 2840764183 2840767422 462
298 iso_pu_bacteria 2841760612 2841760885 462
299 iso_pu_bacteria 2841846520 2841848484 462
300 iso_pu_bacteria 2841851746 2841852508 462
301 iso_pu_bacteria 2841859092 2841862115 462
302 iso_pu_bacteria 2841864319 2841870773 462
303 iso_pu_bacteria 2841911363 2841912877 462
304 iso_pu_bacteria 2841917233 2841918624 462
305 iso_pu_bacteria 2841941048 2841943188 462
306 iso_pu_bacteria 2841949485 2841954081 462
307 iso_pu_bacteria 2841966195 2841968171 462
308 iso_pu_bacteria 2841974524 2841976619 462
309 iso_pu_bacteria 2841983080 2841987992 462
310 iso_pu_bacteria 2842038055 2842042705 462
311 iso_pu_bacteria 2842045827 2842050748 462
312 iso_pu_bacteria 2842077413 2842078869 462
313 iso_pu_bacteria 2842110456 2842113279 462
314 iso_pu_bacteria 2842118031 2842118621 462
315 iso_pu_bacteria 2842124991 2842125485 462
316 iso_pu_bacteria 2842130223 2842130680 462
317 iso_pu_bacteria 2842146304 2842148020 462
318 iso_pu_bacteria 2842152218 2842154150 462
319 iso_pu_bacteria 2842156927 2842158032 462
320 iso_pu_bacteria 2842163707 2842168804 462
321 iso_pu_bacteria 2842170452 2842170911 462
322 iso_pu_bacteria 2842175837 2842177770 462
323 iso_pu_bacteria 2842180545 2842181651 462
324 iso_pu_bacteria 2842187318 2842187776 462
325 iso_pu_bacteria 2842192696 2842197348 462
326 iso_pu_bacteria 2842198810 2842203547 462
327 iso_pu_bacteria 2842205361 2842205489 462
328 iso_pu_bacteria 2842211629 2842212087 462
329 iso_pu_bacteria 2842217011 2842217927 462
330 iso_pu_bacteria 2842224351 2842226294 462
331 iso_pu_bacteria 2842229732 2842230298 462
332 iso_pu_bacteria 2842237096 2842240533 462
333 iso_pu_bacteria 2842243621 2842244200 462
334 iso_pu_bacteria 2842250916 2842253086 462
335 iso_pu_bacteria 2842257432 2842257714 462
336 iso_pu_bacteria 2842264693 2842266257 462
337 iso_pu_bacteria 2842271015 2842271398 462
338 iso_pu_bacteria 2842278818 2842278946 462
339 iso_pu_bacteria 2842285085 2842285610 462
340 iso_pu_bacteria 2842291075 2842292531 462
341 iso_pu_bacteria 2842298080 2842301361 462
342 iso_pu_bacteria 2842304105 2842305026 462
343 iso_pu_bacteria 2842311132 2842314922 462
344 iso_pu_bacteria 2842317721 2842320700 462
345 iso_pu_bacteria 2842341865 2842346449 462
346 iso_pu_bacteria 2842357229 2842357898 462
347 iso_pu_bacteria 2842363717 2842368972 462
348 iso_pu_bacteria 2842370503 2842374108 462
349 iso_pu_bacteria 2842377471 2842378929 462
350 iso_pu_bacteria 2842384541 2842385132 462
351 iso_pu_bacteria 2842395702 2842399893 462
352 iso_pu_bacteria 2842402390 2842402970 462
353 iso_pu_bacteria 2842409023 2842409658 462
354 iso_pu_bacteria 2842415677 2842416309 462
355 iso_pu_bacteria 2842422224 2842423766 462
356 iso_pu_bacteria 2842428310 2842430720 462
357 iso_pu_bacteria 2842434925 2842437293 462
358 iso_pu_bacteria 2842441272 2842443663 462
359 iso_pu_bacteria 2842447887 2842454042 462
360 iso_pu_bacteria 2842462802 2842464863 462
361 iso_pu_bacteria 2842469257 2842471911 462
362 iso_pu_bacteria 2842475841 2842476901 462
363 iso_pu_bacteria 2842482326 2842484569 462
364 iso_pu_bacteria 2842489311 2842491968 462
365 iso_pu_bacteria 2842495871 2842496836 462
366 iso_pu_bacteria 2842502639 2842503342 462
367 iso_pu_bacteria 2842509118 2842511138 462
368 iso_pu_bacteria 2842515876 2842518899 462
369 iso_pu_bacteria 2842521101 2842521806 462
370 iso_pu_bacteria 2842694124 2842697046 462
371 iso_pu_bacteria 2842698319 2842702400 462
372 iso_pu_bacteria 2842922631 2842924148 462
373 iso_pu_bacteria 2844104063 2844106542 462
374 iso_pu_bacteria 2844163670 2844164564 462
375 iso_pu_bacteria 2844315083 2844316915 462
376 iso_pu_bacteria 2844454524 2844458431 462
377 iso_pu_bacteria 2847417321 2847419389 462
378 iso_pu_bacteria 2847930680 2847938562 462
379 iso_pu_bacteria 2847939898 2847944238 462
380 iso_pu_bacteria 2848992105 2848994416 462
381 iso_pu_bacteria 2849076700 2849081529 462
382 iso_pu_bacteria 2850079185 2850081459 462
383 iso_pu_bacteria 2851182111 2851187535 462
384 iso_pu_bacteria 2851246043 2851246898 462
385 iso_pu_bacteria 2852387548 2852390215 462
386 iso_pu_bacteria 2855825444 2855826336 462
387 iso_pu_bacteria 2855839649 2855841726 462
388 iso_pu_bacteria 2855872281 2855872529 462
389 iso_pu_bacteria 2857509624 2857512188 462
390 iso_pu_bacteria 2857516855 2857517443 462
391 iso_pu_bacteria 2857524615 2857529966 462
392 iso_pu_bacteria 2858800743 2858802511 462
393 iso_pu_bacteria 2861691609 2861693453 462
394 iso_pu_bacteria 2874604998 2874612592 462
395 iso_pu_bacteria 2874612657 2874617698 462
396 iso_pu_bacteria 2874620515 2874623436 462
397 iso_pu_bacteria 2874628541 2874630654 462
398 iso_pu_bacteria 2876761206 2876762403 462
399 iso_pu_bacteria 2876808645 2876812894 462
400 iso_pu_bacteria 2879099564 2879101349 462
401 iso_pu_bacteria 2879110137 2879118033 462
402 iso_pu_bacteria 2879127579 2879130504 462
403 iso_pu_bacteria 2879142872 2879146390 462
404 iso_pu_bacteria 2881364244 2881370680 462
405 iso_pu_bacteria 2881665667 2881672685 462
406 iso_pu_bacteria 2885366525 2885366935 462
407 iso_pu_bacteria 2885374607 2885378765 462
408 iso_pu_bacteria 2885383462 2885384489 462
409 iso_pu_bacteria 2885409591 2885413433 462
410 iso_pu_bacteria 2888378607 2888381525 462
411 iso_pu_bacteria 2888388044 2888389114 462
412 iso_pu_bacteria 2888419890 2888421928 462
413 iso_pu_bacteria 2889033259 2889033622 462
414 iso_pu_bacteria 2891373044 2891373339 462
415 iso_pu_bacteria 2893066018 2893069391 462
416 iso_pu_bacteria 2894817345 2894820350 462
417 iso_pu_bacteria 2896384573 2896389034 462
418 iso_pu_bacteria 2899792073 2899796061 462
419 iso_pu_bacteria 2899845264 2899850639 462
420 iso_pu_bacteria 2903727486 2903733965 462
421 iso_pu_bacteria 2903748898 2903751425 462
422 iso_pu_bacteria 2903768456 2903773625 462
423 iso_pu_bacteria 2904666416 2904667333 462
424 iso_pu_bacteria 2904690495 2904697726 462
425 iso_pu_bacteria 2904699407 2904705788 462
426 iso_pu_bacteria 2904711408 2904719227 462
427 iso_pu_bacteria 2906602504 2906604581 462
428 iso_pu_bacteria 2906610324 2906611462 462
429 iso_pu_bacteria 2906626472 2906635178 462
430 iso_pu_bacteria 2906635258 2906641700 462
431 iso_pu_bacteria 2906643746 2906651201 462
432 iso_pu_bacteria 2906660503 2906660802 462
433 iso_pu_bacteria 2908739725 2908745054 462
434 iso_pu_bacteria 2908756301 2908757177 462
435 iso_pu_bacteria 2908775508 2908781599 462
436 iso_pu_bacteria 2909042592 2909044262 462
437 iso_pu_bacteria 2913295892 2913299319 462
438 iso_pu_bacteria 2913308742 2913312559 462
439 iso_pu_bacteria 2915980308 2915981435 462
440 iso_pu_bacteria 2915986958 2915988285 462
441 iso_pu_bacteria 2915993759 2915998696 462
442 iso_pu_bacteria 2916000859 2916003491 462
443 iso_pu_bacteria 2916007675 2916011661 462
444 iso_pu_bacteria 2916014648 2916020773 462
445 iso_pu_bacteria 2916021584 2916024962 462
446 iso_pu_bacteria 2916028427 2916033775 462
447 iso_pu_bacteria 2916035215 2916037862 462
448 iso_pu_bacteria 2916041962 2916045338 462
449 iso_pu_bacteria 2916048683 2916049038 462
450 iso_pu_bacteria 2916055098 2916055724 462
451 iso_pu_bacteria 2916061851 2916064908 462
452 iso_pu_bacteria 2916068649 2916073999 462
453 iso_pu_bacteria 2916076590 2916082594 462
454 iso_pu_bacteria 2917699015 2917704755 462
455 iso_pu_bacteria 2919073203 2919077181 462
456 iso_pu_bacteria 2919100787 2919107666 462
457 iso_pu_bacteria 2919114240 2919114705 462
458 iso_pu_bacteria 2919166419 2919169234 462
459 iso_pu_bacteria 2919408235 2919409971 462
460 iso_pu_bacteria 2919450847 2919452462 462
461 iso_pu_bacteria 2921201388 2921203056 462
462 iso_pu_bacteria 2921208531 2921211116 462
463 iso_pu_bacteria 2921237296 2921240934 462
464 iso_pu_bacteria 2921244191 2921246778 462
465 iso_pu_bacteria 2921250672 2921252082 462
466 iso_pu_bacteria 2921257292 2921261403 462
467 iso_pu_bacteria 2921263974 2921266205 462
468 iso_pu_bacteria 2921282425 2921287971 462
469 iso_pu_bacteria 2921289301 2921290960 462
470 iso_pu_bacteria 2921296804 2921298406 462
471 iso_pu_bacteria 2922361189 2922366990 462
472 iso_pu_bacteria 2922368715 2922371193 462
473 iso_pu_bacteria 2922386360 2922390228 462
474 iso_pu_bacteria 2922393267 2922393565 462
475 iso_pu_bacteria 2922425934 2922427895 462
476 iso_pu_bacteria 2923556063 2923558564 462
477 iso_pu_bacteria 2924144063 2924146758 462
478 iso_pu_bacteria 2924150972 2924157996 462
479 iso_pu_bacteria 2924158325 2924159270 462
480 iso_pu_bacteria 2924165586 2924169165 462
481 iso_pu_bacteria 2924172951 2924174573 462
482 iso_pu_bacteria 2924179722 2924183004 462
483 iso_pu_bacteria 2924186466 2924192715 462
484 iso_pu_bacteria 2924193448 2924195380 462
485 iso_pu_bacteria 2924200457 2924203329 462
486 iso_pu_bacteria 2924207177 2924210748 462
487 iso_pu_bacteria 2924214083 2924217481 462
488 iso_pu_bacteria 2924221636 2924223298 462
489 iso_pu_bacteria 2924228884 2924230516 462
490 iso_pu_bacteria 2926754445 2926755721 462
491 iso_pu_bacteria 2926760298 2926762836 462
492 iso_pu_bacteria 2929615660 2929619577 462
493 iso_pu_bacteria 2929624759 2929627953 462
494 iso_pu_bacteria 2932784394 2932785907 462
495 iso_pu_bacteria 2932794094 2932798313 462
496 iso_pu_bacteria 2932801729 2932804109 462
497 iso_pu_bacteria 2932809354 2932817277 462
498 iso_pu_bacteria 2932818245 2932826874 462
499 iso_pu_bacteria 2932828146 2932830951 462
500 iso_pu_bacteria 2933006813 2933008795 462
501 iso_pu_bacteria 2933011516 2933014927 462
502 iso_pu_bacteria 2933016740 2933019436 462
503 iso_pu_bacteria 2933570622 2933570834 462
504 iso_pu_bacteria 2933577622 2933581497 462
505 iso_pu_bacteria 2933586486 2933588665 462
506 iso_pu_bacteria 2933594066 2933596604 462
507 iso_pu_bacteria 2933599457 2933600958 462
508 iso_pu_bacteria 2935608549 2935612752 462
509 iso_pu_bacteria 2935616580 2935621016 462
510 iso_pu_bacteria 2935630451 2935632178 462
511 iso_pu_bacteria 2935638405 2935640092 462
512 iso_pu_bacteria 2935648319 2935656720 462
513 iso_pu_bacteria 2935656913 2935665541 462
514 iso_pu_bacteria 2935665750 2935667069 462
515 iso_pu_bacteria 2935675223 2935680288 462
516 iso_pu_bacteria 2935684952 2935690201 462
517 iso_pu_bacteria 2935694250 2935699713 462
518 iso_pu_bacteria 2935703347 2935704825 462
519 iso_pu_bacteria 2935713505 2935718102 462
520 iso_pu_bacteria 2935722832 2935726748 462
521 iso_pu_bacteria 2935732158 2935735517 462
522 iso_pu_bacteria 2935741537 2935745212 462
523 iso_pu_bacteria 2935750917 2935755212 462
524 iso_pu_bacteria 2935760218 2935762270 462
525 iso_pu_bacteria 2935769743 2935773658 462
526 iso_pu_bacteria 2935777560 2935780213 462
527 iso_pu_bacteria 2935785616 2935788437 462
528 iso_pu_bacteria 2935793552 2935796593 462
529 iso_pu_bacteria 2935801545 2935803773 462
530 iso_pu_bacteria 2935810662 2935811688 462
531 iso_pu_bacteria 2935819856 2935824241 462
532 iso_pu_bacteria 2935827899 2935829575 462
533 iso_pu_bacteria 2935837841 2935843091 462
534 iso_pu_bacteria 2935847175 2935852612 462
535 iso_pu_bacteria 2935855204 2935858823 462
536 iso_pu_bacteria 2935864058 2935866779 462
537 iso_pu_bacteria 2935873716 2935876910 462
538 iso_pu_bacteria 2935883170 2935884085 462
539 iso_pu_bacteria 2935894831 2935897035 462
540 iso_pu_bacteria 2935901341 2935901968 462
541 iso_pu_bacteria 2935908558 2935912242 462
542 iso_pu_bacteria 2935916978 2935924084 462
543 iso_pu_bacteria 2935926038 2935929271 462
544 iso_pu_bacteria 2935934488 2935935902 462
545 iso_pu_bacteria 2935942939 2935950410 462
546 iso_pu_bacteria 2935951376 2935957432 462
547 iso_pu_bacteria 2935959822 2935962045 462
548 iso_pu_bacteria 2935967501 2935968463 462
549 iso_pu_bacteria 2935984226 2935990724 462
550 iso_pu_bacteria 2935992306 2935993453 462
551 iso_pu_bacteria 2936002035 2936004348 462
552 iso_pu_bacteria 2936011229 2936019583 462
553 iso_pu_bacteria 2936019824 2936028199 462
554 iso_pu_bacteria 2936028420 2936037072 462
555 iso_pu_bacteria 2936037263 2936038270 462
556 iso_pu_bacteria 2936046547 2936055056 462
557 iso_pu_bacteria 2936055302 2936058608 462
558 iso_pu_bacteria 2936367885 2936372047 462
559 iso_pu_bacteria 2936375103 2936379910 462
560 iso_pu_bacteria 2936381700 2936382814 462
561 iso_pu_bacteria 2936996657 2937000700 462
562 iso_pu_bacteria 2937002841 2937004564 462
563 iso_pu_bacteria 2937009748 2937011192 462
564 iso_pu_bacteria 2937016420 2937019829 462
565 iso_pu_bacteria 2937023124 2937024578 462
566 iso_pu_bacteria 2937029754 2937030281 462
567 iso_pu_bacteria 2937036028 2937042663 462
568 iso_pu_bacteria 2937042894 2937045534 462
569 iso_pu_bacteria 2937049772 2937055111 462
570 iso_pu_bacteria 2937056579 2937063576 462
571 iso_pu_bacteria 2937063883 2937067768 462
572 iso_pu_bacteria 2937071275 2937074385 462
573 iso_pu_bacteria 2937078374 2937080281 462
574 iso_pu_bacteria 2937084907 2937086020 462
575 iso_pu_bacteria 2937091812 2937097215 462
576 iso_pu_bacteria 2937098957 2937103041 462
577 iso_pu_bacteria 2937106411 2937113295 462
578 iso_pu_bacteria 2937113482 2937116150 462
579 iso_pu_bacteria 2937119839 2937121979 462
580 iso_pu_bacteria 2937126314 2937128820 462
581 iso_pu_bacteria 2937843397 2937847998 462
582 iso_pu_bacteria 2940556831 2940561507 462
583 iso_pu_bacteria 2941499720 2941502145 462
584 iso_pu_bacteria 2941507105 2941508126 462
585 iso_pu_bacteria 2941515067 2941515369 462
586 iso_pu_bacteria 2941523033 2941524056 462
587 iso_pu_bacteria 2941531003 2941533697 462
588 iso_pu_bacteria 2941538514 2941544315 462
589 iso_pu_bacteria 2957375807 2957376390 462
590 iso_pu_bacteria 2957382221 2957384283 462
591 iso_pu_bacteria 2957388812 2957390746 462
592 iso_pu_bacteria 2957395598 2957395902 462
593 iso_pu_bacteria 2957402308 2957404508 462
594 iso_pu_bacteria 2957408893 2957412095 462
595 iso_pu_bacteria 2957415311 2957421203 462
596 iso_pu_bacteria 2957430029 2957431710 462
597 iso_pu_bacteria 2957443900 2957446914 462
598 iso_pu_bacteria 2957450854 2957453756 462
599 iso_pu_bacteria 2957457609 2957461619 462
600 iso_pu_bacteria 2957464669 2957467050 462
601 iso_pu_bacteria 2957471148 2957476394 462
602 iso_pu_bacteria 2957478035 2957479610 462
603 iso_pu_bacteria 2957484790 2957490468 462
604 iso_pu_bacteria 2957491536 2957494101 462
605 iso_pu_bacteria 2957498199 2957503304 462
606 iso_pu_bacteria 2957505466 2957510608 462
607 iso_pu_bacteria 2960584000 2960585412 462
608 iso_pu_bacteria 2960591022 2960592081 462
609 iso_pu_bacteria 2960597568 2960599999 462
610 iso_pu_bacteria 2960603979 2960610583 462
611 iso_pu_bacteria 2960610863 2960612322 462
612 iso_pu_bacteria 2960617483 2960620458 462
613 iso_pu_bacteria 2960624210 2960624487 462
614 iso_pu_bacteria 2960631154 2960632041 462
615 iso_pu_bacteria 2960637947 2960644130 462
616 iso_pu_bacteria 2960645483 2960648421 462
617 iso_pu_bacteria 2960652885 2960656532 462
618 iso_pu_bacteria 2960660292 2960665573 462
619 iso_pu_bacteria 2960667422 2960669652 462
620 iso_pu_bacteria 2960674078 2960675166 462
621 iso_pu_bacteria 2960680706 2960681616 462
622 iso_pu_bacteria 2960687367 2960691474 462
623 iso_pu_bacteria 2960693952 2960694808 462
624 iso_pu_bacteria 2964607997 2964609778 462
625 iso_pu_bacteria 2964615318 2964617754 462
626 iso_pu_bacteria 2964621998 2964623639 462
627 iso_pu_bacteria 2964628898 2964632580 462
628 iso_pu_bacteria 2964636051 2964640825 462
629 iso_pu_bacteria 2964643177 2964645692 462
630 iso_pu_bacteria 2964649959 2964651549 462
631 iso_pu_bacteria 2964656573 2964660519 462
632 iso_pu_bacteria 2964663802 2964666929 462
633 iso_pu_bacteria 2964678106 2964682868 462
634 iso_pu_bacteria 2964685014 2964688476 462
635 iso_pu_bacteria 2964691889 2964692473 462
636 iso_pu_bacteria 2964698721 2964701649 462
637 iso_pu_bacteria 2964705432 2964711099 462
638 iso_pu_bacteria 2964712639 2964715166 462
639 iso_pu_bacteria 2964719344 2964720672 462
640 iso_pu_bacteria 2967664464 2967666387 462
641 iso_pu_bacteria 2967671571 2967678420 462
642 iso_pu_bacteria 2967678726 2967684432 462
643 iso_pu_bacteria 2967686174 2967689722 462
644 iso_pu_bacteria 2967693043 2967694637 462
645 iso_pu_bacteria 2967699805 2967704072 462
646 iso_pu_bacteria 2967706974 2967708615 462
647 iso_pu_bacteria 2967714385 2967714868 462
648 iso_pu_bacteria 2967721400 2967726130 462
649 iso_pu_bacteria 2967728569 2967729000 462
650 iso_pu_bacteria 2967735183 2967737141 462
651 iso_pu_bacteria 2967748971 2967751609 462
652 iso_pu_bacteria 2967755722 2967760011 462
653 iso_pu_bacteria 2967762386 2967767508 462
654 iso_pu_bacteria 2967769361 2967772127 462
655 iso_pu_bacteria 2967775926 2967782233 462
656 iso_pu_bacteria 2970019648 2970021068 462
657 iso_pu_bacteria 2970026789 2970028350 462
658 iso_pu_bacteria 2970033650 2970040283 462
659 iso_pu_bacteria 2970040964 2970042633 462
660 iso_pu_bacteria 2970047711 2970050964 462
661 iso_pu_bacteria 2970054988 2970056694 462
662 iso_pu_bacteria 2970061556 2970067136 462
663 iso_pu_bacteria 2970068827 2970071580 462
664 iso_pu_bacteria 2970076120 2970078256 462
665 iso_pu_bacteria 2970082768 2970085238 462
666 iso_pu_bacteria 2970088815 2970092540 462
667 iso_pu_bacteria 2970095765 2970102162 462
668 iso_pu_bacteria 2970102677 2970108005 462
669 iso_pu_bacteria 2970109326 2970110702 462
670 iso_pu_bacteria 2970116247 2970117348 462
671 iso_pu_bacteria 2970122695 2970125829 462
672 iso_pu_bacteria 2970129317 2970131172 462
673 iso_pu_bacteria 2970136068 2970136286 462
674 iso_pu_bacteria 2970143518 2970146735 462
675 iso_pu_bacteria 2970149975 2970151622 462
676 iso_pu_bacteria 2970156795 2970159561 462
677 iso_pu_bacteria 2970164137 2970166984 462
678 iso_pu_bacteria 2970170962 2970174236 462
679 iso_pu_bacteria 2970177841 2970180818 462
680 iso_pu_bacteria 2970184632 2970189163 462
681 iso_pu_bacteria 2970191845 2970193593 462
682 iso_pu_bacteria 2977516862 2977519109 462
683 iso_pu_bacteria 2977523885 2977526322 462
684 iso_pu_bacteria 2977530762 2977534062 462
685 iso_pu_bacteria 2977537788 2977539619 462
686 iso_pu_bacteria 2977544691 2977546353 462
687 iso_pu_bacteria 2977551784 2977558425 462
688 iso_pu_bacteria 2977558990 2977564446 462
689 iso_pu_bacteria 2977565890 2977567658 462
690 iso_pu_bacteria 2977572785 2977575753 462
691 iso_pu_bacteria 2977579622 2977582004 462
692 iso_pu_bacteria 2978969890 2978974610 462
693 iso_pu_bacteria 2979089926 2979094671 462
694 iso_pu_bacteria 2979095461 2979100764 462
695 iso_pu_bacteria 2979100975 2979103906 462
696 iso_pu_bacteria 2984509177 2984511527 462
697 iso_pu_bacteria 2984518228 2984522112 462
698 iso_pu_bacteria 2984537506 2984541410 462
699 iso_pu_bacteria 2984587000 2984589931 462
700 iso_pu_bacteria 2984601300 2984603688 462
701 iso_pu_bacteria 2989349275 2989349663 462
702 iso_pu_bacteria 2989771324 2989774278 462
703 iso_pu_bacteria 2996887358 2996889047 462
704 iso_pu_bacteria 2996893221 2996894340 462
705 iso_pu_bacteria 3002141150 3002144748 462
706 iso_pu_bacteria 3005416602 3005419479 462
707 iso_pu_bacteria 3005445848 3005448437 462
708 iso_pu_bacteria 3005452660 3005454627 462
709 iso_pu_bacteria 3005483717 3005486184 462
710 iso_pu_bacteria 3005506211 3005507125 462
711 iso_pu_bacteria 3005587118 3005588497 462
712 iso_pu_bacteria 3005594810 3005596549 462
713 iso_pu_bacteria 3005710791 3005712617 462
714 iso_pu_bacteria 3005718088 3005719678 462
715 iso_pu_bacteria 639633055 639649179 462
716 iso_pu_bacteria 648276728 648739205 462
717 iso_pu_bacteria 650716007 650740550 462
718 iso_pu_bacteria 8001845381 8001846144 462
719 iso_pu_bacteria 8002060224 8002062555 462
720 iso_pu_bacteria 8003570095 8003571615 462
721 iso_pu_bacteria 8003992118 8003994159 462
722 iso_pu_bacteria 8003999396 8004001791 462
723 iso_pu_bacteria 8005258706 8005260296 462
724 iso_pu_bacteria 8005275841 8005281197 462
725 iso_pu_bacteria 8005282627 8005283267 462
726 iso_pu_bacteria 8005289223 8005293627 462
727 iso_pu_bacteria 8005301065 8005303112 462
728 iso_pu_bacteria 8005307578 8005312821 462
729 iso_pu_bacteria 8005314921 8005316770 462
730 iso_pu_bacteria 8005321885 8005323574 462
731 iso_pu_bacteria 8005376324 8005380915 462
732 iso_pu_bacteria 8005382845 8005389135 462
733 iso_pu_bacteria 8005395548 8005396115 462
734 iso_pu_bacteria 8005430974 8005435144 462
735 iso_pu_bacteria 8005460587 8005463674 462
736 iso_pu_bacteria 8005484373 8005489196 462
737 iso_pu_bacteria 8005497431 8005500886 462
738 iso_pu_bacteria 8005556819 8005557028 462
739 iso_pu_bacteria 8005563573 8005567980 462
740 iso_pu_bacteria 8005570704 8005573475 462
741 iso_pu_bacteria 8005619151 8005622259 462
742 iso_pu_bacteria 8005626139 8005632261 462
743 iso_pu_bacteria 8005645114 8005648128 462
744 iso_pu_bacteria 8005668836 8005672303 462
745 iso_pu_bacteria 8005682033 8005682898 462
746 iso_pu_bacteria 8005688590 8005692120 462
747 iso_pu_bacteria 8005695170 8005697387 462
748 iso_pu_bacteria 8006933436 8006933613 462
749 iso_pu_bacteria 8006964411 8006966526 462
750 iso_pu_bacteria 8006973647 8006983286 462
751 iso_pu_bacteria 8006984368 8006989354 462
752 iso_pu_bacteria 8006994254 8006997836 462
753 iso_pu_bacteria 8016511872 8016516434 462
754 iso_pu_bacteria 8016522445 8016523834 462
755 iso_pu_bacteria 8016530956 8016537366 462
756 iso_pu_bacteria 8016539877 8016541635 462
757 iso_pu_bacteria 8016548790 8016551633 462
758 iso_pu_bacteria 8016557553 8016560019 462
759 iso_pu_bacteria 8016566248 8016567021 462
760 iso_pu_bacteria 8016575299 8016579741 462
761 iso_pu_bacteria 8016583857 8016589132 462
762 iso_pu_bacteria 8016595262 8016597944 462
763 iso_pu_bacteria 8016603502 8016604084 462
764 iso_pu_bacteria 8016613128 8016620666 462
765 iso_pu_bacteria 8016622563 8016629332 462
766 iso_pu_bacteria 8016630954 8016633847 462
767 iso_pu_bacteria 8017057580 8017060103 462
768 iso_pu_bacteria 8018127388 8018134081 462
769 iso_pu_bacteria 8018163183 8018164639 462
770 iso_pu_bacteria 8018176218 8018181338 462
771 iso_pu_bacteria 8019530166 8019537049 462
772 iso_pu_bacteria 8019538911 8019542491 462
773 iso_pu_bacteria 8019565922 8019569653 462
774 iso_pu_bacteria 8019576017 8019579613 462
775 iso_pu_bacteria 8019597564 8019604017 462
776 iso_pu_bacteria 8019608314 8019614511 462
777 iso_pu_bacteria 8019648815 8019650024 462
778 iso_pu_bacteria 8023680758 8023683181 462
779 iso_pu_bacteria 8024479707 8024482876 462
780 iso_pu_bacteria 8024486573 8024488018 462
781 iso_pu_bacteria 8024501048 8024504410 462
782 iso_pu_bacteria 8045864390 8045864590 462
783 iso_pu_bacteria 8049293176 8049295313 462
784 iso_pu_bacteria 8054558443 8054562936 462
785 iso_pu_bacteria 8055742211 8055749165 462
786 iso_pu_bacteria 8056375014 8056375921 462
787 iso_pu_bacteria 8056382006 8056386712 462
788 iso_pu_bacteria 8056681323 8056682383 462
789 iso_pu_bacteria 8056689827 8056695170 462
790 iso_pu_bacteria 8056967851 8056969722 462
791 iso_pu_bacteria 8057529695 8057530898 462
792 iso_pu_bacteria 8057575449 8057575746 462
793 iso_pu_bacteria 8057874678 8057877687 462
794 3300005563 Ga0068855_100092034 Ga0068855_1000920342 464
795 3300025912 Ga0207707_10030844 Ga0207707_100308442 464
796 3300025913 Ga0207695_10264854 Ga0207695_102648541 464
797 3300025921 Ga0207652_10055858 Ga0207652_100558583 464
798 3300025949 Ga0207667_10020500 Ga0207667_100205002 464
799 3300042145 Ga0450906_003061 Ga0450906_003061_1996_3405 464
800 3300046512 Ga0495610_0012085 Ga0495610_0012085_1044_2453 464
801 3300048925 Ga0496122_0017720 Ga0496122_0017720_1075_2484 464
802 3300048926 Ga0496123_0011423 Ga0496123_0011423_2534_3943 464
803 3300048927 Ga0496124_0037114 Ga0496124_0037114_2722_4131 464
804 3300048928 Ga0496125_0006049 Ga0496125_0006049_7753_9162 464
805 iso_pu_bacteria 8054563764 8054568615 464
806 3300002987 JGI25159J45721_1002735 JGI25159J45721_10027353 465
807 3300005262 Ga0065165_1000141 Ga0065165_100014124 465
808 3300025284 Ga0209130_1000178 Ga0209130_100017824 465
809 3300025302 Ga0207426_1027642 Ga0207426_10276422 465
810 3300025901 Ga0207688_10045412 Ga0207688_100454122 465
811 3300031548 Ga0307408_100145955 Ga0307408_1001459552 465
812 3300032126 Ga0307415_100156342 Ga0307415_1001563422 465
813 3300039450 Ga0436363_0693856 Ga0436363_0693856_67_1485 465
814 3300044735 Ga0466968_0003374 Ga0466968_0003374_969_2375 465
815 3300045049 Ga0466959_0026291 Ga0466959_0026291_2453_3862 465
816 3300046533 Ga0495640_0018229 Ga0495640_0018229_1988_3397 465
817 3300048922 Ga0496119_0000903 Ga0496119_0000903_37239_38636 465
818 3300048925 Ga0496122_0004307 Ga0496122_0004307_16403_17800 465
819 3300053104 Ga0500556_0005856 Ga0500556_0005856_1968_3365 465
820 3300053730 Ga0500645_001299 Ga0500645_001299_10077_11474 465
821 3300000041 ARcpr5oldR_c000516 ARcpr5oldR_0005162 466
822 3300000042 ARSoilYngRDRAFT_c00728 ARSoilYngRDRAFT_007283 466
823 3300000043 ARcpr5yngRDRAFT_c000549 ARcpr5yngRDRAFT_0005492 466
824 3300000044 ARSoilOldRDRAFT_c000275 ARSoilOldRDRAFT_0002752 466
825 3300000652 ARCol0yngRDRAFT_1000490 ARCol0yngRDRAFT_10004902 466
826 3300001977 JGI24746J21847_1000658 JGI24746J21847_10006584 466
827 3300001979 JGI24740J21852_10002709 JGI24740J21852_100027092 466
828 3300001989 JGI24739J22299_10000203 JGI24739J22299_100002033 466
829 3300001990 JGI24737J22298_10003052 JGI24737J22298_100030526 466
830 3300002070 JGI24750J21931_1000206 JGI24750J21931_10002066 466
831 3300002070 JGI24750J21931_1000813 JGI24750J21931_10008134 466
832 3300002073 JGI24745J21846_1000036 JGI24745J21846_10000362 466
833 3300002074 JGI24748J21848_1000461 JGI24748J21848_10004613 466
834 3300002075 JGI24738J21930_10001355 JGI24738J21930_100013556 466
835 3300002076 JGI24749J21850_1001705 JGI24749J21850_10017052 466
836 3300002077 JGI24744J21845_10006569 JGI24744J21845_100065692 466
837 3300002126 JGI24035J26624_1000184 JGI24035J26624_10001845 466
838 3300002239 JGI24034J26672_10001100 JGI24034J26672_100011003 466
839 3300002244 JGI24742J22300_10000210 JGI24742J22300_100002102 466
840 3300002459 JGI24751J29686_10014198 JGI24751J29686_100141981 466
841 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000148 466
842 3300002738 JGI25154J39366_1000122 JGI25154J39366_10001229 466
843 3300002738 JGI25154J39366_1000150 JGI25154J39366_100015050 466
844 3300002739 JGI25158J39367_1000038 JGI25158J39367_10000388 466
845 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004447 466
846 3300002773 JGI25152J39213_1001384 JGI25152J39213_10013848 466
847 3300002774 JGI25150J39212_1000107 JGI25150J39212_100010714 466
848 3300002774 JGI25150J39212_1003225 JGI25150J39212_10032254 466
849 3300002774 JGI25150J39212_1004915 JGI25150J39212_10049152 466
850 3300002987 JGI25159J45721_1000154 JGI25159J45721_10001546 466
851 3300003187 JGI25151J46595_10000028 JGI25151J46595_10000028134 466
852 3300003187 JGI25151J46595_10000374 JGI25151J46595_1000037432 466
853 3300003187 JGI25151J46595_10000839 JGI25151J46595_1000083912 466
854 3300003187 JGI25151J46595_10016744 JGI25151J46595_100167442 466
855 3300003187 JGI25151J46595_10029284 JGI25151J46595_100292841 466
856 3300003203 JGI25406J46586_10000392 JGI25406J46586_100003921 466
857 3300003203 JGI25406J46586_10003218 JGI25406J46586_100032183 466
858 3300003214 JGI25165J46597_1001042 JGI25165J46597_10010427 466
859 3300003214 JGI25165J46597_1006320 JGI25165J46597_10063202 466
860 3300003215 JGI25153J46596_10000696 JGI25153J46596_1000069610 466
861 3300003215 JGI25153J46596_10003837 JGI25153J46596_100038375 466
862 3300003215 JGI25153J46596_10004141 JGI25153J46596_100041412 466
863 3300003215 JGI25153J46596_10004246 JGI25153J46596_100042463 466
864 3300003215 JGI25153J46596_10006403 JGI25153J46596_100064037 466
865 3300003215 JGI25153J46596_10015480 JGI25153J46596_100154802 466
866 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001661 466
867 3300003354 JGI25160J50197_1001885 JGI25160J50197_10018853 466
868 3300003354 JGI25160J50197_1003307 JGI25160J50197_10033073 466
869 3300003354 JGI25160J50197_1004587 JGI25160J50197_10045872 466
870 3300003354 JGI25160J50197_1008344 JGI25160J50197_10083443 466
871 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000192 466
872 3300003374 JGI25161J50226_1000174 JGI25161J50226_100017430 466
873 3300003659 JGI25404J52841_10002804 JGI25404J52841_100028041 466
874 3300003659 JGI25404J52841_10015585 JGI25404J52841_100155851 466
875 3300003771 Ga0055526_1000597 Ga0055526_100059717 466
876 3300003771 Ga0055526_1000802 Ga0055526_10008028 466
877 3300003771 Ga0055526_1001522 Ga0055526_100152211 466
878 3300003771 Ga0055526_1003626 Ga0055526_10036267 466
879 3300003771 Ga0055526_1007634 Ga0055526_10076342 466
880 3300003771 Ga0055526_1020097 Ga0055526_10200972 466
881 3300003775 Ga0055524_1000020 Ga0055524_1000020211 466
882 3300003775 Ga0055524_1004279 Ga0055524_10042792 466
883 3300003775 Ga0055524_1004359 Ga0055524_10043593 466
884 3300003775 Ga0055524_1004387 Ga0055524_10043875 466
885 3300003775 Ga0055524_1014554 Ga0055524_10145543 466
886 3300003790 Ga0055528_1001199 Ga0055528_10011994 466
887 3300003790 Ga0055528_1002181 Ga0055528_10021817 466
888 3300003790 Ga0055528_1005051 Ga0055528_10050514 466
889 3300003792 Ga0055540_1000929 Ga0055540_10009297 466
890 3300003792 Ga0055540_1003312 Ga0055540_10033125 466
891 3300003794 Ga0055531_10005281 Ga0055531_100052815 466
892 3300004625 Ga0055543_1000003 Ga0055543_1000003108 466
893 3300004625 Ga0055543_1000350 Ga0055543_10003503 466
894 3300004625 Ga0055543_1000500 Ga0055543_100050012 466
895 3300005262 Ga0065165_1000068 Ga0065165_100006861 466
896 3300005262 Ga0065165_1004626 Ga0065165_10046265 466
897 3300005262 Ga0065165_1004931 Ga0065165_10049313 466
898 3300005262 Ga0065165_1011468 Ga0065165_10114681 466
899 3300005262 Ga0065165_1014773 Ga0065165_10147732 466
900 3300005290 Ga0065712_10001033 Ga0065712_100010337 466
901 3300005290 Ga0065712_10003647 Ga0065712_100036474 466
902 3300005293 Ga0065715_10006009 Ga0065715_100060091 466
903 3300005293 Ga0065715_10091317 Ga0065715_100913171 466
904 3300005295 Ga0065707_10131552 Ga0065707_101315522 466
905 3300005327 Ga0070658_10038187 Ga0070658_100381873 466
906 3300005328 Ga0070676_10000499 Ga0070676_1000049913 466
907 3300005328 Ga0070676_10007528 Ga0070676_100075286 466
908 3300005329 Ga0070683_100000265 Ga0070683_10000026514 466
909 3300005329 Ga0070683_100150071 Ga0070683_1001500712 466
910 3300005330 Ga0070690_100000718 Ga0070690_1000007183 466
911 3300005330 Ga0070690_100026323 Ga0070690_1000263233 466
912 3300005331 Ga0070670_100006298 Ga0070670_1000062985 466
913 3300005331 Ga0070670_100014626 Ga0070670_1000146263 466
914 3300005331 Ga0070670_100039987 Ga0070670_1000399873 466
915 3300005331 Ga0070670_100090453 Ga0070670_1000904532 466
916 3300005331 Ga0070670_100102718 Ga0070670_1001027182 466
917 3300005333 Ga0070677_10001854 Ga0070677_100018542 466
918 3300005334 Ga0068869_100000792 Ga0068869_1000007921 466
919 3300005335 Ga0070666_10018983 Ga0070666_100189833 466
920 3300005336 Ga0070680_100001359 Ga0070680_1000013594 466
921 3300005336 Ga0070680_100007344 Ga0070680_1000073443 466
922 3300005336 Ga0070680_100016152 Ga0070680_1000161526 466
923 3300005336 Ga0070680_100067602 Ga0070680_1000676022 466
924 3300005336 Ga0070680_100075252 Ga0070680_1000752522 466
925 3300005337 Ga0070682_100000745 Ga0070682_10000074513 466
926 3300005337 Ga0070682_100037232 Ga0070682_1000372322 466
927 3300005338 Ga0068868_100007218 Ga0068868_1000072182 466
928 3300005338 Ga0068868_100012356 Ga0068868_1000123565 466
929 3300005338 Ga0068868_100119237 Ga0068868_1001192371 466
930 3300005338 Ga0068868_100133070 Ga0068868_1001330702 466
931 3300005339 Ga0070660_100000136 Ga0070660_10000013632 466
932 3300005339 Ga0070660_100002003 Ga0070660_1000020039 466
933 3300005339 Ga0070660_100043329 Ga0070660_1000433292 466
934 3300005340 Ga0070689_100000722 Ga0070689_10000072213 466
935 3300005340 Ga0070689_100001379 Ga0070689_1000013794 466
936 3300005341 Ga0070691_10000148 Ga0070691_1000014813 466
937 3300005343 Ga0070687_100000080 Ga0070687_10000008013 466
938 3300005343 Ga0070687_100057571 Ga0070687_1000575712 466
939 3300005344 Ga0070661_100000425 Ga0070661_1000004255 466
940 3300005344 Ga0070661_100059571 Ga0070661_1000595712 466
941 3300005345 Ga0070692_10000893 Ga0070692_100008936 466
942 3300005345 Ga0070692_10042477 Ga0070692_100424772 466
943 3300005345 Ga0070692_10063725 Ga0070692_100637252 466
944 3300005353 Ga0070669_100000276 Ga0070669_10000027614 466
945 3300005353 Ga0070669_100002660 Ga0070669_1000026608 466
946 3300005353 Ga0070669_100053883 Ga0070669_1000538832 466
947 3300005354 Ga0070675_100000271 Ga0070675_10000027113 466
948 3300005354 Ga0070675_100097097 Ga0070675_1000970972 466
949 3300005354 Ga0070675_100154622 Ga0070675_1001546222 466
950 3300005355 Ga0070671_100000389 Ga0070671_10000038913 466
951 3300005355 Ga0070671_100018200 Ga0070671_1000182005 466
952 3300005355 Ga0070671_100023087 Ga0070671_1000230872 466
953 3300005355 Ga0070671_100051379 Ga0070671_1000513794 466
954 3300005356 Ga0070674_100000928 Ga0070674_10000092813 466
955 3300005356 Ga0070674_100040050 Ga0070674_1000400502 466
956 3300005356 Ga0070674_100124249 Ga0070674_1001242492 466
957 3300005364 Ga0070673_100001722 Ga0070673_1000017227 466
958 3300005364 Ga0070673_100008972 Ga0070673_1000089724 466
959 3300005364 Ga0070673_100175780 Ga0070673_1001757802 466
960 3300005365 Ga0070688_100001551 Ga0070688_1000015516 466
961 3300005365 Ga0070688_100005937 Ga0070688_1000059376 466
962 3300005365 Ga0070688_100023145 Ga0070688_1000231453 466
963 3300005365 Ga0070688_100046475 Ga0070688_1000464752 466
964 3300005365 Ga0070688_100090147 Ga0070688_1000901472 466
965 3300005366 Ga0070659_100006384 Ga0070659_1000063844 466
966 3300005366 Ga0070659_100023831 Ga0070659_1000238312 466
967 3300005367 Ga0070667_100001569 Ga0070667_10000156913 466
968 3300005367 Ga0070667_100049567 Ga0070667_1000495673 466
969 3300005367 Ga0070667_100071904 Ga0070667_1000719042 466
970 3300005367 Ga0070667_100106790 Ga0070667_1001067901 466
971 3300005406 Ga0070703_10001527 Ga0070703_100015275 466
972 3300005406 Ga0070703_10032910 Ga0070703_100329101 466
973 3300005434 Ga0070709_10001417 Ga0070709_100014177 466
974 3300005434 Ga0070709_10009235 Ga0070709_100092353 466
975 3300005434 Ga0070709_10036252 Ga0070709_100362522 466
976 3300005434 Ga0070709_10061585 Ga0070709_100615852 466
977 3300005434 Ga0070709_10068113 Ga0070709_100681132 466
978 3300005434 Ga0070709_10088435 Ga0070709_100884352 466
979 3300005435 Ga0070714_100000678 Ga0070714_10000067810 466
980 3300005435 Ga0070714_100013931 Ga0070714_1000139314 466
981 3300005435 Ga0070714_100018262 Ga0070714_1000182623 466
982 3300005435 Ga0070714_100048804 Ga0070714_1000488043 466
983 3300005435 Ga0070714_100058991 Ga0070714_1000589912 466
984 3300005436 Ga0070713_100002582 Ga0070713_1000025824 466
985 3300005436 Ga0070713_100017559 Ga0070713_1000175592 466
986 3300005436 Ga0070713_100022313 Ga0070713_1000223131 466
987 3300005436 Ga0070713_100033799 Ga0070713_1000337993 466
988 3300005436 Ga0070713_100074835 Ga0070713_1000748352 466
989 3300005436 Ga0070713_100240790 Ga0070713_1002407902 466
990 3300005437 Ga0070710_10000633 Ga0070710_100006339 466
991 3300005437 Ga0070710_10002407 Ga0070710_100024077 466
992 3300005437 Ga0070710_10002708 Ga0070710_100027084 466
993 3300005437 Ga0070710_10006364 Ga0070710_100063643 466
994 3300005437 Ga0070710_10019478 Ga0070710_100194782 466
995 3300005437 Ga0070710_10026128 Ga0070710_100261283 466
996 3300005437 Ga0070710_10046292 Ga0070710_100462922 466
997 3300005438 Ga0070701_10000457 Ga0070701_100004577 466
998 3300005438 Ga0070701_10004482 Ga0070701_100044824 466
999 3300005438 Ga0070701_10011127 Ga0070701_100111272 466
1000 3300005439 Ga0070711_100001478 Ga0070711_1000014782 466
1001 3300005439 Ga0070711_100002216 Ga0070711_1000022162 466
1002 3300005439 Ga0070711_100007229 Ga0070711_1000072293 466
1003 3300005439 Ga0070711_100011186 Ga0070711_1000111862 466
1004 3300005439 Ga0070711_100055922 Ga0070711_1000559222 466
1005 3300005439 Ga0070711_100092586 Ga0070711_1000925862 466
1006 3300005439 Ga0070711_100166193 Ga0070711_1001661932 466
1007 3300005440 Ga0070705_100000579 Ga0070705_1000005796 466
1008 3300005440 Ga0070705_100044359 Ga0070705_1000443591 466
1009 3300005441 Ga0070700_100000515 Ga0070700_1000005155 466
1010 3300005441 Ga0070700_100010386 Ga0070700_1000103865 466
1011 3300005441 Ga0070700_100030563 Ga0070700_1000305633 466
1012 3300005444 Ga0070694_100004976 Ga0070694_1000049762 466
1013 3300005444 Ga0070694_100052391 Ga0070694_1000523913 466
1014 3300005445 Ga0070708_100041592 Ga0070708_1000415923 466
1015 3300005455 Ga0070663_100000580 Ga0070663_10000058013 466
1016 3300005455 Ga0070663_100027924 Ga0070663_1000279243 466
1017 3300005455 Ga0070663_100067369 Ga0070663_1000673693 466
1018 3300005455 Ga0070663_100091152 Ga0070663_1000911522 466
1019 3300005455 Ga0070663_100132571 Ga0070663_1001325711 466
1020 3300005456 Ga0070678_100000016 Ga0070678_10000001613 466
1021 3300005456 Ga0070678_100008371 Ga0070678_1000083712 466
1022 3300005456 Ga0070678_100025343 Ga0070678_1000253433 466
1023 3300005457 Ga0070662_100001325 Ga0070662_10000132513 466
1024 3300005457 Ga0070662_100015684 Ga0070662_1000156844 466
1025 3300005457 Ga0070662_100016017 Ga0070662_1000160172 466
1026 3300005457 Ga0070662_100021879 Ga0070662_1000218792 466
1027 3300005457 Ga0070662_100063250 Ga0070662_1000632502 466
1028 3300005458 Ga0070681_10001764 Ga0070681_1000176413 466
1029 3300005458 Ga0070681_10003323 Ga0070681_100033238 466
1030 3300005458 Ga0070681_10025407 Ga0070681_100254072 466
1031 3300005458 Ga0070681_10043509 Ga0070681_100435093 466
1032 3300005458 Ga0070681_10166077 Ga0070681_101660771 466
1033 3300005459 Ga0068867_100012945 Ga0068867_1000129452 466
1034 3300005459 Ga0068867_100073028 Ga0068867_1000730282 466
1035 3300005466 Ga0070685_10000344 Ga0070685_1000034422 466
1036 3300005466 Ga0070685_10013452 Ga0070685_100134523 466
1037 3300005466 Ga0070685_10024049 Ga0070685_100240492 466
1038 3300005467 Ga0070706_100130741 Ga0070706_1001307412 466
1039 3300005471 Ga0070698_100019627 Ga0070698_1000196272 466
1040 3300005530 Ga0070679_100001267 Ga0070679_10000126713 466
1041 3300005530 Ga0070679_100008695 Ga0070679_1000086952 466
1042 3300005530 Ga0070679_100024858 Ga0070679_1000248582 466
1043 3300005530 Ga0070679_100031436 Ga0070679_1000314365 466
1044 3300005530 Ga0070679_100092503 Ga0070679_1000925032 466
1045 3300005530 Ga0070679_100169723 Ga0070679_1001697231 466
1046 3300005535 Ga0070684_100004054 Ga0070684_1000040541 466
1047 3300005535 Ga0070684_100014119 Ga0070684_1000141194 466
1048 3300005535 Ga0070684_100020270 Ga0070684_1000202702 466
1049 3300005536 Ga0070697_100000413 Ga0070697_10000041315 466
1050 3300005539 Ga0068853_100001111 Ga0068853_10000111114 466
1051 3300005539 Ga0068853_100006219 Ga0068853_1000062195 466
1052 3300005539 Ga0068853_100008362 Ga0068853_1000083622 466
1053 3300005539 Ga0068853_100010311 Ga0068853_1000103114 466
1054 3300005539 Ga0068853_100010423 Ga0068853_1000104232 466
1055 3300005543 Ga0070672_100000233 Ga0070672_10000023313 466
1056 3300005543 Ga0070672_100009467 Ga0070672_1000094675 466
1057 3300005544 Ga0070686_100000699 Ga0070686_1000006995 466
1058 3300005544 Ga0070686_100009615 Ga0070686_1000096155 466
1059 3300005544 Ga0070686_100059868 Ga0070686_1000598682 466
1060 3300005545 Ga0070695_100000624 Ga0070695_10000062414 466
1061 3300005546 Ga0070696_100001198 Ga0070696_1000011984 466
1062 3300005547 Ga0070693_100000594 Ga0070693_1000005945 466
1063 3300005547 Ga0070693_100022952 Ga0070693_1000229522 466
1064 3300005548 Ga0070665_100005019 Ga0070665_10000501911 466
1065 3300005548 Ga0070665_100021991 Ga0070665_1000219916 466
1066 3300005548 Ga0070665_100025615 Ga0070665_1000256154 466
1067 3300005548 Ga0070665_100028235 Ga0070665_1000282352 466
1068 3300005548 Ga0070665_100035418 Ga0070665_1000354182 466
1069 3300005548 Ga0070665_100047437 Ga0070665_1000474373 466
1070 3300005548 Ga0070665_100053711 Ga0070665_1000537112 466
1071 3300005548 Ga0070665_100102127 Ga0070665_1001021272 466
1072 3300005548 Ga0070665_100107111 Ga0070665_1001071112 466
1073 3300005548 Ga0070665_100166239 Ga0070665_1001662392 466
1074 3300005549 Ga0070704_100000112 Ga0070704_10000011214 466
1075 3300005549 Ga0070704_100001736 Ga0070704_1000017365 466
1076 3300005549 Ga0070704_100008535 Ga0070704_1000085354 466
1077 3300005563 Ga0068855_100007243 Ga0068855_1000072437 466
1078 3300005563 Ga0068855_100030914 Ga0068855_1000309144 466
1079 3300005563 Ga0068855_100033133 Ga0068855_1000331338 466
1080 3300005563 Ga0068855_100049698 Ga0068855_1000496984 466
1081 3300005563 Ga0068855_100209747 Ga0068855_1002097472 466
1082 3300005563 Ga0068855_100217628 Ga0068855_1002176282 466
1083 3300005564 Ga0070664_100000924 Ga0070664_1000009244 466
1084 3300005564 Ga0070664_100075219 Ga0070664_1000752193 466
1085 3300005564 Ga0070664_100087965 Ga0070664_1000879652 466
1086 3300005564 Ga0070664_100247502 Ga0070664_1002475022 466
1087 3300005577 Ga0068857_100000371 Ga0068857_10000037123 466
1088 3300005577 Ga0068857_100021812 Ga0068857_1000218125 466
1089 3300005577 Ga0068857_100135199 Ga0068857_1001351992 466
1090 3300005578 Ga0068854_100000735 Ga0068854_10000073513 466
1091 3300005578 Ga0068854_100050602 Ga0068854_1000506023 466
1092 3300005614 Ga0068856_100000091 Ga0068856_10000009161 466
1093 3300005614 Ga0068856_100000520 Ga0068856_10000052037 466
1094 3300005614 Ga0068856_100042057 Ga0068856_1000420572 466
1095 3300005614 Ga0068856_100131878 Ga0068856_1001318782 466
1096 3300005615 Ga0070702_100002320 Ga0070702_1000023202 466
1097 3300005615 Ga0070702_100009804 Ga0070702_1000098044 466
1098 3300005615 Ga0070702_100072947 Ga0070702_1000729472 466
1099 3300005616 Ga0068852_100001599 Ga0068852_1000015994 466
1100 3300005616 Ga0068852_100164473 Ga0068852_1001644732 466
1101 3300005616 Ga0068852_100196972 Ga0068852_1001969721 466
1102 3300005617 Ga0068859_100010201 Ga0068859_1000102014 466
1103 3300005617 Ga0068859_100030056 Ga0068859_1000300561 466
1104 3300005618 Ga0068864_100000333 Ga0068864_10000033332 466
1105 3300005618 Ga0068864_100022846 Ga0068864_1000228462 466
1106 3300005618 Ga0068864_100099199 Ga0068864_1000991992 466
1107 3300005718 Ga0068866_10000143 Ga0068866_100001433 466
1108 3300005718 Ga0068866_10019797 Ga0068866_100197972 466
1109 3300005718 Ga0068866_10025614 Ga0068866_100256142 466
1110 3300005719 Ga0068861_100000417 Ga0068861_10000041713 466
1111 3300005719 Ga0068861_100050057 Ga0068861_1000500572 466
1112 3300005719 Ga0068861_100101383 Ga0068861_1001013832 466
1113 3300005834 Ga0068851_10001608 Ga0068851_100016087 466
1114 3300005840 Ga0068870_10000113 Ga0068870_1000011311 466
1115 3300005840 Ga0068870_10011422 Ga0068870_100114222 466
1116 3300005841 Ga0068863_100022133 Ga0068863_1000221335 466
1117 3300005841 Ga0068863_100133244 Ga0068863_1001332442 466
1118 3300005841 Ga0068863_100257570 Ga0068863_1002575702 466
1119 3300005842 Ga0068858_100000975 Ga0068858_10000097521 466
1120 3300005842 Ga0068858_100010175 Ga0068858_1000101756 466
1121 3300005842 Ga0068858_100021103 Ga0068858_1000211034 466
1122 3300005842 Ga0068858_100103476 Ga0068858_1001034762 466
1123 3300005842 Ga0068858_100197856 Ga0068858_1001978561 466
1124 3300005843 Ga0068860_100000254 Ga0068860_10000025444 466
1125 3300005843 Ga0068860_100001740 Ga0068860_1000017407 466
1126 3300005843 Ga0068860_100015730 Ga0068860_1000157306 466
1127 3300005843 Ga0068860_100032250 Ga0068860_1000322504 466
1128 3300005843 Ga0068860_100033225 Ga0068860_1000332253 466
1129 3300005843 Ga0068860_100051464 Ga0068860_1000514644 466
1130 3300005844 Ga0068862_100001457 Ga0068862_1000014574 466
1131 3300005844 Ga0068862_100201283 Ga0068862_1002012832 466
1132 3300005937 Ga0081455_10000110 Ga0081455_1000011039 466
1133 3300005937 Ga0081455_10004210 Ga0081455_1000421014 466
1134 3300005937 Ga0081455_10007679 Ga0081455_100076798 466
1135 3300005937 Ga0081455_10026261 Ga0081455_100262614 466
1136 3300005937 Ga0081455_10037122 Ga0081455_100371224 466
1137 3300005937 Ga0081455_10042135 Ga0081455_100421353 466
1138 3300005981 Ga0081538_10040034 Ga0081538_100400342 466
1139 3300005981 Ga0081538_10050519 Ga0081538_100505192 466
1140 3300005983 Ga0081540_1000414 Ga0081540_10004146 466
1141 3300005983 Ga0081540_1001143 Ga0081540_100114310 466
1142 3300005983 Ga0081540_1003272 Ga0081540_10032725 466
1143 3300005983 Ga0081540_1009836 Ga0081540_10098364 466
1144 3300005983 Ga0081540_1012356 Ga0081540_10123562 466
1145 3300005983 Ga0081540_1018061 Ga0081540_10180612 466
1146 3300005983 Ga0081540_1032645 Ga0081540_10326453 466
1147 3300005983 Ga0081540_1071123 Ga0081540_10711231 466
1148 3300005985 Ga0081539_10000191 Ga0081539_10000191144 466
1149 3300005985 Ga0081539_10000321 Ga0081539_1000032186 466
1150 3300005985 Ga0081539_10001091 Ga0081539_1000109143 466
1151 3300005985 Ga0081539_10005255 Ga0081539_1000525512 466
1152 3300005985 Ga0081539_10047810 Ga0081539_100478102 466
1153 3300006028 Ga0070717_10000355 Ga0070717_100003551 466
1154 3300006028 Ga0070717_10002936 Ga0070717_100029366 466
1155 3300006028 Ga0070717_10005443 Ga0070717_100054435 466
1156 3300006028 Ga0070717_10027278 Ga0070717_100272783 466
1157 3300006038 Ga0075365_10004585 Ga0075365_100045856 466
1158 3300006038 Ga0075365_10013658 Ga0075365_100136584 466
1159 3300006038 Ga0075365_10023762 Ga0075365_100237623 466
1160 3300006038 Ga0075365_10026332 Ga0075365_100263323 466
1161 3300006042 Ga0075368_10002184 Ga0075368_100021842 466
1162 3300006042 Ga0075368_10055946 Ga0075368_100559462 466
1163 3300006048 Ga0075363_100045637 Ga0075363_1000456372 466
1164 3300006048 Ga0075363_100074545 Ga0075363_1000745452 466
1165 3300006051 Ga0075364_10046742 Ga0075364_100467422 466
1166 3300006051 Ga0075364_10064038 Ga0075364_100640382 466
1167 3300006058 Ga0075432_10004478 Ga0075432_100044783 466
1168 3300006163 Ga0070715_10000078 Ga0070715_1000007815 466
1169 3300006163 Ga0070715_10000694 Ga0070715_100006946 466
1170 3300006163 Ga0070715_10001339 Ga0070715_100013394 466
1171 3300006173 Ga0070716_100004734 Ga0070716_1000047344 466
1172 3300006173 Ga0070716_100009188 Ga0070716_1000091884 466
1173 3300006173 Ga0070716_100026212 Ga0070716_1000262122 466
1174 3300006173 Ga0070716_100077810 Ga0070716_1000778102 466
1175 3300006173 Ga0070716_100095048 Ga0070716_1000950481 466
1176 3300006175 Ga0070712_100002213 Ga0070712_1000022137 466
1177 3300006175 Ga0070712_100011086 Ga0070712_1000110863 466
1178 3300006175 Ga0070712_100020143 Ga0070712_1000201433 466
1179 3300006175 Ga0070712_100055443 Ga0070712_1000554432 466
1180 3300006175 Ga0070712_100082881 Ga0070712_1000828812 466
1181 3300006175 Ga0070712_100149373 Ga0070712_1001493731 466
1182 3300006177 Ga0075362_10010631 Ga0075362_100106313 466
1183 3300006178 Ga0075367_10001860 Ga0075367_100018607 466
1184 3300006186 Ga0075369_10001434 Ga0075369_100014344 466
1185 3300006186 Ga0075369_10016884 Ga0075369_100168842 466
1186 3300006194 Ga0075427_10000813 Ga0075427_100008133 466
1187 3300006195 Ga0075366_10058476 Ga0075366_100584762 466
1188 3300006195 Ga0075366_10082098 Ga0075366_100820981 466
1189 3300006237 Ga0097621_100000203 Ga0097621_1000002035 466
1190 3300006237 Ga0097621_100017219 Ga0097621_1000172193 466
1191 3300006237 Ga0097621_100062009 Ga0097621_1000620092 466
1192 3300006237 Ga0097621_100108603 Ga0097621_1001086032 466
1193 3300006237 Ga0097621_100201177 Ga0097621_1002011771 466
1194 3300006353 Ga0075370_10033371 Ga0075370_100333713 466
1195 3300006358 Ga0068871_100000575 Ga0068871_1000005752 466
1196 3300006358 Ga0068871_100028379 Ga0068871_1000283793 466
1197 3300006358 Ga0068871_100177992 Ga0068871_1001779922 466
1198 3300006844 Ga0075428_100008481 Ga0075428_1000084813 466
1199 3300006844 Ga0075428_100089794 Ga0075428_1000897942 466
1200 3300006844 Ga0075428_100111243 Ga0075428_1001112432 466
1201 3300006846 Ga0075430_100000012 Ga0075430_10000001216 466
1202 3300006846 Ga0075430_100000778 Ga0075430_10000077819 466
1203 3300006847 Ga0075431_100003622 Ga0075431_10000362212 466
1204 3300006852 Ga0075433_10005842 Ga0075433_100058426 466
1205 3300006852 Ga0075433_10009181 Ga0075433_100091817 466
1206 3300006871 Ga0075434_100000114 Ga0075434_10000011440 466
1207 3300006871 Ga0075434_100010989 Ga0075434_1000109894 466
1208 3300006880 Ga0075429_100002694 Ga0075429_10000269412 466
1209 3300006881 Ga0068865_100000654 Ga0068865_10000065413 466
1210 3300006881 Ga0068865_100020024 Ga0068865_1000200243 466
1211 3300006881 Ga0068865_100051878 Ga0068865_1000518782 466
1212 3300006881 Ga0068865_100106538 Ga0068865_1001065382 466
1213 3300006881 Ga0068865_100107012 Ga0068865_1001070122 466
1214 3300006914 Ga0075436_100013589 Ga0075436_1000135893 466
1215 3300006931 Ga0097620_100010201 Ga0097620_1000102014 466
1216 3300006931 Ga0097620_100030056 Ga0097620_1000300561 466
1217 3300006941 Ga0099825_1018997 Ga0099825_10189973 466
1218 3300006943 Ga0099822_1000022 Ga0099822_100002210 466
1219 3300006944 Ga0099823_1027652 Ga0099823_10276524 466
1220 3300006946 Ga0079104_1001253 Ga0079104_10012535 466
1221 3300006948 Ga0099826_10001254 Ga0099826_100012546 466
1222 3300007076 Ga0075435_100021841 Ga0075435_1000218412 466
1223 3300007076 Ga0075435_100041943 Ga0075435_1000419432 466
1224 3300007076 Ga0075435_100113929 Ga0075435_1001139292 466
1225 3300009011 Ga0105251_10015950 Ga0105251_100159501 466
1226 3300009036 Ga0105244_10022702 Ga0105244_100227022 466
1227 3300009092 Ga0105250_10005564 Ga0105250_100055644 466
1228 3300009092 Ga0105250_10020816 Ga0105250_100208162 466
1229 3300009093 Ga0105240_10000076 Ga0105240_10000076154 466
1230 3300009093 Ga0105240_10017201 Ga0105240_100172016 466
1231 3300009093 Ga0105240_10022325 Ga0105240_100223253 466
1232 3300009093 Ga0105240_10092446 Ga0105240_100924462 466
1233 3300009093 Ga0105240_10095268 Ga0105240_100952682 466
1234 3300009094 Ga0111539_10002232 Ga0111539_100022329 466
1235 3300009094 Ga0111539_10004022 Ga0111539_1000402213 466
1236 3300009094 Ga0111539_10141164 Ga0111539_101411642 466
1237 3300009098 Ga0105245_10000230 Ga0105245_1000023036 466
1238 3300009098 Ga0105245_10071520 Ga0105245_100715201 466
1239 3300009098 Ga0105245_10104265 Ga0105245_101042652 466
1240 3300009101 Ga0105247_10016289 Ga0105247_100162894 466
1241 3300009101 Ga0105247_10019830 Ga0105247_100198303 466
1242 3300009101 Ga0105247_10041342 Ga0105247_100413422 466
1243 3300009147 Ga0114129_10002372 Ga0114129_1000237224 466
1244 3300009147 Ga0114129_10008877 Ga0114129_100088778 466
1245 3300009147 Ga0114129_10010926 Ga0114129_100109269 466
1246 3300009147 Ga0114129_10250894 Ga0114129_102508942 466
1247 3300009148 Ga0105243_10002755 Ga0105243_100027555 466
1248 3300009148 Ga0105243_10012152 Ga0105243_100121522 466
1249 3300009148 Ga0105243_10013810 Ga0105243_100138105 466
1250 3300009148 Ga0105243_10085562 Ga0105243_100855622 466
1251 3300009148 Ga0105243_10202847 Ga0105243_102028472 466
1252 3300009174 Ga0105241_10001308 Ga0105241_100013085 466
1253 3300009174 Ga0105241_10009439 Ga0105241_100094394 466
1254 3300009174 Ga0105241_10029800 Ga0105241_100298002 466
1255 3300009176 Ga0105242_10000696 Ga0105242_1000069613 466
1256 3300009176 Ga0105242_10012804 Ga0105242_100128042 466
1257 3300009176 Ga0105242_10062111 Ga0105242_100621112 466
1258 3300009177 Ga0105248_10000015 Ga0105248_10000015267 466
1259 3300009177 Ga0105248_10001593 Ga0105248_1000159319 466
1260 3300009177 Ga0105248_10031210 Ga0105248_100312105 466
1261 3300009177 Ga0105248_10032633 Ga0105248_100326335 466
1262 3300009177 Ga0105248_10043884 Ga0105248_100438844 466
1263 3300009177 Ga0105248_10122049 Ga0105248_101220492 466
1264 3300009177 Ga0105248_10241696 Ga0105248_102416962 466
1265 3300009545 Ga0105237_10000226 Ga0105237_1000022641 466
1266 3300009545 Ga0105237_10011347 Ga0105237_100113474 466
1267 3300009545 Ga0105237_10015378 Ga0105237_100153785 466
1268 3300009545 Ga0105237_10024176 Ga0105237_100241763 466
1269 3300009545 Ga0105237_10033806 Ga0105237_100338062 466
1270 3300009551 Ga0105238_10043849 Ga0105238_100438493 466
1271 3300009551 Ga0105238_10097424 Ga0105238_100974242 466
1272 3300009553 Ga0105249_10001642 Ga0105249_1000164213 466
1273 3300009553 Ga0105249_10096005 Ga0105249_100960052 466
1274 3300009553 Ga0105249_10101988 Ga0105249_101019882 466
1275 3300009553 Ga0105249_10151667 Ga0105249_101516672 466
1276 3300009765 Ga0123341_1000007 Ga0123341_100000791 466
1277 3300009765 Ga0123341_1047554 Ga0123341_10475542 466
1278 3300009766 Ga0123342_1004784 Ga0123342_100478417 466
1279 3300010159 Ga0099796_10001922 Ga0099796_100019223 466
1280 3300010375 Ga0105239_10000641 Ga0105239_1000064113 466
1281 3300010375 Ga0105239_10053854 Ga0105239_100538543 466
1282 3300010375 Ga0105239_10077673 Ga0105239_100776732 466
1283 3300010375 Ga0105239_10128804 Ga0105239_101288042 466
1284 3300010375 Ga0105239_10158078 Ga0105239_101580781 466
1285 3300010375 Ga0105239_10160874 Ga0105239_101608742 466
1286 3300010375 Ga0105239_10201375 Ga0105239_102013752 466
1287 3300010375 Ga0105239_10376400 Ga0105239_103764002 466
1288 3300011119 Ga0105246_10000550 Ga0105246_100005506 466
1289 3300011119 Ga0105246_10027908 Ga0105246_100279082 466
1290 3300011119 Ga0105246_10028278 Ga0105246_100282783 466
1291 3300011119 Ga0105246_10130207 Ga0105246_101302072 466
1292 3300013100 Ga0157373_10011236 Ga0157373_100112362 466
1293 3300013100 Ga0157373_10051657 Ga0157373_100516572 466
1294 3300013102 Ga0157371_10000017 Ga0157371_1000001749 466
1295 3300013102 Ga0157371_10004510 Ga0157371_100045108 466
1296 3300013102 Ga0157371_10054681 Ga0157371_100546812 466
1297 3300013104 Ga0157370_10000455 Ga0157370_1000045535 466
1298 3300013104 Ga0157370_10000461 Ga0157370_1000046131 466
1299 3300013104 Ga0157370_10044331 Ga0157370_100443313 466
1300 3300013104 Ga0157370_10071190 Ga0157370_100711903 466
1301 3300013104 Ga0157370_10110355 Ga0157370_101103552 466
1302 3300013250 Ga0171462_1066 Ga0171462_106610 466
1303 3300013296 Ga0157374_10016190 Ga0157374_100161903 466
1304 3300013296 Ga0157374_10032938 Ga0157374_100329383 466
1305 3300013296 Ga0157374_10036846 Ga0157374_100368464 466
1306 3300013296 Ga0157374_10220423 Ga0157374_102204232 466
1307 3300013297 Ga0157378_10000864 Ga0157378_100008646 466
1308 3300013297 Ga0157378_10034605 Ga0157378_100346053 466
1309 3300013306 Ga0163162_10000420 Ga0163162_100004205 466
1310 3300013306 Ga0163162_10016129 Ga0163162_100161296 466
1311 3300013306 Ga0163162_10072401 Ga0163162_100724012 466
1312 3300013306 Ga0163162_10253519 Ga0163162_102535191 466
1313 3300013307 Ga0157372_10011691 Ga0157372_100116912 466
1314 3300013307 Ga0157372_10024037 Ga0157372_100240374 466
1315 3300013308 Ga0157375_10001626 Ga0157375_100016265 466
1316 3300013308 Ga0157375_10025283 Ga0157375_100252834 466
1317 3300013308 Ga0157375_10037694 Ga0157375_100376942 466
1318 3300014325 Ga0163163_10067324 Ga0163163_100673243 466
1319 3300014325 Ga0163163_10206841 Ga0163163_102068412 466
1320 3300014326 Ga0157380_10000511 Ga0157380_100005118 466
1321 3300014745 Ga0157377_10000053 Ga0157377_1000005355 466
1322 3300014745 Ga0157377_10046260 Ga0157377_100462602 466
1323 3300014745 Ga0157377_10058121 Ga0157377_100581212 466
1324 3300014968 Ga0157379_10001333 Ga0157379_1000133313 466
1325 3300014968 Ga0157379_10016704 Ga0157379_100167044 466
1326 3300014968 Ga0157379_10094343 Ga0157379_100943432 466
1327 3300014968 Ga0157379_10169012 Ga0157379_101690121 466
1328 3300014969 Ga0157376_10000436 Ga0157376_1000043610 466
1329 3300014969 Ga0157376_10114255 Ga0157376_101142552 466
1330 3300015262 Ga0182007_10001815 Ga0182007_100018156 466
1331 3300015265 Ga0182005_1005015 Ga0182005_10050153 466
1332 3300017792 Ga0163161_10001352 Ga0163161_1000135214 466
1333 3300017792 Ga0163161_10007604 Ga0163161_100076044 466
1334 3300017792 Ga0163161_10023487 Ga0163161_100234873 466
1335 3300021320 Ga0214544_1000001 Ga0214544_1000001332 466
1336 3300021321 Ga0214542_1000005 Ga0214542_1000005332 466
1337 3300021321 Ga0214542_1024229 Ga0214542_10242292 466
1338 3300021324 Ga0214545_1000003 Ga0214545_1000003432 466
1339 3300021324 Ga0214545_1023657 Ga0214545_10236572 466
1340 3300021327 Ga0214543_1000002 Ga0214543_1000002334 466
1341 3300021327 Ga0214543_1000024 Ga0214543_100002496 466
1342 3300021327 Ga0214543_1000038 Ga0214543_100003874 466
1343 3300021327 Ga0214543_1026030 Ga0214543_10260302 466
1344 3300021358 Ga0213873_10011292 Ga0213873_100112922 466
1345 3300021377 Ga0213874_10007096 Ga0213874_100070962 466
1346 3300021384 Ga0213876_10021408 Ga0213876_100214083 466
1347 3300021388 Ga0213875_10002982 Ga0213875_100029823 466
1348 3300021388 Ga0213875_10008179 Ga0213875_100081792 466
1349 3300022739 Ga0228711_1000008 Ga0228711_100000845 466
1350 3300022740 Ga0228710_1000009 Ga0228710_100000944 466
1351 3300024225 Ga0224572_1001441 Ga0224572_10014413 466
1352 3300024227 Ga0228598_1001219 Ga0228598_10012191 466
1353 3300025206 Ga0209435_100012 Ga0209435_100012336 466
1354 3300025208 Ga0209436_100150 Ga0209436_10015028 466
1355 3300025230 Ga0209563_103061 Ga0209563_1030612 466
1356 3300025233 Ga0209437_100051 Ga0209437_100051335 466
1357 3300025233 Ga0209437_100098 Ga0209437_100098175 466
1358 3300025245 Ga0207425_1000075 Ga0207425_100007566 466
1359 3300025245 Ga0207425_1001337 Ga0207425_10013379 466
1360 3300025245 Ga0207425_1004121 Ga0207425_10041212 466
1361 3300025246 Ga0209646_1000026 Ga0209646_1000026336 466
1362 3300025250 Ga0209026_1000014 Ga0209026_1000014336 466
1363 3300025253 Ga0209677_101595 Ga0209677_1015956 466
1364 3300025253 Ga0209677_102022 Ga0209677_1020226 466
1365 3300025254 Ga0209148_1000424 Ga0209148_100042440 466
1366 3300025256 Ga0209759_1000012 Ga0209759_1000012336 466
1367 3300025258 Ga0209129_1000156 Ga0209129_100015632 466
1368 3300025258 Ga0209129_1000524 Ga0209129_10005244 466
1369 3300025258 Ga0209129_1000903 Ga0209129_100090313 466
1370 3300025258 Ga0209129_1001820 Ga0209129_10018202 466
1371 3300025258 Ga0209129_1001868 Ga0209129_10018686 466
1372 3300025258 Ga0209129_1002344 Ga0209129_10023443 466
1373 3300025258 Ga0209129_1004509 Ga0209129_10045094 466
1374 3300025261 Ga0209233_1000095 Ga0209233_1000095292 466
1375 3300025261 Ga0209233_1000113 Ga0209233_10001138 466
1376 3300025261 Ga0209233_1000427 Ga0209233_100042711 466
1377 3300025261 Ga0209233_1001485 Ga0209233_10014857 466
1378 3300025261 Ga0209233_1002935 Ga0209233_10029352 466
1379 3300025261 Ga0209233_1004610 Ga0209233_10046102 466
1380 3300025261 Ga0209233_1006596 Ga0209233_10065963 466
1381 3300025271 Ga0207666_1000348 Ga0207666_10003486 466
1382 3300025272 Ga0209455_1003259 Ga0209455_10032595 466
1383 3300025272 Ga0209455_1003833 Ga0209455_10038333 466
1384 3300025273 Ga0209673_1000010 Ga0209673_1000010206 466
1385 3300025273 Ga0209673_1000117 Ga0209673_100011788 466
1386 3300025273 Ga0209673_1000151 Ga0209673_100015163 466
1387 3300025273 Ga0209673_1000863 Ga0209673_100086322 466
1388 3300025273 Ga0209673_1001685 Ga0209673_100168511 466
1389 3300025273 Ga0209673_1002134 Ga0209673_100213411 466
1390 3300025273 Ga0209673_1026911 Ga0209673_10269112 466
1391 3300025284 Ga0209130_1000003 Ga0209130_1000003116 466
1392 3300025284 Ga0209130_1000020 Ga0209130_1000020260 466
1393 3300025284 Ga0209130_1010600 Ga0209130_10106002 466
1394 3300025290 Ga0207673_1000043 Ga0207673_100004311 466
1395 3300025291 Ga0209675_1001344 Ga0209675_10013447 466
1396 3300025291 Ga0209675_1011031 Ga0209675_10110313 466
1397 3300025294 Ga0209025_1000008 Ga0209025_1000008776 466
1398 3300025294 Ga0209025_1000070 Ga0209025_1000070245 466
1399 3300025294 Ga0209025_1000140 Ga0209025_100014078 466
1400 3300025294 Ga0209025_1000506 Ga0209025_100050611 466
1401 3300025294 Ga0209025_1001869 Ga0209025_100186913 466
1402 3300025294 Ga0209025_1003183 Ga0209025_10031838 466
1403 3300025294 Ga0209025_1005402 Ga0209025_10054028 466
1404 3300025294 Ga0209025_1010282 Ga0209025_10102822 466
1405 3300025294 Ga0209025_1028383 Ga0209025_10283831 466
1406 3300025295 Ga0209564_1000049 Ga0209564_1000049335 466
1407 3300025295 Ga0209564_1000065 Ga0209564_1000065105 466
1408 3300025295 Ga0209564_1000485 Ga0209564_100048525 466
1409 3300025295 Ga0209564_1000647 Ga0209564_100064720 466
1410 3300025295 Ga0209564_1001780 Ga0209564_10017807 466
1411 3300025295 Ga0209564_1001993 Ga0209564_10019938 466
1412 3300025295 Ga0209564_1006799 Ga0209564_10067995 466
1413 3300025295 Ga0209564_1009159 Ga0209564_10091593 466
1414 3300025295 Ga0209564_1012956 Ga0209564_10129562 466
1415 3300025297 Ga0209758_1000141 Ga0209758_1000141155 466
1416 3300025297 Ga0209758_1000186 Ga0209758_100018664 466
1417 3300025297 Ga0209758_1000655 Ga0209758_100065511 466
1418 3300025297 Ga0209758_1000758 Ga0209758_100075811 466
1419 3300025297 Ga0209758_1001882 Ga0209758_10018829 466
1420 3300025297 Ga0209758_1002154 Ga0209758_100215411 466
1421 3300025297 Ga0209758_1002420 Ga0209758_10024207 466
1422 3300025297 Ga0209758_1003547 Ga0209758_10035478 466
1423 3300025297 Ga0209758_1005684 Ga0209758_10056846 466
1424 3300025297 Ga0209758_1006158 Ga0209758_10061584 466
1425 3300025297 Ga0209758_1006453 Ga0209758_10064535 466
1426 3300025297 Ga0209758_1021515 Ga0209758_10215152 466
1427 3300025298 Ga0209050_1005467 Ga0209050_10054677 466
1428 3300025299 Ga0209256_1000014 Ga0209256_1000014304 466
1429 3300025299 Ga0209256_1000208 Ga0209256_1000208102 466
1430 3300025299 Ga0209256_1001653 Ga0209256_100165317 466
1431 3300025299 Ga0209256_1001736 Ga0209256_100173617 466
1432 3300025299 Ga0209256_1002712 Ga0209256_10027125 466
1433 3300025299 Ga0209256_1003882 Ga0209256_10038827 466
1434 3300025299 Ga0209256_1012913 Ga0209256_10129133 466
1435 3300025299 Ga0209256_1023617 Ga0209256_10236171 466
1436 3300025302 Ga0207426_1000008 Ga0207426_1000008328 466
1437 3300025302 Ga0207426_1000011 Ga0207426_1000011663 466
1438 3300025302 Ga0207426_1000221 Ga0207426_1000221119 466
1439 3300025302 Ga0207426_1000425 Ga0207426_100042561 466
1440 3300025302 Ga0207426_1000869 Ga0207426_10008694 466
1441 3300025302 Ga0207426_1003443 Ga0207426_10034434 466
1442 3300025302 Ga0207426_1004449 Ga0207426_10044492 466
1443 3300025303 Ga0209051_1000097 Ga0209051_100009754 466
1444 3300025303 Ga0209051_1004880 Ga0209051_10048804 466
1445 3300025303 Ga0209051_1008689 Ga0209051_10086893 466
1446 3300025304 Ga0209257_1000426 Ga0209257_100042633 466
1447 3300025304 Ga0209257_1001142 Ga0209257_100114218 466
1448 3300025304 Ga0209257_1018731 Ga0209257_10187312 466
1449 3300025315 Ga0207697_10000672 Ga0207697_100006726 466
1450 3300025315 Ga0207697_10019395 Ga0207697_100193952 466
1451 3300025711 Ga0207696_1024092 Ga0207696_10240922 466
1452 3300025885 Ga0207653_10000963 Ga0207653_100009636 466
1453 3300025885 Ga0207653_10042695 Ga0207653_100426951 466
1454 3300025893 Ga0207682_10000154 Ga0207682_1000015429 466
1455 3300025898 Ga0207692_10000468 Ga0207692_1000046812 466
1456 3300025898 Ga0207692_10001055 Ga0207692_100010557 466
1457 3300025898 Ga0207692_10003318 Ga0207692_100033183 466
1458 3300025898 Ga0207692_10005603 Ga0207692_100056032 466
1459 3300025898 Ga0207692_10009587 Ga0207692_100095872 466
1460 3300025898 Ga0207692_10040569 Ga0207692_100405692 466
1461 3300025899 Ga0207642_10002038 Ga0207642_100020383 466
1462 3300025899 Ga0207642_10006639 Ga0207642_100066393 466
1463 3300025899 Ga0207642_10012667 Ga0207642_100126672 466
1464 3300025900 Ga0207710_10001145 Ga0207710_1000114511 466
1465 3300025900 Ga0207710_10012463 Ga0207710_100124633 466
1466 3300025900 Ga0207710_10035140 Ga0207710_100351402 466
1467 3300025901 Ga0207688_10000817 Ga0207688_100008173 466
1468 3300025901 Ga0207688_10003295 Ga0207688_100032957 466
1469 3300025901 Ga0207688_10070420 Ga0207688_100704201 466
1470 3300025901 Ga0207688_10077050 Ga0207688_100770502 466
1471 3300025903 Ga0207680_10014997 Ga0207680_100149972 466
1472 3300025904 Ga0207647_10005421 Ga0207647_100054214 466
1473 3300025904 Ga0207647_10067916 Ga0207647_100679162 466
1474 3300025906 Ga0207699_10000390 Ga0207699_100003907 466
1475 3300025906 Ga0207699_10004930 Ga0207699_100049304 466
1476 3300025906 Ga0207699_10008578 Ga0207699_100085784 466
1477 3300025906 Ga0207699_10012034 Ga0207699_100120342 466
1478 3300025906 Ga0207699_10031512 Ga0207699_100315122 466
1479 3300025906 Ga0207699_10042253 Ga0207699_100422531 466
1480 3300025906 Ga0207699_10074694 Ga0207699_100746942 466
1481 3300025907 Ga0207645_10000182 Ga0207645_1000018244 466
1482 3300025907 Ga0207645_10011610 Ga0207645_100116106 466
1483 3300025907 Ga0207645_10027683 Ga0207645_100276833 466
1484 3300025907 Ga0207645_10107850 Ga0207645_101078502 466
1485 3300025908 Ga0207643_10000405 Ga0207643_1000040515 466
1486 3300025908 Ga0207643_10000416 Ga0207643_100004166 466
1487 3300025909 Ga0207705_10065686 Ga0207705_100656862 466
1488 3300025910 Ga0207684_10089462 Ga0207684_100894622 466
1489 3300025911 Ga0207654_10000323 Ga0207654_1000032310 466
1490 3300025911 Ga0207654_10000889 Ga0207654_1000088912 466
1491 3300025911 Ga0207654_10054127 Ga0207654_100541272 466
1492 3300025911 Ga0207654_10143963 Ga0207654_101439632 466
1493 3300025912 Ga0207707_10000178 Ga0207707_1000017810 466
1494 3300025912 Ga0207707_10001762 Ga0207707_1000176214 466
1495 3300025912 Ga0207707_10003772 Ga0207707_100037728 466
1496 3300025912 Ga0207707_10006911 Ga0207707_100069111 466
1497 3300025912 Ga0207707_10151946 Ga0207707_101519461 466
1498 3300025913 Ga0207695_10000011 Ga0207695_1000001147 466
1499 3300025913 Ga0207695_10000062 Ga0207695_10000062273 466
1500 3300025913 Ga0207695_10000497 Ga0207695_1000049714 466
1501 3300025913 Ga0207695_10085113 Ga0207695_100851132 466
1502 3300025913 Ga0207695_10088253 Ga0207695_100882531 466
1503 3300025913 Ga0207695_10106889 Ga0207695_101068891 466
1504 3300025914 Ga0207671_10000093 Ga0207671_1000009385 466
1505 3300025914 Ga0207671_10004982 Ga0207671_100049827 466
1506 3300025914 Ga0207671_10009091 Ga0207671_100090916 466
1507 3300025914 Ga0207671_10011831 Ga0207671_100118312 466
1508 3300025915 Ga0207693_10000842 Ga0207693_1000084216 466
1509 3300025915 Ga0207693_10003503 Ga0207693_100035038 466
1510 3300025915 Ga0207693_10004344 Ga0207693_100043445 466
1511 3300025915 Ga0207693_10005530 Ga0207693_100055304 466
1512 3300025915 Ga0207693_10007487 Ga0207693_100074872 466
1513 3300025915 Ga0207693_10007572 Ga0207693_100075725 466
1514 3300025915 Ga0207693_10013345 Ga0207693_100133454 466
1515 3300025915 Ga0207693_10018008 Ga0207693_100180084 466
1516 3300025915 Ga0207693_10019662 Ga0207693_100196624 466
1517 3300025915 Ga0207693_10027789 Ga0207693_100277893 466
1518 3300025915 Ga0207693_10039213 Ga0207693_100392133 466
1519 3300025915 Ga0207693_10098850 Ga0207693_100988502 466
1520 3300025916 Ga0207663_10001979 Ga0207663_100019791 466
1521 3300025916 Ga0207663_10006434 Ga0207663_100064342 466
1522 3300025916 Ga0207663_10006811 Ga0207663_100068115 466
1523 3300025916 Ga0207663_10014546 Ga0207663_100145461 466
1524 3300025917 Ga0207660_10000007 Ga0207660_1000000736 466
1525 3300025917 Ga0207660_10078989 Ga0207660_100789891 466
1526 3300025917 Ga0207660_10129943 Ga0207660_101299432 466
1527 3300025918 Ga0207662_10009169 Ga0207662_100091692 466
1528 3300025918 Ga0207662_10117357 Ga0207662_101173572 466
1529 3300025919 Ga0207657_10002910 Ga0207657_100029107 466
1530 3300025919 Ga0207657_10010114 Ga0207657_100101144 466
1531 3300025919 Ga0207657_10022087 Ga0207657_100220875 466
1532 3300025919 Ga0207657_10023020 Ga0207657_100230205 466
1533 3300025919 Ga0207657_10029030 Ga0207657_100290303 466
1534 3300025919 Ga0207657_10088502 Ga0207657_100885022 466
1535 3300025920 Ga0207649_10000305 Ga0207649_100003052 466
1536 3300025920 Ga0207649_10083213 Ga0207649_100832131 466
1537 3300025921 Ga0207652_10000459 Ga0207652_1000045935 466
1538 3300025921 Ga0207652_10057241 Ga0207652_100572413 466
1539 3300025921 Ga0207652_10074104 Ga0207652_100741043 466
1540 3300025921 Ga0207652_10176007 Ga0207652_101760072 466
1541 3300025923 Ga0207681_10000116 Ga0207681_1000011666 466
1542 3300025923 Ga0207681_10063702 Ga0207681_100637021 466
1543 3300025923 Ga0207681_10093833 Ga0207681_100938332 466
1544 3300025924 Ga0207694_10000212 Ga0207694_1000021242 466
1545 3300025924 Ga0207694_10020078 Ga0207694_100200781 466
1546 3300025924 Ga0207694_10117303 Ga0207694_101173032 466
1547 3300025925 Ga0207650_10004276 Ga0207650_100042764 466
1548 3300025925 Ga0207650_10004547 Ga0207650_100045475 466
1549 3300025925 Ga0207650_10009331 Ga0207650_100093312 466
1550 3300025925 Ga0207650_10063498 Ga0207650_100634982 466
1551 3300025925 Ga0207650_10068276 Ga0207650_100682762 466
1552 3300025925 Ga0207650_10079346 Ga0207650_100793462 466
1553 3300025926 Ga0207659_10000015 Ga0207659_10000015137 466
1554 3300025926 Ga0207659_10045278 Ga0207659_100452783 466
1555 3300025926 Ga0207659_10156748 Ga0207659_101567482 466
1556 3300025927 Ga0207687_10000357 Ga0207687_100003578 466
1557 3300025927 Ga0207687_10004506 Ga0207687_100045066 466
1558 3300025927 Ga0207687_10016432 Ga0207687_100164323 466
1559 3300025927 Ga0207687_10087510 Ga0207687_100875102 466
1560 3300025928 Ga0207700_10001137 Ga0207700_1000113713 466
1561 3300025928 Ga0207700_10031891 Ga0207700_100318913 466
1562 3300025928 Ga0207700_10037199 Ga0207700_100371992 466
1563 3300025928 Ga0207700_10038868 Ga0207700_100388682 466
1564 3300025928 Ga0207700_10051582 Ga0207700_100515822 466
1565 3300025928 Ga0207700_10073940 Ga0207700_100739402 466
1566 3300025928 Ga0207700_10096958 Ga0207700_100969582 466
1567 3300025928 Ga0207700_10124373 Ga0207700_101243732 466
1568 3300025929 Ga0207664_10007701 Ga0207664_100077011 466
1569 3300025929 Ga0207664_10017466 Ga0207664_100174664 466
1570 3300025929 Ga0207664_10033246 Ga0207664_100332463 466
1571 3300025929 Ga0207664_10036057 Ga0207664_100360573 466
1572 3300025929 Ga0207664_10038518 Ga0207664_100385182 466
1573 3300025929 Ga0207664_10134816 Ga0207664_101348162 466
1574 3300025931 Ga0207644_10000251 Ga0207644_1000025131 466
1575 3300025931 Ga0207644_10002852 Ga0207644_100028528 466
1576 3300025931 Ga0207644_10005542 Ga0207644_100055423 466
1577 3300025931 Ga0207644_10005898 Ga0207644_100058985 466
1578 3300025931 Ga0207644_10041109 Ga0207644_100411092 466
1579 3300025932 Ga0207690_10000320 Ga0207690_1000032029 466
1580 3300025932 Ga0207690_10083028 Ga0207690_100830282 466
1581 3300025932 Ga0207690_10095950 Ga0207690_100959502 466
1582 3300025932 Ga0207690_10133314 Ga0207690_101333142 466
1583 3300025933 Ga0207706_10002583 Ga0207706_1000258313 466
1584 3300025933 Ga0207706_10003309 Ga0207706_100033098 466
1585 3300025933 Ga0207706_10012590 Ga0207706_100125904 466
1586 3300025933 Ga0207706_10020107 Ga0207706_100201072 466
1587 3300025933 Ga0207706_10023317 Ga0207706_100233173 466
1588 3300025933 Ga0207706_10088609 Ga0207706_100886092 466
1589 3300025934 Ga0207686_10000234 Ga0207686_1000023418 466
1590 3300025935 Ga0207709_10000081 Ga0207709_10000081124 466
1591 3300025935 Ga0207709_10046601 Ga0207709_100466013 466
1592 3300025936 Ga0207670_10000620 Ga0207670_100006205 466
1593 3300025936 Ga0207670_10000760 Ga0207670_100007606 466
1594 3300025936 Ga0207670_10006459 Ga0207670_100064595 466
1595 3300025936 Ga0207670_10008745 Ga0207670_100087453 466
1596 3300025937 Ga0207669_10000008 Ga0207669_1000000825 466
1597 3300025937 Ga0207669_10004053 Ga0207669_100040532 466
1598 3300025938 Ga0207704_10000215 Ga0207704_100002152 466
1599 3300025938 Ga0207704_10058982 Ga0207704_100589822 466
1600 3300025938 Ga0207704_10066628 Ga0207704_100666282 466
1601 3300025938 Ga0207704_10125936 Ga0207704_101259361 466
1602 3300025939 Ga0207665_10000361 Ga0207665_1000036112 466
1603 3300025939 Ga0207665_10001484 Ga0207665_100014846 466
1604 3300025939 Ga0207665_10045676 Ga0207665_100456762 466
1605 3300025940 Ga0207691_10000482 Ga0207691_100004829 466
1606 3300025940 Ga0207691_10002588 Ga0207691_1000258811 466
1607 3300025940 Ga0207691_10040950 Ga0207691_100409504 466
1608 3300025941 Ga0207711_10000003 Ga0207711_10000003861 466
1609 3300025941 Ga0207711_10000005 Ga0207711_10000005273 466
1610 3300025941 Ga0207711_10000009 Ga0207711_10000009383 466
1611 3300025941 Ga0207711_10012426 Ga0207711_100124265 466
1612 3300025941 Ga0207711_10040725 Ga0207711_100407253 466
1613 3300025941 Ga0207711_10062352 Ga0207711_100623522 466
1614 3300025941 Ga0207711_10062950 Ga0207711_100629502 466
1615 3300025941 Ga0207711_10070788 Ga0207711_100707883 466
1616 3300025941 Ga0207711_10082864 Ga0207711_100828642 466
1617 3300025941 Ga0207711_10100986 Ga0207711_101009862 466
1618 3300025942 Ga0207689_10000749 Ga0207689_1000074913 466
1619 3300025944 Ga0207661_10000170 Ga0207661_1000017033 466
1620 3300025944 Ga0207661_10004270 Ga0207661_100042703 466
1621 3300025944 Ga0207661_10032345 Ga0207661_100323454 466
1622 3300025944 Ga0207661_10089875 Ga0207661_100898752 466
1623 3300025945 Ga0207679_10000046 Ga0207679_1000004677 466
1624 3300025945 Ga0207679_10010295 Ga0207679_100102953 466
1625 3300025949 Ga0207667_10007538 Ga0207667_100075387 466
1626 3300025949 Ga0207667_10010820 Ga0207667_100108208 466
1627 3300025949 Ga0207667_10038259 Ga0207667_100382592 466
1628 3300025960 Ga0207651_10000200 Ga0207651_1000020015 466
1629 3300025960 Ga0207651_10051209 Ga0207651_100512092 466
1630 3300025960 Ga0207651_10059710 Ga0207651_100597103 466
1631 3300025960 Ga0207651_10111193 Ga0207651_101111932 466
1632 3300025961 Ga0207712_10000495 Ga0207712_100004952 466
1633 3300025961 Ga0207712_10087561 Ga0207712_100875612 466
1634 3300025961 Ga0207712_10088828 Ga0207712_100888282 466
1635 3300025961 Ga0207712_10149277 Ga0207712_101492772 466
1636 3300025972 Ga0207668_10000133 Ga0207668_1000013330 466
1637 3300025972 Ga0207668_10084712 Ga0207668_100847123 466
1638 3300025972 Ga0207668_10103475 Ga0207668_101034752 466
1639 3300025981 Ga0207640_10000191 Ga0207640_1000019134 466
1640 3300025981 Ga0207640_10016944 Ga0207640_100169441 466
1641 3300025981 Ga0207640_10042013 Ga0207640_100420133 466
1642 3300025981 Ga0207640_10058017 Ga0207640_100580172 466
1643 3300025986 Ga0207658_10000535 Ga0207658_1000053527 466
1644 3300025986 Ga0207658_10059229 Ga0207658_100592293 466
1645 3300025986 Ga0207658_10144152 Ga0207658_101441522 466
1646 3300026023 Ga0207677_10000806 Ga0207677_1000080613 466
1647 3300026023 Ga0207677_10075864 Ga0207677_100758642 466
1648 3300026035 Ga0207703_10001617 Ga0207703_100016172 466
1649 3300026035 Ga0207703_10003074 Ga0207703_100030746 466
1650 3300026035 Ga0207703_10012070 Ga0207703_100120702 466
1651 3300026041 Ga0207639_10002809 Ga0207639_100028096 466
1652 3300026041 Ga0207639_10009638 Ga0207639_100096383 466
1653 3300026041 Ga0207639_10009726 Ga0207639_100097266 466
1654 3300026041 Ga0207639_10010472 Ga0207639_100104721 466
1655 3300026041 Ga0207639_10019773 Ga0207639_100197733 466
1656 3300026041 Ga0207639_10237420 Ga0207639_102374202 466
1657 3300026067 Ga0207678_10001859 Ga0207678_100018595 466
1658 3300026067 Ga0207678_10016738 Ga0207678_100167386 466
1659 3300026067 Ga0207678_10054411 Ga0207678_100544112 466
1660 3300026067 Ga0207678_10109849 Ga0207678_101098491 466
1661 3300026075 Ga0207708_10001031 Ga0207708_100010311 466
1662 3300026075 Ga0207708_10018880 Ga0207708_100188805 466
1663 3300026075 Ga0207708_10019057 Ga0207708_100190571 466
1664 3300026075 Ga0207708_10104329 Ga0207708_101043292 466
1665 3300026075 Ga0207708_10150977 Ga0207708_101509772 466
1666 3300026078 Ga0207702_10000003 Ga0207702_10000003389 466
1667 3300026078 Ga0207702_10000041 Ga0207702_1000004174 466
1668 3300026078 Ga0207702_10003065 Ga0207702_1000306513 466
1669 3300026088 Ga0207641_10000593 Ga0207641_1000059314 466
1670 3300026088 Ga0207641_10019300 Ga0207641_100193004 466
1671 3300026089 Ga0207648_10002417 Ga0207648_100024176 466
1672 3300026089 Ga0207648_10013629 Ga0207648_100136294 466
1673 3300026095 Ga0207676_10009283 Ga0207676_100092835 466
1674 3300026095 Ga0207676_10011206 Ga0207676_100112062 466
1675 3300026095 Ga0207676_10011983 Ga0207676_100119834 466
1676 3300026116 Ga0207674_10003381 Ga0207674_100033816 466
1677 3300026116 Ga0207674_10004756 Ga0207674_100047569 466
1678 3300026116 Ga0207674_10026464 Ga0207674_100264647 466
1679 3300026116 Ga0207674_10031482 Ga0207674_100314822 466
1680 3300026116 Ga0207674_10165937 Ga0207674_101659372 466
1681 3300026118 Ga0207675_100002182 Ga0207675_10000218213 466
1682 3300026118 Ga0207675_100029789 Ga0207675_1000297892 466
1683 3300026118 Ga0207675_100033143 Ga0207675_1000331432 466
1684 3300026118 Ga0207675_100038306 Ga0207675_1000383062 466
1685 3300026121 Ga0207683_10000002 Ga0207683_10000002259 466
1686 3300026121 Ga0207683_10006919 Ga0207683_100069195 466
1687 3300026121 Ga0207683_10041959 Ga0207683_100419592 466
1688 3300026121 Ga0207683_10042740 Ga0207683_100427404 466
1689 3300026121 Ga0207683_10072340 Ga0207683_100723403 466
1690 3300026142 Ga0207698_10000545 Ga0207698_1000054511 466
1691 3300026142 Ga0207698_10004110 Ga0207698_100041105 466
1692 3300026142 Ga0207698_10021924 Ga0207698_100219243 466
1693 3300026142 Ga0207698_10054008 Ga0207698_100540083 466
1694 3300026142 Ga0207698_10214656 Ga0207698_102146562 466
1695 3300027111 Ga0209281_1000106 Ga0209281_1000106187 466
1696 3300027111 Ga0209281_1000318 Ga0209281_100031832 466
1697 3300027296 Ga0209389_1000004 Ga0209389_10000044 466
1698 3300027296 Ga0209389_1000023 Ga0209389_100002311 466
1699 3300027312 Ga0209371_1000022 Ga0209371_100002277 466
1700 3300027312 Ga0209371_1001019 Ga0209371_100101919 466
1701 3300027312 Ga0209371_1004133 Ga0209371_10041332 466
1702 3300027357 Ga0209589_1000006 Ga0209589_1000006372 466
1703 3300027357 Ga0209589_1000010 Ga0209589_1000010148 466
1704 3300027361 Ga0209489_100007 Ga0209489_100007372 466
1705 3300027361 Ga0209489_100011 Ga0209489_10001188 466
1706 3300027361 Ga0209489_100295 Ga0209489_1002953 466
1707 3300027363 Ga0209700_100008 Ga0209700_100008372 466
1708 3300027363 Ga0209700_100013 Ga0209700_10001391 466
1709 3300027512 Ga0209179_1002939 Ga0209179_10029392 466
1710 3300027666 Ga0209282_1000024 Ga0209282_1000024118 466
1711 3300027666 Ga0209282_1000531 Ga0209282_10005315 466
1712 3300027695 Ga0209966_1000800 Ga0209966_10008004 466
1713 3300027695 Ga0209966_1004060 Ga0209966_10040601 466
1714 3300027717 Ga0209998_10015195 Ga0209998_100151951 466
1715 3300027866 Ga0209813_10002584 Ga0209813_100025843 466
1716 3300027866 Ga0209813_10032067 Ga0209813_100320671 466
1717 3300027876 Ga0209974_10000944 Ga0209974_100009445 466
1718 3300027876 Ga0209974_10009960 Ga0209974_100099602 466
1719 3300027907 Ga0207428_10000011 Ga0207428_1000001143 466
1720 3300027907 Ga0207428_10000046 Ga0207428_10000046138 466
1721 3300027907 Ga0207428_10000058 Ga0207428_1000005878 466
1722 3300027907 Ga0207428_10001276 Ga0207428_1000127610 466
1723 3300027907 Ga0207428_10032257 Ga0207428_100322572 466
1724 3300028379 Ga0268266_10004900 Ga0268266_100049008 466
1725 3300028379 Ga0268266_10006027 Ga0268266_100060274 466
1726 3300028379 Ga0268266_10008843 Ga0268266_100088437 466
1727 3300028379 Ga0268266_10013893 Ga0268266_100138933 466
1728 3300028379 Ga0268266_10019605 Ga0268266_100196054 466
1729 3300028379 Ga0268266_10039703 Ga0268266_100397032 466
1730 3300028379 Ga0268266_10124277 Ga0268266_101242771 466
1731 3300028380 Ga0268265_10010132 Ga0268265_100101324 466
1732 3300028380 Ga0268265_10011194 Ga0268265_100111945 466
1733 3300028380 Ga0268265_10060191 Ga0268265_100601911 466
1734 3300028380 Ga0268265_10232093 Ga0268265_102320931 466
1735 3300028381 Ga0268264_10000093 Ga0268264_10000093115 466
1736 3300028381 Ga0268264_10000340 Ga0268264_100003407 466
1737 3300028381 Ga0268264_10013402 Ga0268264_100134023 466
1738 3300028381 Ga0268264_10016659 Ga0268264_100166594 466
1739 3300028381 Ga0268264_10102505 Ga0268264_101025052 466
1740 3300028381 Ga0268264_10140599 Ga0268264_101405991 466
1741 3300028666 Ga0265336_10005296 Ga0265336_100052962 466
1742 3300028786 Ga0307517_10000085 Ga0307517_10000085112 466
1743 3300028786 Ga0307517_10098343 Ga0307517_100983432 466
1744 3300028794 Ga0307515_10001978 Ga0307515_1000197821 466
1745 3300028794 Ga0307515_10007368 Ga0307515_100073689 466
1746 3300028794 Ga0307515_10030752 Ga0307515_100307525 466
1747 3300028794 Ga0307515_10039862 Ga0307515_100398626 466
1748 3300028800 Ga0265338_10000328 Ga0265338_1000032825 466
1749 3300028800 Ga0265338_10030731 Ga0265338_100307315 466
1750 3300028800 Ga0265338_10033564 Ga0265338_100335641 466
1751 3300030500 Ga0268256_1000019 Ga0268256_1000019443 466
1752 3300030500 Ga0268256_1003875 Ga0268256_10038752 466
1753 3300030500 Ga0268256_1016593 Ga0268256_10165932 466
1754 3300030521 Ga0307511_10057782 Ga0307511_100577822 466
1755 3300031235 Ga0265330_10016569 Ga0265330_100165692 466
1756 3300031235 Ga0265330_10034309 Ga0265330_100343092 466
1757 3300031238 Ga0265332_10011026 Ga0265332_100110262 466
1758 3300031239 Ga0265328_10000047 Ga0265328_1000004758 466
1759 3300031239 Ga0265328_10004803 Ga0265328_100048036 466
1760 3300031239 Ga0265328_10011003 Ga0265328_100110033 466
1761 3300031240 Ga0265320_10000209 Ga0265320_1000020924 466
1762 3300031241 Ga0265325_10000117 Ga0265325_1000011738 466
1763 3300031241 Ga0265325_10000855 Ga0265325_100008556 466
1764 3300031241 Ga0265325_10005212 Ga0265325_100052124 466
1765 3300031241 Ga0265325_10011412 Ga0265325_100114122 466
1766 3300031241 Ga0265325_10013215 Ga0265325_100132154 466
1767 3300031241 Ga0265325_10046783 Ga0265325_100467832 466
1768 3300031242 Ga0265329_10036621 Ga0265329_100366212 466
1769 3300031247 Ga0265340_10002779 Ga0265340_100027796 466
1770 3300031247 Ga0265340_10006860 Ga0265340_100068604 466
1771 3300031247 Ga0265340_10009498 Ga0265340_100094983 466
1772 3300031247 Ga0265340_10017347 Ga0265340_100173472 466
1773 3300031249 Ga0265339_10000084 Ga0265339_1000008472 466
1774 3300031249 Ga0265339_10000450 Ga0265339_1000045023 466
1775 3300031249 Ga0265339_10021175 Ga0265339_100211752 466
1776 3300031250 Ga0265331_10000707 Ga0265331_100007077 466
1777 3300031250 Ga0265331_10013005 Ga0265331_100130053 466
1778 3300031250 Ga0265331_10014674 Ga0265331_100146742 466
1779 3300031251 Ga0265327_10015402 Ga0265327_100154022 466
1780 3300031344 Ga0265316_10002618 Ga0265316_100026183 466
1781 3300031456 Ga0307513_10010539 Ga0307513_100105397 466
1782 3300031456 Ga0307513_10077997 Ga0307513_100779973 466
1783 3300031456 Ga0307513_10082118 Ga0307513_100821183 466
1784 3300031456 Ga0307513_10228700 Ga0307513_102287001 466
1785 3300031548 Ga0307408_100056480 Ga0307408_1000564802 466
1786 3300031595 Ga0265313_10000242 Ga0265313_1000024215 466
1787 3300031595 Ga0265313_10000340 Ga0265313_1000034028 466
1788 3300031595 Ga0265313_10005463 Ga0265313_1000546310 466
1789 3300031595 Ga0265313_10009155 Ga0265313_100091555 466
1790 3300031595 Ga0265313_10064921 Ga0265313_100649212 466
1791 3300031616 Ga0307508_10000034 Ga0307508_10000034125 466
1792 3300031616 Ga0307508_10047091 Ga0307508_100470913 466
1793 3300031616 Ga0307508_10057194 Ga0307508_100571942 466
1794 3300031691 Ga0316579_10007101 Ga0316579_100071016 466
1795 3300031711 Ga0265314_10001245 Ga0265314_1000124510 466
1796 3300031711 Ga0265314_10005302 Ga0265314_100053025 466
1797 3300031711 Ga0265314_10067583 Ga0265314_100675832 466
1798 3300031712 Ga0265342_10000211 Ga0265342_1000021116 466
1799 3300031712 Ga0265342_10006824 Ga0265342_100068245 466
1800 3300031712 Ga0265342_10009227 Ga0265342_100092274 466
1801 3300031712 Ga0265342_10022614 Ga0265342_100226143 466
1802 3300031712 Ga0265342_10076179 Ga0265342_100761792 466
1803 3300031731 Ga0307405_10067890 Ga0307405_100678902 466
1804 3300031824 Ga0307413_10046953 Ga0307413_100469531 466
1805 3300031901 Ga0307406_10092557 Ga0307406_100925572 466
1806 3300031967 Ga0315914_1000012 Ga0315914_100001245 466
1807 3300031995 Ga0307409_100020095 Ga0307409_1000200953 466
1808 3300031995 Ga0307409_100057238 Ga0307409_1000572382 466
1809 3300032004 Ga0307414_10058321 Ga0307414_100583212 466
1810 3300032133 Ga0316583_10002698 Ga0316583_100026984 466
1811 3300033180 Ga0307510_10004348 Ga0307510_100043487 466
1812 3300033180 Ga0307510_10036621 Ga0307510_100366213 466
1813 3300033430 Ga0315913_1000006 Ga0315913_100000645 466
1814 3300033442 Ga0315911_1000010 Ga0315911_1000010164 466
1815 3300033464 Ga0315915_1000010 Ga0315915_1000010220 466
1816 3300034816 Ga0373930_0003116 Ga0373930_0003116_185_1585 466
1817 3300034816 Ga0373930_0010266 Ga0373930_0010266_19_1422 466
1818 3300034817 Ga0373948_0000885 Ga0373948_0000885_768_2168 466
1819 3300034817 Ga0373948_0010641 Ga0373948_0010641_126_1526 466
1820 3300034818 Ga0373950_0001808 Ga0373950_0001808_1231_2631 466
1821 3300034818 Ga0373950_0002959 Ga0373950_0002959_72_1472 466
1822 3300034819 Ga0373958_0000097 Ga0373958_0000097_3358_4758 466
1823 3300034820 Ga0373959_0000831 Ga0373959_0000831_162_1562 466
1824 3300034957 Ga0373938_0000032 Ga0373938_0000032_4272_5672 466
1825 3300034957 Ga0373938_0000454 Ga0373938_0000454_698_2098 466
1826 3300034957 Ga0373938_0005302 Ga0373938_0005302_352_1752 466
1827 3300035083 Ga0373926_0004868 Ga0373926_0004868_534_1934 466
1828 3300035083 Ga0373926_0012760 Ga0373926_0012760_837_2249 466
1829 3300035085 Ga0373929_0001755 Ga0373929_0001755_1729_3129 466
1830 3300035085 Ga0373929_0003006 Ga0373929_0003006_189_1589 466
1831 3300035086 Ga0373934_0037578 Ga0373934_0037578_491_1894 466
1832 3300035090 Ga0373949_0001084 Ga0373949_0001084_1481_2881 466
1833 3300035091 Ga0373951_0000472 Ga0373951_0000472_6746_8146 466
1834 3300035091 Ga0373951_0002239 Ga0373951_0002239_2891_4291 466
1835 3300035092 Ga0373952_0000675 Ga0373952_0000675_2071_3471 466
1836 3300035092 Ga0373952_0000857 Ga0373952_0000857_120_1520 466
1837 3300035111 Ga0373923_0001236 Ga0373923_0001236_4747_6222 466
1838 3300035111 Ga0373923_0002149 Ga0373923_0002149_2410_3861 466
1839 3300035112 Ga0373932_0000180 Ga0373932_0000180_4144_5544 466
1840 3300035112 Ga0373932_0004968 Ga0373932_0004968_959_2359 466
1841 3300035113 Ga0373936_0005755 Ga0373936_0005755_705_2156 466
1842 3300035113 Ga0373936_0016254 Ga0373936_0016254_1183_2586 466
1843 3300035113 Ga0373936_0020061 Ga0373936_0020061_1181_2584 466
1844 3300035114 Ga0373939_0000151 Ga0373939_0000151_13664_15064 466
1845 3300035114 Ga0373939_0001404 Ga0373939_0001404_4272_5672 466
1846 3300035115 Ga0373941_0001811 Ga0373941_0001811_1535_2938 466
1847 3300035115 Ga0373941_0002963 Ga0373941_0002963_1407_2807 466
1848 3300035115 Ga0373941_0003543 Ga0373941_0003543_1432_2832 466
1849 3300035116 Ga0373945_0001892 Ga0373945_0001892_596_2047 466
1850 3300035116 Ga0373945_0014158 Ga0373945_0014158_645_2045 466
1851 3300035117 Ga0373953_0001359 Ga0373953_0001359_4984_6393 466
1852 3300035117 Ga0373953_0001859 Ga0373953_0001859_3337_4737 466
1853 3300035118 Ga0373954_0001664 Ga0373954_0001664_7204_8679 466
1854 3300035118 Ga0373954_0002584 Ga0373954_0002584_5978_7381 466
1855 3300035118 Ga0373954_0004556 Ga0373954_0004556_3495_4904 466
1856 3300035118 Ga0373954_0023646 Ga0373954_0023646_188_1591 466
1857 3300035118 Ga0373954_0054205 Ga0373954_0054205_183_1634 466
1858 3300035118 Ga0373954_0056759 Ga0373954_0056759_147_1550 466
1859 3300035119 Ga0373956_0034829 Ga0373956_0034829_274_1677 466
1860 3300035120 Ga0373957_0001068 Ga0373957_0001068_1899_3308 466
1861 3300035120 Ga0373957_0015263 Ga0373957_0015263_755_2158 466
1862 3300035121 Ga0373960_0000184 Ga0373960_0000184_6937_8337 466
1863 3300035121 Ga0373960_0003038 Ga0373960_0003038_1462_2862 466
1864 3300035170 Ga0373943_0000072 Ga0373943_0000072_4885_6294 466
1865 3300035170 Ga0373943_0006580 Ga0373943_0006580_2398_3801 466
1866 3300035170 Ga0373943_0007994 Ga0373943_0007994_1478_2881 466
1867 3300035170 Ga0373943_0024755 Ga0373943_0024755_230_1633 466
1868 3300035170 Ga0373943_0046399 Ga0373943_0046399_276_1676 466
1869 3300035171 Ga0373946_0009681 Ga0373946_0009681_954_2354 466
1870 3300035171 Ga0373946_0012729 Ga0373946_0012729_355_1755 466
1871 3300035171 Ga0373946_0035330 Ga0373946_0035330_548_1960 466
1872 3300035172 Ga0373955_0000880 Ga0373955_0000880_7777_9186 466
1873 3300035172 Ga0373955_0004332 Ga0373955_0004332_2126_3601 466
1874 3300035172 Ga0373955_0006574 Ga0373955_0006574_2548_3951 466
1875 3300035172 Ga0373955_0014225 Ga0373955_0014225_10_1422 466
1876 3300035172 Ga0373955_0050101 Ga0373955_0050101_110_1510 466
1877 3300035172 Ga0373955_0054012 Ga0373955_0054012_634_2034 466
1878 3300035172 Ga0373955_0059876 Ga0373955_0059876_680_2083 466
1879 3300035207 Ga0373942_0000288 Ga0373942_0000288_855_2255 466
1880 3300035207 Ga0373942_0005465 Ga0373942_0005465_1198_2598 466
1881 3300035241 Ga0373961_0003973 Ga0373961_0003973_820_2223 466
1882 3300035242 Ga0373962_0000113 Ga0373962_0000113_12077_13477 466
1883 3300035242 Ga0373962_0000606 Ga0373962_0000606_161_1561 466
1884 3300035242 Ga0373962_0002013 Ga0373962_0002013_99_1499 466
1885 3300035398 Ga0316574_0001675 Ga0316574_0001675_7363_8778 466
1886 3300035410 Ga0373924_0002398 Ga0373924_0002398_782_2191 466
1887 3300035410 Ga0373924_0006697 Ga0373924_0006697_375_1778 466
1888 3300035410 Ga0373924_0007407 Ga0373924_0007407_1808_3259 466
1889 3300035691 Ga0373931_0000290 Ga0373931_0000290_13552_14952 466
1890 3300035691 Ga0373931_0004295 Ga0373931_0004295_324_1730 466
1891 3300035691 Ga0373931_0009129 Ga0373931_0009129_1996_3396 466
1892 3300035691 Ga0373931_0053672 Ga0373931_0053672_731_2134 466
1893 3300035692 Ga0373935_0000185 Ga0373935_0000185_10529_12004 466
1894 3300035692 Ga0373935_0000259 Ga0373935_0000259_14963_16366 466
1895 3300035692 Ga0373935_0007559 Ga0373935_0007559_4907_6316 466
1896 3300035692 Ga0373935_0010080 Ga0373935_0010080_2744_4147 466
1897 3300035692 Ga0373935_0015153 Ga0373935_0015153_448_1848 466
1898 3300035692 Ga0373935_0018309 Ga0373935_0018309_1889_3298 466
1899 3300035692 Ga0373935_0023830 Ga0373935_0023830_1674_3074 466
1900 3300035692 Ga0373935_0032229 Ga0373935_0032229_304_1755 466
1901 3300035692 Ga0373935_0035977 Ga0373935_0035977_1340_2752 466
1902 3300035692 Ga0373935_0046704 Ga0373935_0046704_1078_2478 466
1903 3300035692 Ga0373935_0111083 Ga0373935_0111083_259_1671 466
1904 3300035695 Ga0373927_0000350 Ga0373927_0000350_31803_33218 466
1905 3300035695 Ga0373927_0002379 Ga0373927_0002379_5450_6853 466
1906 3300035695 Ga0373927_0005383 Ga0373927_0005383_2519_3928 466
1907 3300035695 Ga0373927_0009651 Ga0373927_0009651_1172_2581 466
1908 3300035695 Ga0373927_0012786 Ga0373927_0012786_2084_3559 466
1909 3300035695 Ga0373927_0016655 Ga0373927_0016655_2817_4220 466
1910 3300035695 Ga0373927_0040366 Ga0373927_0040366_908_2320 466
1911 3300035695 Ga0373927_0095089 Ga0373927_0095089_129_1532 466
1912 3300035724 Ga0373933_0000672 Ga0373933_0000672_3155_4555 466
1913 3300035724 Ga0373933_0001150 Ga0373933_0001150_13984_15387 466
1914 3300035724 Ga0373933_0002191 Ga0373933_0002191_3340_4749 466
1915 3300035724 Ga0373933_0008994 Ga0373933_0008994_1194_2669 466
1916 3300035724 Ga0373933_0015628 Ga0373933_0015628_199_1599 466
1917 3300035725 Ga0373947_0000217 Ga0373947_0000217_12929_14332 466
1918 3300035725 Ga0373947_0002658 Ga0373947_0002658_800_2200 466
1919 3300035725 Ga0373947_0010938 Ga0373947_0010938_3455_4858 466
1920 3300035725 Ga0373947_0012207 Ga0373947_0012207_753_2156 466
1921 3300035725 Ga0373947_0012703 Ga0373947_0012703_35_1438 466
1922 3300035725 Ga0373947_0013046 Ga0373947_0013046_2879_4282 466
1923 3300035725 Ga0373947_0025550 Ga0373947_0025550_1691_3142 466
1924 3300035725 Ga0373947_0060565 Ga0373947_0060565_355_1767 466
1925 3300035725 Ga0373947_0073931 Ga0373947_0073931_270_1673 466
1926 3300036401 Ga0373937_0000068 Ga0373937_0000068_79769_81244 466
1927 3300036401 Ga0373937_0003441 Ga0373937_0003441_7740_9152 466
1928 3300036401 Ga0373937_0005533 Ga0373937_0005533_4221_5624 466
1929 3300036401 Ga0373937_0006578 Ga0373937_0006578_5447_6856 466
1930 3300036401 Ga0373937_0019412 Ga0373937_0019412_1367_2767 466
1931 3300036401 Ga0373937_0022213 Ga0373937_0022213_2721_4124 466
1932 3300036401 Ga0373937_0022578 Ga0373937_0022578_925_2325 466
1933 3300036401 Ga0373937_0048658 Ga0373937_0048658_1079_2482 466
1934 3300036401 Ga0373937_0051281 Ga0373937_0051281_1551_2954 466
1935 3300036401 Ga0373937_0062102 Ga0373937_0062102_119_1519 466
1936 3300036401 Ga0373937_0154886 Ga0373937_0154886_127_1530 466
1937 3300036401 Ga0373937_0160985 Ga0373937_0160985_282_1685 466
1938 3300036712 Ga0316584_0000295 Ga0316584_0000295_9391_10806 466
1939 3300037068 Ga0373925_0002114 Ga0373925_0002114_13688_15097 466
1940 3300037068 Ga0373925_0002364 Ga0373925_0002364_640_2115 466
1941 3300037068 Ga0373925_0004501 Ga0373925_0004501_4984_6387 466
1942 3300037068 Ga0373925_0012856 Ga0373925_0012856_534_1943 466
1943 3300037068 Ga0373925_0026107 Ga0373925_0026107_151_1560 466
1944 3300037068 Ga0373925_0027981 Ga0373925_0027981_1302_2705 466
1945 3300037068 Ga0373925_0032521 Ga0373925_0032521_1131_2531 466
1946 3300037068 Ga0373925_0032858 Ga0373925_0032858_279_1694 466
1947 3300037068 Ga0373925_0045644 Ga0373925_0045644_1007_2416 466
1948 3300037068 Ga0373925_0055362 Ga0373925_0055362_117_1529 466
1949 3300037068 Ga0373925_0109575 Ga0373925_0109575_304_1755 466
1950 3300037068 Ga0373925_0144718 Ga0373925_0144718_37_1440 466
1951 3300037312 Ga0395899_0011711 Ga0395899_0011711_3656_5068 466
1952 3300037418 Ga0395900_0001924 Ga0395900_0001924_10262_11665 466
1953 3300037418 Ga0395900_0002400 Ga0395900_0002400_13062_14474 466
1954 3300037418 Ga0395900_0006327 Ga0395900_0006327_818_2218 466
1955 3300037418 Ga0395900_0070134 Ga0395900_0070134_507_1910 466
1956 3300037418 Ga0395900_0086570 Ga0395900_0086570_1100_2503 466
1957 3300037466 Ga0395898_0007812 Ga0395898_0007812_4193_5605 466
1958 3300037466 Ga0395898_0020243 Ga0395898_0020243_4670_6073 466
1959 3300037471 Ga0395905_0019046 Ga0395905_0019046_642_2087 466
1960 3300037853 Ga0436364_0351366 Ga0436364_0351366_372_1781 466
1961 3300037853 Ga0436364_0387248 Ga0436364_0387248_119_1522 466
1962 3300037853 Ga0436364_0578778 Ga0436364_0578778_1912_3315 466
1963 3300037853 Ga0436364_0719813 Ga0436364_0719813_630_2042 466
1964 3300037853 Ga0436364_0789056 Ga0436364_0789056_2643_4052 466
1965 3300038443 Ga0395901_0015985 Ga0395901_0015985_3088_4491 466
1966 3300038443 Ga0395901_0021552 Ga0395901_0021552_837_2249 466
1967 3300038443 Ga0395901_0116262 Ga0395901_0116262_720_2123 466
1968 3300038443 Ga0395901_0142816 Ga0395901_0142816_818_2221 466
1969 3300038443 Ga0395901_0161217 Ga0395901_0161217_896_2302 466
1970 3300039437 Ga0436365_0141715 Ga0436365_0141715_4785_6233 466
1971 3300039437 Ga0436365_0179847 Ga0436365_0179847_2039_3451 466
1972 3300039437 Ga0436365_0247802 Ga0436365_0247802_5498_6910 466
1973 3300039437 Ga0436365_1010704 Ga0436365_1010704_3923_5323 466
1974 3300039437 Ga0436365_1100914 Ga0436365_1100914_682_2094 466
1975 3300039437 Ga0436365_1359797 Ga0436365_1359797_342_1757 466
1976 3300039437 Ga0436365_1926106 Ga0436365_1926106_40_1452 466
1977 3300039438 Ga0436360_0147860 Ga0436360_0147860_265_1668 466
1978 3300039438 Ga0436360_0973324 Ga0436360_0973324_1379_2782 466
1979 3300039447 Ga0436361_0343104 Ga0436361_0343104_124_1536 466
1980 3300039447 Ga0436361_0532916 Ga0436361_0532916_270_1679 466
1981 3300039447 Ga0436361_1121961 Ga0436361_1121961_1425_2828 466
1982 3300039450 Ga0436363_0405250 Ga0436363_0405250_11395_12807 466
1983 3300039450 Ga0436363_0602817 Ga0436363_0602817_477_1889 466
1984 3300039453 Ga0436362_0646134 Ga0436362_0646134_3640_5043 466
1985 3300039453 Ga0436362_1096230 Ga0436362_1096230_13381_14829 466
1986 3300041441 Ga0451787_254401 Ga0451787_254401_792_2207 466
1987 3300041491 Ga0451833_0066605 Ga0451833_0066605_1681_3096 466
1988 3300041507 Ga0451851_1088920 Ga0451851_1088920_296_1711 466
1989 3300041509 Ga0451843_0599573 Ga0451843_0599573_402_1817 466
1990 3300042007 Ga0439449_0005174 Ga0439449_0005174_893_2308 466
1991 3300042122 Ga0450920_001623 Ga0450920_001623_1702_3117 466
1992 3300044658 Ga0466972_0000520 Ga0466972_0000520_4661_6103 466
1993 3300044658 Ga0466972_0004454 Ga0466972_0004454_2743_4185 466
1994 3300044693 Ga0466961_0000149 Ga0466961_0000149_44890_46293 466
1995 3300044694 Ga0466963_0006409 Ga0466963_0006409_4944_6350 466
1996 3300044694 Ga0466963_0006941 Ga0466963_0006941_4929_6332 466
1997 3300044694 Ga0466963_0073365 Ga0466963_0073365_571_1971 466
1998 3300044735 Ga0466968_0026660 Ga0466968_0026660_270_1712 466
1999 3300044842 Ga0466957_0017500 Ga0466957_0017500_2657_4060 466
2000 3300044842 Ga0466957_0049612 Ga0466957_0049612_191_1597 466
2001 3300044842 Ga0466957_0050773 Ga0466957_0050773_170_1573 466
2002 3300044901 Ga0466960_0053233 Ga0466960_0053233_527_1930 466
2003 3300045049 Ga0466959_0004087 Ga0466959_0004087_2628_4031 466
2004 3300045049 Ga0466959_0083136 Ga0466959_0083136_469_1872 466
2005 3300045051 Ga0451576_0145916 Ga0451576_0145916_772_2190 466
2006 3300045836 Ga0466958_0005656 Ga0466958_0005656_1421_2824 466
2007 3300045976 Ga0466967_0022781 Ga0466967_0022781_1686_3089 466
2008 3300045976 Ga0466967_0040762 Ga0466967_0040762_119_1522 466
2009 3300045976 Ga0466967_0073074 Ga0466967_0073074_1261_2664 466
2010 3300046454 Ga0495592_0000488 Ga0495592_0000488_997_2472 466
2011 3300046454 Ga0495592_0001276 Ga0495592_0001276_3155_4555 466
2012 3300046454 Ga0495592_0008207 Ga0495592_0008207_2895_4304 466
2013 3300046454 Ga0495592_0013719 Ga0495592_0013719_642_2045 466
2014 3300046454 Ga0495592_0029636 Ga0495592_0029636_1628_3031 466
2015 3300046454 Ga0495592_0035414 Ga0495592_0035414_183_1634 466
2016 3300046454 Ga0495592_0076319 Ga0495592_0076319_656_2056 466
2017 3300046455 Ga0495603_0000352 Ga0495603_0000352_8617_10020 466
2018 3300046455 Ga0495603_0019849 Ga0495603_0019849_1653_3056 466
2019 3300046459 Ga0495629_0001536 Ga0495629_0001536_5497_6897 466
2020 3300046459 Ga0495629_0002961 Ga0495629_0002961_6565_7968 466
2021 3300046459 Ga0495629_0003719 Ga0495629_0003719_7449_8852 466
2022 3300046459 Ga0495629_0006765 Ga0495629_0006765_473_1882 466
2023 3300046459 Ga0495629_0011224 Ga0495629_0011224_890_2365 466
2024 3300046459 Ga0495629_0017083 Ga0495629_0017083_668_2068 466
2025 3300046459 Ga0495629_0035281 Ga0495629_0035281_1924_3336 466
2026 3300046459 Ga0495629_0047563 Ga0495629_0047563_470_1873 466
2027 3300046460 Ga0495638_0014321 Ga0495638_0014321_652_2055 466
2028 3300046460 Ga0495638_0018200 Ga0495638_0018200_1027_2430 466
2029 3300046461 Ga0495641_0005001 Ga0495641_0005001_2090_3541 466
2030 3300046461 Ga0495641_0006337 Ga0495641_0006337_999_2402 466
2031 3300046461 Ga0495641_0010439 Ga0495641_0010439_2550_3962 466
2032 3300046461 Ga0495641_0041907 Ga0495641_0041907_534_1943 466
2033 3300046462 Ga0495651_0000655 Ga0495651_0000655_5746_7149 466
2034 3300046462 Ga0495651_0001053 Ga0495651_0001053_11664_13064 466
2035 3300046462 Ga0495651_0002415 Ga0495651_0002415_6880_8355 466
2036 3300046462 Ga0495651_0006660 Ga0495651_0006660_7284_8684 466
2037 3300046462 Ga0495651_0008150 Ga0495651_0008150_1395_2804 466
2038 3300046462 Ga0495651_0009605 Ga0495651_0009605_5369_6772 466
2039 3300046462 Ga0495651_0028771 Ga0495651_0028771_33_1436 466
2040 3300046462 Ga0495651_0063230 Ga0495651_0063230_311_1717 466
2041 3300046463 Ga0495653_0000199 Ga0495653_0000199_2669_4144 466
2042 3300046463 Ga0495653_0002222 Ga0495653_0002222_13450_14853 466
2043 3300046463 Ga0495653_0002829 Ga0495653_0002829_7951_9402 466
2044 3300046463 Ga0495653_0012753 Ga0495653_0012753_4037_5446 466
2045 3300046463 Ga0495653_0024422 Ga0495653_0024422_1584_2984 466
2046 3300046463 Ga0495653_0025837 Ga0495653_0025837_1512_2954 466
2047 3300046463 Ga0495653_0041780 Ga0495653_0041780_478_1878 466
2048 3300046463 Ga0495653_0071890 Ga0495653_0071890_847_2247 466
2049 3300046472 Ga0495580_0083053 Ga0495580_0083053_775_2178 466
2050 3300046473 Ga0495582_0000245 Ga0495582_0000245_27071_28474 466
2051 3300046473 Ga0495582_0001755 Ga0495582_0001755_4696_6096 466
2052 3300046473 Ga0495582_0017971 Ga0495582_0017971_1516_2916 466
2053 3300046473 Ga0495582_0024440 Ga0495582_0024440_1802_3205 466
2054 3300046474 Ga0495605_0001952 Ga0495605_0001952_11367_12782 466
2055 3300046475 Ga0495639_0015671 Ga0495639_0015671_955_2367 466
2056 3300046475 Ga0495639_0056596 Ga0495639_0056596_230_1630 466
2057 3300046476 Ga0495662_0000872 Ga0495662_0000872_8326_9729 466
2058 3300046476 Ga0495662_0001370 Ga0495662_0001370_8517_9926 466
2059 3300046476 Ga0495662_0009090 Ga0495662_0009090_2925_4400 466
2060 3300046476 Ga0495662_0034272 Ga0495662_0034272_750_2153 466
2061 3300046476 Ga0495662_0088210 Ga0495662_0088210_87_1490 466
2062 3300046477 Ga0495664_0000105 Ga0495664_0000105_12901_14376 466
2063 3300046477 Ga0495664_0000848 Ga0495664_0000848_12142_13551 466
2064 3300046477 Ga0495664_0002940 Ga0495664_0002940_4366_5766 466
2065 3300046477 Ga0495664_0004666 Ga0495664_0004666_4401_5804 466
2066 3300046477 Ga0495664_0013868 Ga0495664_0013868_2514_4049 466
2067 3300046477 Ga0495664_0019650 Ga0495664_0019650_1573_3024 466
2068 3300046477 Ga0495664_0041648 Ga0495664_0041648_679_2082 466
2069 3300046491 Ga0495584_0010859 Ga0495584_0010859_3196_4647 466
2070 3300046491 Ga0495584_0055575 Ga0495584_0055575_574_1974 466
2071 3300046492 Ga0495585_0015360 Ga0495585_0015360_1635_3086 466
2072 3300046492 Ga0495585_0021569 Ga0495585_0021569_873_2285 466
2073 3300046492 Ga0495585_0050268 Ga0495585_0050268_610_2052 466
2074 3300046500 Ga0495596_0049656 Ga0495596_0049656_98_1501 466
2075 3300046501 Ga0495607_0046374 Ga0495607_0046374_380_1795 466
2076 3300046501 Ga0495607_0058102 Ga0495607_0058102_441_1853 466
2077 3300046511 Ga0495608_0000020 Ga0495608_0000020_26403_27878 466
2078 3300046511 Ga0495608_0005839 Ga0495608_0005839_5188_6591 466
2079 3300046511 Ga0495608_0006424 Ga0495608_0006424_801_2201 466
2080 3300046511 Ga0495608_0015143 Ga0495608_0015143_3904_5304 466
2081 3300046511 Ga0495608_0019409 Ga0495608_0019409_2562_3965 466
2082 3300046511 Ga0495608_0025279 Ga0495608_0025279_2024_3433 466
2083 3300046511 Ga0495608_0041347 Ga0495608_0041347_1495_2898 466
2084 3300046511 Ga0495608_0044765 Ga0495608_0044765_704_2107 466
2085 3300046511 Ga0495608_0063772 Ga0495608_0063772_122_1525 466
2086 3300046512 Ga0495610_0078313 Ga0495610_0078313_97_1500 466
2087 3300046513 Ga0495616_0035673 Ga0495616_0035673_939_2351 466
2088 3300046514 Ga0495618_0001074 Ga0495618_0001074_4256_5731 466
2089 3300046514 Ga0495618_0009256 Ga0495618_0009256_1003_2406 466
2090 3300046514 Ga0495618_0014797 Ga0495618_0014797_1890_3290 466
2091 3300046514 Ga0495618_0039877 Ga0495618_0039877_1338_2741 466
2092 3300046514 Ga0495618_0049512 Ga0495618_0049512_931_2334 466
2093 3300046515 Ga0495620_0020509 Ga0495620_0020509_1750_3153 466
2094 3300046516 Ga0495628_0000005 Ga0495628_0000005_79599_81074 466
2095 3300046516 Ga0495628_0003193 Ga0495628_0003193_1270_2670 466
2096 3300046516 Ga0495628_0005097 Ga0495628_0005097_6730_8139 466
2097 3300046516 Ga0495628_0019614 Ga0495628_0019614_3066_4469 466
2098 3300046516 Ga0495628_0052582 Ga0495628_0052582_607_2058 466
2099 3300046516 Ga0495628_0058839 Ga0495628_0058839_587_1993 466
2100 3300046517 Ga0495630_0001784 Ga0495630_0001784_3093_4568 466
2101 3300046517 Ga0495630_0043306 Ga0495630_0043306_565_1974 466
2102 3300046517 Ga0495630_0043308 Ga0495630_0043308_1467_2867 466
2103 3300046518 Ga0495631_0064912 Ga0495631_0064912_142_1554 466
2104 3300046522 Ga0495643_0002725 Ga0495643_0002725_6205_7620 466
2105 3300046523 Ga0495644_0003283 Ga0495644_0003283_2359_3810 466
2106 3300046524 Ga0495648_0001680 Ga0495648_0001680_11786_13189 466
2107 3300046524 Ga0495648_0044051 Ga0495648_0044051_944_2359 466
2108 3300046526 Ga0495666_0015592 Ga0495666_0015592_1571_2971 466
2109 3300046526 Ga0495666_0068918 Ga0495666_0068918_91_1500 466
2110 3300046529 Ga0495652_0000001 Ga0495652_0000001_998070_999545 466
2111 3300046529 Ga0495652_0001783 Ga0495652_0001783_3738_5141 466
2112 3300046529 Ga0495652_0007926 Ga0495652_0007926_3250_4650 466
2113 3300046529 Ga0495652_0010443 Ga0495652_0010443_949_2349 466
2114 3300046529 Ga0495652_0036021 Ga0495652_0036021_249_1652 466
2115 3300046529 Ga0495652_0036122 Ga0495652_0036122_575_1984 466
2116 3300046529 Ga0495652_0101270 Ga0495652_0101270_222_1622 466
2117 3300046531 Ga0495665_0000361 Ga0495665_0000361_4068_5471 466
2118 3300046531 Ga0495665_0016782 Ga0495665_0016782_159_1568 466
2119 3300046531 Ga0495665_0023775 Ga0495665_0023775_843_2246 466
2120 3300046533 Ga0495640_0000027 Ga0495640_0000027_76341_77816 466
2121 3300046533 Ga0495640_0002916 Ga0495640_0002916_2131_3540 466
2122 3300046533 Ga0495640_0003002 Ga0495640_0003002_4067_5470 466
2123 3300046533 Ga0495640_0008459 Ga0495640_0008459_876_2276 466
2124 3300046533 Ga0495640_0008740 Ga0495640_0008740_2463_3863 466
2125 3300046533 Ga0495640_0010157 Ga0495640_0010157_1108_2511 466
2126 3300046533 Ga0495640_0017400 Ga0495640_0017400_2899_4302 466
2127 3300046533 Ga0495640_0034231 Ga0495640_0034231_1012_2415 466
2128 3300046535 Ga0495586_0013373 Ga0495586_0013373_921_2330 466
2129 3300046536 Ga0495587_0000017 Ga0495587_0000017_28794_30269 466
2130 3300046536 Ga0495587_0001634 Ga0495587_0001634_4313_5716 466
2131 3300046536 Ga0495587_0004533 Ga0495587_0004533_1995_3395 466
2132 3300046536 Ga0495587_0011251 Ga0495587_0011251_118_1518 466
2133 3300046536 Ga0495587_0017008 Ga0495587_0017008_2936_4339 466
2134 3300046536 Ga0495587_0018218 Ga0495587_0018218_2372_3781 466
2135 3300046536 Ga0495587_0059072 Ga0495587_0059072_813_2213 466
2136 3300046536 Ga0495587_0117126 Ga0495587_0117126_28_1434 466
2137 3300046537 Ga0495598_0000989 Ga0495598_0000989_785_2197 466
2138 3300046543 Ga0495645_0000212 Ga0495645_0000212_27463_28938 466
2139 3300046543 Ga0495645_0001744 Ga0495645_0001744_6144_7553 466
2140 3300046543 Ga0495645_0020761 Ga0495645_0020761_1961_3403 466
2141 3300046543 Ga0495645_0023607 Ga0495645_0023607_2422_3957 466
2142 3300046543 Ga0495645_0031817 Ga0495645_0031817_1937_3337 466
2143 3300046543 Ga0495645_0055550 Ga0495645_0055550_622_2025 466
2144 3300046543 Ga0495645_0140832 Ga0495645_0140832_198_1601 466
2145 3300046557 Ga0495622_0006317 Ga0495622_0006317_1857_3260 466
2146 3300046558 Ga0495633_0012648 Ga0495633_0012648_2097_3548 466
2147 3300046558 Ga0495633_0016697 Ga0495633_0016697_1600_3015 466
2148 3300046558 Ga0495633_0042755 Ga0495633_0042755_612_2024 466
2149 3300046559 Ga0495667_0000031 Ga0495667_0000031_118409_119884 466
2150 3300046559 Ga0495667_0002154 Ga0495667_0002154_7487_8890 466
2151 3300046559 Ga0495667_0005829 Ga0495667_0005829_575_1984 466
2152 3300046559 Ga0495667_0008100 Ga0495667_0008100_1731_3131 466
2153 3300046559 Ga0495667_0008220 Ga0495667_0008220_485_1936 466
2154 3300046559 Ga0495667_0012248 Ga0495667_0012248_4036_5439 466
2155 3300046559 Ga0495667_0017063 Ga0495667_0017063_58_1458 466
2156 3300046615 Ga0495656_0000812 Ga0495656_0000812_3631_5082 466
2157 3300046615 Ga0495656_0017683 Ga0495656_0017683_470_1882 466
2158 3300046615 Ga0495656_0039808 Ga0495656_0039808_489_1892 466
2159 3300046616 Ga0495668_0020542 Ga0495668_0020542_1141_2544 466
2160 3300046616 Ga0495668_0101055 Ga0495668_0101055_75_1490 466
2161 3300046642 Ga0495634_0000006 Ga0495634_0000006_125862_127337 466
2162 3300046642 Ga0495634_0000249 Ga0495634_0000249_7921_9324 466
2163 3300046642 Ga0495634_0004120 Ga0495634_0004120_4413_5816 466
2164 3300046642 Ga0495634_0019062 Ga0495634_0019062_1504_2913 466
2165 3300046642 Ga0495634_0102277 Ga0495634_0102277_287_1690 466
2166 3300046648 Ga0495611_0006846 Ga0495611_0006846_3213_4685 466
2167 3300046663 Ga0495635_0000154 Ga0495635_0000154_12908_14383 466
2168 3300046663 Ga0495635_0000239 Ga0495635_0000239_5580_6983 466
2169 3300046663 Ga0495635_0000681 Ga0495635_0000681_4921_6330 466
2170 3300046663 Ga0495635_0001492 Ga0495635_0001492_13790_15193 466
2171 3300046663 Ga0495635_0003846 Ga0495635_0003846_4987_6396 466
2172 3300046663 Ga0495635_0014377 Ga0495635_0014377_4075_5478 466
2173 3300046663 Ga0495635_0019133 Ga0495635_0019133_433_1842 466
2174 3300046663 Ga0495635_0031183 Ga0495635_0031183_2064_3464 466
2175 3300046663 Ga0495635_0037865 Ga0495635_0037865_1839_3239 466
2176 3300046663 Ga0495635_0055286 Ga0495635_0055286_157_1560 466
2177 3300046663 Ga0495635_0082315 Ga0495635_0082315_668_2068 466
2178 3300046664 Ga0495659_0021922 Ga0495659_0021922_258_1709 466
2179 3300046665 Ga0495661_0031412 Ga0495661_0031412_1764_3215 466
2180 3300046674 Ga0495588_0002364 Ga0495588_0002364_4230_5681 466
2181 3300046674 Ga0495588_0014080 Ga0495588_0014080_2394_3797 466
2182 3300046674 Ga0495588_0051178 Ga0495588_0051178_475_1890 466
2183 3300046674 Ga0495588_0098105 Ga0495588_0098105_99_1508 466
2184 3300046675 Ga0495657_0000828 Ga0495657_0000828_12776_14251 466
2185 3300046675 Ga0495657_0003492 Ga0495657_0003492_5878_7320 466
2186 3300046675 Ga0495657_0004137 Ga0495657_0004137_8299_9699 466
2187 3300046675 Ga0495657_0006927 Ga0495657_0006927_3877_5286 466
2188 3300046675 Ga0495657_0009432 Ga0495657_0009432_1658_3061 466
2189 3300046675 Ga0495657_0137070 Ga0495657_0137070_90_1490 466
2190 3300046678 Ga0495599_0000051 Ga0495599_0000051_12820_14295 466
2191 3300046678 Ga0495599_0001556 Ga0495599_0001556_4115_5524 466
2192 3300046678 Ga0495599_0001605 Ga0495599_0001605_10045_11445 466
2193 3300046678 Ga0495599_0008411 Ga0495599_0008411_689_2092 466
2194 3300046678 Ga0495599_0009208 Ga0495599_0009208_2130_3533 466
2195 3300046678 Ga0495599_0021267 Ga0495599_0021267_118_1518 466
2196 3300046678 Ga0495599_0025691 Ga0495599_0025691_2237_3643 466
2197 3300046679 Ga0495623_0001078 Ga0495623_0001078_4131_5606 466
2198 3300046679 Ga0495623_0002296 Ga0495623_0002296_6374_7816 466
2199 3300046679 Ga0495623_0004017 Ga0495623_0004017_819_2219 466
2200 3300046679 Ga0495623_0005074 Ga0495623_0005074_4612_6015 466
2201 3300046679 Ga0495623_0009107 Ga0495623_0009107_3637_5046 466
2202 3300046679 Ga0495623_0010478 Ga0495623_0010478_3935_5338 466
2203 3300046679 Ga0495623_0034442 Ga0495623_0034442_1467_2873 466
2204 3300046680 Ga0495646_0000102 Ga0495646_0000102_12839_14314 466
2205 3300046680 Ga0495646_0001918 Ga0495646_0001918_6242_7651 466
2206 3300046680 Ga0495646_0004146 Ga0495646_0004146_3667_5067 466
2207 3300046680 Ga0495646_0005453 Ga0495646_0005453_3118_4521 466
2208 3300046680 Ga0495646_0011250 Ga0495646_0011250_2693_4096 466
2209 3300046680 Ga0495646_0040366 Ga0495646_0040366_1167_2570 466
2210 3300046681 Ga0495647_0001979 Ga0495647_0001979_4871_6271 466
2211 3300046683 Ga0495658_0001058 Ga0495658_0001058_6578_7981 466
2212 3300046683 Ga0495658_0019298 Ga0495658_0019298_42_1445 466
2213 3300046683 Ga0495658_0046436 Ga0495658_0046436_662_2074 466
2214 3300046684 Ga0495669_0025636 Ga0495669_0025636_142_1542 466
2215 3300046689 Ga0495613_0000929 Ga0495613_0000929_14425_15828 466
2216 3300046689 Ga0495613_0003386 Ga0495613_0003386_5865_7265 466
2217 3300046689 Ga0495613_0018983 Ga0495613_0018983_2858_4267 466
2218 3300046689 Ga0495613_0030472 Ga0495613_0030472_2123_3532 466
2219 3300046689 Ga0495613_0032215 Ga0495613_0032215_624_2066 466
2220 3300046689 Ga0495613_0097810 Ga0495613_0097810_566_1972 466
2221 3300046690 Ga0495624_0000538 Ga0495624_0000538_475_1878 466
2222 3300046690 Ga0495624_0005667 Ga0495624_0005667_5523_6974 466
2223 3300046690 Ga0495624_0029990 Ga0495624_0029990_805_2205 466
2224 3300046690 Ga0495624_0056485 Ga0495624_0056485_643_2046 466
2225 3300046690 Ga0495624_0058970 Ga0495624_0058970_133_1536 466
2226 3300046691 Ga0495670_0002486 Ga0495670_0002486_6880_8331 466
2227 3300046691 Ga0495670_0013147 Ga0495670_0013147_2175_3587 466
2228 3300046694 Ga0495649_0012742 Ga0495649_0012742_469_1884 466
2229 3300046809 Ga0495600_0000069 Ga0495600_0000069_44289_45764 466
2230 3300046809 Ga0495600_0002229 Ga0495600_0002229_7330_8739 466
2231 3300046809 Ga0495600_0007632 Ga0495600_0007632_3451_4854 466
2232 3300046809 Ga0495600_0028766 Ga0495600_0028766_389_1798 466
2233 3300046809 Ga0495600_0046092 Ga0495600_0046092_420_1820 466
2234 3300046809 Ga0495600_0049335 Ga0495600_0049335_168_1568 466
2235 3300046809 Ga0495600_0054681 Ga0495600_0054681_678_2093 466
2236 3300046809 Ga0495600_0059314 Ga0495600_0059314_345_1748 466
2237 3300047315 Ga0495581_0001238 Ga0495581_0001238_11067_12470 466
2238 3300047315 Ga0495581_0013980 Ga0495581_0013980_1168_2577 466
2239 3300047315 Ga0495581_0016881 Ga0495581_0016881_2118_3521 466
2240 3300047315 Ga0495581_0033675 Ga0495581_0033675_304_1755 466
2241 3300047315 Ga0495581_0047949 Ga0495581_0047949_490_1890 466
2242 3300047317 Ga0495604_0000007 Ga0495604_0000007_365204_366679 466
2243 3300047317 Ga0495604_0000198 Ga0495604_0000198_32833_34236 466
2244 3300047317 Ga0495604_0003926 Ga0495604_0003926_2879_4279 466
2245 3300047317 Ga0495604_0005469 Ga0495604_0005469_3368_4810 466
2246 3300047317 Ga0495604_0007916 Ga0495604_0007916_621_2030 466
2247 3300047317 Ga0495604_0013426 Ga0495604_0013426_2237_3688 466
2248 3300047317 Ga0495604_0126654 Ga0495604_0126654_249_1652 466
2249 3300047319 Ga0495674_0000001 Ga0495674_0000001_27503_28978 466
2250 3300047319 Ga0495674_0001854 Ga0495674_0001854_11039_12442 466
2251 3300047319 Ga0495674_0004728 Ga0495674_0004728_2451_3860 466
2252 3300047319 Ga0495674_0018520 Ga0495674_0018520_492_1895 466
2253 3300047319 Ga0495674_0019302 Ga0495674_0019302_1792_3192 466
2254 3300047319 Ga0495674_0020768 Ga0495674_0020768_1317_2720 466
2255 3300047319 Ga0495674_0021792 Ga0495674_0021792_3161_4570 466
2256 3300047319 Ga0495674_0043222 Ga0495674_0043222_876_2276 466
2257 3300047319 Ga0495674_0060078 Ga0495674_0060078_874_2316 466
2258 3300047320 Ga0495672_0020040 Ga0495672_0020040_1560_2963 466
2259 3300047320 Ga0495672_0065823 Ga0495672_0065823_71_1474 466
2260 3300047321 Ga0495676_0027183 Ga0495676_0027183_2610_4013 466
2261 3300047321 Ga0495676_0034451 Ga0495676_0034451_2643_4046 466
2262 3300047321 Ga0495676_0123474 Ga0495676_0123474_421_1824 466
2263 3300047322 Ga0495680_0001692 Ga0495680_0001692_6488_7891 466
2264 3300047322 Ga0495680_0012862 Ga0495680_0012862_1065_2474 466
2265 3300047322 Ga0495680_0014111 Ga0495680_0014111_4918_6318 466
2266 3300047322 Ga0495680_0014519 Ga0495680_0014519_118_1569 466
2267 3300047322 Ga0495680_0021114 Ga0495680_0021114_590_1993 466
2268 3300047444 Ga0495675_0000216 Ga0495675_0000216_12776_14251 466
2269 3300047444 Ga0495675_0003321 Ga0495675_0003321_7649_9058 466
2270 3300047444 Ga0495675_0005926 Ga0495675_0005926_2191_3591 466
2271 3300047444 Ga0495675_0013295 Ga0495675_0013295_2240_3643 466
2272 3300047444 Ga0495675_0112366 Ga0495675_0112366_55_1464 466
2273 3300047470 Ga0495681_0010028 Ga0495681_0010028_2461_3876 466
2274 3300047471 Ga0495684_0000009 Ga0495684_0000009_45488_46963 466
2275 3300047471 Ga0495684_0000893 Ga0495684_0000893_6753_8162 466
2276 3300047471 Ga0495684_0008239 Ga0495684_0008239_1752_3161 466
2277 3300047471 Ga0495684_0012532 Ga0495684_0012532_143_1546 466
2278 3300047471 Ga0495684_0018847 Ga0495684_0018847_1807_3216 466
2279 3300047471 Ga0495684_0044818 Ga0495684_0044818_1198_2601 466
2280 3300047471 Ga0495684_0050814 Ga0495684_0050814_660_2063 466
2281 3300047472 Ga0495686_0002729 Ga0495686_0002729_7129_8544 466
2282 3300047472 Ga0495686_0021390 Ga0495686_0021390_174_1577 466
2283 3300047472 Ga0495686_0028426 Ga0495686_0028426_1783_3186 466
2284 3300047673 Ga0495593_0000034 Ga0495593_0000034_49522_50925 466
2285 3300047673 Ga0495593_0005065 Ga0495593_0005065_5322_6797 466
2286 3300047673 Ga0495593_0005088 Ga0495593_0005088_2068_3477 466
2287 3300047673 Ga0495593_0010592 Ga0495593_0010592_1383_2834 466
2288 3300047673 Ga0495593_0011441 Ga0495593_0011441_776_2185 466
2289 3300047673 Ga0495593_0030123 Ga0495593_0030123_303_1706 466
2290 3300047673 Ga0495593_0041683 Ga0495593_0041683_779_2179 466
2291 3300048088 Ga0495602_0000373 Ga0495602_0000373_12830_14305 466
2292 3300048088 Ga0495602_0002340 Ga0495602_0002340_16793_18196 466
2293 3300048088 Ga0495602_0010712 Ga0495602_0010712_6236_7636 466
2294 3300048088 Ga0495602_0029454 Ga0495602_0029454_1648_3048 466
2295 3300048088 Ga0495602_0030283 Ga0495602_0030283_205_1614 466
2296 3300048089 Ga0495614_0012962 Ga0495614_0012962_1197_2648 466
2297 3300048903 Ga0496100_0000171 Ga0496100_0000171_29403_30803 466
2298 3300048903 Ga0496100_0005513 Ga0496100_0005513_3413_4813 466
2299 3300048903 Ga0496100_0005621 Ga0496100_0005621_4355_5767 466
2300 3300048903 Ga0496100_0041911 Ga0496100_0041911_1088_2509 466
2301 3300048904 Ga0496101_0000246 Ga0496101_0000246_15235_16635 466
2302 3300048904 Ga0496101_0002583 Ga0496101_0002583_6060_7472 466
2303 3300048904 Ga0496101_0005889 Ga0496101_0005889_2947_4350 466
2304 3300048904 Ga0496101_0077962 Ga0496101_0077962_74_1576 466
2305 3300048905 Ga0496102_0003080 Ga0496102_0003080_9908_11308 466
2306 3300048905 Ga0496102_0015817 Ga0496102_0015817_643_2055 466
2307 3300048905 Ga0496102_0030603 Ga0496102_0030603_2853_4265 466
2308 3300048905 Ga0496102_0047397 Ga0496102_0047397_1098_2510 466
2309 3300048905 Ga0496102_0079901 Ga0496102_0079901_1306_2709 466
2310 3300048905 Ga0496102_0104172 Ga0496102_0104172_1069_2469 466
2311 3300048905 Ga0496102_0190699 Ga0496102_0190699_220_1620 466
2312 3300048906 Ga0496103_0000753 Ga0496103_0000753_22155_23555 466
2313 3300048906 Ga0496103_0001814 Ga0496103_0001814_6070_7482 466
2314 3300048906 Ga0496103_0019062 Ga0496103_0019062_2468_3868 466
2315 3300048907 Ga0496104_0000102 Ga0496104_0000102_26775_28184 466
2316 3300048907 Ga0496104_0000159 Ga0496104_0000159_1183_2583 466
2317 3300048907 Ga0496104_0000774 Ga0496104_0000774_22965_24377 466
2318 3300048907 Ga0496104_0001290 Ga0496104_0001290_12937_14346 466
2319 3300048907 Ga0496104_0003304 Ga0496104_0003304_2383_3795 466
2320 3300048907 Ga0496104_0004126 Ga0496104_0004126_1415_2824 466
2321 3300048907 Ga0496104_0004366 Ga0496104_0004366_8176_9588 466
2322 3300048907 Ga0496104_0015916 Ga0496104_0015916_237_1742 466
2323 3300048907 Ga0496104_0040399 Ga0496104_0040399_2248_3654 466
2324 3300048907 Ga0496104_0130937 Ga0496104_0130937_563_1966 466
2325 3300048907 Ga0496104_0208411 Ga0496104_0208411_81_1481 466
2326 3300048908 Ga0496105_0000066 Ga0496105_0000066_28513_29922 466
2327 3300048908 Ga0496105_0000410 Ga0496105_0000410_15500_16900 466
2328 3300048908 Ga0496105_0000660 Ga0496105_0000660_9216_10625 466
2329 3300048908 Ga0496105_0002875 Ga0496105_0002875_1415_2824 466
2330 3300048908 Ga0496105_0003208 Ga0496105_0003208_3740_5152 466
2331 3300048908 Ga0496105_0015677 Ga0496105_0015677_1558_2970 466
2332 3300048908 Ga0496105_0017518 Ga0496105_0017518_138_1580 466
2333 3300048908 Ga0496105_0021219 Ga0496105_0021219_2377_3789 466
2334 3300048908 Ga0496105_0029545 Ga0496105_0029545_136_1557 466
2335 3300048908 Ga0496105_0048636 Ga0496105_0048636_1479_2879 466
2336 3300048908 Ga0496105_0102015 Ga0496105_0102015_400_1812 466
2337 3300048909 Ga0496106_0000183 Ga0496106_0000183_24631_26031 466
2338 3300048909 Ga0496106_0000649 Ga0496106_0000649_16726_18135 466
2339 3300048909 Ga0496106_0000982 Ga0496106_0000982_8220_9635 466
2340 3300048909 Ga0496106_0001165 Ga0496106_0001165_13763_15265 466
2341 3300048909 Ga0496106_0003721 Ga0496106_0003721_6216_7628 466
2342 3300048909 Ga0496106_0013694 Ga0496106_0013694_4283_5695 466
2343 3300048909 Ga0496106_0015146 Ga0496106_0015146_3979_5400 466
2344 3300048909 Ga0496106_0046114 Ga0496106_0046114_866_2275 466
2345 3300048909 Ga0496106_0076130 Ga0496106_0076130_1112_2512 466
2346 3300048910 Ga0496107_0001430 Ga0496107_0001430_453_1853 466
2347 3300048910 Ga0496107_0008995 Ga0496107_0008995_559_1959 466
2348 3300048910 Ga0496107_0009499 Ga0496107_0009499_4762_6174 466
2349 3300048910 Ga0496107_0012532 Ga0496107_0012532_1390_2802 466
2350 3300048910 Ga0496107_0015904 Ga0496107_0015904_3825_5225 466
2351 3300048910 Ga0496107_0021046 Ga0496107_0021046_2606_4018 466
2352 3300048910 Ga0496107_0042322 Ga0496107_0042322_1280_2680 466
2353 3300048910 Ga0496107_0066510 Ga0496107_0066510_43_1446 466
2354 3300048910 Ga0496107_0090146 Ga0496107_0090146_293_1693 466
2355 3300048911 Ga0496108_0000436 Ga0496108_0000436_30762_32174 466
2356 3300048911 Ga0496108_0000931 Ga0496108_0000931_16127_17536 466
2357 3300048911 Ga0496108_0001856 Ga0496108_0001856_11519_12919 466
2358 3300048911 Ga0496108_0008443 Ga0496108_0008443_2718_4130 466
2359 3300048911 Ga0496108_0041092 Ga0496108_0041092_1698_3119 466
2360 3300048911 Ga0496108_0065905 Ga0496108_0065905_1591_2994 466
2361 3300048911 Ga0496108_0073828 Ga0496108_0073828_945_2345 466
2362 3300048911 Ga0496108_0137709 Ga0496108_0137709_300_1700 466
2363 3300048912 Ga0496109_0001350 Ga0496109_0001350_17341_18741 466
2364 3300048912 Ga0496109_0001766 Ga0496109_0001766_7476_8978 466
2365 3300048912 Ga0496109_0003286 Ga0496109_0003286_6694_8106 466
2366 3300048912 Ga0496109_0004165 Ga0496109_0004165_1135_2535 466
2367 3300048912 Ga0496109_0006221 Ga0496109_0006221_2587_3996 466
2368 3300048912 Ga0496109_0015570 Ga0496109_0015570_4367_5788 466
2369 3300048912 Ga0496109_0037548 Ga0496109_0037548_674_2086 466
2370 3300048912 Ga0496109_0044561 Ga0496109_0044561_1988_3391 466
2371 3300048912 Ga0496109_0050558 Ga0496109_0050558_438_1838 466
2372 3300048912 Ga0496109_0118867 Ga0496109_0118867_675_2075 466
2373 3300048912 Ga0496109_0129340 Ga0496109_0129340_337_1758 466
2374 3300048913 Ga0496110_0001937 Ga0496110_0001937_859_2280 466
2375 3300048913 Ga0496110_0003940 Ga0496110_0003940_3799_5208 466
2376 3300048913 Ga0496110_0004370 Ga0496110_0004370_8099_9511 466
2377 3300048913 Ga0496110_0006833 Ga0496110_0006833_5306_6808 466
2378 3300048913 Ga0496110_0020911 Ga0496110_0020911_1112_2512 466
2379 3300048913 Ga0496110_0051830 Ga0496110_0051830_1802_3205 466
2380 3300048913 Ga0496110_0056020 Ga0496110_0056020_73_1476 466
2381 3300048913 Ga0496110_0065660 Ga0496110_0065660_1479_2894 466
2382 3300048913 Ga0496110_0066495 Ga0496110_0066495_578_1978 466
2383 3300048913 Ga0496110_0107304 Ga0496110_0107304_973_2385 466
2384 3300048913 Ga0496110_0135255 Ga0496110_0135255_31_1431 466
2385 3300048914 Ga0496111_0001107 Ga0496111_0001107_13344_14753 466
2386 3300048914 Ga0496111_0001128 Ga0496111_0001128_6210_7622 466
2387 3300048914 Ga0496111_0001815 Ga0496111_0001815_7998_9398 466
2388 3300048914 Ga0496111_0021291 Ga0496111_0021291_209_1621 466
2389 3300048914 Ga0496111_0031351 Ga0496111_0031351_1403_2803 466
2390 3300048915 Ga0496112_0000008 Ga0496112_0000008_8641_10128 466
2391 3300048915 Ga0496112_0000735 Ga0496112_0000735_19966_21378 466
2392 3300048915 Ga0496112_0002588 Ga0496112_0002588_7342_8754 466
2393 3300048915 Ga0496112_0002673 Ga0496112_0002673_5912_7321 466
2394 3300048915 Ga0496112_0003217 Ga0496112_0003217_407_1828 466
2395 3300048915 Ga0496112_0015968 Ga0496112_0015968_5409_6812 466
2396 3300048915 Ga0496112_0016298 Ga0496112_0016298_3029_4429 466
2397 3300048915 Ga0496112_0035334 Ga0496112_0035334_60_1463 466
2398 3300048915 Ga0496112_0050851 Ga0496112_0050851_758_2161 466
2399 3300048915 Ga0496112_0057762 Ga0496112_0057762_2400_3806 466
2400 3300048915 Ga0496112_0074587 Ga0496112_0074587_1068_2471 466
2401 3300048915 Ga0496112_0124520 Ga0496112_0124520_223_1626 466
2402 3300048916 Ga0496113_0001031 Ga0496113_0001031_10893_12305 466
2403 3300048916 Ga0496113_0001697 Ga0496113_0001697_706_2118 466
2404 3300048916 Ga0496113_0005725 Ga0496113_0005725_2745_4145 466
2405 3300048916 Ga0496113_0013405 Ga0496113_0013405_424_1827 466
2406 3300048916 Ga0496113_0020676 Ga0496113_0020676_1519_2940 466
2407 3300048916 Ga0496113_0032840 Ga0496113_0032840_1594_2994 466
2408 3300048916 Ga0496113_0167540 Ga0496113_0167540_221_1621 466
2409 3300048917 Ga0496114_0002224 Ga0496114_0002224_687_2087 466
2410 3300048917 Ga0496114_0028100 Ga0496114_0028100_2998_4401 466
2411 3300048917 Ga0496114_0034325 Ga0496114_0034325_1430_2842 466
2412 3300048917 Ga0496114_0228259 Ga0496114_0228259_178_1590 466
2413 3300048918 Ga0496115_0003582 Ga0496115_0003582_6814_8226 466
2414 3300048918 Ga0496115_0005349 Ga0496115_0005349_3699_5111 466
2415 3300048918 Ga0496115_0007272 Ga0496115_0007272_5268_6671 466
2416 3300048918 Ga0496115_0008771 Ga0496115_0008771_1924_3324 466
2417 3300048918 Ga0496115_0015832 Ga0496115_0015832_1125_2528 466
2418 3300048918 Ga0496115_0107107 Ga0496115_0107107_591_2012 466
2419 3300048918 Ga0496115_0117589 Ga0496115_0117589_103_1506 466
2420 3300048918 Ga0496115_0120660 Ga0496115_0120660_295_1707 466
2421 3300048918 Ga0496115_0131610 Ga0496115_0131610_282_1694 466
2422 3300048918 Ga0496115_0155460 Ga0496115_0155460_111_1511 466
2423 3300048919 Ga0496116_0000142 Ga0496116_0000142_102479_103894 466
2424 3300048919 Ga0496116_0003364 Ga0496116_0003364_14379_15782 466
2425 3300048919 Ga0496116_0051303 Ga0496116_0051303_926_2341 466
2426 3300048920 Ga0496117_0000002 Ga0496117_0000002_479779_481194 466
2427 3300048920 Ga0496117_0001574 Ga0496117_0001574_7450_8865 466
2428 3300048920 Ga0496117_0019627 Ga0496117_0019627_3967_5382 466
2429 3300048920 Ga0496117_0020764 Ga0496117_0020764_1788_3203 466
2430 3300048920 Ga0496117_0035578 Ga0496117_0035578_39_1448 466
2431 3300048920 Ga0496117_0089219 Ga0496117_0089219_57_1463 466
2432 3300048920 Ga0496117_0098184 Ga0496117_0098184_428_1831 466
2433 3300048921 Ga0496118_0000087 Ga0496118_0000087_91338_92753 466
2434 3300048921 Ga0496118_0008894 Ga0496118_0008894_7269_8684 466
2435 3300048921 Ga0496118_0043982 Ga0496118_0043982_1186_2589 466
2436 3300048921 Ga0496118_0046917 Ga0496118_0046917_1932_3335 466
2437 3300048921 Ga0496118_0050959 Ga0496118_0050959_822_2225 466
2438 3300048921 Ga0496118_0061482 Ga0496118_0061482_363_1766 466
2439 3300048921 Ga0496118_0132718 Ga0496118_0132718_16_1425 466
2440 3300048922 Ga0496119_0001143 Ga0496119_0001143_27181_28590 466
2441 3300048922 Ga0496119_0029282 Ga0496119_0029282_57_1472 466
2442 3300048922 Ga0496119_0034940 Ga0496119_0034940_755_2197 466
2443 3300048923 Ga0496120_0000413 Ga0496120_0000413_4767_6182 466
2444 3300048924 Ga0496121_0000476 Ga0496121_0000476_66075_67484 466
2445 3300048924 Ga0496121_0001497 Ga0496121_0001497_29644_31050 466
2446 3300048924 Ga0496121_0001742 Ga0496121_0001742_15771_17174 466
2447 3300048924 Ga0496121_0003089 Ga0496121_0003089_17053_18456 466
2448 3300048924 Ga0496121_0015642 Ga0496121_0015642_3369_4874 466
2449 3300048924 Ga0496121_0017380 Ga0496121_0017380_4460_5863 466
2450 3300048924 Ga0496121_0021924 Ga0496121_0021924_4658_6061 466
2451 3300048924 Ga0496121_0037277 Ga0496121_0037277_352_1755 466
2452 3300048924 Ga0496121_0038697 Ga0496121_0038697_149_1552 466
2453 3300048924 Ga0496121_0049287 Ga0496121_0049287_1858_3261 466
2454 3300048924 Ga0496121_0051164 Ga0496121_0051164_1859_3262 466
2455 3300048924 Ga0496121_0134696 Ga0496121_0134696_21_1436 466
2456 3300048925 Ga0496122_0000004 Ga0496122_0000004_108664_110079 466
2457 3300048925 Ga0496122_0000190 Ga0496122_0000190_123227_124642 466
2458 3300048925 Ga0496122_0029884 Ga0496122_0029884_1580_2983 466
2459 3300048925 Ga0496122_0056469 Ga0496122_0056469_1147_2550 466
2460 3300048926 Ga0496123_0000007 Ga0496123_0000007_108664_110079 466
2461 3300048926 Ga0496123_0000336 Ga0496123_0000336_7223_8638 466
2462 3300048926 Ga0496123_0024244 Ga0496123_0024244_1847_3262 466
2463 3300048926 Ga0496123_0027440 Ga0496123_0027440_982_2388 466
2464 3300048926 Ga0496123_0031265 Ga0496123_0031265_2420_3823 466
2465 3300048926 Ga0496123_0032300 Ga0496123_0032300_517_1920 466
2466 3300048926 Ga0496123_0042101 Ga0496123_0042101_515_1921 466
2467 3300048926 Ga0496123_0065130 Ga0496123_0065130_360_1775 466
2468 3300048926 Ga0496123_0069502 Ga0496123_0069502_698_2104 466
2469 3300048927 Ga0496124_0001128 Ga0496124_0001128_35181_36590 466
2470 3300048927 Ga0496124_0009838 Ga0496124_0009838_6387_7802 466
2471 3300048927 Ga0496124_0011540 Ga0496124_0011540_7230_8645 466
2472 3300048927 Ga0496124_0075324 Ga0496124_0075324_498_1901 466
2473 3300048928 Ga0496125_0000154 Ga0496125_0000154_42112_43515 466
2474 3300048928 Ga0496125_0000248 Ga0496125_0000248_102049_103464 466
2475 3300048928 Ga0496125_0000823 Ga0496125_0000823_9244_10650 466
2476 3300048928 Ga0496125_0015007 Ga0496125_0015007_465_1874 466
2477 3300048928 Ga0496125_0019665 Ga0496125_0019665_2268_3683 466
2478 3300048928 Ga0496125_0105364 Ga0496125_0105364_155_1558 466
2479 3300048928 Ga0496125_0143173 Ga0496125_0143173_48_1451 466
2480 3300048929 Ga0496126_0000866 Ga0496126_0000866_7256_8671 466
2481 3300048929 Ga0496126_0001294 Ga0496126_0001294_6820_8235 466
2482 3300048929 Ga0496126_0002744 Ga0496126_0002744_18635_20038 466
2483 3300048929 Ga0496126_0006113 Ga0496126_0006113_2573_3976 466
2484 3300048929 Ga0496126_0007435 Ga0496126_0007435_9521_10930 466
2485 3300048929 Ga0496126_0009402 Ga0496126_0009402_3424_4827 466
2486 3300048929 Ga0496126_0014931 Ga0496126_0014931_6404_7819 466
2487 3300048929 Ga0496126_0015910 Ga0496126_0015910_4296_5702 466
2488 3300048929 Ga0496126_0020832 Ga0496126_0020832_1945_3348 466
2489 3300048929 Ga0496126_0032430 Ga0496126_0032430_1858_3261 466
2490 3300048929 Ga0496126_0039244 Ga0496126_0039244_2568_3971 466
2491 3300048929 Ga0496126_0049254 Ga0496126_0049254_1641_3050 466
2492 3300048929 Ga0496126_0053931 Ga0496126_0053931_96_1499 466
2493 3300048929 Ga0496126_0057046 Ga0496126_0057046_1416_2819 466
2494 3300049568 Ga0501031_0009852 Ga0501031_0009852_1355_2758 466
2495 3300049568 Ga0501031_0028410 Ga0501031_0028410_563_1978 466
2496 3300049569 Ga0501032_0003534 Ga0501032_0003534_4980_6383 466
2497 3300049569 Ga0501032_0008293 Ga0501032_0008293_4181_5584 466
2498 3300049569 Ga0501032_0033503 Ga0501032_0033503_1909_3324 466
2499 3300049569 Ga0501032_0085772 Ga0501032_0085772_352_1755 466
2500 3300049569 Ga0501032_0105845 Ga0501032_0105845_224_1627 466
2501 3300049570 Ga0501033_0000249 Ga0501033_0000249_26708_28111 466
2502 3300049570 Ga0501033_0000951 Ga0501033_0000951_20835_22238 466
2503 3300049570 Ga0501033_0001862 Ga0501033_0001862_6514_7920 466
2504 3300049570 Ga0501033_0036294 Ga0501033_0036294_1191_2606 466
2505 3300049570 Ga0501033_0036543 Ga0501033_0036543_11_1417 466
2506 3300049570 Ga0501033_0057802 Ga0501033_0057802_84_1487 466
2507 3300049570 Ga0501033_0078757 Ga0501033_0078757_666_2081 466
2508 3300049571 Ga0501034_0000197 Ga0501034_0000197_53193_54596 466
2509 3300049571 Ga0501034_0001938 Ga0501034_0001938_6659_8062 466
2510 3300049571 Ga0501034_0003303 Ga0501034_0003303_13110_14513 466
2511 3300049571 Ga0501034_0003931 Ga0501034_0003931_12091_13494 466
2512 3300049571 Ga0501034_0018261 Ga0501034_0018261_4577_5992 466
2513 3300049571 Ga0501034_0029910 Ga0501034_0029910_2209_3612 466
2514 3300049571 Ga0501034_0060787 Ga0501034_0060787_1541_2944 466
2515 3300049571 Ga0501034_0063839 Ga0501034_0063839_2117_3523 466
2516 3300049571 Ga0501034_0063869 Ga0501034_0063869_745_2160 466
2517 3300049571 Ga0501034_0103631 Ga0501034_0103631_42_1445 466
2518 3300049571 Ga0501034_0240727 Ga0501034_0240727_42_1445 466
2519 3300049571 Ga0501034_0255686 Ga0501034_0255686_126_1529 466
2520 3300049572 Ga0501036_0001894 Ga0501036_0001894_4941_6344 466
2521 3300049572 Ga0501036_0004433 Ga0501036_0004433_6575_7978 466
2522 3300049572 Ga0501036_0014718 Ga0501036_0014718_3223_4638 466
2523 3300049572 Ga0501036_0020317 Ga0501036_0020317_2799_4202 466
2524 3300049572 Ga0501036_0026547 Ga0501036_0026547_1276_2679 466
2525 3300049572 Ga0501036_0121562 Ga0501036_0121562_381_1784 466
2526 3300049572 Ga0501036_0128420 Ga0501036_0128420_710_2113 466
2527 3300049572 Ga0501036_0132946 Ga0501036_0132946_562_1974 466
2528 3300049573 Ga0501037_0000112 Ga0501037_0000112_28171_29574 466
2529 3300049573 Ga0501037_0004019 Ga0501037_0004019_8965_10368 466
2530 3300049573 Ga0501037_0023027 Ga0501037_0023027_1899_3302 466
2531 3300049573 Ga0501037_0023753 Ga0501037_0023753_150_1550 466
2532 3300049573 Ga0501037_0025895 Ga0501037_0025895_84_1487 466
2533 3300049573 Ga0501037_0027054 Ga0501037_0027054_1740_3143 466
2534 3300049573 Ga0501037_0040501 Ga0501037_0040501_926_2341 466
2535 3300049574 Ga0501038_0000160 Ga0501038_0000160_44175_45578 466
2536 3300049574 Ga0501038_0002206 Ga0501038_0002206_3126_4529 466
2537 3300049574 Ga0501038_0004382 Ga0501038_0004382_8495_9910 466
2538 3300049574 Ga0501038_0019027 Ga0501038_0019027_4486_5889 466
2539 3300049574 Ga0501038_0072151 Ga0501038_0072151_621_2024 466
2540 3300049574 Ga0501038_0113818 Ga0501038_0113818_215_1618 466
2541 3300049574 Ga0501038_0144733 Ga0501038_0144733_399_1802 466
2542 3300049574 Ga0501038_0171569 Ga0501038_0171569_311_1714 466
2543 3300049574 Ga0501038_0192297 Ga0501038_0192297_197_1600 466
2544 3300049575 Ga0501039_0003318 Ga0501039_0003318_2749_4164 466
2545 3300049575 Ga0501039_0068601 Ga0501039_0068601_407_1822 466
2546 3300049575 Ga0501039_0068838 Ga0501039_0068838_1097_2551 466
2547 3300049575 Ga0501039_0109920 Ga0501039_0109920_305_1711 466
2548 3300049576 Ga0501040_0054530 Ga0501040_0054530_1126_2529 466
2549 3300049578 Ga0501042_0015592 Ga0501042_0015592_881_2284 466
2550 3300049579 Ga0501043_0000278 Ga0501043_0000278_27332_28735 466
2551 3300049579 Ga0501043_0003514 Ga0501043_0003514_9607_11010 466
2552 3300049579 Ga0501043_0007295 Ga0501043_0007295_2353_3768 466
2553 3300049579 Ga0501043_0008635 Ga0501043_0008635_2379_3782 466
2554 3300049579 Ga0501043_0009609 Ga0501043_0009609_4223_5638 466
2555 3300049579 Ga0501043_0022578 Ga0501043_0022578_1600_3006 466
2556 3300049579 Ga0501043_0022870 Ga0501043_0022870_984_2387 466
2557 3300049579 Ga0501043_0036587 Ga0501043_0036587_1715_3118 466
2558 3300049579 Ga0501043_0059303 Ga0501043_0059303_1017_2420 466
2559 3300049580 Ga0501046_0000937 Ga0501046_0000937_2840_4243 466
2560 3300049580 Ga0501046_0008812 Ga0501046_0008812_4401_5807 466
2561 3300049580 Ga0501046_0012556 Ga0501046_0012556_5044_6447 466
2562 3300049580 Ga0501046_0050515 Ga0501046_0050515_492_1895 466
2563 3300049580 Ga0501046_0054701 Ga0501046_0054701_818_2233 466
2564 3300049581 Ga0501047_0000275 Ga0501047_0000275_37942_39345 466
2565 3300049581 Ga0501047_0000688 Ga0501047_0000688_27724_29127 466
2566 3300049581 Ga0501047_0003823 Ga0501047_0003823_8904_10307 466
2567 3300049581 Ga0501047_0009938 Ga0501047_0009938_4398_5804 466
2568 3300049581 Ga0501047_0018665 Ga0501047_0018665_685_2088 466
2569 3300049581 Ga0501047_0038155 Ga0501047_0038155_1198_2601 466
2570 3300049581 Ga0501047_0040535 Ga0501047_0040535_1718_3121 466
2571 3300049581 Ga0501047_0050183 Ga0501047_0050183_1651_3054 466
2572 3300049581 Ga0501047_0089000 Ga0501047_0089000_1527_2930 466
2573 3300049581 Ga0501047_0115148 Ga0501047_0115148_501_1958 466
2574 3300049581 Ga0501047_0139295 Ga0501047_0139295_380_1780 466
2575 3300049581 Ga0501047_0181313 Ga0501047_0181313_406_1809 466
2576 3300049581 Ga0501047_0196182 Ga0501047_0196182_94_1497 466
2577 3300049582 Ga0501048_0001248 Ga0501048_0001248_5439_6842 466
2578 3300049582 Ga0501048_0002575 Ga0501048_0002575_9396_10799 466
2579 3300049582 Ga0501048_0011414 Ga0501048_0011414_1184_2587 466
2580 3300049582 Ga0501048_0022723 Ga0501048_0022723_745_2148 466
2581 3300049582 Ga0501048_0047682 Ga0501048_0047682_1446_2861 466
2582 3300049582 Ga0501048_0123764 Ga0501048_0123764_318_1721 466
2583 3300049583 Ga0501067_0000258 Ga0501067_0000258_12158_13561 466
2584 3300049583 Ga0501067_0007852 Ga0501067_0007852_3119_4534 466
2585 3300049583 Ga0501067_0037309 Ga0501067_0037309_721_2124 466
2586 3300049583 Ga0501067_0110334 Ga0501067_0110334_60_1463 466
2587 3300049584 Ga0501068_0004146 Ga0501068_0004146_3062_4465 466
2588 3300049584 Ga0501068_0013165 Ga0501068_0013165_816_2231 466
2589 3300049584 Ga0501068_0014609 Ga0501068_0014609_450_1853 466
2590 3300049584 Ga0501068_0026245 Ga0501068_0026245_20_1423 466
2591 3300049585 Ga0501069_0014567 Ga0501069_0014567_519_1934 466
2592 3300049585 Ga0501069_0071080 Ga0501069_0071080_217_1620 466
2593 3300049586 Ga0501070_0002548 Ga0501070_0002548_5410_6813 466
2594 3300049586 Ga0501070_0006200 Ga0501070_0006200_1833_3236 466
2595 3300049586 Ga0501070_0013214 Ga0501070_0013214_3706_5109 466
2596 3300049586 Ga0501070_0020554 Ga0501070_0020554_3709_5112 466
2597 3300049586 Ga0501070_0022267 Ga0501070_0022267_926_2341 466
2598 3300049586 Ga0501070_0024977 Ga0501070_0024977_2631_4034 466
2599 3300049586 Ga0501070_0025040 Ga0501070_0025040_2341_3744 466
2600 3300049586 Ga0501070_0156925 Ga0501070_0156925_463_1866 466
2601 3300049586 Ga0501070_0216337 Ga0501070_0216337_122_1525 466
2602 3300049587 Ga0501071_0011386 Ga0501071_0011386_1778_3193 466
2603 3300049587 Ga0501071_0059871 Ga0501071_0059871_160_1563 466
2604 3300049588 Ga0501072_0066240 Ga0501072_0066240_681_2084 466
2605 3300049588 Ga0501072_0067082 Ga0501072_0067082_682_2088 466
2606 3300049589 Ga0501073_0000103 Ga0501073_0000103_18356_19759 466
2607 3300049589 Ga0501073_0057275 Ga0501073_0057275_502_1905 466
2608 3300049589 Ga0501073_0059061 Ga0501073_0059061_906_2321 466
2609 3300049589 Ga0501073_0147488 Ga0501073_0147488_180_1583 466
2610 3300049589 Ga0501073_0151360 Ga0501073_0151360_78_1493 466
2611 3300049590 Ga0501074_0000456 Ga0501074_0000456_21122_22525 466
2612 3300049590 Ga0501074_0001612 Ga0501074_0001612_505_1908 466
2613 3300049590 Ga0501074_0005242 Ga0501074_0005242_7004_8419 466
2614 3300049590 Ga0501074_0025367 Ga0501074_0025367_2775_4178 466
2615 3300049590 Ga0501074_0029373 Ga0501074_0029373_1656_3059 466
2616 3300049590 Ga0501074_0047059 Ga0501074_0047059_1153_2556 466
2617 3300049592 Ga0501076_0002639 Ga0501076_0002639_7596_9008 466
2618 3300049592 Ga0501076_0089958 Ga0501076_0089958_639_2054 466
2619 3300049592 Ga0501076_0121843 Ga0501076_0121843_663_2063 466
2620 3300049593 Ga0501077_0003492 Ga0501077_0003492_7828_9240 466
2621 3300049741 Ga0501079_0000451 Ga0501079_0000451_12849_14252 466
2622 3300049741 Ga0501079_0010445 Ga0501079_0010445_1021_2532 466
2623 3300049741 Ga0501079_0038416 Ga0501079_0038416_1980_3383 466
2624 3300049741 Ga0501079_0042211 Ga0501079_0042211_1415_2821 466
2625 3300049741 Ga0501079_0125027 Ga0501079_0125027_210_1613 466
2626 3300049741 Ga0501079_0147849 Ga0501079_0147849_376_1788 466
2627 3300049742 Ga0501080_0000082 Ga0501080_0000082_4921_6324 466
2628 3300049742 Ga0501080_0000153 Ga0501080_0000153_42754_44157 466
2629 3300049742 Ga0501080_0002998 Ga0501080_0002998_9106_10509 466
2630 3300049742 Ga0501080_0011942 Ga0501080_0011942_1958_3373 466
2631 3300049742 Ga0501080_0016338 Ga0501080_0016338_4569_5972 466
2632 3300049742 Ga0501080_0019550 Ga0501080_0019550_429_1844 466
2633 3300049742 Ga0501080_0034657 Ga0501080_0034657_2865_4268 466
2634 3300049742 Ga0501080_0042442 Ga0501080_0042442_2790_4193 466
2635 3300049742 Ga0501080_0061381 Ga0501080_0061381_1841_3241 466
2636 3300049742 Ga0501080_0064923 Ga0501080_0064923_1042_2445 466
2637 3300049742 Ga0501080_0112736 Ga0501080_0112736_624_2036 466
2638 3300049743 Ga0501081_0000145 Ga0501081_0000145_12609_14021 466
2639 3300049744 Ga0501083_0003065 Ga0501083_0003065_5950_7353 466
2640 3300049744 Ga0501083_0009193 Ga0501083_0009193_5410_6813 466
2641 3300049744 Ga0501083_0013677 Ga0501083_0013677_2676_4082 466
2642 3300049744 Ga0501083_0024526 Ga0501083_0024526_28_1434 466
2643 3300049744 Ga0501083_0037937 Ga0501083_0037937_1272_2687 466
2644 3300049822 Ga0501035_0000584 Ga0501035_0000584_1118_2524 466
2645 3300049822 Ga0501035_0000766 Ga0501035_0000766_18356_19759 466
2646 3300049822 Ga0501035_0001708 Ga0501035_0001708_20312_21712 466
2647 3300049822 Ga0501035_0018251 Ga0501035_0018251_4158_5561 466
2648 3300049822 Ga0501035_0026906 Ga0501035_0026906_1175_2590 466
2649 3300049822 Ga0501035_0046712 Ga0501035_0046712_1871_3274 466
2650 3300049822 Ga0501035_0049300 Ga0501035_0049300_429_1841 466
2651 3300049822 Ga0501035_0054488 Ga0501035_0054488_1044_2447 466
2652 3300049822 Ga0501035_0112140 Ga0501035_0112140_84_1487 466
2653 3300049822 Ga0501035_0255715 Ga0501035_0255715_50_1453 466
2654 3300049823 Ga0501044_0000286 Ga0501044_0000286_16757_18172 466
2655 3300049823 Ga0501044_0000418 Ga0501044_0000418_44488_45891 466
2656 3300049823 Ga0501044_0007955 Ga0501044_0007955_5915_7318 466
2657 3300049823 Ga0501044_0013097 Ga0501044_0013097_5119_6522 466
2658 3300049823 Ga0501044_0024381 Ga0501044_0024381_1556_2959 466
2659 3300049823 Ga0501044_0028251 Ga0501044_0028251_518_1924 466
2660 3300049823 Ga0501044_0028517 Ga0501044_0028517_889_2292 466
2661 3300049823 Ga0501044_0034063 Ga0501044_0034063_1732_3135 466
2662 3300049823 Ga0501044_0051865 Ga0501044_0051865_146_1561 466
2663 3300049823 Ga0501044_0067195 Ga0501044_0067195_1252_2709 466
2664 3300049823 Ga0501044_0101689 Ga0501044_0101689_108_1511 466
2665 3300049823 Ga0501044_0102882 Ga0501044_0102882_1440_2843 466
2666 3300049823 Ga0501044_0121107 Ga0501044_0121107_334_1734 466
2667 3300049823 Ga0501044_0176428 Ga0501044_0176428_393_1796 466
2668 3300049823 Ga0501044_0188063 Ga0501044_0188063_444_1847 466
2669 3300049824 Ga0501045_0054354 Ga0501045_0054354_564_1967 466
2670 3300049824 Ga0501045_0056551 Ga0501045_0056551_1320_2735 466
2671 3300050489 nmdc:mga03683_2117_c1 nmdc:mga03683_2117_c1_3679_5094 466
2672 3300050490 nmdc:mga03n38_1307_c3 nmdc:mga03n38_1307_c3_231_1637 466
2673 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_27630_29045 466
2674 3300050491 nmdc:mga00v17_62963_c1 nmdc:mga00v17_62963_c1_848_2251 466
2675 3300050491 nmdc:mga00v17_639_c1 nmdc:mga00v17_639_c1_7320_8735 466
2676 3300050492 nmdc:mga0yw44_1397_c1 nmdc:mga0yw44_1397_c1_5082_6485 466
2677 3300050492 nmdc:mga0yw44_16757_c1 nmdc:mga0yw44_16757_c1_1371_2774 466
2678 3300050492 nmdc:mga0yw44_291_c1 nmdc:mga0yw44_291_c1_14510_15925 466
2679 3300050492 nmdc:mga0yw44_5474_c1 nmdc:mga0yw44_5474_c1_2454_3866 466
2680 3300050492 nmdc:mga0yw44_64749_c1 nmdc:mga0yw44_64749_c1_406_1809 466
2681 3300050493 nmdc:mga0k408_19986_c1 nmdc:mga0k408_19986_c1_110_1513 466
2682 3300050493 nmdc:mga0k408_43409_c1 nmdc:mga0k408_43409_c1_117_1532 466
2683 3300050493 nmdc:mga0k408_54844_c1 nmdc:mga0k408_54844_c1_199_1608 466
2684 3300050494 nmdc:mga06z11_59933_c1 nmdc:mga06z11_59933_c1_56_1459 466
2685 3300050495 nmdc:mga04h51_21673_c1 nmdc:mga04h51_21673_c1_16_1419 466
2686 3300050496 nmdc:mga07m45_33942_c1 nmdc:mga07m45_33942_c1_654_2057 466
2687 3300050507 nmdc:mga05p37_140758_c1 nmdc:mga05p37_140758_c1_896_2308 466
2688 3300050507 nmdc:mga05p37_16389_c1 nmdc:mga05p37_16389_c1_4456_5868 466
2689 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_39152_40552 466
2690 3300050507 nmdc:mga05p37_62404_c1 nmdc:mga05p37_62404_c1_590_1993 466
2691 3300050507 nmdc:mga05p37_66173_c1 nmdc:mga05p37_66173_c1_2775_4187 466
2692 3300050507 nmdc:mga05p37_71679_c1 nmdc:mga05p37_71679_c1_375_1787 466
2693 3300050508 nmdc:mga09592_813_c1 nmdc:mga09592_813_c1_11887_13287 466
2694 3300050509 nmdc:mga0qj67_101_c1 nmdc:mga0qj67_101_c1_38205_39617 466
2695 3300050509 nmdc:mga0qj67_1453_c1 nmdc:mga0qj67_1453_c1_11915_13315 466
2696 3300050511 nmdc:mga08y16_1715_c1 nmdc:mga08y16_1715_c1_8074_9474 466
2697 3300050511 nmdc:mga08y16_2882_c1 nmdc:mga08y16_2882_c1_15447_16847 466
2698 3300050511 nmdc:mga08y16_42428_c1 nmdc:mga08y16_42428_c1_2937_4349 466
2699 3300050512 nmdc:mga0n895_1392_c1 nmdc:mga0n895_1392_c1_4661_6061 466
2700 3300050512 nmdc:mga0n895_30575_c1 nmdc:mga0n895_30575_c1_3638_5044 466
2701 3300050512 nmdc:mga0n895_58282_c1 nmdc:mga0n895_58282_c1_2069_3472 466
2702 3300050512 nmdc:mga0n895_971_c1 nmdc:mga0n895_971_c1_12827_14227 466
2703 3300050513 nmdc:mga0rr50_78964_c1 nmdc:mga0rr50_78964_c1_261_1661 466
2704 3300050514 nmdc:mga08x19_25741_c1 nmdc:mga08x19_25741_c1_960_2360 466
2705 3300050514 nmdc:mga08x19_66_c1 nmdc:mga08x19_66_c1_39448_40866 466
2706 3300050515 nmdc:mga0a205_1026_c1 nmdc:mga0a205_1026_c1_6465_7865 466
2707 3300050515 nmdc:mga0a205_27448_c1 nmdc:mga0a205_27448_c1_237_1637 466
2708 3300050515 nmdc:mga0a205_687_c1 nmdc:mga0a205_687_c1_21768_23168 466
2709 3300050516 nmdc:mga0sz30_1084_c1 nmdc:mga0sz30_1084_c1_6054_7469 466
2710 3300050516 nmdc:mga0sz30_47039_c1 nmdc:mga0sz30_47039_c1_26_1429 466
2711 3300050516 nmdc:mga0sz30_5454_c1 nmdc:mga0sz30_5454_c1_317_1723 466
2712 3300053077 Ga0495601_0000020 Ga0495601_0000020_131047_132522 466
2713 3300053077 Ga0495601_0002032 Ga0495601_0002032_3950_5350 466
2714 3300053077 Ga0495601_0002166 Ga0495601_0002166_2091_3491 466
2715 3300053077 Ga0495601_0009529 Ga0495601_0009529_1992_3401 466
2716 3300053077 Ga0495601_0024023 Ga0495601_0024023_1353_2762 466
2717 3300053077 Ga0495601_0025589 Ga0495601_0025589_752_2152 466
2718 3300053078 Ga0495612_0000030 Ga0495612_0000030_67566_69041 466
2719 3300053078 Ga0495612_0000095 Ga0495612_0000095_85_1494 466
2720 3300053078 Ga0495612_0000616 Ga0495612_0000616_11733_13133 466
2721 3300053078 Ga0495612_0005510 Ga0495612_0005510_2928_4328 466
2722 3300053078 Ga0495612_0013166 Ga0495612_0013166_1916_3316 466
2723 3300053078 Ga0495612_0014874 Ga0495612_0014874_164_1564 466
2724 3300053078 Ga0495612_0015258 Ga0495612_0015258_778_2178 466
2725 3300053084 Ga0495595_0000125 Ga0495595_0000125_18717_20192 466
2726 3300053084 Ga0495595_0002085 Ga0495595_0002085_5301_6710 466
2727 3300053084 Ga0495595_0003032 Ga0495595_0003032_1857_3257 466
2728 3300053084 Ga0495595_0004343 Ga0495595_0004343_2973_4373 466
2729 3300053084 Ga0495595_0005397 Ga0495595_0005397_3131_4531 466
2730 3300053084 Ga0495595_0012561 Ga0495595_0012561_1040_2491 466
2731 3300053084 Ga0495595_0028530 Ga0495595_0028530_1013_2413 466
2732 3300053084 Ga0495595_0029769 Ga0495595_0029769_165_1568 466
2733 3300053085 Ga0495619_0000151 Ga0495619_0000151_34688_36088 466
2734 3300053085 Ga0495619_0000216 Ga0495619_0000216_27512_28987 466
2735 3300053085 Ga0495619_0000419 Ga0495619_0000419_12247_13647 466
2736 3300053085 Ga0495619_0000504 Ga0495619_0000504_14107_15510 466
2737 3300053085 Ga0495619_0001557 Ga0495619_0001557_10748_12157 466
2738 3300053085 Ga0495619_0001606 Ga0495619_0001606_9229_10629 466
2739 3300053085 Ga0495619_0005274 Ga0495619_0005274_5530_6933 466
2740 3300053085 Ga0495619_0005598 Ga0495619_0005598_1065_2474 466
2741 3300053085 Ga0495619_0009643 Ga0495619_0009643_1462_2862 466
2742 3300053085 Ga0495619_0010322 Ga0495619_0010322_4123_5574 466
2743 3300053085 Ga0495619_0012726 Ga0495619_0012726_904_2304 466
2744 3300053085 Ga0495619_0012816 Ga0495619_0012816_903_2303 466
2745 3300053085 Ga0495619_0065533 Ga0495619_0065533_81_1496 466
2746 3300053086 Ga0500578_0035303 Ga0500578_0035303_953_2368 466
2747 3300053087 Ga0500643_000267 Ga0500643_000267_11052_12455 466
2748 3300053087 Ga0500643_013683 Ga0500643_013683_156_1559 466
2749 3300053087 Ga0500643_022533 Ga0500643_022533_433_1836 466
2750 3300053091 Ga0500647_0016593 Ga0500647_0016593_35_1438 466
2751 3300053093 Ga0500651_0000861 Ga0500651_0000861_13295_14698 466
2752 3300053093 Ga0500651_0006227 Ga0500651_0006227_4732_6141 466
2753 3300053093 Ga0500651_0035377 Ga0500651_0035377_541_1944 466
2754 3300053093 Ga0500651_0081820 Ga0500651_0081820_147_1556 466
2755 3300053093 Ga0500651_0086679 Ga0500651_0086679_147_1550 466
2756 3300053094 Ga0500566_0000157 Ga0500566_0000157_3567_4970 466
2757 3300053094 Ga0500566_0000185 Ga0500566_0000185_379_1782 466
2758 3300053094 Ga0500566_0000925 Ga0500566_0000925_113_1516 466
2759 3300053096 Ga0500641_0001160 Ga0500641_0001160_3503_4909 466
2760 3300053096 Ga0500641_0006535 Ga0500641_0006535_317_1720 466
2761 3300053096 Ga0500641_0024451 Ga0500641_0024451_363_1766 466
2762 3300053096 Ga0500641_0028182 Ga0500641_0028182_731_2134 466
2763 3300053102 Ga0500554_000718 Ga0500554_000718_644_2047 466
2764 3300053104 Ga0500556_0000413 Ga0500556_0000413_157_1560 466
2765 3300053104 Ga0500556_0008713 Ga0500556_0008713_940_2343 466
2766 3300053105 Ga0500557_000041 Ga0500557_000041_41131_42534 466
2767 3300053107 Ga0500560_007025 Ga0500560_007025_923_2338 466
2768 3300053108 Ga0500562_011056 Ga0500562_011056_111_1514 466
2769 3300053111 Ga0500572_001865 Ga0500572_001865_139_1542 466
2770 3300053111 Ga0500572_003851 Ga0500572_003851_1823_3250 466
2771 3300053116 Ga0500592_008834 Ga0500592_008834_53_1456 466
2772 3300053119 Ga0500595_000024 Ga0500595_000024_109760_111163 466
2773 3300053119 Ga0500595_003935 Ga0500595_003935_2414_3817 466
2774 3300053119 Ga0500595_006228 Ga0500595_006228_1806_3209 466
2775 3300053119 Ga0500595_018179 Ga0500595_018179_597_2000 466
2776 3300053119 Ga0500595_023855 Ga0500595_023855_670_2073 466
2777 3300053123 Ga0500614_001219 Ga0500614_001219_3217_4620 466
2778 3300053125 Ga0500618_006718 Ga0500618_006718_781_2190 466
2779 3300053130 Ga0500642_0000005 Ga0500642_0000005_29607_31010 466
2780 3300053130 Ga0500642_0000140 Ga0500642_0000140_25024_26457 466
2781 3300053131 Ga0500652_000011 Ga0500652_000011_7431_8837 466
2782 3300053131 Ga0500652_000531 Ga0500652_000531_3008_4411 466
2783 3300053134 Ga0500658_0004847 Ga0500658_0004847_1934_3337 466
2784 3300053136 Ga0500559_0002089 Ga0500559_0002089_5966_7369 466
2785 3300053136 Ga0500559_0004041 Ga0500559_0004041_1117_2529 466
2786 3300053136 Ga0500559_0004212 Ga0500559_0004212_4303_5706 466
2787 3300053137 Ga0500561_0000098 Ga0500561_0000098_4833_6248 466
2788 3300053139 Ga0500568_0002109 Ga0500568_0002109_4685_6088 466
2789 3300053142 Ga0500577_0000693 Ga0500577_0000693_5102_6505 466
2790 3300053148 Ga0500590_083058 Ga0500590_083058_153_1556 466
2791 3300053150 Ga0500603_000277 Ga0500603_000277_5928_7331 466
2792 3300053150 Ga0500603_001226 Ga0500603_001226_4373_5776 466
2793 3300053151 Ga0500604_0019289 Ga0500604_0019289_300_1703 466
2794 3300053153 Ga0500616_0000001 Ga0500616_0000001_36069_37472 466
2795 3300053153 Ga0500616_0000166 Ga0500616_0000166_79903_81309 466
2796 3300053153 Ga0500616_0000180 Ga0500616_0000180_75009_76412 466
2797 3300053153 Ga0500616_0004617 Ga0500616_0004617_6033_7448 466
2798 3300053153 Ga0500616_0009939 Ga0500616_0009939_4198_5613 466
2799 3300053156 Ga0500622_0000458 Ga0500622_0000458_29185_30600 466
2800 3300053156 Ga0500622_0029561 Ga0500622_0029561_10_1413 466
2801 3300053156 Ga0500622_0037547 Ga0500622_0037547_69_1472 466
2802 3300053156 Ga0500622_0045943 Ga0500622_0045943_317_1720 466
2803 3300053162 Ga0500638_078740 Ga0500638_078740_73_1476 466
2804 3300053163 Ga0500639_000014 Ga0500639_000014_145_1548 466
2805 3300053163 Ga0500639_063951 Ga0500639_063951_78_1505 466
2806 3300053177 Ga0500636_0000180 Ga0500636_0000180_21160_22575 466
2807 3300053177 Ga0500636_0001459 Ga0500636_0001459_4488_5903 466
2808 3300053177 Ga0500636_0001916 Ga0500636_0001916_5636_7078 466
2809 3300053177 Ga0500636_0004158 Ga0500636_0004158_4671_6074 466
2810 3300053178 Ga0500637_0002840 Ga0500637_0002840_5911_7314 466
2811 3300053178 Ga0500637_0029199 Ga0500637_0029199_963_2372 466
2812 3300053729 Ga0500625_003212 Ga0500625_003212_3373_4776 466
2813 3300053730 Ga0500645_002180 Ga0500645_002180_6730_8136 466
2814 3300053730 Ga0500645_013842 Ga0500645_013842_683_2086 466
2815 3300053736 Ga0500599_000459 Ga0500599_000459_396_1799 466
2816 3300053737 Ga0500601_000076 Ga0500601_000076_17350_18753 466
2817 3300054114 Ga0501084_0003972 Ga0501084_0003972_5508_6911 466
2818 3300054114 Ga0501084_0073507 Ga0501084_0073507_921_2324 466
2819 3300054114 Ga0501084_0114235 Ga0501084_0114235_59_1468 466
2820 3300054114 Ga0501084_0148146 Ga0501084_0148146_342_1754 466
2821 3300060353 Ga0501082_0011183 Ga0501082_0011183_818_2221 466
2822 3300060353 Ga0501082_0011925 Ga0501082_0011925_4136_5551 466
2823 3300060353 Ga0501082_0040978 Ga0501082_0040978_1925_3328 466
2824 3300060353 Ga0501082_0051160 Ga0501082_0051160_1886_3343 466
2825 3300060353 Ga0501082_0111109 Ga0501082_0111109_178_1581 466
2826 3300061719 Ga0466962_0032239 Ga0466962_0032239_940_2355 466
2827 3300061734 Ga0530510_0024936 Ga0530510_0024936_1126_2538 466
2828 iso_pu_bacteria 2515154112 2515625437 466
2829 iso_pu_bacteria 2874590934 2874597748 466
2830 iso_pu_bacteria 2874645413 2874651277 466
2831 iso_pu_bacteria 2876771140 2876776348 466
2832 iso_pu_bacteria 2876818435 2876820916 466
2833 iso_pu_bacteria 2879074833 2879081789 466
2834 iso_pu_bacteria 2935975950 2935976652 466
2835 iso_pu_bacteria 3005474847 3005477605 466
2836 iso_pu_bacteria 8006926726 8006932253 466
2837 iso_pu_bacteria 8019619141 8019625137 466
2838 iso_pu_bacteria 8019638758 8019642561 466
2839 iso_pu_bacteria 8019668869 8019674444 466
2840 iso_pu_bacteria 8019678201 8019681659 466
2841 iso_pu_bacteria 8056673599 8056674870 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01225

Mur_ligase

Mur ligase family, catalytic domain

9

108

0.98

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

319

449

0.93

PF08245

Mur_ligase_M

Mur ligase middle domain

112

297

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cau-assembly1.cif.gz_A udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp 0.9569 1 317
6cau-assembly1.cif.gz_A udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp 0.9508 1 317
1gqy-assembly1.cif.gz_A murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp 0.9448 1 463
2f00-assembly1.cif.gz_B escherichia coli murc 0.9419 4 465
1p3d-assembly2.cif.gz_B crystal structure of udp-n-acetylmuramic acid:l-alanine ligase (murc) in complex with uma and anp. 0.9395 5 461
ID Description Score Start End Superfamily
1gqqB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.986 11 94 3.40.50.720
1j6uA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9712 10 94 3.40.50.720
2f00B02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9682 97 316 3.40.1190.10
1gqqB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9633 11 94 3.40.50.720
af_P9WJL7_8_102_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 5 94 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G8PXB3-F1-model_v4 Mur ligase N-terminal catalytic domain-containing protein 0.9964 9 96 GO:0009058
GO:0016881
AF-A0A382V739-F1-model_v4 Mur ligase N-terminal catalytic domain-containing protein 0.9912 20 100 GO:0009058
GO:0016881
AF-A0A352GG65-F1-model_v4 Mur ligase C-terminal domain-containing protein 0.9902 361 464 GO:0009058
GO:0016881
AF-Q98KB4-F1-model_v4 UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8) (UDP-N-acetylmuramoyl-L-alanine synthetase) 0.9872 1 465 GO:0005524
GO:0005737
GO:0008360
GO:0008763
GO:0009252
GO:0051301
GO:0071555
AF-A0A528FJS9-F1-model_v4 UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8) 0.9864 316 463 GO:0008763
GO:0009058

Feature Viewer

pLDDT pTM Quality
93.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map