F497093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2841 | 1380 | 2062 | 468 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8054563764|8054568615 |
| Length | 464 |
| Sequence | LKMTTAIGPVHFVGIGGIGMSGIAEVLHNLGYTVQGSDIAENANVQRLREKGIKVLIGHKAENIAGATVLVVSSAVKRDNPELMAARARLLPVVRRAEMLAELMRLKQAIAVGGTHGKTTTTSLVATLLEAGGLDPTVINGGIINAYGTNARLGEGDWLVAEADESDGTFVKLPADIAIVTNIDPEHLDHYGTFDGVRAAFRQFVENIPFYGFAVMCLDHPEVQAMVGRIEDRRIITYGANPQADVRFIDVDYGPRTTFAVDITDRVTGEHRTIRNLSLPMPGVHNVSNATAAVAVADRLGIDGDAIRRGFEAFRGVKRRFTHVGDWNGVAIFDDYGHHPVEIRAVLAAARQATKGKVIAVVQPHRYSRLQSLFDDFCLCFNDADLVIVTDVYAAGESPIPGADRDALVAGLSVRGHRDSIALENREALAPLIKARAAPGDIVVCLGAGSITQWAATLPDELAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 5 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 6 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 7 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 8 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 9 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 13 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 14 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 15 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 16 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 17 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 18 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 19 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 20 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 21 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 22 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 23 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 24 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 25 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 26 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 27 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 28 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 29 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 30 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 31 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 32 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 33 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 34 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 35 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 36 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 37 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 38 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 39 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 40 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 41 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 42 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 43 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 44 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 45 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 46 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 47 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 48 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 49 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 50 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 51 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 52 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 53 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 54 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 55 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 56 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 57 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 58 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 59 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 60 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 61 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 62 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 63 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 64 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 65 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 66 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 67 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 68 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 69 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 70 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 71 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 72 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 73 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 74 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 75 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 76 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 77 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 78 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 79 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 80 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 81 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 82 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 83 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 84 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 85 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 86 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 87 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 88 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 89 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 90 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 91 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 92 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 93 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 94 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 95 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 96 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 97 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 98 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 99 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 100 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 101 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 102 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 103 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 104 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 105 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 106 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 107 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 108 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 109 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 110 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 111 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 112 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 113 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 114 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 115 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 116 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 117 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 118 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 119 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 120 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 121 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 122 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 123 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 124 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 125 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 126 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 127 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 128 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 129 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 130 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 131 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 132 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 133 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 134 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 135 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 136 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 137 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 138 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 139 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 140 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 141 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 142 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 143 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 144 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 145 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 146 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 147 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 148 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 149 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 150 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 151 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 152 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 153 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 154 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 155 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 156 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 157 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 158 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 159 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 160 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 161 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 162 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 163 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 164 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 165 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 166 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 167 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 168 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 169 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 170 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 171 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 172 | 2791355199 | |||
| 173 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 174 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 175 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 176 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 177 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 178 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 179 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 180 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 181 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 182 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 183 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 184 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 185 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 186 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 187 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 188 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 189 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 190 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 191 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 192 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 193 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 194 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 195 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 196 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 197 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 198 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 199 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 200 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 201 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 202 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 203 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 204 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 205 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 206 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 207 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 208 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 209 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 210 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 211 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 212 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 213 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 214 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 215 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 216 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 217 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 218 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 219 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 220 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 221 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 222 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 223 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 224 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 225 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 226 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 227 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 228 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 229 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 230 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 231 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 232 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 233 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 234 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 235 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 236 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 237 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 238 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 239 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 240 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 241 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 242 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 243 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 244 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 245 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 246 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 247 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 248 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 249 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 250 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 251 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 252 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 253 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 254 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 255 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 256 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 257 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 258 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 259 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 260 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 261 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 262 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 263 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 264 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 265 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 266 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 267 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 268 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 269 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 270 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 271 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 272 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 273 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 274 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 275 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 276 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 277 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 278 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 279 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 280 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 281 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 282 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 283 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 284 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 285 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 286 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 287 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 288 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 289 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 290 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 291 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 292 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 293 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 294 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 295 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 296 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 297 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 298 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 299 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 300 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 301 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 302 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 303 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 304 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 305 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 306 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 307 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 308 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 309 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 310 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 311 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 312 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 313 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 314 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 315 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 316 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 317 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 318 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 319 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 320 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 321 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 322 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 323 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 324 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 325 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 326 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 327 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 328 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 329 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 330 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 331 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 332 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 333 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 334 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 335 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 336 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 337 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 338 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 339 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 340 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 341 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 342 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 343 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 344 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 345 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 346 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 347 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 348 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 349 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 350 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 351 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 352 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 353 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 354 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 355 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 356 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 357 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 358 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 359 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 360 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 361 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 362 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 363 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 364 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 365 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 366 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 367 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 368 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 369 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 370 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 371 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 372 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 373 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 374 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 375 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 376 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 377 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 378 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 379 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 380 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 381 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 382 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 383 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 384 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 385 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 386 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 387 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 388 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 389 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 390 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 391 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 392 | 2904699407 | |||
| 393 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 394 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 395 | 2906610324 | |||
| 396 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 397 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 398 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 399 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 400 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 401 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 402 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 403 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 404 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 405 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 406 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 407 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 408 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 409 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 410 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 411 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 412 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 413 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 414 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 415 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 416 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 417 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 418 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 419 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 420 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 421 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 422 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 423 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 424 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 425 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 426 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 427 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 428 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 429 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 430 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 431 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 432 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 433 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 434 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 435 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 436 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 437 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 438 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 439 | 2922368715 | |||
| 440 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 441 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 442 | 2922425934 | |||
| 443 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 444 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 445 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 446 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 447 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 448 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 449 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 450 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 451 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 452 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 453 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 454 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 455 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 456 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 457 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 458 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 459 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 460 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 461 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 462 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 463 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 464 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 465 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 466 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 467 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 468 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 469 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 470 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 471 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 472 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 473 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 474 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 475 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 476 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 477 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 478 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 479 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 480 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 481 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 482 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 483 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 484 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 485 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 486 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 487 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 488 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 489 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 490 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 491 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 492 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 493 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 494 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 495 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 496 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 497 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 498 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 499 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 500 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 501 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 502 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 503 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 504 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 505 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 506 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 507 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 508 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 509 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 510 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 511 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 512 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 513 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 514 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 515 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 516 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 517 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 518 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 519 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 520 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 521 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 522 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 523 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 524 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 525 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 526 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 527 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 528 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 529 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 530 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 531 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 532 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 533 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 534 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 535 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 536 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 537 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 538 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 539 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 540 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 541 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 542 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 543 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 544 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 545 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 546 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 547 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 548 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 549 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 550 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 551 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 552 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 553 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 554 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 555 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 556 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 557 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 558 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 559 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 560 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 561 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 562 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 563 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 564 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 565 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 566 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 567 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 568 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 569 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 570 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 571 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 572 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 573 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 574 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 575 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 576 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 577 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 578 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 579 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 580 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 581 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 582 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 583 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 584 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 585 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 586 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 587 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 588 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 589 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 590 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 591 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 592 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 593 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 594 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 595 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 596 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 597 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 598 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 599 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 600 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 601 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 602 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 603 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 604 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 605 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 606 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 607 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 608 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 609 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 610 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 611 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 612 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 613 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 614 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 615 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 616 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 617 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 618 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 619 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 620 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 621 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 622 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 623 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 624 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 625 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 626 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 627 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 628 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 629 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 630 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 631 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 632 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 633 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 634 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 635 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 636 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 637 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 638 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 639 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 640 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 641 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 642 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 643 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 644 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 645 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 646 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 647 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 648 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 649 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 650 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 651 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 652 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 653 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 654 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 655 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 656 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 657 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 658 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 659 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 660 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 661 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 662 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 663 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 664 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 665 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 666 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 667 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 668 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 669 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 670 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 671 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 672 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 673 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 674 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 675 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 676 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 677 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 678 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 679 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 680 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 681 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 682 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 683 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 684 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 685 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 686 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 687 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 688 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 689 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 691 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 693 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 694 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 695 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 696 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 697 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 698 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 699 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 700 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 701 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 702 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 703 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 704 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 705 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 706 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 707 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 708 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 709 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 710 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 711 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 712 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 713 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 714 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 715 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 716 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 717 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 718 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 719 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 720 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 721 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 722 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 723 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 724 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 725 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 726 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 727 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 728 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 729 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 730 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 731 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 732 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 733 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 734 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 735 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 736 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 737 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 738 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 739 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 740 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 741 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 742 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 743 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 744 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 745 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 746 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 747 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 748 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 749 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 750 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 751 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 752 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 753 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 754 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 755 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 756 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 757 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 758 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 759 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 760 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 761 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 762 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 763 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 764 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 765 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 766 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 767 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 768 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 769 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 770 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 771 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 772 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 773 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 774 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 775 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 776 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 777 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 778 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 779 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 780 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 781 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 782 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 783 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 784 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 785 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 786 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 787 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 788 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 789 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 790 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 791 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 792 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 793 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 794 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 795 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 796 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 797 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 798 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 799 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 800 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 801 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 802 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 803 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 804 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 805 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 806 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 807 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 808 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 809 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 810 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 811 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 812 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 813 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 814 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 815 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 816 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 817 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 818 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 819 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 820 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 821 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 822 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 823 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 824 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 825 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 826 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 827 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 828 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 829 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 830 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 831 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 832 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 833 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 834 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 835 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 836 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 837 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 838 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 839 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 840 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 841 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 842 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 843 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 844 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 845 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 846 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 847 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 848 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 849 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 850 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 851 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 852 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 853 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 854 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 855 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 856 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 857 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 858 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 859 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 860 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 861 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 862 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 863 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 864 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 865 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 866 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 867 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 868 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 869 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 870 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 871 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 872 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 873 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 874 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 875 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 876 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 877 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 878 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 879 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 880 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 881 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 882 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 883 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 884 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 885 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 886 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 887 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 888 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 889 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 890 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 891 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 892 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 893 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 894 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 895 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 896 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 897 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 898 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 899 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 900 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 901 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 902 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 903 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 904 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 905 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 906 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 907 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 908 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 909 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 910 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 911 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 912 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 913 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 914 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 915 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 916 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 917 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 918 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 919 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 920 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 921 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 922 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 923 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 924 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 925 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 926 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 927 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 928 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 929 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 930 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 931 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 932 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 933 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 934 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 935 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 936 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 937 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 938 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 939 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 940 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 941 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 942 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 943 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 944 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 945 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 946 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 947 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 948 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 949 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 950 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 951 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 952 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 953 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 954 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 955 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 956 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 957 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 958 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 959 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 961 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 965 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 966 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 967 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 969 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 970 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 971 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 972 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 973 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 974 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 975 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 977 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 978 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 979 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 980 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 983 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 984 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 986 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 987 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 988 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 990 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 992 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 993 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 995 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 996 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 997 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 998 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 999 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 1000 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1001 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1002 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1003 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 1004 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1005 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 1006 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 1007 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 1008 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 1009 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 1010 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 1011 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 1012 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 1013 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 1014 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 1015 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1016 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1017 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 1018 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 1019 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 1020 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1021 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1022 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1023 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 1024 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1025 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1026 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1027 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1028 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 1029 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 1030 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 1031 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1032 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 1033 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1034 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 1035 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 1036 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 1037 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 1038 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 1039 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 1040 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 1041 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 1042 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 1043 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 1044 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 1045 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 1046 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1047 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 1048 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1049 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 1050 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 1051 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 1052 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 1053 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 1054 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 1055 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 1056 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 1057 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 1058 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 1059 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 1060 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 1061 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 1062 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 1063 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 1064 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1065 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1066 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1067 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1068 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 1069 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1070 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1071 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1072 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1073 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1074 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1075 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1076 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1077 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1078 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1079 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1080 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1081 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1082 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1083 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 1084 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 1085 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1086 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1087 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1088 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1089 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 1090 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 1091 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1092 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 1093 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1094 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1095 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1096 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1097 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1098 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1099 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 1100 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1101 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1102 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1103 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1104 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1105 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 1106 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1107 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1108 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1111 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1113 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1114 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 1115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1116 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 1117 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1118 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 1119 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1122 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1126 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1127 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1129 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 1130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1131 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 1132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1133 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 1134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1135 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 1136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1137 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1138 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1140 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1143 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1145 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 1146 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1147 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1149 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1150 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1152 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 1153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1156 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1157 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1161 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1166 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1167 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1170 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1171 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1172 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1189 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1195 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1196 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1208 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1210 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1211 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1213 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1214 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1218 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1220 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1222 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1223 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1224 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1226 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1227 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1229 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1230 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1231 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1232 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1234 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1235 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1237 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1238 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1241 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1242 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1243 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1244 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1247 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1249 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1250 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1252 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1253 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1254 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 1255 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1256 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1257 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1258 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 1259 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1260 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1261 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1262 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1263 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1264 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1265 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1266 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 1267 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1268 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1269 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 1270 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1271 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1272 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1273 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1274 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1275 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1276 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 1277 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1278 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1279 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1280 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 1281 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 1282 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1283 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1284 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 1285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1286 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 1287 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 1288 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1290 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 1291 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1292 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1293 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 1294 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 1295 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1296 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1297 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1298 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 1299 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1300 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1301 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1302 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1303 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1304 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1305 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1306 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1307 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1308 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1309 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1310 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1311 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1312 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1313 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1314 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1315 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1316 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1317 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1318 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1319 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1320 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1321 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1322 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1323 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1324 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1325 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1326 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1327 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 1328 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 1329 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 1330 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 1331 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 1332 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 1333 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1334 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1335 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 1336 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 1337 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 1338 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1339 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1340 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1341 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 1342 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1343 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1344 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1345 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1346 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1347 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1348 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1349 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1350 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1351 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 1352 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1353 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 1354 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1355 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1356 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1357 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1358 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1359 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1360 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1361 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 1362 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 1363 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1364 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1365 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1366 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1367 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1368 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1369 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1370 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 1371 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1372 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1373 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1374 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 1375 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 1376 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 1377 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1378 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 1379 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1380 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.71 |
| Metatranscriptomes | 0 |
| Isolates | 27.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 9.01 |
| Nodule | 21.12 |
| Rhizoplane | 4.82 |
| Rhizosphere | 55.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000516 | 3300000041 | Bacteria | 4854 |
| 2 | ARSoilYngRDRAFT_c00728 | 3300000042 | Bacteria | 3012 |
| 3 | ARcpr5yngRDRAFT_c000549 | 3300000043 | Bacteria | 4823 |
| 4 | ARSoilOldRDRAFT_c000275 | 3300000044 | Bacteria | 7322 |
| 5 | ARCol0yngRDRAFT_1000490 | 3300000652 | Bacteria | 4696 |
| 6 | JGI24746J21847_1000658 | 3300001977 | Bacteria | 5289 |
| 7 | JGI24740J21852_10002709 | 3300001979 | Bacteria | 7951 |
| 8 | JGI24739J22299_10000203 | 3300001989 | Bacteria | 19736 |
| 9 | JGI24737J22298_10003052 | 3300001990 | Bacteria | 5933 |
| 10 | JGI24750J21931_1000206 | 3300002070 | Bacteria | 9983 |
| 11 | JGI24750J21931_1000813 | 3300002070 | Bacteria | 4319 |
| 12 | JGI24745J21846_1000036 | 3300002073 | Bacteria | 9023 |
| 13 | JGI24748J21848_1000461 | 3300002074 | Bacteria | 4506 |
| 14 | JGI24738J21930_10001355 | 3300002075 | Bacteria | 6788 |
| 15 | JGI24749J21850_1001705 | 3300002076 | Bacteria | 3116 |
| 16 | JGI24744J21845_10006569 | 3300002077 | Bacteria | 2411 |
| 17 | JGI24035J26624_1000184 | 3300002126 | Bacteria | 5800 |
| 18 | JGI24034J26672_10001100 | 3300002239 | Bacteria | 3524 |
| 19 | JGI24742J22300_10000210 | 3300002244 | Bacteria | 8662 |
| 20 | JGI24751J29686_10014198 | 3300002459 | Bacteria | 1644 |
| 21 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 22 | JGI25154J39366_1000122 | 3300002738 | Bacteria | 61892 |
| 23 | JGI25154J39366_1000150 | 3300002738 | Bacteria | 54544 |
| 24 | JGI25158J39367_1000038 | 3300002739 | Bacteria | 30017 |
| 25 | JGI25157J39369_1000044 | 3300002741 | Bacteria | 122466 |
| 26 | JGI25152J39213_1001384 | 3300002773 | Bacteria | 10513 |
| 27 | JGI25150J39212_1000107 | 3300002774 | Bacteria | 48306 |
| 28 | JGI25150J39212_1003225 | 3300002774 | Bacteria | 3859 |
| 29 | JGI25150J39212_1004915 | 3300002774 | Bacteria | 2912 |
| 30 | JGI25159J45721_1000154 | 3300002987 | Bacteria | 32025 |
| 31 | JGI25159J45721_1002735 | 3300002987 | Bacteria | 6539 |
| 32 | JGI25151J46595_10000028 | 3300003187 | Bacteria | 208373 |
| 33 | JGI25151J46595_10000374 | 3300003187 | Bacteria | 46807 |
| 34 | JGI25151J46595_10000839 | 3300003187 | Bacteria | 24488 |
| 35 | JGI25151J46595_10016744 | 3300003187 | Bacteria | 3198 |
| 36 | JGI25151J46595_10029284 | 3300003187 | Bacteria | 2182 |
| 37 | JGI25406J46586_10000392 | 3300003203 | Bacteria | 20055 |
| 38 | JGI25406J46586_10003218 | 3300003203 | Bacteria | 7680 |
| 39 | JGI25165J46597_1001042 | 3300003214 | Bacteria | 18102 |
| 40 | JGI25165J46597_1006320 | 3300003214 | Bacteria | 2112 |
| 41 | JGI25153J46596_10000696 | 3300003215 | Bacteria | 20557 |
| 42 | JGI25153J46596_10003837 | 3300003215 | Bacteria | 8280 |
| 43 | JGI25153J46596_10004141 | 3300003215 | Bacteria | 7882 |
| 44 | JGI25153J46596_10004246 | 3300003215 | Bacteria | 7754 |
| 45 | JGI25153J46596_10006403 | 3300003215 | Bacteria | 5958 |
| 46 | JGI25153J46596_10015480 | 3300003215 | Bacteria | 3104 |
| 47 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 48 | JGI25160J50197_1001885 | 3300003354 | Bacteria | 10064 |
| 49 | JGI25160J50197_1003307 | 3300003354 | Bacteria | 7256 |
| 50 | JGI25160J50197_1004587 | 3300003354 | Bacteria | 5948 |
| 51 | JGI25160J50197_1008344 | 3300003354 | Bacteria | 3953 |
| 52 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 53 | JGI25161J50226_1000174 | 3300003374 | Bacteria | 43080 |
| 54 | JGI25404J52841_10002804 | 3300003659 | Bacteria | 3356 |
| 55 | JGI25404J52841_10015585 | 3300003659 | Bacteria | 1649 |
| 56 | Ga0055526_1000597 | 3300003771 | Bacteria | 28415 |
| 57 | Ga0055526_1000802 | 3300003771 | Bacteria | 23436 |
| 58 | Ga0055526_1001522 | 3300003771 | Bacteria | 16418 |
| 59 | Ga0055526_1003626 | 3300003771 | Bacteria | 9665 |
| 60 | Ga0055526_1007634 | 3300003771 | Bacteria | 5578 |
| 61 | Ga0055526_1020097 | 3300003771 | Bacteria | 2397 |
| 62 | Ga0055524_1000020 | 3300003775 | Bacteria | 227971 |
| 63 | Ga0055524_1004279 | 3300003775 | Bacteria | 6626 |
| 64 | Ga0055524_1004359 | 3300003775 | Bacteria | 6539 |
| 65 | Ga0055524_1004387 | 3300003775 | Bacteria | 6512 |
| 66 | Ga0055524_1014554 | 3300003775 | Bacteria | 2911 |
| 67 | Ga0055528_1001199 | 3300003790 | Bacteria | 16717 |
| 68 | Ga0055528_1002181 | 3300003790 | Bacteria | 10723 |
| 69 | Ga0055528_1005051 | 3300003790 | Bacteria | 6231 |
| 70 | Ga0055540_1000929 | 3300003792 | Bacteria | 19079 |
| 71 | Ga0055540_1003312 | 3300003792 | Bacteria | 7857 |
| 72 | Ga0055531_10005281 | 3300003794 | Bacteria | 7578 |
| 73 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 74 | Ga0055543_1000350 | 3300004625 | Bacteria | 31311 |
| 75 | Ga0055543_1000500 | 3300004625 | Bacteria | 22620 |
| 76 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 77 | Ga0065165_1000141 | 3300005262 | Bacteria | 125536 |
| 78 | Ga0065165_1004626 | 3300005262 | Bacteria | 8358 |
| 79 | Ga0065165_1004931 | 3300005262 | Bacteria | 7867 |
| 80 | Ga0065165_1011468 | 3300005262 | Bacteria | 3693 |
| 81 | Ga0065165_1014773 | 3300005262 | Bacteria | 3015 |
| 82 | Ga0065712_10001033 | 3300005290 | Bacteria | 10330 |
| 83 | Ga0065712_10003647 | 3300005290 | Bacteria | 4552 |
| 84 | Ga0065715_10006009 | 3300005293 | Bacteria | 5768 |
| 85 | Ga0065715_10091317 | 3300005293 | Bacteria | 5885 |
| 86 | Ga0065707_10131552 | 3300005295 | Bacteria | 1912 |
| 87 | Ga0070658_10038187 | 3300005327 | Bacteria | 3873 |
| 88 | Ga0070676_10000499 | 3300005328 | Bacteria | 18707 |
| 89 | Ga0070676_10007528 | 3300005328 | Bacteria | 5848 |
| 90 | Ga0070683_100000265 | 3300005329 | Bacteria | 36059 |
| 91 | Ga0070683_100150071 | 3300005329 | Bacteria | 2210 |
| 92 | Ga0070690_100000718 | 3300005330 | Bacteria | 16997 |
| 93 | Ga0070690_100026323 | 3300005330 | Bacteria | 3587 |
| 94 | Ga0070670_100006298 | 3300005331 | Bacteria | 10047 |
| 95 | Ga0070670_100014626 | 3300005331 | Bacteria | 6737 |
| 96 | Ga0070670_100039987 | 3300005331 | Bacteria | 4033 |
| 97 | Ga0070670_100090453 | 3300005331 | Bacteria | 2630 |
| 98 | Ga0070670_100102718 | 3300005331 | Bacteria | 2462 |
| 99 | Ga0070677_10001854 | 3300005333 | Bacteria | 6684 |
| 100 | Ga0068869_100000792 | 3300005334 | Bacteria | 18060 |
| 101 | Ga0070666_10018983 | 3300005335 | Bacteria | 4431 |
| 102 | Ga0070680_100001359 | 3300005336 | Bacteria | 17686 |
| 103 | Ga0070680_100007344 | 3300005336 | Bacteria | 8406 |
| 104 | Ga0070680_100016152 | 3300005336 | Bacteria | 5869 |
| 105 | Ga0070680_100067602 | 3300005336 | Bacteria | 2931 |
| 106 | Ga0070680_100075252 | 3300005336 | Bacteria | 2779 |
| 107 | Ga0070682_100000745 | 3300005337 | Bacteria | 19431 |
| 108 | Ga0070682_100037232 | 3300005337 | Bacteria | 2977 |
| 109 | Ga0068868_100007218 | 3300005338 | Bacteria | 7897 |
| 110 | Ga0068868_100012356 | 3300005338 | Bacteria | 6239 |
| 111 | Ga0068868_100119237 | 3300005338 | Bacteria | 2151 |
| 112 | Ga0068868_100133070 | 3300005338 | Bacteria | 2036 |
| 113 | Ga0070660_100000136 | 3300005339 | Bacteria | 46892 |
| 114 | Ga0070660_100002003 | 3300005339 | Bacteria | 14053 |
| 115 | Ga0070660_100043329 | 3300005339 | Bacteria | 3439 |
| 116 | Ga0070689_100000722 | 3300005340 | Bacteria | 20157 |
| 117 | Ga0070689_100001379 | 3300005340 | Bacteria | 15450 |
| 118 | Ga0070691_10000148 | 3300005341 | Bacteria | 22373 |
| 119 | Ga0070687_100000080 | 3300005343 | Bacteria | 31259 |
| 120 | Ga0070687_100057571 | 3300005343 | Bacteria | 2039 |
| 121 | Ga0070661_100000425 | 3300005344 | Bacteria | 32302 |
| 122 | Ga0070661_100059571 | 3300005344 | Bacteria | 2800 |
| 123 | Ga0070692_10000893 | 3300005345 | Bacteria | 10102 |
| 124 | Ga0070692_10042477 | 3300005345 | Bacteria | 2335 |
| 125 | Ga0070692_10063725 | 3300005345 | Bacteria | 1948 |
| 126 | Ga0070669_100000276 | 3300005353 | Bacteria | 41366 |
| 127 | Ga0070669_100002660 | 3300005353 | Bacteria | 12871 |
| 128 | Ga0070669_100053883 | 3300005353 | Bacteria | 2945 |
| 129 | Ga0070675_100000271 | 3300005354 | Bacteria | 34156 |
| 130 | Ga0070675_100097097 | 3300005354 | Bacteria | 2477 |
| 131 | Ga0070675_100154622 | 3300005354 | Bacteria | 1969 |
| 132 | Ga0070671_100000389 | 3300005355 | Bacteria | 30190 |
| 133 | Ga0070671_100018200 | 3300005355 | Bacteria | 5703 |
| 134 | Ga0070671_100023087 | 3300005355 | Bacteria | 5085 |
| 135 | Ga0070671_100051379 | 3300005355 | Bacteria | 3428 |
| 136 | Ga0070674_100000928 | 3300005356 | Bacteria | 15290 |
| 137 | Ga0070674_100040050 | 3300005356 | Bacteria | 3168 |
| 138 | Ga0070674_100124249 | 3300005356 | Bacteria | 1914 |
| 139 | Ga0070673_100001722 | 3300005364 | Bacteria | 13004 |
| 140 | Ga0070673_100008972 | 3300005364 | Bacteria | 6688 |
| 141 | Ga0070673_100175780 | 3300005364 | Bacteria | 1830 |
| 142 | Ga0070688_100001551 | 3300005365 | Bacteria | 11468 |
| 143 | Ga0070688_100005937 | 3300005365 | Bacteria | 6469 |
| 144 | Ga0070688_100023145 | 3300005365 | Bacteria | 3650 |
| 145 | Ga0070688_100046475 | 3300005365 | Bacteria | 2688 |
| 146 | Ga0070688_100090147 | 3300005365 | Bacteria | 2002 |
| 147 | Ga0070659_100006384 | 3300005366 | Bacteria | 8513 |
| 148 | Ga0070659_100023831 | 3300005366 | Bacteria | 4687 |
| 149 | Ga0070667_100001569 | 3300005367 | Bacteria | 20471 |
| 150 | Ga0070667_100049567 | 3300005367 | Bacteria | 3537 |
| 151 | Ga0070667_100071904 | 3300005367 | Bacteria | 2946 |
| 152 | Ga0070667_100106790 | 3300005367 | Bacteria | 2423 |
| 153 | Ga0070703_10001527 | 3300005406 | Bacteria | 6911 |
| 154 | Ga0070703_10032910 | 3300005406 | Bacteria | 1577 |
| 155 | Ga0070709_10001417 | 3300005434 | Bacteria | 12994 |
| 156 | Ga0070709_10009235 | 3300005434 | Bacteria | 5429 |
| 157 | Ga0070709_10036252 | 3300005434 | Bacteria | 3003 |
| 158 | Ga0070709_10061585 | 3300005434 | Bacteria | 2389 |
| 159 | Ga0070709_10068113 | 3300005434 | Bacteria | 2288 |
| 160 | Ga0070709_10088435 | 3300005434 | Bacteria | 2038 |
| 161 | Ga0070714_100000678 | 3300005435 | Bacteria | 24075 |
| 162 | Ga0070714_100013931 | 3300005435 | Bacteria | 6452 |
| 163 | Ga0070714_100018262 | 3300005435 | Bacteria | 5694 |
| 164 | Ga0070714_100048804 | 3300005435 | Bacteria | 3601 |
| 165 | Ga0070714_100058991 | 3300005435 | Bacteria | 3290 |
| 166 | Ga0070713_100002582 | 3300005436 | Bacteria | 11845 |
| 167 | Ga0070713_100017559 | 3300005436 | Bacteria | 5414 |
| 168 | Ga0070713_100022313 | 3300005436 | Bacteria | 4890 |
| 169 | Ga0070713_100033799 | 3300005436 | Bacteria | 4101 |
| 170 | Ga0070713_100074835 | 3300005436 | Bacteria | 2870 |
| 171 | Ga0070713_100135610 | 3300005436 | Bacteria | 2175 |
| 172 | Ga0070713_100240790 | 3300005436 | Bacteria | 1647 |
| 173 | Ga0070710_10000633 | 3300005437 | Bacteria | 16752 |
| 174 | Ga0070710_10002407 | 3300005437 | Bacteria | 8862 |
| 175 | Ga0070710_10002708 | 3300005437 | Bacteria | 8421 |
| 176 | Ga0070710_10006364 | 3300005437 | Bacteria | 5669 |
| 177 | Ga0070710_10019478 | 3300005437 | Bacteria | 3507 |
| 178 | Ga0070710_10026128 | 3300005437 | Bacteria | 3099 |
| 179 | Ga0070710_10046292 | 3300005437 | Bacteria | 2421 |
| 180 | Ga0070701_10000457 | 3300005438 | Bacteria | 13932 |
| 181 | Ga0070701_10004482 | 3300005438 | Bacteria | 5666 |
| 182 | Ga0070701_10011127 | 3300005438 | Bacteria | 4007 |
| 183 | Ga0070711_100001478 | 3300005439 | Bacteria | 12909 |
| 184 | Ga0070711_100002216 | 3300005439 | Bacteria | 11029 |
| 185 | Ga0070711_100007229 | 3300005439 | Bacteria | 6746 |
| 186 | Ga0070711_100011186 | 3300005439 | Bacteria | 5564 |
| 187 | Ga0070711_100055922 | 3300005439 | Bacteria | 2727 |
| 188 | Ga0070711_100092586 | 3300005439 | Bacteria | 2181 |
| 189 | Ga0070711_100166193 | 3300005439 | Bacteria | 1677 |
| 190 | Ga0070705_100000579 | 3300005440 | Bacteria | 21266 |
| 191 | Ga0070705_100044359 | 3300005440 | Bacteria | 2554 |
| 192 | Ga0070700_100000515 | 3300005441 | Bacteria | 19292 |
| 193 | Ga0070700_100010386 | 3300005441 | Bacteria | 5138 |
| 194 | Ga0070700_100030563 | 3300005441 | Bacteria | 3220 |
| 195 | Ga0070694_100004976 | 3300005444 | Bacteria | 8009 |
| 196 | Ga0070694_100052391 | 3300005444 | Bacteria | 2758 |
| 197 | Ga0070708_100041592 | 3300005445 | Bacteria | 4030 |
| 198 | Ga0070663_100000580 | 3300005455 | Bacteria | 19553 |
| 199 | Ga0070663_100027924 | 3300005455 | Bacteria | 3836 |
| 200 | Ga0070663_100067369 | 3300005455 | Bacteria | 2596 |
| 201 | Ga0070663_100091152 | 3300005455 | Bacteria | 2258 |
| 202 | Ga0070663_100132571 | 3300005455 | Bacteria | 1894 |
| 203 | Ga0070678_100000016 | 3300005456 | Bacteria | 53269 |
| 204 | Ga0070678_100008371 | 3300005456 | Bacteria | 6195 |
| 205 | Ga0070678_100025343 | 3300005456 | Bacteria | 3988 |
| 206 | Ga0070662_100001325 | 3300005457 | Bacteria | 15215 |
| 207 | Ga0070662_100015684 | 3300005457 | Bacteria | 5080 |
| 208 | Ga0070662_100016017 | 3300005457 | Bacteria | 5030 |
| 209 | Ga0070662_100021879 | 3300005457 | Bacteria | 4370 |
| 210 | Ga0070662_100063250 | 3300005457 | Bacteria | 2706 |
| 211 | Ga0070681_10001764 | 3300005458 | Bacteria | 19392 |
| 212 | Ga0070681_10003323 | 3300005458 | Bacteria | 15029 |
| 213 | Ga0070681_10025407 | 3300005458 | Bacteria | 5957 |
| 214 | Ga0070681_10043509 | 3300005458 | Bacteria | 4499 |
| 215 | Ga0070681_10166077 | 3300005458 | Bacteria | 2130 |
| 216 | Ga0068867_100012945 | 3300005459 | Bacteria | 5902 |
| 217 | Ga0068867_100073028 | 3300005459 | Bacteria | 2569 |
| 218 | Ga0070685_10000344 | 3300005466 | Bacteria | 28550 |
| 219 | Ga0070685_10013452 | 3300005466 | Bacteria | 4316 |
| 220 | Ga0070685_10024049 | 3300005466 | Bacteria | 3343 |
| 221 | Ga0070706_100130741 | 3300005467 | Bacteria | 2342 |
| 222 | Ga0070698_100019627 | 3300005471 | Bacteria | 7091 |
| 223 | Ga0070679_100001267 | 3300005530 | Bacteria | 22298 |
| 224 | Ga0070679_100008695 | 3300005530 | Bacteria | 9571 |
| 225 | Ga0070679_100024858 | 3300005530 | Bacteria | 5870 |
| 226 | Ga0070679_100031436 | 3300005530 | Bacteria | 5243 |
| 227 | Ga0070679_100092503 | 3300005530 | Bacteria | 3012 |
| 228 | Ga0070679_100169723 | 3300005530 | Bacteria | 2155 |
| 229 | Ga0070684_100004054 | 3300005535 | Bacteria | 11087 |
| 230 | Ga0070684_100005206 | 3300005535 | Bacteria | 9945 |
| 231 | Ga0070684_100014119 | 3300005535 | Bacteria | 6458 |
| 232 | Ga0070684_100020270 | 3300005535 | Bacteria | 5515 |
| 233 | Ga0070697_100000413 | 3300005536 | Bacteria | 32976 |
| 234 | Ga0068853_100001111 | 3300005539 | Bacteria | 19042 |
| 235 | Ga0068853_100006219 | 3300005539 | Bacteria | 9457 |
| 236 | Ga0068853_100008362 | 3300005539 | Bacteria | 8309 |
| 237 | Ga0068853_100010311 | 3300005539 | Bacteria | 7556 |
| 238 | Ga0068853_100010423 | 3300005539 | Bacteria | 7520 |
| 239 | Ga0070672_100000233 | 3300005543 | Bacteria | 31143 |
| 240 | Ga0070672_100009467 | 3300005543 | Bacteria | 6717 |
| 241 | Ga0070686_100000699 | 3300005544 | Bacteria | 19478 |
| 242 | Ga0070686_100009615 | 3300005544 | Bacteria | 5436 |
| 243 | Ga0070686_100059868 | 3300005544 | Bacteria | 2455 |
| 244 | Ga0070695_100000624 | 3300005545 | Bacteria | 18756 |
| 245 | Ga0070696_100001198 | 3300005546 | Bacteria | 16816 |
| 246 | Ga0070693_100000594 | 3300005547 | Bacteria | 16031 |
| 247 | Ga0070693_100022952 | 3300005547 | Bacteria | 3327 |
| 248 | Ga0070665_100005019 | 3300005548 | Bacteria | 13728 |
| 249 | Ga0070665_100021991 | 3300005548 | Bacteria | 6415 |
| 250 | Ga0070665_100025615 | 3300005548 | Bacteria | 5942 |
| 251 | Ga0070665_100028235 | 3300005548 | Bacteria | 5651 |
| 252 | Ga0070665_100035418 | 3300005548 | Bacteria | 5019 |
| 253 | Ga0070665_100047437 | 3300005548 | Bacteria | 4311 |
| 254 | Ga0070665_100053711 | 3300005548 | Bacteria | 4040 |
| 255 | Ga0070665_100102127 | 3300005548 | Bacteria | 2871 |
| 256 | Ga0070665_100107111 | 3300005548 | Bacteria | 2797 |
| 257 | Ga0070665_100166239 | 3300005548 | Bacteria | 2208 |
| 258 | Ga0070704_100000112 | 3300005549 | Bacteria | 28583 |
| 259 | Ga0070704_100001736 | 3300005549 | Bacteria | 11901 |
| 260 | Ga0070704_100008535 | 3300005549 | Bacteria | 6149 |
| 261 | Ga0068855_100007243 | 3300005563 | Bacteria | 13453 |
| 262 | Ga0068855_100030914 | 3300005563 | Bacteria | 6399 |
| 263 | Ga0068855_100033133 | 3300005563 | Bacteria | 6167 |
| 264 | Ga0068855_100049698 | 3300005563 | Bacteria | 4944 |
| 265 | Ga0068855_100092034 | 3300005563 | Bacteria | 3497 |
| 266 | Ga0068855_100209747 | 3300005563 | Bacteria | 2189 |
| 267 | Ga0068855_100217628 | 3300005563 | Bacteria | 2143 |
| 268 | Ga0070664_100000924 | 3300005564 | Bacteria | 22943 |
| 269 | Ga0070664_100075219 | 3300005564 | Bacteria | 2900 |
| 270 | Ga0070664_100087965 | 3300005564 | Bacteria | 2686 |
| 271 | Ga0070664_100247502 | 3300005564 | Bacteria | 1601 |
| 272 | Ga0068857_100000371 | 3300005577 | Bacteria | 31431 |
| 273 | Ga0068857_100021812 | 3300005577 | Bacteria | 5637 |
| 274 | Ga0068857_100135199 | 3300005577 | Bacteria | 2226 |
| 275 | Ga0068854_100000735 | 3300005578 | Bacteria | 19431 |
| 276 | Ga0068854_100050602 | 3300005578 | Bacteria | 2974 |
| 277 | Ga0068856_100000091 | 3300005614 | Bacteria | 85048 |
| 278 | Ga0068856_100000520 | 3300005614 | Bacteria | 42483 |
| 279 | Ga0068856_100042057 | 3300005614 | Bacteria | 4494 |
| 280 | Ga0068856_100131878 | 3300005614 | Bacteria | 2504 |
| 281 | Ga0070702_100002320 | 3300005615 | Bacteria | 8168 |
| 282 | Ga0070702_100009804 | 3300005615 | Bacteria | 4700 |
| 283 | Ga0070702_100072947 | 3300005615 | Bacteria | 2032 |
| 284 | Ga0068852_100001599 | 3300005616 | Bacteria | 15407 |
| 285 | Ga0068852_100164473 | 3300005616 | Bacteria | 2075 |
| 286 | Ga0068852_100196972 | 3300005616 | Bacteria | 1904 |
| 287 | Ga0068859_100010201 | 3300005617 | Bacteria | 9455 |
| 288 | Ga0068859_100030056 | 3300005617 | Bacteria | 5452 |
| 289 | Ga0068864_100000333 | 3300005618 | Bacteria | 41669 |
| 290 | Ga0068864_100022846 | 3300005618 | Bacteria | 5246 |
| 291 | Ga0068864_100099199 | 3300005618 | Bacteria | 2580 |
| 292 | Ga0068866_10000143 | 3300005718 | Bacteria | 32232 |
| 293 | Ga0068866_10019797 | 3300005718 | Bacteria | 3071 |
| 294 | Ga0068866_10025614 | 3300005718 | Bacteria | 2775 |
| 295 | Ga0068861_100000417 | 3300005719 | Bacteria | 24695 |
| 296 | Ga0068861_100050057 | 3300005719 | Bacteria | 3166 |
| 297 | Ga0068861_100101383 | 3300005719 | Bacteria | 2290 |
| 298 | Ga0068851_10001608 | 3300005834 | Bacteria | 9920 |
| 299 | Ga0068870_10000113 | 3300005840 | Bacteria | 27642 |
| 300 | Ga0068870_10011422 | 3300005840 | Bacteria | 4117 |
| 301 | Ga0068863_100022133 | 3300005841 | Bacteria | 6068 |
| 302 | Ga0068863_100133244 | 3300005841 | Bacteria | 2373 |
| 303 | Ga0068863_100257570 | 3300005841 | Bacteria | 1686 |
| 304 | Ga0068858_100000975 | 3300005842 | Bacteria | 29622 |
| 305 | Ga0068858_100010175 | 3300005842 | Bacteria | 8928 |
| 306 | Ga0068858_100021103 | 3300005842 | Bacteria | 6084 |
| 307 | Ga0068858_100103476 | 3300005842 | Bacteria | 2656 |
| 308 | Ga0068858_100197856 | 3300005842 | Bacteria | 1900 |
| 309 | Ga0068860_100000254 | 3300005843 | Bacteria | 79465 |
| 310 | Ga0068860_100001740 | 3300005843 | Bacteria | 23200 |
| 311 | Ga0068860_100015730 | 3300005843 | Bacteria | 7387 |
| 312 | Ga0068860_100032250 | 3300005843 | Bacteria | 5035 |
| 313 | Ga0068860_100033225 | 3300005843 | Bacteria | 4952 |
| 314 | Ga0068860_100051464 | 3300005843 | Bacteria | 3919 |
| 315 | Ga0068862_100001457 | 3300005844 | Bacteria | 21772 |
| 316 | Ga0068862_100201283 | 3300005844 | Bacteria | 1796 |
| 317 | Ga0081455_10000110 | 3300005937 | Bacteria | 92459 |
| 318 | Ga0081455_10004210 | 3300005937 | Bacteria | 16214 |
| 319 | Ga0081455_10007679 | 3300005937 | Bacteria | 11320 |
| 320 | Ga0081455_10026261 | 3300005937 | Bacteria | 5362 |
| 321 | Ga0081455_10037122 | 3300005937 | Bacteria | 4331 |
| 322 | Ga0081455_10042135 | 3300005937 | Bacteria | 4008 |
| 323 | Ga0081538_10040034 | 3300005981 | Bacteria | 2995 |
| 324 | Ga0081538_10050519 | 3300005981 | Bacteria | 2510 |
| 325 | Ga0081540_1000414 | 3300005983 | Bacteria | 42174 |
| 326 | Ga0081540_1001143 | 3300005983 | Bacteria | 23424 |
| 327 | Ga0081540_1003272 | 3300005983 | Bacteria | 12881 |
| 328 | Ga0081540_1009836 | 3300005983 | Bacteria | 6542 |
| 329 | Ga0081540_1012356 | 3300005983 | Bacteria | 5633 |
| 330 | Ga0081540_1018061 | 3300005983 | Bacteria | 4341 |
| 331 | Ga0081540_1032645 | 3300005983 | Bacteria | 2839 |
| 332 | Ga0081540_1071123 | 3300005983 | Bacteria | 1609 |
| 333 | Ga0081539_10000191 | 3300005985 | Bacteria | 142387 |
| 334 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 335 | Ga0081539_10001091 | 3300005985 | Bacteria | 49336 |
| 336 | Ga0081539_10005255 | 3300005985 | Bacteria | 13360 |
| 337 | Ga0081539_10047810 | 3300005985 | Bacteria | 2439 |
| 338 | Ga0070717_10000355 | 3300006028 | Bacteria | 29408 |
| 339 | Ga0070717_10002936 | 3300006028 | Bacteria | 12106 |
| 340 | Ga0070717_10005443 | 3300006028 | Bacteria | 9293 |
| 341 | Ga0070717_10027278 | 3300006028 | Bacteria | 4564 |
| 342 | Ga0075365_10004585 | 3300006038 | Bacteria | 7349 |
| 343 | Ga0075365_10013658 | 3300006038 | Bacteria | 4868 |
| 344 | Ga0075365_10023762 | 3300006038 | Bacteria | 3859 |
| 345 | Ga0075365_10026332 | 3300006038 | Bacteria | 3691 |
| 346 | Ga0075368_10002184 | 3300006042 | Bacteria | 6339 |
| 347 | Ga0075368_10055946 | 3300006042 | Bacteria | 1573 |
| 348 | Ga0075363_100045637 | 3300006048 | Bacteria | 2324 |
| 349 | Ga0075363_100074545 | 3300006048 | Bacteria | 1847 |
| 350 | Ga0075364_10046742 | 3300006051 | Bacteria | 2818 |
| 351 | Ga0075364_10064038 | 3300006051 | Bacteria | 2413 |
| 352 | Ga0075432_10004478 | 3300006058 | Bacteria | 4764 |
| 353 | Ga0070715_10000078 | 3300006163 | Bacteria | 27243 |
| 354 | Ga0070715_10000694 | 3300006163 | Bacteria | 9037 |
| 355 | Ga0070715_10001339 | 3300006163 | Bacteria | 7099 |
| 356 | Ga0070716_100004734 | 3300006173 | Bacteria | 6527 |
| 357 | Ga0070716_100009188 | 3300006173 | Bacteria | 4922 |
| 358 | Ga0070716_100026212 | 3300006173 | Bacteria | 3120 |
| 359 | Ga0070716_100077810 | 3300006173 | Bacteria | 1970 |
| 360 | Ga0070716_100095048 | 3300006173 | Bacteria | 1813 |
| 361 | Ga0070712_100002213 | 3300006175 | Bacteria | 11958 |
| 362 | Ga0070712_100011086 | 3300006175 | Bacteria | 5706 |
| 363 | Ga0070712_100020143 | 3300006175 | Bacteria | 4361 |
| 364 | Ga0070712_100055443 | 3300006175 | Bacteria | 2776 |
| 365 | Ga0070712_100082881 | 3300006175 | Bacteria | 2327 |
| 366 | Ga0070712_100149373 | 3300006175 | Bacteria | 1792 |
| 367 | Ga0075362_10010631 | 3300006177 | Bacteria | 3601 |
| 368 | Ga0075367_10001860 | 3300006178 | Bacteria | 9322 |
| 369 | Ga0075369_10001434 | 3300006186 | Bacteria | 8135 |
| 370 | Ga0075369_10016884 | 3300006186 | Bacteria | 2953 |
| 371 | Ga0075427_10000813 | 3300006194 | Bacteria | 3806 |
| 372 | Ga0075366_10058476 | 3300006195 | Bacteria | 2290 |
| 373 | Ga0075366_10082098 | 3300006195 | Bacteria | 1926 |
| 374 | Ga0097621_100000203 | 3300006237 | Bacteria | 38745 |
| 375 | Ga0097621_100017219 | 3300006237 | Bacteria | 5484 |
| 376 | Ga0097621_100062009 | 3300006237 | Bacteria | 3068 |
| 377 | Ga0097621_100108603 | 3300006237 | Bacteria | 2342 |
| 378 | Ga0097621_100201177 | 3300006237 | Bacteria | 1729 |
| 379 | Ga0075370_10033371 | 3300006353 | Bacteria | 2882 |
| 380 | Ga0068871_100000575 | 3300006358 | Bacteria | 25171 |
| 381 | Ga0068871_100028379 | 3300006358 | Bacteria | 4386 |
| 382 | Ga0068871_100177992 | 3300006358 | Bacteria | 1826 |
| 383 | Ga0075428_100008481 | 3300006844 | Bacteria | 11403 |
| 384 | Ga0075428_100089794 | 3300006844 | Bacteria | 3351 |
| 385 | Ga0075428_100111243 | 3300006844 | Bacteria | 2984 |
| 386 | Ga0075430_100000012 | 3300006846 | Bacteria | 94359 |
| 387 | Ga0075430_100000778 | 3300006846 | Bacteria | 24663 |
| 388 | Ga0075431_100003622 | 3300006847 | Bacteria | 14964 |
| 389 | Ga0075433_10005842 | 3300006852 | Bacteria | 9692 |
| 390 | Ga0075433_10009181 | 3300006852 | Bacteria | 7902 |
| 391 | Ga0075434_100000114 | 3300006871 | Bacteria | 46406 |
| 392 | Ga0075434_100010989 | 3300006871 | Bacteria | 8515 |
| 393 | Ga0075429_100002694 | 3300006880 | Bacteria | 14964 |
| 394 | Ga0068865_100000654 | 3300006881 | Bacteria | 19602 |
| 395 | Ga0068865_100020024 | 3300006881 | Bacteria | 4337 |
| 396 | Ga0068865_100051878 | 3300006881 | Bacteria | 2840 |
| 397 | Ga0068865_100106538 | 3300006881 | Bacteria | 2061 |
| 398 | Ga0068865_100107012 | 3300006881 | Bacteria | 2056 |
| 399 | Ga0075436_100013589 | 3300006914 | Bacteria | 5576 |
| 400 | Ga0097620_100010201 | 3300006931 | Bacteria | 9455 |
| 401 | Ga0097620_100030056 | 3300006931 | Bacteria | 5452 |
| 402 | Ga0099825_1018997 | 3300006941 | Bacteria | 5214 |
| 403 | Ga0099822_1000022 | 3300006943 | Bacteria | 64942 |
| 404 | Ga0099823_1027652 | 3300006944 | Bacteria | 4931 |
| 405 | Ga0079104_1001253 | 3300006946 | Bacteria | 17716 |
| 406 | Ga0099826_10001254 | 3300006948 | Bacteria | 14871 |
| 407 | Ga0075435_100021841 | 3300007076 | Bacteria | 4931 |
| 408 | Ga0075435_100041943 | 3300007076 | Bacteria | 3659 |
| 409 | Ga0075435_100113929 | 3300007076 | Bacteria | 2251 |
| 410 | Ga0105251_10015950 | 3300009011 | Bacteria | 4083 |
| 411 | Ga0105244_10022702 | 3300009036 | Bacteria | 3450 |
| 412 | Ga0105250_10005564 | 3300009092 | Bacteria | 5634 |
| 413 | Ga0105250_10020816 | 3300009092 | Bacteria | 2649 |
| 414 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 415 | Ga0105240_10017201 | 3300009093 | Bacteria | 9755 |
| 416 | Ga0105240_10022325 | 3300009093 | Bacteria | 8392 |
| 417 | Ga0105240_10092446 | 3300009093 | Bacteria | 3694 |
| 418 | Ga0105240_10095268 | 3300009093 | Bacteria | 3630 |
| 419 | Ga0111539_10000581 | 3300009094 | Bacteria | 47068 |
| 420 | Ga0111539_10002232 | 3300009094 | Bacteria | 25871 |
| 421 | Ga0111539_10004022 | 3300009094 | Bacteria | 19301 |
| 422 | Ga0111539_10141164 | 3300009094 | Bacteria | 2820 |
| 423 | Ga0105245_10000230 | 3300009098 | Bacteria | 53225 |
| 424 | Ga0105245_10071520 | 3300009098 | Bacteria | 3150 |
| 425 | Ga0105245_10104265 | 3300009098 | Bacteria | 2629 |
| 426 | Ga0105247_10016289 | 3300009101 | Bacteria | 4453 |
| 427 | Ga0105247_10019830 | 3300009101 | Bacteria | 4039 |
| 428 | Ga0105247_10041342 | 3300009101 | Bacteria | 2822 |
| 429 | Ga0114129_10002372 | 3300009147 | Bacteria | 26153 |
| 430 | Ga0114129_10008877 | 3300009147 | Bacteria | 14335 |
| 431 | Ga0114129_10010926 | 3300009147 | Bacteria | 12938 |
| 432 | Ga0114129_10250894 | 3300009147 | Bacteria | 2375 |
| 433 | Ga0105243_10002755 | 3300009148 | Bacteria | 14611 |
| 434 | Ga0105243_10012152 | 3300009148 | Bacteria | 6508 |
| 435 | Ga0105243_10013810 | 3300009148 | Bacteria | 6112 |
| 436 | Ga0105243_10085562 | 3300009148 | Bacteria | 2585 |
| 437 | Ga0105243_10202847 | 3300009148 | Bacteria | 1740 |
| 438 | Ga0105241_10001308 | 3300009174 | Bacteria | 18957 |
| 439 | Ga0105241_10009439 | 3300009174 | Bacteria | 7164 |
| 440 | Ga0105241_10029800 | 3300009174 | Bacteria | 4074 |
| 441 | Ga0105242_10000696 | 3300009176 | Bacteria | 26370 |
| 442 | Ga0105242_10012804 | 3300009176 | Bacteria | 6461 |
| 443 | Ga0105242_10062111 | 3300009176 | Bacteria | 3074 |
| 444 | Ga0105248_10000015 | 3300009177 | Bacteria | 322959 |
| 445 | Ga0105248_10001593 | 3300009177 | Bacteria | 25250 |
| 446 | Ga0105248_10031210 | 3300009177 | Bacteria | 5955 |
| 447 | Ga0105248_10032633 | 3300009177 | Bacteria | 5818 |
| 448 | Ga0105248_10043884 | 3300009177 | Bacteria | 5015 |
| 449 | Ga0105248_10122049 | 3300009177 | Bacteria | 2939 |
| 450 | Ga0105248_10241696 | 3300009177 | Bacteria | 2032 |
| 451 | Ga0105237_10000226 | 3300009545 | Bacteria | 79798 |
| 452 | Ga0105237_10011347 | 3300009545 | Bacteria | 9428 |
| 453 | Ga0105237_10015378 | 3300009545 | Bacteria | 7967 |
| 454 | Ga0105237_10024176 | 3300009545 | Bacteria | 6216 |
| 455 | Ga0105237_10033806 | 3300009545 | Bacteria | 5180 |
| 456 | Ga0105238_10043849 | 3300009551 | Bacteria | 4524 |
| 457 | Ga0105238_10097424 | 3300009551 | Bacteria | 2927 |
| 458 | Ga0105249_10001642 | 3300009553 | Bacteria | 19605 |
| 459 | Ga0105249_10096005 | 3300009553 | Bacteria | 2780 |
| 460 | Ga0105249_10101988 | 3300009553 | Bacteria | 2700 |
| 461 | Ga0105249_10151667 | 3300009553 | Bacteria | 2232 |
| 462 | Ga0123341_1000007 | 3300009765 | Bacteria | 147072 |
| 463 | Ga0123341_1047554 | 3300009765 | Bacteria | 2528 |
| 464 | Ga0123342_1004784 | 3300009766 | Bacteria | 20320 |
| 465 | Ga0099796_10001922 | 3300010159 | Bacteria | 4401 |
| 466 | Ga0105239_10000641 | 3300010375 | Bacteria | 49765 |
| 467 | Ga0105239_10053854 | 3300010375 | Bacteria | 4412 |
| 468 | Ga0105239_10077673 | 3300010375 | Bacteria | 3654 |
| 469 | Ga0105239_10128804 | 3300010375 | Bacteria | 2813 |
| 470 | Ga0105239_10158078 | 3300010375 | Bacteria | 2532 |
| 471 | Ga0105239_10160874 | 3300010375 | Bacteria | 2508 |
| 472 | Ga0105239_10201375 | 3300010375 | Bacteria | 2230 |
| 473 | Ga0105239_10376400 | 3300010375 | Bacteria | 1605 |
| 474 | Ga0105246_10000550 | 3300011119 | Bacteria | 20662 |
| 475 | Ga0105246_10027908 | 3300011119 | Bacteria | 3704 |
| 476 | Ga0105246_10028278 | 3300011119 | Bacteria | 3682 |
| 477 | Ga0105246_10130207 | 3300011119 | Bacteria | 1878 |
| 478 | Ga0157373_10011236 | 3300013100 | Bacteria | 6588 |
| 479 | Ga0157373_10051657 | 3300013100 | Bacteria | 2927 |
| 480 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 481 | Ga0157371_10004510 | 3300013102 | Bacteria | 12131 |
| 482 | Ga0157371_10054681 | 3300013102 | Bacteria | 2834 |
| 483 | Ga0157370_10000455 | 3300013104 | Bacteria | 51231 |
| 484 | Ga0157370_10000461 | 3300013104 | Bacteria | 50850 |
| 485 | Ga0157370_10044331 | 3300013104 | Bacteria | 4276 |
| 486 | Ga0157370_10071190 | 3300013104 | Bacteria | 3281 |
| 487 | Ga0157370_10110355 | 3300013104 | Bacteria | 2572 |
| 488 | Ga0157369_10186475 | 3300013105 | Bacteria | 2181 |
| 489 | Ga0171462_1066 | 3300013250 | Bacteria | 14419 |
| 490 | Ga0157374_10016190 | 3300013296 | Bacteria | 6551 |
| 491 | Ga0157374_10032938 | 3300013296 | Bacteria | 4723 |
| 492 | Ga0157374_10036846 | 3300013296 | Bacteria | 4483 |
| 493 | Ga0157374_10220423 | 3300013296 | Bacteria | 1861 |
| 494 | Ga0157378_10000864 | 3300013297 | Bacteria | 28028 |
| 495 | Ga0157378_10034605 | 3300013297 | Bacteria | 4467 |
| 496 | Ga0163162_10000420 | 3300013306 | Bacteria | 39042 |
| 497 | Ga0163162_10016129 | 3300013306 | Bacteria | 7303 |
| 498 | Ga0163162_10072401 | 3300013306 | Bacteria | 3501 |
| 499 | Ga0163162_10253519 | 3300013306 | Bacteria | 1891 |
| 500 | Ga0157372_10011691 | 3300013307 | Bacteria | 9347 |
| 501 | Ga0157372_10024037 | 3300013307 | Bacteria | 6611 |
| 502 | Ga0157372_10271572 | 3300013307 | Bacteria | 1971 |
| 503 | Ga0157375_10001626 | 3300013308 | Bacteria | 19334 |
| 504 | Ga0157375_10025283 | 3300013308 | Bacteria | 5514 |
| 505 | Ga0157375_10037694 | 3300013308 | Bacteria | 4634 |
| 506 | Ga0163163_10067324 | 3300014325 | Bacteria | 3561 |
| 507 | Ga0163163_10206841 | 3300014325 | Bacteria | 2011 |
| 508 | Ga0157380_10000511 | 3300014326 | Bacteria | 23725 |
| 509 | Ga0157377_10000053 | 3300014745 | Bacteria | 89091 |
| 510 | Ga0157377_10046260 | 3300014745 | Bacteria | 2433 |
| 511 | Ga0157377_10058121 | 3300014745 | Bacteria | 2201 |
| 512 | Ga0157379_10001333 | 3300014968 | Bacteria | 20150 |
| 513 | Ga0157379_10016704 | 3300014968 | Bacteria | 6457 |
| 514 | Ga0157379_10094343 | 3300014968 | Bacteria | 2685 |
| 515 | Ga0157379_10169012 | 3300014968 | Bacteria | 1974 |
| 516 | Ga0157376_10000436 | 3300014969 | Bacteria | 26857 |
| 517 | Ga0157376_10114255 | 3300014969 | Bacteria | 2382 |
| 518 | Ga0182007_10001815 | 3300015262 | Bacteria | 11146 |
| 519 | Ga0182005_1005015 | 3300015265 | Bacteria | 4184 |
| 520 | Ga0163161_10001352 | 3300017792 | Bacteria | 18231 |
| 521 | Ga0163161_10007604 | 3300017792 | Bacteria | 7495 |
| 522 | Ga0163161_10023487 | 3300017792 | Bacteria | 4350 |
| 523 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 524 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 525 | Ga0214542_1024229 | 3300021321 | Bacteria | 3439 |
| 526 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 527 | Ga0214545_1023657 | 3300021324 | Bacteria | 3986 |
| 528 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 529 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 530 | Ga0214543_1000038 | 3300021327 | Bacteria | 182106 |
| 531 | Ga0214543_1026030 | 3300021327 | Bacteria | 3240 |
| 532 | Ga0213873_10011292 | 3300021358 | Bacteria | 1907 |
| 533 | Ga0213874_10007096 | 3300021377 | Bacteria | 2677 |
| 534 | Ga0213876_10021408 | 3300021384 | Bacteria | 3419 |
| 535 | Ga0213875_10002982 | 3300021388 | Bacteria | 9856 |
| 536 | Ga0213875_10008179 | 3300021388 | Bacteria | 5367 |
| 537 | Ga0228711_1000008 | 3300022739 | Bacteria | 169893 |
| 538 | Ga0228710_1000009 | 3300022740 | Bacteria | 169770 |
| 539 | Ga0224572_1001441 | 3300024225 | Bacteria | 3522 |
| 540 | Ga0228598_1001219 | 3300024227 | Bacteria | 5682 |
| 541 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 542 | Ga0209436_100150 | 3300025208 | Bacteria | 33510 |
| 543 | Ga0209563_103061 | 3300025230 | Bacteria | 3567 |
| 544 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 545 | Ga0209437_100098 | 3300025233 | Bacteria | 229766 |
| 546 | Ga0207425_1000075 | 3300025245 | Bacteria | 107452 |
| 547 | Ga0207425_1001337 | 3300025245 | Bacteria | 10584 |
| 548 | Ga0207425_1004121 | 3300025245 | Bacteria | 4441 |
| 549 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 550 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 551 | Ga0209677_101595 | 3300025253 | Bacteria | 9567 |
| 552 | Ga0209677_102022 | 3300025253 | Bacteria | 8058 |
| 553 | Ga0209148_1000424 | 3300025254 | Bacteria | 47087 |
| 554 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 555 | Ga0209129_1000156 | 3300025258 | Bacteria | 107484 |
| 556 | Ga0209129_1000524 | 3300025258 | Bacteria | 26835 |
| 557 | Ga0209129_1000903 | 3300025258 | Bacteria | 18159 |
| 558 | Ga0209129_1001820 | 3300025258 | Bacteria | 11302 |
| 559 | Ga0209129_1001868 | 3300025258 | Bacteria | 11120 |
| 560 | Ga0209129_1002344 | 3300025258 | Bacteria | 9373 |
| 561 | Ga0209129_1004509 | 3300025258 | Bacteria | 5399 |
| 562 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 563 | Ga0209233_1000113 | 3300025261 | Bacteria | 253455 |
| 564 | Ga0209233_1000427 | 3300025261 | Bacteria | 30799 |
| 565 | Ga0209233_1001485 | 3300025261 | Bacteria | 9233 |
| 566 | Ga0209233_1002935 | 3300025261 | Bacteria | 6096 |
| 567 | Ga0209233_1004610 | 3300025261 | Bacteria | 4661 |
| 568 | Ga0209233_1006596 | 3300025261 | Bacteria | 3730 |
| 569 | Ga0207666_1000348 | 3300025271 | Bacteria | 6343 |
| 570 | Ga0209455_1003259 | 3300025272 | Bacteria | 5843 |
| 571 | Ga0209455_1003833 | 3300025272 | Bacteria | 5147 |
| 572 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 573 | Ga0209673_1000117 | 3300025273 | Bacteria | 172081 |
| 574 | Ga0209673_1000151 | 3300025273 | Bacteria | 148103 |
| 575 | Ga0209673_1000863 | 3300025273 | Bacteria | 39346 |
| 576 | Ga0209673_1001685 | 3300025273 | Bacteria | 18869 |
| 577 | Ga0209673_1002134 | 3300025273 | Bacteria | 14747 |
| 578 | Ga0209673_1026911 | 3300025273 | Bacteria | 1880 |
| 579 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 580 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 581 | Ga0209130_1000178 | 3300025284 | Bacteria | 90293 |
| 582 | Ga0209130_1010600 | 3300025284 | Bacteria | 2524 |
| 583 | Ga0207673_1000043 | 3300025290 | Bacteria | 9962 |
| 584 | Ga0209675_1001344 | 3300025291 | Bacteria | 14518 |
| 585 | Ga0209675_1011031 | 3300025291 | Bacteria | 3030 |
| 586 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 587 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 588 | Ga0209025_1000140 | 3300025294 | Bacteria | 184765 |
| 589 | Ga0209025_1000506 | 3300025294 | Bacteria | 74798 |
| 590 | Ga0209025_1001869 | 3300025294 | Bacteria | 24674 |
| 591 | Ga0209025_1003183 | 3300025294 | Bacteria | 15930 |
| 592 | Ga0209025_1005402 | 3300025294 | Bacteria | 10443 |
| 593 | Ga0209025_1010282 | 3300025294 | Bacteria | 6361 |
| 594 | Ga0209025_1028383 | 3300025294 | Bacteria | 2744 |
| 595 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 596 | Ga0209564_1000065 | 3300025295 | Bacteria | 315205 |
| 597 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 598 | Ga0209564_1000647 | 3300025295 | Bacteria | 52658 |
| 599 | Ga0209564_1001780 | 3300025295 | Bacteria | 19956 |
| 600 | Ga0209564_1001993 | 3300025295 | Bacteria | 17874 |
| 601 | Ga0209564_1006799 | 3300025295 | Bacteria | 6048 |
| 602 | Ga0209564_1009159 | 3300025295 | Bacteria | 4759 |
| 603 | Ga0209564_1012956 | 3300025295 | Bacteria | 3586 |
| 604 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 605 | Ga0209758_1000186 | 3300025297 | Bacteria | 138804 |
| 606 | Ga0209758_1000655 | 3300025297 | Bacteria | 52188 |
| 607 | Ga0209758_1000758 | 3300025297 | Bacteria | 46817 |
| 608 | Ga0209758_1001882 | 3300025297 | Bacteria | 22974 |
| 609 | Ga0209758_1002154 | 3300025297 | Bacteria | 20718 |
| 610 | Ga0209758_1002420 | 3300025297 | Bacteria | 19114 |
| 611 | Ga0209758_1003547 | 3300025297 | Bacteria | 14035 |
| 612 | Ga0209758_1005684 | 3300025297 | Bacteria | 9427 |
| 613 | Ga0209758_1006158 | 3300025297 | Bacteria | 8788 |
| 614 | Ga0209758_1006453 | 3300025297 | Bacteria | 8414 |
| 615 | Ga0209758_1021515 | 3300025297 | Bacteria | 3003 |
| 616 | Ga0209050_1005467 | 3300025298 | Bacteria | 7967 |
| 617 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 618 | Ga0209256_1000208 | 3300025299 | Bacteria | 110551 |
| 619 | Ga0209256_1001653 | 3300025299 | Bacteria | 21690 |
| 620 | Ga0209256_1001736 | 3300025299 | Bacteria | 20844 |
| 621 | Ga0209256_1002712 | 3300025299 | Bacteria | 13781 |
| 622 | Ga0209256_1003882 | 3300025299 | Bacteria | 9914 |
| 623 | Ga0209256_1012913 | 3300025299 | Bacteria | 3144 |
| 624 | Ga0209256_1023617 | 3300025299 | Bacteria | 1829 |
| 625 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 626 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 627 | Ga0207426_1000221 | 3300025302 | Bacteria | 134756 |
| 628 | Ga0207426_1000425 | 3300025302 | Bacteria | 69088 |
| 629 | Ga0207426_1000869 | 3300025302 | Bacteria | 31530 |
| 630 | Ga0207426_1003443 | 3300025302 | Bacteria | 8598 |
| 631 | Ga0207426_1004449 | 3300025302 | Bacteria | 6833 |
| 632 | Ga0207426_1027642 | 3300025302 | Bacteria | 1888 |
| 633 | Ga0209051_1000097 | 3300025303 | Bacteria | 167378 |
| 634 | Ga0209051_1004880 | 3300025303 | Bacteria | 8039 |
| 635 | Ga0209051_1008689 | 3300025303 | Bacteria | 5347 |
| 636 | Ga0209257_1000426 | 3300025304 | Bacteria | 81095 |
| 637 | Ga0209257_1001142 | 3300025304 | Bacteria | 33931 |
| 638 | Ga0209257_1018731 | 3300025304 | Bacteria | 2644 |
| 639 | Ga0207697_10000672 | 3300025315 | Bacteria | 19436 |
| 640 | Ga0207697_10019395 | 3300025315 | Bacteria | 2785 |
| 641 | Ga0207696_1024092 | 3300025711 | Bacteria | 1911 |
| 642 | Ga0207653_10000963 | 3300025885 | Bacteria | 9488 |
| 643 | Ga0207653_10042695 | 3300025885 | Bacteria | 1492 |
| 644 | Ga0207682_10000154 | 3300025893 | Bacteria | 31265 |
| 645 | Ga0207692_10000468 | 3300025898 | Bacteria | 14298 |
| 646 | Ga0207692_10001055 | 3300025898 | Bacteria | 10067 |
| 647 | Ga0207692_10003318 | 3300025898 | Bacteria | 6272 |
| 648 | Ga0207692_10005603 | 3300025898 | Bacteria | 5039 |
| 649 | Ga0207692_10009587 | 3300025898 | Bacteria | 4051 |
| 650 | Ga0207692_10040569 | 3300025898 | Bacteria | 2298 |
| 651 | Ga0207642_10002038 | 3300025899 | Bacteria | 6231 |
| 652 | Ga0207642_10006639 | 3300025899 | Bacteria | 3859 |
| 653 | Ga0207642_10012667 | 3300025899 | Bacteria | 3052 |
| 654 | Ga0207710_10001145 | 3300025900 | Bacteria | 13506 |
| 655 | Ga0207710_10012463 | 3300025900 | Bacteria | 3578 |
| 656 | Ga0207710_10035140 | 3300025900 | Bacteria | 2205 |
| 657 | Ga0207688_10000817 | 3300025901 | Bacteria | 15595 |
| 658 | Ga0207688_10003295 | 3300025901 | Bacteria | 8818 |
| 659 | Ga0207688_10045412 | 3300025901 | Bacteria | 2451 |
| 660 | Ga0207688_10070420 | 3300025901 | Bacteria | 1983 |
| 661 | Ga0207688_10077050 | 3300025901 | Bacteria | 1899 |
| 662 | Ga0207680_10014997 | 3300025903 | Bacteria | 4033 |
| 663 | Ga0207647_10005421 | 3300025904 | Bacteria | 9350 |
| 664 | Ga0207647_10067916 | 3300025904 | Bacteria | 2159 |
| 665 | Ga0207699_10000390 | 3300025906 | Bacteria | 22928 |
| 666 | Ga0207699_10004930 | 3300025906 | Bacteria | 6389 |
| 667 | Ga0207699_10008578 | 3300025906 | Bacteria | 5052 |
| 668 | Ga0207699_10012034 | 3300025906 | Bacteria | 4390 |
| 669 | Ga0207699_10031512 | 3300025906 | Bacteria | 2977 |
| 670 | Ga0207699_10042253 | 3300025906 | Bacteria | 2639 |
| 671 | Ga0207699_10074694 | 3300025906 | Bacteria | 2083 |
| 672 | Ga0207645_10000182 | 3300025907 | Bacteria | 50129 |
| 673 | Ga0207645_10011610 | 3300025907 | Bacteria | 6008 |
| 674 | Ga0207645_10027683 | 3300025907 | Bacteria | 3659 |
| 675 | Ga0207645_10107850 | 3300025907 | Bacteria | 1801 |
| 676 | Ga0207643_10000405 | 3300025908 | Bacteria | 28698 |
| 677 | Ga0207643_10000416 | 3300025908 | Bacteria | 28107 |
| 678 | Ga0207705_10065686 | 3300025909 | Bacteria | 2623 |
| 679 | Ga0207684_10089462 | 3300025910 | Bacteria | 2623 |
| 680 | Ga0207654_10000323 | 3300025911 | Bacteria | 28628 |
| 681 | Ga0207654_10000889 | 3300025911 | Bacteria | 16573 |
| 682 | Ga0207654_10054127 | 3300025911 | Bacteria | 2319 |
| 683 | Ga0207654_10143963 | 3300025911 | Bacteria | 1523 |
| 684 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 685 | Ga0207707_10001762 | 3300025912 | Bacteria | 19871 |
| 686 | Ga0207707_10003772 | 3300025912 | Bacteria | 13432 |
| 687 | Ga0207707_10006911 | 3300025912 | Bacteria | 9901 |
| 688 | Ga0207707_10030844 | 3300025912 | Bacteria | 4690 |
| 689 | Ga0207707_10151946 | 3300025912 | Bacteria | 2024 |
| 690 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 691 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 692 | Ga0207695_10000497 | 3300025913 | Bacteria | 83894 |
| 693 | Ga0207695_10085113 | 3300025913 | Bacteria | 3191 |
| 694 | Ga0207695_10088253 | 3300025913 | Bacteria | 3122 |
| 695 | Ga0207695_10106889 | 3300025913 | Bacteria | 2784 |
| 696 | Ga0207695_10264854 | 3300025913 | Bacteria | 1615 |
| 697 | Ga0207671_10000093 | 3300025914 | Bacteria | 138939 |
| 698 | Ga0207671_10004982 | 3300025914 | Bacteria | 12436 |
| 699 | Ga0207671_10009091 | 3300025914 | Bacteria | 8349 |
| 700 | Ga0207671_10011831 | 3300025914 | Bacteria | 7061 |
| 701 | Ga0207693_10000842 | 3300025915 | Bacteria | 27312 |
| 702 | Ga0207693_10003503 | 3300025915 | Bacteria | 13399 |
| 703 | Ga0207693_10004344 | 3300025915 | Bacteria | 11994 |
| 704 | Ga0207693_10005530 | 3300025915 | Bacteria | 10516 |
| 705 | Ga0207693_10007487 | 3300025915 | Bacteria | 8977 |
| 706 | Ga0207693_10007572 | 3300025915 | Bacteria | 8922 |
| 707 | Ga0207693_10013345 | 3300025915 | Bacteria | 6623 |
| 708 | Ga0207693_10018008 | 3300025915 | Bacteria | 5629 |
| 709 | Ga0207693_10019662 | 3300025915 | Bacteria | 5371 |
| 710 | Ga0207693_10027789 | 3300025915 | Bacteria | 4471 |
| 711 | Ga0207693_10039213 | 3300025915 | Bacteria | 3730 |
| 712 | Ga0207693_10098850 | 3300025915 | Bacteria | 2288 |
| 713 | Ga0207663_10001979 | 3300025916 | Bacteria | 9717 |
| 714 | Ga0207663_10006434 | 3300025916 | Bacteria | 6008 |
| 715 | Ga0207663_10006811 | 3300025916 | Bacteria | 5884 |
| 716 | Ga0207663_10014546 | 3300025916 | Bacteria | 4312 |
| 717 | Ga0207660_10000007 | 3300025917 | Bacteria | 102878 |
| 718 | Ga0207660_10014180 | 3300025917 | Bacteria | 5233 |
| 719 | Ga0207660_10078989 | 3300025917 | Bacteria | 2413 |
| 720 | Ga0207660_10129943 | 3300025917 | Bacteria | 1916 |
| 721 | Ga0207662_10009169 | 3300025918 | Bacteria | 5439 |
| 722 | Ga0207662_10117357 | 3300025918 | Bacteria | 1665 |
| 723 | Ga0207657_10002910 | 3300025919 | Bacteria | 18383 |
| 724 | Ga0207657_10010114 | 3300025919 | Bacteria | 9429 |
| 725 | Ga0207657_10022087 | 3300025919 | Bacteria | 5972 |
| 726 | Ga0207657_10023020 | 3300025919 | Bacteria | 5812 |
| 727 | Ga0207657_10029030 | 3300025919 | Bacteria | 5040 |
| 728 | Ga0207657_10088502 | 3300025919 | Bacteria | 2588 |
| 729 | Ga0207649_10000305 | 3300025920 | Bacteria | 37712 |
| 730 | Ga0207649_10083213 | 3300025920 | Bacteria | 2077 |
| 731 | Ga0207652_10000459 | 3300025921 | Bacteria | 42058 |
| 732 | Ga0207652_10055858 | 3300025921 | Bacteria | 3397 |
| 733 | Ga0207652_10057241 | 3300025921 | Bacteria | 3357 |
| 734 | Ga0207652_10074104 | 3300025921 | Bacteria | 2963 |
| 735 | Ga0207652_10176007 | 3300025921 | Bacteria | 1921 |
| 736 | Ga0207681_10000116 | 3300025923 | Bacteria | 67094 |
| 737 | Ga0207681_10063702 | 3300025923 | Bacteria | 2543 |
| 738 | Ga0207681_10093833 | 3300025923 | Bacteria | 2149 |
| 739 | Ga0207694_10000212 | 3300025924 | Bacteria | 56506 |
| 740 | Ga0207694_10020078 | 3300025924 | Bacteria | 5053 |
| 741 | Ga0207694_10117303 | 3300025924 | Bacteria | 2122 |
| 742 | Ga0207650_10004276 | 3300025925 | Bacteria | 9744 |
| 743 | Ga0207650_10004547 | 3300025925 | Bacteria | 9488 |
| 744 | Ga0207650_10009331 | 3300025925 | Bacteria | 6705 |
| 745 | Ga0207650_10063498 | 3300025925 | Bacteria | 2761 |
| 746 | Ga0207650_10068276 | 3300025925 | Bacteria | 2669 |
| 747 | Ga0207650_10079346 | 3300025925 | Bacteria | 2486 |
| 748 | Ga0207659_10000015 | 3300025926 | Bacteria | 168475 |
| 749 | Ga0207659_10045278 | 3300025926 | Bacteria | 3101 |
| 750 | Ga0207659_10156748 | 3300025926 | Bacteria | 1784 |
| 751 | Ga0207687_10000357 | 3300025927 | Bacteria | 30477 |
| 752 | Ga0207687_10004506 | 3300025927 | Bacteria | 9269 |
| 753 | Ga0207687_10016432 | 3300025927 | Bacteria | 4862 |
| 754 | Ga0207687_10087510 | 3300025927 | Bacteria | 2264 |
| 755 | Ga0207700_10001137 | 3300025928 | Bacteria | 15268 |
| 756 | Ga0207700_10031891 | 3300025928 | Bacteria | 3750 |
| 757 | Ga0207700_10037199 | 3300025928 | Bacteria | 3523 |
| 758 | Ga0207700_10038868 | 3300025928 | Bacteria | 3458 |
| 759 | Ga0207700_10051582 | 3300025928 | Bacteria | 3071 |
| 760 | Ga0207700_10073940 | 3300025928 | Bacteria | 2634 |
| 761 | Ga0207700_10096958 | 3300025928 | Bacteria | 2343 |
| 762 | Ga0207700_10124373 | 3300025928 | Bacteria | 2096 |
| 763 | Ga0207664_10007701 | 3300025929 | Bacteria | 7474 |
| 764 | Ga0207664_10017466 | 3300025929 | Bacteria | 5261 |
| 765 | Ga0207664_10033246 | 3300025929 | Bacteria | 3961 |
| 766 | Ga0207664_10036057 | 3300025929 | Bacteria | 3821 |
| 767 | Ga0207664_10038518 | 3300025929 | Bacteria | 3708 |
| 768 | Ga0207664_10134816 | 3300025929 | Bacteria | 2083 |
| 769 | Ga0207644_10000251 | 3300025931 | Bacteria | 36497 |
| 770 | Ga0207644_10002852 | 3300025931 | Bacteria | 11143 |
| 771 | Ga0207644_10005542 | 3300025931 | Bacteria | 8213 |
| 772 | Ga0207644_10005898 | 3300025931 | Bacteria | 7989 |
| 773 | Ga0207644_10041109 | 3300025931 | Bacteria | 3269 |
| 774 | Ga0207690_10000320 | 3300025932 | Bacteria | 32219 |
| 775 | Ga0207690_10083028 | 3300025932 | Bacteria | 2242 |
| 776 | Ga0207690_10095950 | 3300025932 | Bacteria | 2107 |
| 777 | Ga0207690_10133314 | 3300025932 | Bacteria | 1821 |
| 778 | Ga0207706_10002583 | 3300025933 | Bacteria | 17644 |
| 779 | Ga0207706_10003309 | 3300025933 | Bacteria | 15434 |
| 780 | Ga0207706_10012590 | 3300025933 | Bacteria | 7701 |
| 781 | Ga0207706_10020107 | 3300025933 | Bacteria | 6000 |
| 782 | Ga0207706_10023317 | 3300025933 | Bacteria | 5559 |
| 783 | Ga0207706_10088609 | 3300025933 | Bacteria | 2720 |
| 784 | Ga0207686_10000234 | 3300025934 | Bacteria | 42207 |
| 785 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 786 | Ga0207709_10046601 | 3300025935 | Bacteria | 2632 |
| 787 | Ga0207670_10000620 | 3300025936 | Bacteria | 19095 |
| 788 | Ga0207670_10000760 | 3300025936 | Bacteria | 16979 |
| 789 | Ga0207670_10006459 | 3300025936 | Bacteria | 6503 |
| 790 | Ga0207670_10008745 | 3300025936 | Bacteria | 5734 |
| 791 | Ga0207669_10000008 | 3300025937 | Bacteria | 168213 |
| 792 | Ga0207669_10004053 | 3300025937 | Bacteria | 6414 |
| 793 | Ga0207704_10000215 | 3300025938 | Bacteria | 28899 |
| 794 | Ga0207704_10058982 | 3300025938 | Bacteria | 2367 |
| 795 | Ga0207704_10066628 | 3300025938 | Bacteria | 2261 |
| 796 | Ga0207704_10125936 | 3300025938 | Bacteria | 1764 |
| 797 | Ga0207665_10000361 | 3300025939 | Bacteria | 31561 |
| 798 | Ga0207665_10001484 | 3300025939 | Bacteria | 15767 |
| 799 | Ga0207665_10045676 | 3300025939 | Bacteria | 2933 |
| 800 | Ga0207691_10000482 | 3300025940 | Bacteria | 39467 |
| 801 | Ga0207691_10002588 | 3300025940 | Bacteria | 17682 |
| 802 | Ga0207691_10040950 | 3300025940 | Bacteria | 4279 |
| 803 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 804 | Ga0207711_10000005 | 3300025941 | Bacteria | 822972 |
| 805 | Ga0207711_10000009 | 3300025941 | Bacteria | 580864 |
| 806 | Ga0207711_10012426 | 3300025941 | Bacteria | 7078 |
| 807 | Ga0207711_10040725 | 3300025941 | Bacteria | 3953 |
| 808 | Ga0207711_10062352 | 3300025941 | Bacteria | 3216 |
| 809 | Ga0207711_10062950 | 3300025941 | Bacteria | 3201 |
| 810 | Ga0207711_10070788 | 3300025941 | Bacteria | 3025 |
| 811 | Ga0207711_10082864 | 3300025941 | Bacteria | 2804 |
| 812 | Ga0207711_10100986 | 3300025941 | Bacteria | 2552 |
| 813 | Ga0207689_10000749 | 3300025942 | Bacteria | 31134 |
| 814 | Ga0207661_10000170 | 3300025944 | Bacteria | 41868 |
| 815 | Ga0207661_10004270 | 3300025944 | Bacteria | 10004 |
| 816 | Ga0207661_10032345 | 3300025944 | Bacteria | 4051 |
| 817 | Ga0207661_10089875 | 3300025944 | Bacteria | 2556 |
| 818 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 819 | Ga0207679_10010295 | 3300025945 | Bacteria | 6017 |
| 820 | Ga0207667_10007538 | 3300025949 | Bacteria | 13058 |
| 821 | Ga0207667_10010820 | 3300025949 | Bacteria | 10639 |
| 822 | Ga0207667_10020500 | 3300025949 | Bacteria | 7349 |
| 823 | Ga0207667_10038259 | 3300025949 | Bacteria | 5125 |
| 824 | Ga0207651_10000200 | 3300025960 | Bacteria | 26185 |
| 825 | Ga0207651_10051209 | 3300025960 | Bacteria | 2808 |
| 826 | Ga0207651_10059710 | 3300025960 | Bacteria | 2643 |
| 827 | Ga0207651_10111193 | 3300025960 | Bacteria | 2057 |
| 828 | Ga0207712_10000495 | 3300025961 | Bacteria | 32538 |
| 829 | Ga0207712_10087561 | 3300025961 | Bacteria | 2284 |
| 830 | Ga0207712_10088828 | 3300025961 | Bacteria | 2271 |
| 831 | Ga0207712_10149277 | 3300025961 | Bacteria | 1804 |
| 832 | Ga0207668_10000133 | 3300025972 | Bacteria | 52202 |
| 833 | Ga0207668_10084712 | 3300025972 | Bacteria | 2310 |
| 834 | Ga0207668_10103475 | 3300025972 | Bacteria | 2120 |
| 835 | Ga0207640_10000191 | 3300025981 | Bacteria | 43590 |
| 836 | Ga0207640_10016944 | 3300025981 | Bacteria | 4251 |
| 837 | Ga0207640_10042013 | 3300025981 | Bacteria | 2912 |
| 838 | Ga0207640_10058017 | 3300025981 | Bacteria | 2549 |
| 839 | Ga0207658_10000535 | 3300025986 | Bacteria | 34617 |
| 840 | Ga0207658_10059229 | 3300025986 | Bacteria | 2853 |
| 841 | Ga0207658_10144152 | 3300025986 | Bacteria | 1932 |
| 842 | Ga0207677_10000806 | 3300026023 | Bacteria | 17984 |
| 843 | Ga0207677_10075864 | 3300026023 | Bacteria | 2391 |
| 844 | Ga0207703_10001617 | 3300026035 | Bacteria | 20325 |
| 845 | Ga0207703_10003074 | 3300026035 | Bacteria | 14117 |
| 846 | Ga0207703_10012070 | 3300026035 | Bacteria | 6731 |
| 847 | Ga0207703_10097783 | 3300026035 | Bacteria | 2481 |
| 848 | Ga0207639_10002809 | 3300026041 | Bacteria | 11682 |
| 849 | Ga0207639_10009638 | 3300026041 | Bacteria | 6672 |
| 850 | Ga0207639_10009726 | 3300026041 | Bacteria | 6640 |
| 851 | Ga0207639_10010472 | 3300026041 | Bacteria | 6423 |
| 852 | Ga0207639_10019773 | 3300026041 | Bacteria | 4809 |
| 853 | Ga0207639_10237420 | 3300026041 | Bacteria | 1583 |
| 854 | Ga0207678_10001859 | 3300026067 | Bacteria | 19293 |
| 855 | Ga0207678_10016738 | 3300026067 | Bacteria | 6439 |
| 856 | Ga0207678_10054411 | 3300026067 | Bacteria | 3447 |
| 857 | Ga0207678_10109849 | 3300026067 | Bacteria | 2352 |
| 858 | Ga0207708_10001031 | 3300026075 | Bacteria | 20855 |
| 859 | Ga0207708_10018880 | 3300026075 | Bacteria | 5194 |
| 860 | Ga0207708_10019057 | 3300026075 | Bacteria | 5167 |
| 861 | Ga0207708_10104329 | 3300026075 | Bacteria | 2196 |
| 862 | Ga0207708_10150977 | 3300026075 | Bacteria | 1829 |
| 863 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 864 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 865 | Ga0207702_10003065 | 3300026078 | Bacteria | 15534 |
| 866 | Ga0207641_10000593 | 3300026088 | Bacteria | 39825 |
| 867 | Ga0207641_10019300 | 3300026088 | Bacteria | 5594 |
| 868 | Ga0207648_10002417 | 3300026089 | Bacteria | 20105 |
| 869 | Ga0207648_10013629 | 3300026089 | Bacteria | 7547 |
| 870 | Ga0207676_10009283 | 3300026095 | Bacteria | 6997 |
| 871 | Ga0207676_10011206 | 3300026095 | Bacteria | 6403 |
| 872 | Ga0207676_10011983 | 3300026095 | Bacteria | 6205 |
| 873 | Ga0207674_10003381 | 3300026116 | Bacteria | 19581 |
| 874 | Ga0207674_10004756 | 3300026116 | Bacteria | 16280 |
| 875 | Ga0207674_10026464 | 3300026116 | Bacteria | 6159 |
| 876 | Ga0207674_10031482 | 3300026116 | Bacteria | 5573 |
| 877 | Ga0207674_10165937 | 3300026116 | Bacteria | 2162 |
| 878 | Ga0207675_100002182 | 3300026118 | Bacteria | 19438 |
| 879 | Ga0207675_100029789 | 3300026118 | Bacteria | 5082 |
| 880 | Ga0207675_100033143 | 3300026118 | Bacteria | 4813 |
| 881 | Ga0207675_100038306 | 3300026118 | Bacteria | 4474 |
| 882 | Ga0207683_10000002 | 3300026121 | Bacteria | 258441 |
| 883 | Ga0207683_10006919 | 3300026121 | Bacteria | 9710 |
| 884 | Ga0207683_10041959 | 3300026121 | Bacteria | 3996 |
| 885 | Ga0207683_10042740 | 3300026121 | Bacteria | 3959 |
| 886 | Ga0207683_10072340 | 3300026121 | Bacteria | 3049 |
| 887 | Ga0207698_10000545 | 3300026142 | Bacteria | 21874 |
| 888 | Ga0207698_10004110 | 3300026142 | Bacteria | 8839 |
| 889 | Ga0207698_10021924 | 3300026142 | Bacteria | 4427 |
| 890 | Ga0207698_10054008 | 3300026142 | Bacteria | 3088 |
| 891 | Ga0207698_10214656 | 3300026142 | Bacteria | 1734 |
| 892 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 893 | Ga0209281_1000318 | 3300027111 | Bacteria | 85039 |
| 894 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 895 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 896 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 897 | Ga0209371_1001019 | 3300027312 | Bacteria | 21271 |
| 898 | Ga0209371_1004133 | 3300027312 | Bacteria | 6511 |
| 899 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 900 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 901 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 902 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 903 | Ga0209489_100295 | 3300027361 | Bacteria | 87273 |
| 904 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 905 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 906 | Ga0209179_1002939 | 3300027512 | Bacteria | 2382 |
| 907 | Ga0209282_1000024 | 3300027666 | Bacteria | 170348 |
| 908 | Ga0209282_1000531 | 3300027666 | Bacteria | 18489 |
| 909 | Ga0209966_1000800 | 3300027695 | Bacteria | 6283 |
| 910 | Ga0209966_1004060 | 3300027695 | Bacteria | 2472 |
| 911 | Ga0209998_10015195 | 3300027717 | Bacteria | 1610 |
| 912 | Ga0209813_10002584 | 3300027866 | Bacteria | 4157 |
| 913 | Ga0209813_10032067 | 3300027866 | Bacteria | 1555 |
| 914 | Ga0209974_10000944 | 3300027876 | Bacteria | 10160 |
| 915 | Ga0209974_10009960 | 3300027876 | Bacteria | 3215 |
| 916 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 917 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 918 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 919 | Ga0207428_10001276 | 3300027907 | Bacteria | 26949 |
| 920 | Ga0207428_10032257 | 3300027907 | Bacteria | 4310 |
| 921 | Ga0268266_10004900 | 3300028379 | Bacteria | 12695 |
| 922 | Ga0268266_10006027 | 3300028379 | Bacteria | 11179 |
| 923 | Ga0268266_10008843 | 3300028379 | Bacteria | 8918 |
| 924 | Ga0268266_10013893 | 3300028379 | Bacteria | 6934 |
| 925 | Ga0268266_10019605 | 3300028379 | Bacteria | 5762 |
| 926 | Ga0268266_10039703 | 3300028379 | Bacteria | 4009 |
| 927 | Ga0268266_10124277 | 3300028379 | Bacteria | 2300 |
| 928 | Ga0268265_10010132 | 3300028380 | Bacteria | 6365 |
| 929 | Ga0268265_10011194 | 3300028380 | Bacteria | 6062 |
| 930 | Ga0268265_10060191 | 3300028380 | Bacteria | 2909 |
| 931 | Ga0268265_10232093 | 3300028380 | Bacteria | 1622 |
| 932 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 933 | Ga0268264_10000340 | 3300028381 | Bacteria | 71850 |
| 934 | Ga0268264_10013402 | 3300028381 | Bacteria | 6748 |
| 935 | Ga0268264_10016659 | 3300028381 | Bacteria | 6018 |
| 936 | Ga0268264_10102505 | 3300028381 | Bacteria | 2490 |
| 937 | Ga0268264_10140599 | 3300028381 | Bacteria | 2152 |
| 938 | Ga0265336_10005296 | 3300028666 | Bacteria | 4775 |
| 939 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 940 | Ga0307517_10098343 | 3300028786 | Bacteria | 2329 |
| 941 | Ga0307515_10001978 | 3300028794 | Bacteria | 45366 |
| 942 | Ga0307515_10007368 | 3300028794 | Bacteria | 21770 |
| 943 | Ga0307515_10030752 | 3300028794 | Bacteria | 8997 |
| 944 | Ga0307515_10039862 | 3300028794 | Bacteria | 7450 |
| 945 | Ga0265338_10000328 | 3300028800 | Bacteria | 86546 |
| 946 | Ga0265338_10030731 | 3300028800 | Bacteria | 5281 |
| 947 | Ga0265338_10033564 | 3300028800 | Bacteria | 4977 |
| 948 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 949 | Ga0268256_1003875 | 3300030500 | Bacteria | 6511 |
| 950 | Ga0268256_1016593 | 3300030500 | Bacteria | 2103 |
| 951 | Ga0307511_10057782 | 3300030521 | Bacteria | 3010 |
| 952 | Ga0265330_10016569 | 3300031235 | Bacteria | 3399 |
| 953 | Ga0265330_10034309 | 3300031235 | Bacteria | 2267 |
| 954 | Ga0265332_10011026 | 3300031238 | Bacteria | 4016 |
| 955 | Ga0265328_10000047 | 3300031239 | Bacteria | 80006 |
| 956 | Ga0265328_10004803 | 3300031239 | Bacteria | 5836 |
| 957 | Ga0265328_10011003 | 3300031239 | Bacteria | 3627 |
| 958 | Ga0265320_10000209 | 3300031240 | Bacteria | 47757 |
| 959 | Ga0265320_10028632 | 3300031240 | Bacteria | 2890 |
| 960 | Ga0265325_10000117 | 3300031241 | Bacteria | 54546 |
| 961 | Ga0265325_10000855 | 3300031241 | Bacteria | 21943 |
| 962 | Ga0265325_10005212 | 3300031241 | Bacteria | 8068 |
| 963 | Ga0265325_10011412 | 3300031241 | Bacteria | 5106 |
| 964 | Ga0265325_10013215 | 3300031241 | Bacteria | 4704 |
| 965 | Ga0265325_10036991 | 3300031241 | Bacteria | 2582 |
| 966 | Ga0265325_10046783 | 3300031241 | Bacteria | 2242 |
| 967 | Ga0265329_10036621 | 3300031242 | Bacteria | 1581 |
| 968 | Ga0265340_10002779 | 3300031247 | Bacteria | 9978 |
| 969 | Ga0265340_10006860 | 3300031247 | Bacteria | 6227 |
| 970 | Ga0265340_10007603 | 3300031247 | Bacteria | 5880 |
| 971 | Ga0265340_10008228 | 3300031247 | Bacteria | 5636 |
| 972 | Ga0265340_10009498 | 3300031247 | Bacteria | 5218 |
| 973 | Ga0265340_10017347 | 3300031247 | Bacteria | 3723 |
| 974 | Ga0265339_10000084 | 3300031249 | Bacteria | 80035 |
| 975 | Ga0265339_10000450 | 3300031249 | Bacteria | 32195 |
| 976 | Ga0265339_10021175 | 3300031249 | Bacteria | 3788 |
| 977 | Ga0265331_10000707 | 3300031250 | Bacteria | 28439 |
| 978 | Ga0265331_10013005 | 3300031250 | Bacteria | 4485 |
| 979 | Ga0265331_10014674 | 3300031250 | Bacteria | 4163 |
| 980 | Ga0265327_10015402 | 3300031251 | Bacteria | 4938 |
| 981 | Ga0265316_10002618 | 3300031344 | Bacteria | 18560 |
| 982 | Ga0307513_10010539 | 3300031456 | Bacteria | 11570 |
| 983 | Ga0307513_10077997 | 3300031456 | Bacteria | 3428 |
| 984 | Ga0307513_10082118 | 3300031456 | Bacteria | 3319 |
| 985 | Ga0307513_10228700 | 3300031456 | Bacteria | 1674 |
| 986 | Ga0307408_100056480 | 3300031548 | Bacteria | 2847 |
| 987 | Ga0307408_100145955 | 3300031548 | Bacteria | 1862 |
| 988 | Ga0265313_10000242 | 3300031595 | Bacteria | 59524 |
| 989 | Ga0265313_10000340 | 3300031595 | Bacteria | 50703 |
| 990 | Ga0265313_10005463 | 3300031595 | Bacteria | 9345 |
| 991 | Ga0265313_10009155 | 3300031595 | Bacteria | 6462 |
| 992 | Ga0265313_10064921 | 3300031595 | Bacteria | 1696 |
| 993 | Ga0307508_10000034 | 3300031616 | Bacteria | 160115 |
| 994 | Ga0307508_10047091 | 3300031616 | Bacteria | 3847 |
| 995 | Ga0307508_10057194 | 3300031616 | Bacteria | 3451 |
| 996 | Ga0316579_10007101 | 3300031691 | Bacteria | 4609 |
| 997 | Ga0265314_10001245 | 3300031711 | Bacteria | 29069 |
| 998 | Ga0265314_10005302 | 3300031711 | Bacteria | 11664 |
| 999 | Ga0265314_10067583 | 3300031711 | Bacteria | 2406 |
| 1000 | Ga0265342_10000211 | 3300031712 | Bacteria | 65440 |
| 1001 | Ga0265342_10006824 | 3300031712 | Bacteria | 8440 |
| 1002 | Ga0265342_10009227 | 3300031712 | Bacteria | 6978 |
| 1003 | Ga0265342_10022614 | 3300031712 | Bacteria | 3994 |
| 1004 | Ga0265342_10076179 | 3300031712 | Bacteria | 1945 |
| 1005 | Ga0307405_10067890 | 3300031731 | Bacteria | 2280 |
| 1006 | Ga0307413_10046953 | 3300031824 | Bacteria | 2572 |
| 1007 | Ga0307406_10092557 | 3300031901 | Bacteria | 2039 |
| 1008 | Ga0315914_1000012 | 3300031967 | Bacteria | 169896 |
| 1009 | Ga0307409_100020095 | 3300031995 | Bacteria | 4543 |
| 1010 | Ga0307409_100057238 | 3300031995 | Bacteria | 3020 |
| 1011 | Ga0307414_10058321 | 3300032004 | Bacteria | 2719 |
| 1012 | Ga0307415_100156342 | 3300032126 | Bacteria | 1761 |
| 1013 | Ga0316583_10002698 | 3300032133 | Bacteria | 6201 |
| 1014 | Ga0307510_10004348 | 3300033180 | Bacteria | 16677 |
| 1015 | Ga0307510_10036621 | 3300033180 | Bacteria | 5458 |
| 1016 | Ga0315913_1000006 | 3300033430 | Bacteria | 169893 |
| 1017 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 1018 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 1019 | Ga0373930_0003116 | 3300034816 | Bacteria | 2611 |
| 1020 | Ga0373930_0010266 | 3300034816 | Bacteria | 1671 |
| 1021 | Ga0373948_0000885 | 3300034817 | Bacteria | 3992 |
| 1022 | Ga0373948_0010641 | 3300034817 | Bacteria | 1611 |
| 1023 | Ga0373950_0001808 | 3300034818 | Bacteria | 2854 |
| 1024 | Ga0373950_0002959 | 3300034818 | Bacteria | 2392 |
| 1025 | Ga0373958_0000097 | 3300034819 | Bacteria | 9234 |
| 1026 | Ga0373959_0000831 | 3300034820 | Bacteria | 5274 |
| 1027 | Ga0373938_0000032 | 3300034957 | Bacteria | 17872 |
| 1028 | Ga0373938_0000454 | 3300034957 | Bacteria | 6672 |
| 1029 | Ga0373938_0005302 | 3300034957 | Bacteria | 2189 |
| 1030 | Ga0373926_0004868 | 3300035083 | Bacteria | 4412 |
| 1031 | Ga0373926_0012760 | 3300035083 | Bacteria | 2844 |
| 1032 | Ga0373929_0001755 | 3300035085 | Bacteria | 4076 |
| 1033 | Ga0373929_0003006 | 3300035085 | Bacteria | 3069 |
| 1034 | Ga0373934_0037578 | 3300035086 | Bacteria | 1906 |
| 1035 | Ga0373949_0001084 | 3300035090 | Bacteria | 8306 |
| 1036 | Ga0373951_0000472 | 3300035091 | Bacteria | 11551 |
| 1037 | Ga0373951_0002239 | 3300035091 | Bacteria | 4918 |
| 1038 | Ga0373952_0000675 | 3300035092 | Bacteria | 6046 |
| 1039 | Ga0373952_0000857 | 3300035092 | Bacteria | 5529 |
| 1040 | Ga0373923_0001236 | 3300035111 | Bacteria | 7167 |
| 1041 | Ga0373923_0002149 | 3300035111 | Bacteria | 5975 |
| 1042 | Ga0373932_0000180 | 3300035112 | Bacteria | 18517 |
| 1043 | Ga0373932_0004968 | 3300035112 | Bacteria | 3129 |
| 1044 | Ga0373936_0005755 | 3300035113 | Bacteria | 4673 |
| 1045 | Ga0373936_0016254 | 3300035113 | Bacteria | 2862 |
| 1046 | Ga0373936_0020061 | 3300035113 | Bacteria | 2594 |
| 1047 | Ga0373939_0000151 | 3300035114 | Bacteria | 19559 |
| 1048 | Ga0373939_0001404 | 3300035114 | Bacteria | 5839 |
| 1049 | Ga0373941_0001811 | 3300035115 | Bacteria | 4599 |
| 1050 | Ga0373941_0002963 | 3300035115 | Bacteria | 3797 |
| 1051 | Ga0373941_0003543 | 3300035115 | Bacteria | 3546 |
| 1052 | Ga0373945_0001892 | 3300035116 | Bacteria | 6491 |
| 1053 | Ga0373945_0014158 | 3300035116 | Bacteria | 2668 |
| 1054 | Ga0373953_0001359 | 3300035117 | Bacteria | 7040 |
| 1055 | Ga0373953_0001859 | 3300035117 | Bacteria | 6251 |
| 1056 | Ga0373954_0001664 | 3300035118 | Bacteria | 9102 |
| 1057 | Ga0373954_0002584 | 3300035118 | Bacteria | 7606 |
| 1058 | Ga0373954_0004556 | 3300035118 | Bacteria | 5968 |
| 1059 | Ga0373954_0023646 | 3300035118 | Bacteria | 2796 |
| 1060 | Ga0373954_0054205 | 3300035118 | Bacteria | 1885 |
| 1061 | Ga0373954_0056759 | 3300035118 | Bacteria | 1843 |
| 1062 | Ga0373956_0034829 | 3300035119 | Bacteria | 2218 |
| 1063 | Ga0373957_0001068 | 3300035120 | Bacteria | 7227 |
| 1064 | Ga0373957_0015263 | 3300035120 | Bacteria | 2641 |
| 1065 | Ga0373960_0000184 | 3300035121 | Bacteria | 11160 |
| 1066 | Ga0373960_0003038 | 3300035121 | Bacteria | 3788 |
| 1067 | Ga0373943_0000072 | 3300035170 | Bacteria | 35413 |
| 1068 | Ga0373943_0006580 | 3300035170 | Bacteria | 5212 |
| 1069 | Ga0373943_0007994 | 3300035170 | Bacteria | 4747 |
| 1070 | Ga0373943_0024755 | 3300035170 | Bacteria | 2802 |
| 1071 | Ga0373943_0046399 | 3300035170 | Bacteria | 2120 |
| 1072 | Ga0373946_0009681 | 3300035171 | Bacteria | 3556 |
| 1073 | Ga0373946_0012729 | 3300035171 | Bacteria | 3153 |
| 1074 | Ga0373946_0035330 | 3300035171 | Bacteria | 2022 |
| 1075 | Ga0373955_0000880 | 3300035172 | Bacteria | 12889 |
| 1076 | Ga0373955_0004332 | 3300035172 | Bacteria | 6275 |
| 1077 | Ga0373955_0006574 | 3300035172 | Bacteria | 5302 |
| 1078 | Ga0373955_0014225 | 3300035172 | Bacteria | 3865 |
| 1079 | Ga0373955_0050101 | 3300035172 | Bacteria | 2270 |
| 1080 | Ga0373955_0054012 | 3300035172 | Bacteria | 2195 |
| 1081 | Ga0373955_0059876 | 3300035172 | Bacteria | 2098 |
| 1082 | Ga0373942_0000288 | 3300035207 | Bacteria | 13666 |
| 1083 | Ga0373942_0005465 | 3300035207 | Bacteria | 2947 |
| 1084 | Ga0373961_0003973 | 3300035241 | Bacteria | 3608 |
| 1085 | Ga0373962_0000113 | 3300035242 | Bacteria | 16882 |
| 1086 | Ga0373962_0000606 | 3300035242 | Bacteria | 8091 |
| 1087 | Ga0373962_0002013 | 3300035242 | Bacteria | 4842 |
| 1088 | Ga0316574_0001675 | 3300035398 | Bacteria | 10688 |
| 1089 | Ga0373924_0002398 | 3300035410 | Bacteria | 6306 |
| 1090 | Ga0373924_0006697 | 3300035410 | Bacteria | 4137 |
| 1091 | Ga0373924_0007407 | 3300035410 | Bacteria | 3963 |
| 1092 | Ga0373931_0000290 | 3300035691 | Bacteria | 21067 |
| 1093 | Ga0373931_0004295 | 3300035691 | Bacteria | 6492 |
| 1094 | Ga0373931_0009129 | 3300035691 | Bacteria | 4732 |
| 1095 | Ga0373931_0053672 | 3300035691 | Bacteria | 2151 |
| 1096 | Ga0373935_0000185 | 3300035692 | Bacteria | 29355 |
| 1097 | Ga0373935_0000259 | 3300035692 | Bacteria | 26229 |
| 1098 | Ga0373935_0007559 | 3300035692 | Bacteria | 6506 |
| 1099 | Ga0373935_0010080 | 3300035692 | Bacteria | 5660 |
| 1100 | Ga0373935_0015153 | 3300035692 | Bacteria | 4658 |
| 1101 | Ga0373935_0018309 | 3300035692 | Bacteria | 4258 |
| 1102 | Ga0373935_0023830 | 3300035692 | Bacteria | 3760 |
| 1103 | Ga0373935_0032229 | 3300035692 | Bacteria | 3255 |
| 1104 | Ga0373935_0035977 | 3300035692 | Bacteria | 3093 |
| 1105 | Ga0373935_0046704 | 3300035692 | Bacteria | 2736 |
| 1106 | Ga0373935_0111083 | 3300035692 | Bacteria | 1820 |
| 1107 | Ga0373927_0000350 | 3300035695 | Bacteria | 36173 |
| 1108 | Ga0373927_0002379 | 3300035695 | Bacteria | 13707 |
| 1109 | Ga0373927_0005383 | 3300035695 | Bacteria | 8840 |
| 1110 | Ga0373927_0009651 | 3300035695 | Bacteria | 6471 |
| 1111 | Ga0373927_0012786 | 3300035695 | Bacteria | 5584 |
| 1112 | Ga0373927_0016655 | 3300035695 | Bacteria | 4849 |
| 1113 | Ga0373927_0040366 | 3300035695 | Bacteria | 3027 |
| 1114 | Ga0373927_0085954 | 3300035695 | Bacteria | 2041 |
| 1115 | Ga0373927_0095089 | 3300035695 | Bacteria | 1936 |
| 1116 | Ga0373933_0000672 | 3300035724 | Bacteria | 21195 |
| 1117 | Ga0373933_0001150 | 3300035724 | Bacteria | 15688 |
| 1118 | Ga0373933_0002191 | 3300035724 | Bacteria | 11169 |
| 1119 | Ga0373933_0008994 | 3300035724 | Bacteria | 5449 |
| 1120 | Ga0373933_0015628 | 3300035724 | Bacteria | 4233 |
| 1121 | Ga0373947_0000217 | 3300035725 | Bacteria | 32254 |
| 1122 | Ga0373947_0002658 | 3300035725 | Bacteria | 10739 |
| 1123 | Ga0373947_0010938 | 3300035725 | Bacteria | 5211 |
| 1124 | Ga0373947_0012207 | 3300035725 | Bacteria | 4919 |
| 1125 | Ga0373947_0012703 | 3300035725 | Bacteria | 4828 |
| 1126 | Ga0373947_0013046 | 3300035725 | Bacteria | 4764 |
| 1127 | Ga0373947_0025550 | 3300035725 | Bacteria | 3445 |
| 1128 | Ga0373947_0060565 | 3300035725 | Bacteria | 2299 |
| 1129 | Ga0373947_0073931 | 3300035725 | Bacteria | 2096 |
| 1130 | Ga0373937_0000068 | 3300036401 | Bacteria | 94138 |
| 1131 | Ga0373937_0003441 | 3300036401 | Bacteria | 13290 |
| 1132 | Ga0373937_0005533 | 3300036401 | Bacteria | 10832 |
| 1133 | Ga0373937_0006578 | 3300036401 | Bacteria | 10035 |
| 1134 | Ga0373937_0019412 | 3300036401 | Bacteria | 6084 |
| 1135 | Ga0373937_0022213 | 3300036401 | Bacteria | 5702 |
| 1136 | Ga0373937_0022578 | 3300036401 | Bacteria | 5660 |
| 1137 | Ga0373937_0048658 | 3300036401 | Bacteria | 3882 |
| 1138 | Ga0373937_0051281 | 3300036401 | Bacteria | 3782 |
| 1139 | Ga0373937_0062102 | 3300036401 | Bacteria | 3434 |
| 1140 | Ga0373937_0154886 | 3300036401 | Bacteria | 2147 |
| 1141 | Ga0373937_0160985 | 3300036401 | Bacteria | 2104 |
| 1142 | Ga0316584_0000295 | 3300036712 | Bacteria | 25457 |
| 1143 | Ga0373925_0002114 | 3300037068 | Bacteria | 16302 |
| 1144 | Ga0373925_0002364 | 3300037068 | Bacteria | 15132 |
| 1145 | Ga0373925_0004501 | 3300037068 | Bacteria | 10530 |
| 1146 | Ga0373925_0012856 | 3300037068 | Bacteria | 6063 |
| 1147 | Ga0373925_0026107 | 3300037068 | Bacteria | 4272 |
| 1148 | Ga0373925_0027981 | 3300037068 | Bacteria | 4128 |
| 1149 | Ga0373925_0032521 | 3300037068 | Bacteria | 3840 |
| 1150 | Ga0373925_0032858 | 3300037068 | Bacteria | 3821 |
| 1151 | Ga0373925_0045644 | 3300037068 | Bacteria | 3255 |
| 1152 | Ga0373925_0055362 | 3300037068 | Bacteria | 2969 |
| 1153 | Ga0373925_0109575 | 3300037068 | Bacteria | 2131 |
| 1154 | Ga0373925_0144718 | 3300037068 | Bacteria | 1862 |
| 1155 | Ga0395899_0011711 | 3300037312 | Bacteria | 6714 |
| 1156 | Ga0395900_0001924 | 3300037418 | Bacteria | 23564 |
| 1157 | Ga0395900_0002400 | 3300037418 | Bacteria | 20663 |
| 1158 | Ga0395900_0006327 | 3300037418 | Bacteria | 12346 |
| 1159 | Ga0395900_0070134 | 3300037418 | Bacteria | 3603 |
| 1160 | Ga0395900_0086570 | 3300037418 | Bacteria | 3220 |
| 1161 | Ga0395898_0007812 | 3300037466 | Bacteria | 11355 |
| 1162 | Ga0395898_0020243 | 3300037466 | Bacteria | 6760 |
| 1163 | Ga0395905_0019046 | 3300037471 | Bacteria | 6510 |
| 1164 | Ga0436364_0351366 | 3300037853 | Bacteria | 1852 |
| 1165 | Ga0436364_0387248 | 3300037853 | Bacteria | 1942 |
| 1166 | Ga0436364_0578778 | 3300037853 | Bacteria | 5418 |
| 1167 | Ga0436364_0719813 | 3300037853 | Bacteria | 2276 |
| 1168 | Ga0436364_0789056 | 3300037853 | Bacteria | 7649 |
| 1169 | Ga0395901_0015985 | 3300038443 | Bacteria | 7647 |
| 1170 | Ga0395901_0021552 | 3300038443 | Bacteria | 6602 |
| 1171 | Ga0395901_0116262 | 3300038443 | Bacteria | 2809 |
| 1172 | Ga0395901_0142816 | 3300038443 | Bacteria | 2516 |
| 1173 | Ga0395901_0161217 | 3300038443 | Bacteria | 2355 |
| 1174 | Ga0436365_0141715 | 3300039437 | Bacteria | 19847 |
| 1175 | Ga0436365_0179847 | 3300039437 | Bacteria | 5225 |
| 1176 | Ga0436365_0247802 | 3300039437 | Bacteria | 15036 |
| 1177 | Ga0436365_1010704 | 3300039437 | Bacteria | 15340 |
| 1178 | Ga0436365_1100914 | 3300039437 | Bacteria | 2111 |
| 1179 | Ga0436365_1359797 | 3300039437 | Bacteria | 1773 |
| 1180 | Ga0436365_1926106 | 3300039437 | Bacteria | 2812 |
| 1181 | Ga0436360_0147860 | 3300039438 | Bacteria | 2430 |
| 1182 | Ga0436360_0973324 | 3300039438 | Bacteria | 3801 |
| 1183 | Ga0436361_0343104 | 3300039447 | Bacteria | 1713 |
| 1184 | Ga0436361_0532916 | 3300039447 | Bacteria | 1816 |
| 1185 | Ga0436361_1025841 | 3300039447 | Bacteria | 1837 |
| 1186 | Ga0436361_1121961 | 3300039447 | Bacteria | 4323 |
| 1187 | Ga0436363_0405250 | 3300039450 | Bacteria | 18420 |
| 1188 | Ga0436363_0602817 | 3300039450 | Bacteria | 3182 |
| 1189 | Ga0436363_0693856 | 3300039450 | Bacteria | 1677 |
| 1190 | Ga0436362_0646134 | 3300039453 | Bacteria | 7178 |
| 1191 | Ga0436362_1096230 | 3300039453 | Bacteria | 18621 |
| 1192 | Ga0451787_254401 | 3300041441 | Bacteria | 2856 |
| 1193 | Ga0451833_0066605 | 3300041491 | Bacteria | 3916 |
| 1194 | Ga0451851_1088920 | 3300041507 | Bacteria | 2685 |
| 1195 | Ga0451843_0599573 | 3300041509 | Bacteria | 1959 |
| 1196 | Ga0439449_0005174 | 3300042007 | Bacteria | 5009 |
| 1197 | Ga0450920_001623 | 3300042122 | Bacteria | 3754 |
| 1198 | Ga0450906_003061 | 3300042145 | Bacteria | 3623 |
| 1199 | Ga0466972_0000520 | 3300044658 | Bacteria | 19029 |
| 1200 | Ga0466972_0004454 | 3300044658 | Bacteria | 7005 |
| 1201 | Ga0466961_0000149 | 3300044693 | Bacteria | 47561 |
| 1202 | Ga0466963_0006409 | 3300044694 | Bacteria | 6961 |
| 1203 | Ga0466963_0006941 | 3300044694 | Bacteria | 6737 |
| 1204 | Ga0466963_0073365 | 3300044694 | Bacteria | 2307 |
| 1205 | Ga0466968_0003374 | 3300044735 | Bacteria | 5902 |
| 1206 | Ga0466968_0026660 | 3300044735 | Bacteria | 2373 |
| 1207 | Ga0466957_0017500 | 3300044842 | Bacteria | 4199 |
| 1208 | Ga0466957_0049612 | 3300044842 | Bacteria | 2552 |
| 1209 | Ga0466957_0050773 | 3300044842 | Bacteria | 2524 |
| 1210 | Ga0466960_0053233 | 3300044901 | Bacteria | 1961 |
| 1211 | Ga0466959_0004087 | 3300045049 | Bacteria | 9713 |
| 1212 | Ga0466959_0026291 | 3300045049 | Bacteria | 4314 |
| 1213 | Ga0466959_0083136 | 3300045049 | Bacteria | 2306 |
| 1214 | Ga0451576_0145916 | 3300045051 | Bacteria | 2467 |
| 1215 | Ga0466958_0005656 | 3300045836 | Bacteria | 6750 |
| 1216 | Ga0466967_0022781 | 3300045976 | Bacteria | 5120 |
| 1217 | Ga0466967_0040762 | 3300045976 | Bacteria | 3999 |
| 1218 | Ga0466967_0073074 | 3300045976 | Bacteria | 3076 |
| 1219 | Ga0495592_0000488 | 3300046454 | Bacteria | 28883 |
| 1220 | Ga0495592_0001276 | 3300046454 | Bacteria | 17453 |
| 1221 | Ga0495592_0008207 | 3300046454 | Bacteria | 7841 |
| 1222 | Ga0495592_0013719 | 3300046454 | Bacteria | 6163 |
| 1223 | Ga0495592_0029636 | 3300046454 | Bacteria | 4143 |
| 1224 | Ga0495592_0035414 | 3300046454 | Bacteria | 3761 |
| 1225 | Ga0495592_0076319 | 3300046454 | Bacteria | 2432 |
| 1226 | Ga0495603_0000352 | 3300046455 | Bacteria | 24722 |
| 1227 | Ga0495603_0019849 | 3300046455 | Bacteria | 4070 |
| 1228 | Ga0495603_0142376 | 3300046455 | Bacteria | 1394 |
| 1229 | Ga0495629_0001536 | 3300046459 | Bacteria | 18162 |
| 1230 | Ga0495629_0002961 | 3300046459 | Bacteria | 12929 |
| 1231 | Ga0495629_0003719 | 3300046459 | Bacteria | 11498 |
| 1232 | Ga0495629_0006765 | 3300046459 | Bacteria | 8473 |
| 1233 | Ga0495629_0011224 | 3300046459 | Bacteria | 6505 |
| 1234 | Ga0495629_0017083 | 3300046459 | Bacteria | 5204 |
| 1235 | Ga0495629_0035281 | 3300046459 | Bacteria | 3534 |
| 1236 | Ga0495629_0047563 | 3300046459 | Bacteria | 3009 |
| 1237 | Ga0495638_0014321 | 3300046460 | Bacteria | 5367 |
| 1238 | Ga0495638_0018200 | 3300046460 | Bacteria | 4668 |
| 1239 | Ga0495641_0005001 | 3300046461 | Bacteria | 9146 |
| 1240 | Ga0495641_0006337 | 3300046461 | Bacteria | 7689 |
| 1241 | Ga0495641_0010439 | 3300046461 | Bacteria | 5383 |
| 1242 | Ga0495641_0041907 | 3300046461 | Bacteria | 2125 |
| 1243 | Ga0495651_0000655 | 3300046462 | Bacteria | 26780 |
| 1244 | Ga0495651_0001053 | 3300046462 | Bacteria | 21347 |
| 1245 | Ga0495651_0002415 | 3300046462 | Bacteria | 14429 |
| 1246 | Ga0495651_0006660 | 3300046462 | Bacteria | 8831 |
| 1247 | Ga0495651_0008150 | 3300046462 | Bacteria | 8034 |
| 1248 | Ga0495651_0009605 | 3300046462 | Bacteria | 7433 |
| 1249 | Ga0495651_0028771 | 3300046462 | Bacteria | 4331 |
| 1250 | Ga0495651_0063230 | 3300046462 | Bacteria | 2829 |
| 1251 | Ga0495653_0000199 | 3300046463 | Bacteria | 48763 |
| 1252 | Ga0495653_0002222 | 3300046463 | Bacteria | 15345 |
| 1253 | Ga0495653_0002829 | 3300046463 | Bacteria | 13841 |
| 1254 | Ga0495653_0012753 | 3300046463 | Bacteria | 6862 |
| 1255 | Ga0495653_0024422 | 3300046463 | Bacteria | 4871 |
| 1256 | Ga0495653_0025837 | 3300046463 | Bacteria | 4712 |
| 1257 | Ga0495653_0041780 | 3300046463 | Bacteria | 3577 |
| 1258 | Ga0495653_0071890 | 3300046463 | Bacteria | 2585 |
| 1259 | Ga0495580_0083053 | 3300046472 | Bacteria | 2232 |
| 1260 | Ga0495582_0000245 | 3300046473 | Bacteria | 30263 |
| 1261 | Ga0495582_0001755 | 3300046473 | Bacteria | 12244 |
| 1262 | Ga0495582_0017971 | 3300046473 | Bacteria | 3865 |
| 1263 | Ga0495582_0024440 | 3300046473 | Bacteria | 3306 |
| 1264 | Ga0495605_0001952 | 3300046474 | Bacteria | 13095 |
| 1265 | Ga0495639_0002472 | 3300046475 | Bacteria | 8065 |
| 1266 | Ga0495639_0015671 | 3300046475 | Bacteria | 3287 |
| 1267 | Ga0495639_0056596 | 3300046475 | Bacteria | 1790 |
| 1268 | Ga0495662_0000872 | 3300046476 | Bacteria | 14723 |
| 1269 | Ga0495662_0001370 | 3300046476 | Bacteria | 12055 |
| 1270 | Ga0495662_0009090 | 3300046476 | Bacteria | 4877 |
| 1271 | Ga0495662_0034272 | 3300046476 | Bacteria | 2451 |
| 1272 | Ga0495662_0088210 | 3300046476 | Bacteria | 1511 |
| 1273 | Ga0495664_0000105 | 3300046477 | Bacteria | 41914 |
| 1274 | Ga0495664_0000848 | 3300046477 | Bacteria | 15717 |
| 1275 | Ga0495664_0002940 | 3300046477 | Bacteria | 9201 |
| 1276 | Ga0495664_0004666 | 3300046477 | Bacteria | 7494 |
| 1277 | Ga0495664_0013868 | 3300046477 | Bacteria | 4570 |
| 1278 | Ga0495664_0019650 | 3300046477 | Bacteria | 3887 |
| 1279 | Ga0495664_0041648 | 3300046477 | Bacteria | 2718 |
| 1280 | Ga0495584_0010859 | 3300046491 | Bacteria | 4674 |
| 1281 | Ga0495584_0055575 | 3300046491 | Bacteria | 1992 |
| 1282 | Ga0495585_0015360 | 3300046492 | Bacteria | 4449 |
| 1283 | Ga0495585_0021569 | 3300046492 | Bacteria | 3698 |
| 1284 | Ga0495585_0050268 | 3300046492 | Bacteria | 2313 |
| 1285 | Ga0495596_0049656 | 3300046500 | Bacteria | 1645 |
| 1286 | Ga0495607_0046374 | 3300046501 | Bacteria | 2553 |
| 1287 | Ga0495607_0058102 | 3300046501 | Bacteria | 2214 |
| 1288 | Ga0495608_0000020 | 3300046511 | Bacteria | 169036 |
| 1289 | Ga0495608_0005839 | 3300046511 | Bacteria | 8764 |
| 1290 | Ga0495608_0006424 | 3300046511 | Bacteria | 8349 |
| 1291 | Ga0495608_0015143 | 3300046511 | Bacteria | 5350 |
| 1292 | Ga0495608_0019409 | 3300046511 | Bacteria | 4678 |
| 1293 | Ga0495608_0025279 | 3300046511 | Bacteria | 4053 |
| 1294 | Ga0495608_0041347 | 3300046511 | Bacteria | 3085 |
| 1295 | Ga0495608_0044765 | 3300046511 | Bacteria | 2953 |
| 1296 | Ga0495608_0063772 | 3300046511 | Bacteria | 2417 |
| 1297 | Ga0495610_0012085 | 3300046512 | Bacteria | 5221 |
| 1298 | Ga0495610_0078313 | 3300046512 | Bacteria | 1524 |
| 1299 | Ga0495616_0035673 | 3300046513 | Bacteria | 2571 |
| 1300 | Ga0495618_0001074 | 3300046514 | Bacteria | 18661 |
| 1301 | Ga0495618_0009256 | 3300046514 | Bacteria | 5944 |
| 1302 | Ga0495618_0014797 | 3300046514 | Bacteria | 4759 |
| 1303 | Ga0495618_0039877 | 3300046514 | Bacteria | 2953 |
| 1304 | Ga0495618_0049512 | 3300046514 | Bacteria | 2653 |
| 1305 | Ga0495620_0020509 | 3300046515 | Bacteria | 3227 |
| 1306 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 1307 | Ga0495628_0003193 | 3300046516 | Bacteria | 14701 |
| 1308 | Ga0495628_0005097 | 3300046516 | Bacteria | 11546 |
| 1309 | Ga0495628_0019614 | 3300046516 | Bacteria | 5586 |
| 1310 | Ga0495628_0052582 | 3300046516 | Bacteria | 3217 |
| 1311 | Ga0495628_0058839 | 3300046516 | Bacteria | 3019 |
| 1312 | Ga0495630_0001784 | 3300046517 | Bacteria | 15054 |
| 1313 | Ga0495630_0043306 | 3300046517 | Bacteria | 3362 |
| 1314 | Ga0495630_0043308 | 3300046517 | Bacteria | 3362 |
| 1315 | Ga0495630_0060622 | 3300046517 | Bacteria | 2840 |
| 1316 | Ga0495631_0064912 | 3300046518 | Bacteria | 1580 |
| 1317 | Ga0495643_0002725 | 3300046522 | Bacteria | 13593 |
| 1318 | Ga0495644_0003283 | 3300046523 | Bacteria | 6397 |
| 1319 | Ga0495648_0001680 | 3300046524 | Bacteria | 21407 |
| 1320 | Ga0495648_0044051 | 3300046524 | Bacteria | 2789 |
| 1321 | Ga0495666_0015592 | 3300046526 | Bacteria | 3783 |
| 1322 | Ga0495666_0068918 | 3300046526 | Bacteria | 1683 |
| 1323 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 1324 | Ga0495652_0001783 | 3300046529 | Bacteria | 23000 |
| 1325 | Ga0495652_0007926 | 3300046529 | Bacteria | 9749 |
| 1326 | Ga0495652_0010443 | 3300046529 | Bacteria | 8413 |
| 1327 | Ga0495652_0036021 | 3300046529 | Bacteria | 4304 |
| 1328 | Ga0495652_0036122 | 3300046529 | Bacteria | 4297 |
| 1329 | Ga0495652_0101270 | 3300046529 | Bacteria | 2335 |
| 1330 | Ga0495665_0000361 | 3300046531 | Bacteria | 22971 |
| 1331 | Ga0495665_0016782 | 3300046531 | Bacteria | 3942 |
| 1332 | Ga0495665_0023775 | 3300046531 | Bacteria | 3292 |
| 1333 | Ga0495640_0000027 | 3300046533 | Bacteria | 90638 |
| 1334 | Ga0495640_0002916 | 3300046533 | Bacteria | 13760 |
| 1335 | Ga0495640_0003002 | 3300046533 | Bacteria | 13580 |
| 1336 | Ga0495640_0008459 | 3300046533 | Bacteria | 8070 |
| 1337 | Ga0495640_0008740 | 3300046533 | Bacteria | 7936 |
| 1338 | Ga0495640_0010157 | 3300046533 | Bacteria | 7294 |
| 1339 | Ga0495640_0017400 | 3300046533 | Bacteria | 5359 |
| 1340 | Ga0495640_0018229 | 3300046533 | Bacteria | 5214 |
| 1341 | Ga0495640_0034231 | 3300046533 | Bacteria | 3604 |
| 1342 | Ga0495586_0013373 | 3300046535 | Bacteria | 4352 |
| 1343 | Ga0495587_0000017 | 3300046536 | Bacteria | 172923 |
| 1344 | Ga0495587_0001634 | 3300046536 | Bacteria | 14937 |
| 1345 | Ga0495587_0004533 | 3300046536 | Bacteria | 9126 |
| 1346 | Ga0495587_0011251 | 3300046536 | Bacteria | 5673 |
| 1347 | Ga0495587_0017008 | 3300046536 | Bacteria | 4521 |
| 1348 | Ga0495587_0018218 | 3300046536 | Bacteria | 4355 |
| 1349 | Ga0495587_0059072 | 3300046536 | Bacteria | 2252 |
| 1350 | Ga0495587_0117126 | 3300046536 | Bacteria | 1527 |
| 1351 | Ga0495598_0000989 | 3300046537 | Bacteria | 5474 |
| 1352 | Ga0495645_0000212 | 3300046543 | Bacteria | 41774 |
| 1353 | Ga0495645_0001744 | 3300046543 | Bacteria | 14776 |
| 1354 | Ga0495645_0020761 | 3300046543 | Bacteria | 4744 |
| 1355 | Ga0495645_0023607 | 3300046543 | Bacteria | 4455 |
| 1356 | Ga0495645_0031817 | 3300046543 | Bacteria | 3845 |
| 1357 | Ga0495645_0055550 | 3300046543 | Bacteria | 2875 |
| 1358 | Ga0495645_0140832 | 3300046543 | Bacteria | 1683 |
| 1359 | Ga0495622_0006317 | 3300046557 | Bacteria | 5501 |
| 1360 | Ga0495633_0012648 | 3300046558 | Bacteria | 4479 |
| 1361 | Ga0495633_0016697 | 3300046558 | Bacteria | 3778 |
| 1362 | Ga0495633_0042755 | 3300046558 | Bacteria | 2151 |
| 1363 | Ga0495667_0000031 | 3300046559 | Bacteria | 147377 |
| 1364 | Ga0495667_0002154 | 3300046559 | Bacteria | 13133 |
| 1365 | Ga0495667_0005829 | 3300046559 | Bacteria | 8350 |
| 1366 | Ga0495667_0008100 | 3300046559 | Bacteria | 7132 |
| 1367 | Ga0495667_0008220 | 3300046559 | Bacteria | 7081 |
| 1368 | Ga0495667_0012248 | 3300046559 | Bacteria | 5812 |
| 1369 | Ga0495667_0017063 | 3300046559 | Bacteria | 4903 |
| 1370 | Ga0495656_0000812 | 3300046615 | Bacteria | 10072 |
| 1371 | Ga0495656_0017683 | 3300046615 | Bacteria | 2724 |
| 1372 | Ga0495656_0039808 | 3300046615 | Bacteria | 1955 |
| 1373 | Ga0495668_0020542 | 3300046616 | Bacteria | 3797 |
| 1374 | Ga0495668_0101055 | 3300046616 | Bacteria | 1578 |
| 1375 | Ga0495634_0000006 | 3300046642 | Bacteria | 172775 |
| 1376 | Ga0495634_0000249 | 3300046642 | Bacteria | 50835 |
| 1377 | Ga0495634_0004120 | 3300046642 | Bacteria | 11513 |
| 1378 | Ga0495634_0019062 | 3300046642 | Bacteria | 4877 |
| 1379 | Ga0495634_0102277 | 3300046642 | Bacteria | 1850 |
| 1380 | Ga0495611_0006846 | 3300046648 | Bacteria | 4844 |
| 1381 | Ga0495635_0000154 | 3300046663 | Bacteria | 41886 |
| 1382 | Ga0495635_0000239 | 3300046663 | Bacteria | 34889 |
| 1383 | Ga0495635_0000681 | 3300046663 | Bacteria | 21881 |
| 1384 | Ga0495635_0001492 | 3300046663 | Bacteria | 15672 |
| 1385 | Ga0495635_0003846 | 3300046663 | Bacteria | 10429 |
| 1386 | Ga0495635_0014377 | 3300046663 | Bacteria | 5536 |
| 1387 | Ga0495635_0019133 | 3300046663 | Bacteria | 4778 |
| 1388 | Ga0495635_0031183 | 3300046663 | Bacteria | 3703 |
| 1389 | Ga0495635_0037865 | 3300046663 | Bacteria | 3339 |
| 1390 | Ga0495635_0055286 | 3300046663 | Bacteria | 2734 |
| 1391 | Ga0495635_0082315 | 3300046663 | Bacteria | 2202 |
| 1392 | Ga0495659_0021922 | 3300046664 | Bacteria | 2156 |
| 1393 | Ga0495661_0031412 | 3300046665 | Bacteria | 3371 |
| 1394 | Ga0495588_0002364 | 3300046674 | Bacteria | 8071 |
| 1395 | Ga0495588_0014080 | 3300046674 | Bacteria | 3823 |
| 1396 | Ga0495588_0051178 | 3300046674 | Bacteria | 2127 |
| 1397 | Ga0495588_0098105 | 3300046674 | Bacteria | 1538 |
| 1398 | Ga0495657_0000828 | 3300046675 | Bacteria | 27353 |
| 1399 | Ga0495657_0003492 | 3300046675 | Bacteria | 12822 |
| 1400 | Ga0495657_0004137 | 3300046675 | Bacteria | 11618 |
| 1401 | Ga0495657_0006927 | 3300046675 | Bacteria | 8808 |
| 1402 | Ga0495657_0009432 | 3300046675 | Bacteria | 7395 |
| 1403 | Ga0495657_0137070 | 3300046675 | Bacteria | 1528 |
| 1404 | Ga0495599_0000051 | 3300046678 | Bacteria | 81853 |
| 1405 | Ga0495599_0001556 | 3300046678 | Bacteria | 13209 |
| 1406 | Ga0495599_0001605 | 3300046678 | Bacteria | 13038 |
| 1407 | Ga0495599_0008411 | 3300046678 | Bacteria | 6272 |
| 1408 | Ga0495599_0009208 | 3300046678 | Bacteria | 6026 |
| 1409 | Ga0495599_0021267 | 3300046678 | Bacteria | 4047 |
| 1410 | Ga0495599_0025691 | 3300046678 | Bacteria | 3688 |
| 1411 | Ga0495623_0001078 | 3300046679 | Bacteria | 18463 |
| 1412 | Ga0495623_0002296 | 3300046679 | Bacteria | 12741 |
| 1413 | Ga0495623_0004017 | 3300046679 | Bacteria | 9681 |
| 1414 | Ga0495623_0005074 | 3300046679 | Bacteria | 8634 |
| 1415 | Ga0495623_0009107 | 3300046679 | Bacteria | 6440 |
| 1416 | Ga0495623_0010478 | 3300046679 | Bacteria | 6000 |
| 1417 | Ga0495623_0034442 | 3300046679 | Bacteria | 3247 |
| 1418 | Ga0495646_0000102 | 3300046680 | Bacteria | 41798 |
| 1419 | Ga0495646_0001918 | 3300046680 | Bacteria | 12509 |
| 1420 | Ga0495646_0004146 | 3300046680 | Bacteria | 9100 |
| 1421 | Ga0495646_0005453 | 3300046680 | Bacteria | 8043 |
| 1422 | Ga0495646_0011250 | 3300046680 | Bacteria | 5683 |
| 1423 | Ga0495646_0040366 | 3300046680 | Bacteria | 2875 |
| 1424 | Ga0495647_0001979 | 3300046681 | Bacteria | 6401 |
| 1425 | Ga0495658_0001058 | 3300046683 | Bacteria | 14532 |
| 1426 | Ga0495658_0019298 | 3300046683 | Bacteria | 3556 |
| 1427 | Ga0495658_0046436 | 3300046683 | Bacteria | 2441 |
| 1428 | Ga0495669_0025636 | 3300046684 | Bacteria | 2572 |
| 1429 | Ga0495613_0000929 | 3300046689 | Bacteria | 22466 |
| 1430 | Ga0495613_0003386 | 3300046689 | Bacteria | 11918 |
| 1431 | Ga0495613_0018983 | 3300046689 | Bacteria | 5123 |
| 1432 | Ga0495613_0030472 | 3300046689 | Bacteria | 4007 |
| 1433 | Ga0495613_0032215 | 3300046689 | Bacteria | 3893 |
| 1434 | Ga0495613_0097810 | 3300046689 | Bacteria | 2121 |
| 1435 | Ga0495624_0000538 | 3300046690 | Bacteria | 29656 |
| 1436 | Ga0495624_0005667 | 3300046690 | Bacteria | 8960 |
| 1437 | Ga0495624_0029990 | 3300046690 | Bacteria | 3545 |
| 1438 | Ga0495624_0056485 | 3300046690 | Bacteria | 2470 |
| 1439 | Ga0495624_0058970 | 3300046690 | Bacteria | 2409 |
| 1440 | Ga0495670_0002486 | 3300046691 | Bacteria | 9106 |
| 1441 | Ga0495670_0013147 | 3300046691 | Bacteria | 4070 |
| 1442 | Ga0495649_0012742 | 3300046694 | Bacteria | 4878 |
| 1443 | Ga0495600_0000069 | 3300046809 | Bacteria | 58754 |
| 1444 | Ga0495600_0002229 | 3300046809 | Bacteria | 11033 |
| 1445 | Ga0495600_0007632 | 3300046809 | Bacteria | 6624 |
| 1446 | Ga0495600_0028766 | 3300046809 | Bacteria | 3597 |
| 1447 | Ga0495600_0046092 | 3300046809 | Bacteria | 2845 |
| 1448 | Ga0495600_0049335 | 3300046809 | Bacteria | 2747 |
| 1449 | Ga0495600_0054681 | 3300046809 | Bacteria | 2607 |
| 1450 | Ga0495600_0059314 | 3300046809 | Bacteria | 2499 |
| 1451 | Ga0495581_0001238 | 3300047315 | Bacteria | 14050 |
| 1452 | Ga0495581_0013980 | 3300047315 | Bacteria | 4655 |
| 1453 | Ga0495581_0016881 | 3300047315 | Bacteria | 4243 |
| 1454 | Ga0495581_0033675 | 3300047315 | Bacteria | 2965 |
| 1455 | Ga0495581_0047949 | 3300047315 | Bacteria | 2468 |
| 1456 | Ga0495581_0077776 | 3300047315 | Bacteria | 1920 |
| 1457 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 1458 | Ga0495604_0000198 | 3300047317 | Bacteria | 54624 |
| 1459 | Ga0495604_0003926 | 3300047317 | Bacteria | 11841 |
| 1460 | Ga0495604_0005469 | 3300047317 | Bacteria | 10075 |
| 1461 | Ga0495604_0007916 | 3300047317 | Bacteria | 8417 |
| 1462 | Ga0495604_0013426 | 3300047317 | Bacteria | 6525 |
| 1463 | Ga0495604_0126654 | 3300047317 | Bacteria | 1840 |
| 1464 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 1465 | Ga0495674_0001854 | 3300047319 | Bacteria | 20818 |
| 1466 | Ga0495674_0004728 | 3300047319 | Bacteria | 13095 |
| 1467 | Ga0495674_0018520 | 3300047319 | Bacteria | 6481 |
| 1468 | Ga0495674_0019302 | 3300047319 | Bacteria | 6328 |
| 1469 | Ga0495674_0020768 | 3300047319 | Bacteria | 6080 |
| 1470 | Ga0495674_0021792 | 3300047319 | Bacteria | 5921 |
| 1471 | Ga0495674_0043222 | 3300047319 | Bacteria | 4011 |
| 1472 | Ga0495674_0060078 | 3300047319 | Bacteria | 3317 |
| 1473 | Ga0495672_0020040 | 3300047320 | Bacteria | 4393 |
| 1474 | Ga0495672_0065823 | 3300047320 | Bacteria | 2070 |
| 1475 | Ga0495676_0027183 | 3300047321 | Bacteria | 4911 |
| 1476 | Ga0495676_0034451 | 3300047321 | Bacteria | 4249 |
| 1477 | Ga0495676_0123474 | 3300047321 | Bacteria | 1880 |
| 1478 | Ga0495680_0001692 | 3300047322 | Bacteria | 23414 |
| 1479 | Ga0495680_0012862 | 3300047322 | Bacteria | 7332 |
| 1480 | Ga0495680_0014111 | 3300047322 | Bacteria | 6938 |
| 1481 | Ga0495680_0014519 | 3300047322 | Bacteria | 6818 |
| 1482 | Ga0495680_0021114 | 3300047322 | Bacteria | 5456 |
| 1483 | Ga0495675_0000216 | 3300047444 | Bacteria | 41783 |
| 1484 | Ga0495675_0003321 | 3300047444 | Bacteria | 9678 |
| 1485 | Ga0495675_0005926 | 3300047444 | Bacteria | 7468 |
| 1486 | Ga0495675_0013295 | 3300047444 | Bacteria | 5194 |
| 1487 | Ga0495675_0112366 | 3300047444 | Bacteria | 1700 |
| 1488 | Ga0495681_0010028 | 3300047470 | Bacteria | 5769 |
| 1489 | Ga0495684_0000009 | 3300047471 | Bacteria | 199436 |
| 1490 | Ga0495684_0000893 | 3300047471 | Bacteria | 24119 |
| 1491 | Ga0495684_0008239 | 3300047471 | Bacteria | 8067 |
| 1492 | Ga0495684_0012532 | 3300047471 | Bacteria | 6535 |
| 1493 | Ga0495684_0018847 | 3300047471 | Bacteria | 5316 |
| 1494 | Ga0495684_0044818 | 3300047471 | Bacteria | 3385 |
| 1495 | Ga0495684_0050814 | 3300047471 | Bacteria | 3164 |
| 1496 | Ga0495686_0002729 | 3300047472 | Bacteria | 16131 |
| 1497 | Ga0495686_0021390 | 3300047472 | Bacteria | 4296 |
| 1498 | Ga0495686_0028426 | 3300047472 | Bacteria | 3642 |
| 1499 | Ga0495593_0000034 | 3300047673 | Bacteria | 57993 |
| 1500 | Ga0495593_0005065 | 3300047673 | Bacteria | 7792 |
| 1501 | Ga0495593_0005088 | 3300047673 | Bacteria | 7774 |
| 1502 | Ga0495593_0010592 | 3300047673 | Bacteria | 5319 |
| 1503 | Ga0495593_0011441 | 3300047673 | Bacteria | 5097 |
| 1504 | Ga0495593_0030123 | 3300047673 | Bacteria | 2971 |
| 1505 | Ga0495593_0041683 | 3300047673 | Bacteria | 2467 |
| 1506 | Ga0495602_0000373 | 3300048088 | Bacteria | 41729 |
| 1507 | Ga0495602_0002340 | 3300048088 | Bacteria | 19175 |
| 1508 | Ga0495602_0010712 | 3300048088 | Bacteria | 9507 |
| 1509 | Ga0495602_0029454 | 3300048088 | Bacteria | 5227 |
| 1510 | Ga0495602_0030283 | 3300048088 | Bacteria | 5136 |
| 1511 | Ga0495614_0012962 | 3300048089 | Bacteria | 3655 |
| 1512 | Ga0496100_0000171 | 3300048903 | Bacteria | 35989 |
| 1513 | Ga0496100_0005513 | 3300048903 | Bacteria | 6827 |
| 1514 | Ga0496100_0005621 | 3300048903 | Bacteria | 6772 |
| 1515 | Ga0496100_0041911 | 3300048903 | Bacteria | 2921 |
| 1516 | Ga0496101_0000246 | 3300048904 | Bacteria | 39478 |
| 1517 | Ga0496101_0002583 | 3300048904 | Bacteria | 11123 |
| 1518 | Ga0496101_0005889 | 3300048904 | Bacteria | 7849 |
| 1519 | Ga0496101_0077962 | 3300048904 | Bacteria | 2443 |
| 1520 | Ga0496102_0003080 | 3300048905 | Bacteria | 14123 |
| 1521 | Ga0496102_0015817 | 3300048905 | Bacteria | 6577 |
| 1522 | Ga0496102_0030603 | 3300048905 | Bacteria | 4818 |
| 1523 | Ga0496102_0047397 | 3300048905 | Bacteria | 3905 |
| 1524 | Ga0496102_0079901 | 3300048905 | Bacteria | 3012 |
| 1525 | Ga0496102_0104172 | 3300048905 | Bacteria | 2639 |
| 1526 | Ga0496102_0190699 | 3300048905 | Bacteria | 1931 |
| 1527 | Ga0496103_0000753 | 3300048906 | Bacteria | 23863 |
| 1528 | Ga0496103_0001814 | 3300048906 | Bacteria | 13893 |
| 1529 | Ga0496103_0019062 | 3300048906 | Bacteria | 4120 |
| 1530 | Ga0496104_0000102 | 3300048907 | Bacteria | 81318 |
| 1531 | Ga0496104_0000159 | 3300048907 | Bacteria | 61494 |
| 1532 | Ga0496104_0000774 | 3300048907 | Bacteria | 27343 |
| 1533 | Ga0496104_0001290 | 3300048907 | Bacteria | 21593 |
| 1534 | Ga0496104_0003304 | 3300048907 | Bacteria | 13921 |
| 1535 | Ga0496104_0004126 | 3300048907 | Bacteria | 12614 |
| 1536 | Ga0496104_0004366 | 3300048907 | Bacteria | 12305 |
| 1537 | Ga0496104_0015916 | 3300048907 | Bacteria | 6825 |
| 1538 | Ga0496104_0040399 | 3300048907 | Bacteria | 4372 |
| 1539 | Ga0496104_0130937 | 3300048907 | Bacteria | 2409 |
| 1540 | Ga0496104_0208411 | 3300048907 | Bacteria | 1866 |
| 1541 | Ga0496105_0000066 | 3300048908 | Bacteria | 83056 |
| 1542 | Ga0496105_0000410 | 3300048908 | Bacteria | 28167 |
| 1543 | Ga0496105_0000660 | 3300048908 | Bacteria | 23143 |
| 1544 | Ga0496105_0002875 | 3300048908 | Bacteria | 12614 |
| 1545 | Ga0496105_0003208 | 3300048908 | Bacteria | 12040 |
| 1546 | Ga0496105_0015677 | 3300048908 | Bacteria | 6046 |
| 1547 | Ga0496105_0017518 | 3300048908 | Bacteria | 5746 |
| 1548 | Ga0496105_0021219 | 3300048908 | Bacteria | 5255 |
| 1549 | Ga0496105_0029545 | 3300048908 | Bacteria | 4487 |
| 1550 | Ga0496105_0048636 | 3300048908 | Bacteria | 3500 |
| 1551 | Ga0496105_0102015 | 3300048908 | Bacteria | 2369 |
| 1552 | Ga0496106_0000183 | 3300048909 | Bacteria | 45053 |
| 1553 | Ga0496106_0000649 | 3300048909 | Bacteria | 24884 |
| 1554 | Ga0496106_0000982 | 3300048909 | Bacteria | 20805 |
| 1555 | Ga0496106_0001165 | 3300048909 | Bacteria | 19535 |
| 1556 | Ga0496106_0003721 | 3300048909 | Bacteria | 11376 |
| 1557 | Ga0496106_0013694 | 3300048909 | Bacteria | 5989 |
| 1558 | Ga0496106_0015146 | 3300048909 | Bacteria | 5706 |
| 1559 | Ga0496106_0046114 | 3300048909 | Bacteria | 3276 |
| 1560 | Ga0496106_0076130 | 3300048909 | Bacteria | 2571 |
| 1561 | Ga0496107_0001430 | 3300048910 | Bacteria | 14748 |
| 1562 | Ga0496107_0008995 | 3300048910 | Bacteria | 6922 |
| 1563 | Ga0496107_0009499 | 3300048910 | Bacteria | 6747 |
| 1564 | Ga0496107_0012532 | 3300048910 | Bacteria | 5919 |
| 1565 | Ga0496107_0015904 | 3300048910 | Bacteria | 5278 |
| 1566 | Ga0496107_0021046 | 3300048910 | Bacteria | 4610 |
| 1567 | Ga0496107_0042322 | 3300048910 | Bacteria | 3271 |
| 1568 | Ga0496107_0066510 | 3300048910 | Bacteria | 2613 |
| 1569 | Ga0496107_0090146 | 3300048910 | Bacteria | 2239 |
| 1570 | Ga0496108_0000436 | 3300048911 | Bacteria | 33627 |
| 1571 | Ga0496108_0000931 | 3300048911 | Bacteria | 22844 |
| 1572 | Ga0496108_0001856 | 3300048911 | Bacteria | 16893 |
| 1573 | Ga0496108_0008443 | 3300048911 | Bacteria | 8356 |
| 1574 | Ga0496108_0041092 | 3300048911 | Bacteria | 3859 |
| 1575 | Ga0496108_0065905 | 3300048911 | Bacteria | 3053 |
| 1576 | Ga0496108_0073828 | 3300048911 | Bacteria | 2879 |
| 1577 | Ga0496108_0137709 | 3300048911 | Bacteria | 2102 |
| 1578 | Ga0496109_0001350 | 3300048912 | Bacteria | 20293 |
| 1579 | Ga0496109_0001766 | 3300048912 | Bacteria | 17962 |
| 1580 | Ga0496109_0003286 | 3300048912 | Bacteria | 13499 |
| 1581 | Ga0496109_0004165 | 3300048912 | Bacteria | 12074 |
| 1582 | Ga0496109_0006221 | 3300048912 | Bacteria | 10035 |
| 1583 | Ga0496109_0015570 | 3300048912 | Bacteria | 6631 |
| 1584 | Ga0496109_0037548 | 3300048912 | Bacteria | 4376 |
| 1585 | Ga0496109_0044561 | 3300048912 | Bacteria | 4024 |
| 1586 | Ga0496109_0050558 | 3300048912 | Bacteria | 3785 |
| 1587 | Ga0496109_0118867 | 3300048912 | Bacteria | 2460 |
| 1588 | Ga0496109_0129340 | 3300048912 | Bacteria | 2356 |
| 1589 | Ga0496110_0001937 | 3300048913 | Bacteria | 15340 |
| 1590 | Ga0496110_0003940 | 3300048913 | Bacteria | 11418 |
| 1591 | Ga0496110_0004370 | 3300048913 | Bacteria | 10940 |
| 1592 | Ga0496110_0006833 | 3300048913 | Bacteria | 9070 |
| 1593 | Ga0496110_0020911 | 3300048913 | Bacteria | 5528 |
| 1594 | Ga0496110_0051830 | 3300048913 | Bacteria | 3606 |
| 1595 | Ga0496110_0056020 | 3300048913 | Bacteria | 3469 |
| 1596 | Ga0496110_0065660 | 3300048913 | Bacteria | 3209 |
| 1597 | Ga0496110_0066495 | 3300048913 | Bacteria | 3188 |
| 1598 | Ga0496110_0107304 | 3300048913 | Bacteria | 2506 |
| 1599 | Ga0496110_0135255 | 3300048913 | Bacteria | 2227 |
| 1600 | Ga0496111_0001107 | 3300048914 | Bacteria | 14927 |
| 1601 | Ga0496111_0001128 | 3300048914 | Bacteria | 14799 |
| 1602 | Ga0496111_0001815 | 3300048914 | Bacteria | 12543 |
| 1603 | Ga0496111_0021291 | 3300048914 | Bacteria | 4524 |
| 1604 | Ga0496111_0031351 | 3300048914 | Bacteria | 3786 |
| 1605 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 1606 | Ga0496112_0000735 | 3300048915 | Bacteria | 22831 |
| 1607 | Ga0496112_0002588 | 3300048915 | Bacteria | 14615 |
| 1608 | Ga0496112_0002673 | 3300048915 | Bacteria | 14416 |
| 1609 | Ga0496112_0003217 | 3300048915 | Bacteria | 13450 |
| 1610 | Ga0496112_0015968 | 3300048915 | Bacteria | 7020 |
| 1611 | Ga0496112_0016298 | 3300048915 | Bacteria | 6958 |
| 1612 | Ga0496112_0035334 | 3300048915 | Bacteria | 4868 |
| 1613 | Ga0496112_0050851 | 3300048915 | Bacteria | 4064 |
| 1614 | Ga0496112_0057762 | 3300048915 | Bacteria | 3820 |
| 1615 | Ga0496112_0074587 | 3300048915 | Bacteria | 3354 |
| 1616 | Ga0496112_0124520 | 3300048915 | Bacteria | 2548 |
| 1617 | Ga0496113_0001031 | 3300048916 | Bacteria | 15000 |
| 1618 | Ga0496113_0001697 | 3300048916 | Bacteria | 12482 |
| 1619 | Ga0496113_0005725 | 3300048916 | Bacteria | 7785 |
| 1620 | Ga0496113_0013405 | 3300048916 | Bacteria | 5553 |
| 1621 | Ga0496113_0020676 | 3300048916 | Bacteria | 4633 |
| 1622 | Ga0496113_0032840 | 3300048916 | Bacteria | 3773 |
| 1623 | Ga0496113_0167540 | 3300048916 | Bacteria | 1739 |
| 1624 | Ga0496114_0002224 | 3300048917 | Bacteria | 14788 |
| 1625 | Ga0496114_0028100 | 3300048917 | Bacteria | 4613 |
| 1626 | Ga0496114_0034325 | 3300048917 | Bacteria | 4184 |
| 1627 | Ga0496114_0130075 | 3300048917 | Bacteria | 2173 |
| 1628 | Ga0496114_0228259 | 3300048917 | Bacteria | 1635 |
| 1629 | Ga0496115_0003582 | 3300048918 | Bacteria | 11170 |
| 1630 | Ga0496115_0005349 | 3300048918 | Bacteria | 9337 |
| 1631 | Ga0496115_0007272 | 3300048918 | Bacteria | 8144 |
| 1632 | Ga0496115_0008771 | 3300048918 | Bacteria | 7494 |
| 1633 | Ga0496115_0015832 | 3300048918 | Bacteria | 5728 |
| 1634 | Ga0496115_0107107 | 3300048918 | Bacteria | 2295 |
| 1635 | Ga0496115_0117589 | 3300048918 | Bacteria | 2187 |
| 1636 | Ga0496115_0120660 | 3300048918 | Bacteria | 2157 |
| 1637 | Ga0496115_0131610 | 3300048918 | Bacteria | 2062 |
| 1638 | Ga0496115_0155460 | 3300048918 | Bacteria | 1889 |
| 1639 | Ga0496116_0000142 | 3300048919 | Bacteria | 150342 |
| 1640 | Ga0496116_0003364 | 3300048919 | Bacteria | 15879 |
| 1641 | Ga0496116_0051303 | 3300048919 | Bacteria | 2741 |
| 1642 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 1643 | Ga0496117_0001574 | 3300048920 | Bacteria | 32408 |
| 1644 | Ga0496117_0019627 | 3300048920 | Bacteria | 5544 |
| 1645 | Ga0496117_0020764 | 3300048920 | Bacteria | 5344 |
| 1646 | Ga0496117_0035578 | 3300048920 | Bacteria | 3736 |
| 1647 | Ga0496117_0089219 | 3300048920 | Bacteria | 1992 |
| 1648 | Ga0496117_0098184 | 3300048920 | Bacteria | 1863 |
| 1649 | Ga0496118_0000087 | 3300048921 | Bacteria | 176693 |
| 1650 | Ga0496118_0008894 | 3300048921 | Bacteria | 10262 |
| 1651 | Ga0496118_0043982 | 3300048921 | Bacteria | 3503 |
| 1652 | Ga0496118_0046917 | 3300048921 | Bacteria | 3355 |
| 1653 | Ga0496118_0050959 | 3300048921 | Bacteria | 3171 |
| 1654 | Ga0496118_0061482 | 3300048921 | Bacteria | 2781 |
| 1655 | Ga0496118_0132718 | 3300048921 | Bacteria | 1595 |
| 1656 | Ga0496119_0000903 | 3300048922 | Bacteria | 38694 |
| 1657 | Ga0496119_0001143 | 3300048922 | Bacteria | 33302 |
| 1658 | Ga0496119_0029282 | 3300048922 | Bacteria | 3739 |
| 1659 | Ga0496119_0034940 | 3300048922 | Bacteria | 3300 |
| 1660 | Ga0496120_0000413 | 3300048923 | Bacteria | 68125 |
| 1661 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 1662 | Ga0496121_0001497 | 3300048924 | Bacteria | 39336 |
| 1663 | Ga0496121_0001742 | 3300048924 | Bacteria | 35564 |
| 1664 | Ga0496121_0003089 | 3300048924 | Bacteria | 24095 |
| 1665 | Ga0496121_0015642 | 3300048924 | Bacteria | 7916 |
| 1666 | Ga0496121_0017380 | 3300048924 | Bacteria | 7352 |
| 1667 | Ga0496121_0021924 | 3300048924 | Bacteria | 6231 |
| 1668 | Ga0496121_0037277 | 3300048924 | Bacteria | 4321 |
| 1669 | Ga0496121_0038697 | 3300048924 | Bacteria | 4216 |
| 1670 | Ga0496121_0049287 | 3300048924 | Bacteria | 3572 |
| 1671 | Ga0496121_0051164 | 3300048924 | Bacteria | 3482 |
| 1672 | Ga0496121_0134696 | 3300048924 | Bacteria | 1842 |
| 1673 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 1674 | Ga0496122_0000190 | 3300048925 | Bacteria | 140376 |
| 1675 | Ga0496122_0004307 | 3300048925 | Bacteria | 17825 |
| 1676 | Ga0496122_0017720 | 3300048925 | Bacteria | 6632 |
| 1677 | Ga0496122_0024662 | 3300048925 | Bacteria | 5257 |
| 1678 | Ga0496122_0029884 | 3300048925 | Bacteria | 4582 |
| 1679 | Ga0496122_0056469 | 3300048925 | Bacteria | 2926 |
| 1680 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 1681 | Ga0496123_0000336 | 3300048926 | Bacteria | 89161 |
| 1682 | Ga0496123_0011423 | 3300048926 | Bacteria | 7697 |
| 1683 | Ga0496123_0024244 | 3300048926 | Bacteria | 4617 |
| 1684 | Ga0496123_0027440 | 3300048926 | Bacteria | 4241 |
| 1685 | Ga0496123_0031265 | 3300048926 | Bacteria | 3876 |
| 1686 | Ga0496123_0032300 | 3300048926 | Bacteria | 3793 |
| 1687 | Ga0496123_0042101 | 3300048926 | Bacteria | 3157 |
| 1688 | Ga0496123_0065130 | 3300048926 | Bacteria | 2318 |
| 1689 | Ga0496123_0069502 | 3300048926 | Bacteria | 2210 |
| 1690 | Ga0496124_0001128 | 3300048927 | Bacteria | 42017 |
| 1691 | Ga0496124_0009838 | 3300048927 | Bacteria | 9779 |
| 1692 | Ga0496124_0011540 | 3300048927 | Bacteria | 8817 |
| 1693 | Ga0496124_0037114 | 3300048927 | Bacteria | 4241 |
| 1694 | Ga0496124_0075324 | 3300048927 | Bacteria | 2788 |
| 1695 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 1696 | Ga0496125_0000248 | 3300048928 | Bacteria | 110840 |
| 1697 | Ga0496125_0000823 | 3300048928 | Bacteria | 50271 |
| 1698 | Ga0496125_0006049 | 3300048928 | Bacteria | 13230 |
| 1699 | Ga0496125_0015007 | 3300048928 | Bacteria | 7523 |
| 1700 | Ga0496125_0019665 | 3300048928 | Bacteria | 6360 |
| 1701 | Ga0496125_0105364 | 3300048928 | Bacteria | 2061 |
| 1702 | Ga0496125_0143173 | 3300048928 | Bacteria | 1658 |
| 1703 | Ga0496126_0000866 | 3300048929 | Bacteria | 53241 |
| 1704 | Ga0496126_0001294 | 3300048929 | Bacteria | 39967 |
| 1705 | Ga0496126_0002744 | 3300048929 | Bacteria | 23267 |
| 1706 | Ga0496126_0006113 | 3300048929 | Bacteria | 13500 |
| 1707 | Ga0496126_0007435 | 3300048929 | Bacteria | 12015 |
| 1708 | Ga0496126_0009402 | 3300048929 | Bacteria | 10385 |
| 1709 | Ga0496126_0014931 | 3300048929 | Bacteria | 7831 |
| 1710 | Ga0496126_0015910 | 3300048929 | Bacteria | 7552 |
| 1711 | Ga0496126_0020832 | 3300048929 | Bacteria | 6418 |
| 1712 | Ga0496126_0032430 | 3300048929 | Bacteria | 4920 |
| 1713 | Ga0496126_0039244 | 3300048929 | Bacteria | 4396 |
| 1714 | Ga0496126_0049254 | 3300048929 | Bacteria | 3847 |
| 1715 | Ga0496126_0053931 | 3300048929 | Bacteria | 3645 |
| 1716 | Ga0496126_0057046 | 3300048929 | Bacteria | 3528 |
| 1717 | Ga0501031_0009852 | 3300049568 | Bacteria | 6221 |
| 1718 | Ga0501031_0028410 | 3300049568 | Bacteria | 3645 |
| 1719 | Ga0501031_0050735 | 3300049568 | Bacteria | 2702 |
| 1720 | Ga0501032_0003534 | 3300049569 | Bacteria | 11926 |
| 1721 | Ga0501032_0008293 | 3300049569 | Bacteria | 7571 |
| 1722 | Ga0501032_0033503 | 3300049569 | Bacteria | 3519 |
| 1723 | Ga0501032_0085772 | 3300049569 | Bacteria | 2093 |
| 1724 | Ga0501032_0094501 | 3300049569 | Bacteria | 1982 |
| 1725 | Ga0501032_0105845 | 3300049569 | Bacteria | 1863 |
| 1726 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 1727 | Ga0501033_0000951 | 3300049570 | Bacteria | 26299 |
| 1728 | Ga0501033_0001862 | 3300049570 | Bacteria | 18338 |
| 1729 | Ga0501033_0036294 | 3300049570 | Bacteria | 3693 |
| 1730 | Ga0501033_0036543 | 3300049570 | Bacteria | 3680 |
| 1731 | Ga0501033_0057802 | 3300049570 | Bacteria | 2865 |
| 1732 | Ga0501033_0078757 | 3300049570 | Bacteria | 2418 |
| 1733 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 1734 | Ga0501034_0001938 | 3300049571 | Bacteria | 26206 |
| 1735 | Ga0501034_0003303 | 3300049571 | Bacteria | 18422 |
| 1736 | Ga0501034_0003931 | 3300049571 | Bacteria | 16699 |
| 1737 | Ga0501034_0018261 | 3300049571 | Bacteria | 7193 |
| 1738 | Ga0501034_0029910 | 3300049571 | Bacteria | 5536 |
| 1739 | Ga0501034_0032008 | 3300049571 | Bacteria | 5342 |
| 1740 | Ga0501034_0060787 | 3300049571 | Bacteria | 3795 |
| 1741 | Ga0501034_0063839 | 3300049571 | Bacteria | 3696 |
| 1742 | Ga0501034_0063869 | 3300049571 | Bacteria | 3696 |
| 1743 | Ga0501034_0085798 | 3300049571 | Bacteria | 3149 |
| 1744 | Ga0501034_0103631 | 3300049571 | Bacteria | 2838 |
| 1745 | Ga0501034_0240727 | 3300049571 | Bacteria | 1755 |
| 1746 | Ga0501034_0255686 | 3300049571 | Bacteria | 1695 |
| 1747 | Ga0501036_0001894 | 3300049572 | Bacteria | 16266 |
| 1748 | Ga0501036_0004433 | 3300049572 | Bacteria | 11343 |
| 1749 | Ga0501036_0014718 | 3300049572 | Bacteria | 6523 |
| 1750 | Ga0501036_0020317 | 3300049572 | Bacteria | 5577 |
| 1751 | Ga0501036_0026547 | 3300049572 | Bacteria | 4889 |
| 1752 | Ga0501036_0121562 | 3300049572 | Bacteria | 2205 |
| 1753 | Ga0501036_0128420 | 3300049572 | Bacteria | 2140 |
| 1754 | Ga0501036_0132946 | 3300049572 | Bacteria | 2100 |
| 1755 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 1756 | Ga0501037_0004019 | 3300049573 | Bacteria | 10664 |
| 1757 | Ga0501037_0023027 | 3300049573 | Bacteria | 4606 |
| 1758 | Ga0501037_0023753 | 3300049573 | Bacteria | 4532 |
| 1759 | Ga0501037_0025895 | 3300049573 | Bacteria | 4332 |
| 1760 | Ga0501037_0027054 | 3300049573 | Bacteria | 4237 |
| 1761 | Ga0501037_0040501 | 3300049573 | Bacteria | 3428 |
| 1762 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 1763 | Ga0501038_0002206 | 3300049574 | Bacteria | 18110 |
| 1764 | Ga0501038_0004382 | 3300049574 | Bacteria | 13128 |
| 1765 | Ga0501038_0019027 | 3300049574 | Bacteria | 6196 |
| 1766 | Ga0501038_0072151 | 3300049574 | Bacteria | 2926 |
| 1767 | Ga0501038_0113818 | 3300049574 | Bacteria | 2238 |
| 1768 | Ga0501038_0144733 | 3300049574 | Bacteria | 1941 |
| 1769 | Ga0501038_0171569 | 3300049574 | Bacteria | 1755 |
| 1770 | Ga0501038_0192297 | 3300049574 | Bacteria | 1641 |
| 1771 | Ga0501039_0003318 | 3300049575 | Bacteria | 12039 |
| 1772 | Ga0501039_0068601 | 3300049575 | Bacteria | 2753 |
| 1773 | Ga0501039_0068838 | 3300049575 | Bacteria | 2748 |
| 1774 | Ga0501039_0109920 | 3300049575 | Bacteria | 2155 |
| 1775 | Ga0501040_0054530 | 3300049576 | Bacteria | 2740 |
| 1776 | Ga0501042_0015592 | 3300049578 | Bacteria | 5205 |
| 1777 | Ga0501043_0000278 | 3300049579 | Bacteria | 46214 |
| 1778 | Ga0501043_0003514 | 3300049579 | Bacteria | 12892 |
| 1779 | Ga0501043_0007295 | 3300049579 | Bacteria | 8775 |
| 1780 | Ga0501043_0008635 | 3300049579 | Bacteria | 8029 |
| 1781 | Ga0501043_0009609 | 3300049579 | Bacteria | 7576 |
| 1782 | Ga0501043_0022578 | 3300049579 | Bacteria | 4933 |
| 1783 | Ga0501043_0022870 | 3300049579 | Bacteria | 4901 |
| 1784 | Ga0501043_0036587 | 3300049579 | Bacteria | 3862 |
| 1785 | Ga0501043_0059303 | 3300049579 | Bacteria | 3003 |
| 1786 | Ga0501046_0000937 | 3300049580 | Bacteria | 28581 |
| 1787 | Ga0501046_0008812 | 3300049580 | Bacteria | 8763 |
| 1788 | Ga0501046_0012556 | 3300049580 | Bacteria | 7204 |
| 1789 | Ga0501046_0050515 | 3300049580 | Bacteria | 3285 |
| 1790 | Ga0501046_0054701 | 3300049580 | Bacteria | 3138 |
| 1791 | Ga0501047_0000275 | 3300049581 | Bacteria | 59536 |
| 1792 | Ga0501047_0000688 | 3300049581 | Bacteria | 35266 |
| 1793 | Ga0501047_0003823 | 3300049581 | Bacteria | 14152 |
| 1794 | Ga0501047_0009938 | 3300049581 | Bacteria | 8998 |
| 1795 | Ga0501047_0012864 | 3300049581 | Bacteria | 7930 |
| 1796 | Ga0501047_0018665 | 3300049581 | Bacteria | 6650 |
| 1797 | Ga0501047_0038155 | 3300049581 | Bacteria | 4647 |
| 1798 | Ga0501047_0040535 | 3300049581 | Bacteria | 4504 |
| 1799 | Ga0501047_0050183 | 3300049581 | Bacteria | 4029 |
| 1800 | Ga0501047_0089000 | 3300049581 | Bacteria | 2964 |
| 1801 | Ga0501047_0115148 | 3300049581 | Bacteria | 2571 |
| 1802 | Ga0501047_0139295 | 3300049581 | Bacteria | 2305 |
| 1803 | Ga0501047_0181313 | 3300049581 | Bacteria | 1972 |
| 1804 | Ga0501047_0196182 | 3300049581 | Bacteria | 1881 |
| 1805 | Ga0501048_0001248 | 3300049582 | Bacteria | 19253 |
| 1806 | Ga0501048_0002575 | 3300049582 | Bacteria | 13870 |
| 1807 | Ga0501048_0011414 | 3300049582 | Bacteria | 6626 |
| 1808 | Ga0501048_0022723 | 3300049582 | Bacteria | 4584 |
| 1809 | Ga0501048_0047682 | 3300049582 | Bacteria | 3056 |
| 1810 | Ga0501048_0123764 | 3300049582 | Bacteria | 1828 |
| 1811 | Ga0501067_0000258 | 3300049583 | Bacteria | 28937 |
| 1812 | Ga0501067_0007852 | 3300049583 | Bacteria | 5930 |
| 1813 | Ga0501067_0037309 | 3300049583 | Bacteria | 2699 |
| 1814 | Ga0501067_0110334 | 3300049583 | Bacteria | 1529 |
| 1815 | Ga0501068_0004146 | 3300049584 | Bacteria | 7852 |
| 1816 | Ga0501068_0013165 | 3300049584 | Bacteria | 4703 |
| 1817 | Ga0501068_0014609 | 3300049584 | Bacteria | 4493 |
| 1818 | Ga0501068_0026245 | 3300049584 | Bacteria | 3431 |
| 1819 | Ga0501069_0014567 | 3300049585 | Bacteria | 4204 |
| 1820 | Ga0501069_0071080 | 3300049585 | Bacteria | 1950 |
| 1821 | Ga0501070_0002548 | 3300049586 | Bacteria | 15964 |
| 1822 | Ga0501070_0006200 | 3300049586 | Bacteria | 10187 |
| 1823 | Ga0501070_0013214 | 3300049586 | Bacteria | 6960 |
| 1824 | Ga0501070_0020554 | 3300049586 | Bacteria | 5537 |
| 1825 | Ga0501070_0022267 | 3300049586 | Bacteria | 5309 |
| 1826 | Ga0501070_0024977 | 3300049586 | Bacteria | 5011 |
| 1827 | Ga0501070_0025040 | 3300049586 | Bacteria | 5004 |
| 1828 | Ga0501070_0142755 | 3300049586 | Bacteria | 1977 |
| 1829 | Ga0501070_0156925 | 3300049586 | Bacteria | 1876 |
| 1830 | Ga0501070_0216337 | 3300049586 | Bacteria | 1572 |
| 1831 | Ga0501071_0011386 | 3300049587 | Bacteria | 5993 |
| 1832 | Ga0501071_0059871 | 3300049587 | Bacteria | 2756 |
| 1833 | Ga0501072_0005621 | 3300049588 | Bacteria | 9541 |
| 1834 | Ga0501072_0066240 | 3300049588 | Bacteria | 2849 |
| 1835 | Ga0501072_0067082 | 3300049588 | Bacteria | 2831 |
| 1836 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 1837 | Ga0501073_0057275 | 3300049589 | Bacteria | 2725 |
| 1838 | Ga0501073_0059061 | 3300049589 | Bacteria | 2679 |
| 1839 | Ga0501073_0113520 | 3300049589 | Bacteria | 1879 |
| 1840 | Ga0501073_0147488 | 3300049589 | Bacteria | 1630 |
| 1841 | Ga0501073_0151360 | 3300049589 | Bacteria | 1608 |
| 1842 | Ga0501074_0000456 | 3300049590 | Bacteria | 24566 |
| 1843 | Ga0501074_0001612 | 3300049590 | Bacteria | 15274 |
| 1844 | Ga0501074_0005242 | 3300049590 | Bacteria | 9324 |
| 1845 | Ga0501074_0025367 | 3300049590 | Bacteria | 4305 |
| 1846 | Ga0501074_0029373 | 3300049590 | Bacteria | 3982 |
| 1847 | Ga0501074_0047059 | 3300049590 | Bacteria | 3118 |
| 1848 | Ga0501076_0002639 | 3300049592 | Bacteria | 12373 |
| 1849 | Ga0501076_0089958 | 3300049592 | Bacteria | 2468 |
| 1850 | Ga0501076_0121843 | 3300049592 | Bacteria | 2112 |
| 1851 | Ga0501077_0003492 | 3300049593 | Bacteria | 9437 |
| 1852 | Ga0501079_0000451 | 3300049741 | Bacteria | 26871 |
| 1853 | Ga0501079_0010445 | 3300049741 | Bacteria | 7058 |
| 1854 | Ga0501079_0038416 | 3300049741 | Bacteria | 3691 |
| 1855 | Ga0501079_0042211 | 3300049741 | Bacteria | 3523 |
| 1856 | Ga0501079_0125027 | 3300049741 | Bacteria | 2001 |
| 1857 | Ga0501079_0147849 | 3300049741 | Bacteria | 1831 |
| 1858 | Ga0501080_0000082 | 3300049742 | Bacteria | 63972 |
| 1859 | Ga0501080_0000153 | 3300049742 | Bacteria | 49231 |
| 1860 | Ga0501080_0002998 | 3300049742 | Bacteria | 14886 |
| 1861 | Ga0501080_0011942 | 3300049742 | Bacteria | 7955 |
| 1862 | Ga0501080_0016338 | 3300049742 | Bacteria | 6854 |
| 1863 | Ga0501080_0019550 | 3300049742 | Bacteria | 6275 |
| 1864 | Ga0501080_0034657 | 3300049742 | Bacteria | 4714 |
| 1865 | Ga0501080_0042442 | 3300049742 | Bacteria | 4234 |
| 1866 | Ga0501080_0061381 | 3300049742 | Bacteria | 3499 |
| 1867 | Ga0501080_0064923 | 3300049742 | Bacteria | 3396 |
| 1868 | Ga0501080_0112736 | 3300049742 | Bacteria | 2521 |
| 1869 | Ga0501081_0000145 | 3300049743 | Bacteria | 32074 |
| 1870 | Ga0501083_0003065 | 3300049744 | Bacteria | 11615 |
| 1871 | Ga0501083_0009193 | 3300049744 | Bacteria | 6980 |
| 1872 | Ga0501083_0013677 | 3300049744 | Bacteria | 5675 |
| 1873 | Ga0501083_0024526 | 3300049744 | Bacteria | 4178 |
| 1874 | Ga0501083_0037937 | 3300049744 | Bacteria | 3277 |
| 1875 | Ga0501035_0000584 | 3300049822 | Bacteria | 40265 |
| 1876 | Ga0501035_0000766 | 3300049822 | Bacteria | 34513 |
| 1877 | Ga0501035_0001708 | 3300049822 | Bacteria | 22182 |
| 1878 | Ga0501035_0018251 | 3300049822 | Bacteria | 6463 |
| 1879 | Ga0501035_0026906 | 3300049822 | Bacteria | 5258 |
| 1880 | Ga0501035_0046712 | 3300049822 | Bacteria | 3894 |
| 1881 | Ga0501035_0049300 | 3300049822 | Bacteria | 3774 |
| 1882 | Ga0501035_0054488 | 3300049822 | Bacteria | 3573 |
| 1883 | Ga0501035_0112140 | 3300049822 | Bacteria | 2389 |
| 1884 | Ga0501035_0255715 | 3300049822 | Bacteria | 1486 |
| 1885 | Ga0501044_0000286 | 3300049823 | Bacteria | 64389 |
| 1886 | Ga0501044_0000418 | 3300049823 | Bacteria | 52554 |
| 1887 | Ga0501044_0007955 | 3300049823 | Bacteria | 11650 |
| 1888 | Ga0501044_0013097 | 3300049823 | Bacteria | 8978 |
| 1889 | Ga0501044_0013740 | 3300049823 | Bacteria | 8750 |
| 1890 | Ga0501044_0024381 | 3300049823 | Bacteria | 6423 |
| 1891 | Ga0501044_0028251 | 3300049823 | Bacteria | 5921 |
| 1892 | Ga0501044_0028517 | 3300049823 | Bacteria | 5892 |
| 1893 | Ga0501044_0034063 | 3300049823 | Bacteria | 5345 |
| 1894 | Ga0501044_0051865 | 3300049823 | Bacteria | 4229 |
| 1895 | Ga0501044_0067195 | 3300049823 | Bacteria | 3653 |
| 1896 | Ga0501044_0101689 | 3300049823 | Bacteria | 2891 |
| 1897 | Ga0501044_0102882 | 3300049823 | Bacteria | 2871 |
| 1898 | Ga0501044_0121107 | 3300049823 | Bacteria | 2617 |
| 1899 | Ga0501044_0176428 | 3300049823 | Bacteria | 2106 |
| 1900 | Ga0501044_0188063 | 3300049823 | Bacteria | 2029 |
| 1901 | Ga0501045_0054354 | 3300049824 | Bacteria | 2927 |
| 1902 | Ga0501045_0056551 | 3300049824 | Bacteria | 2869 |
| 1903 | nmdc:mga03683_2117_c1 | 3300050489 | Bacteria | 6112 |
| 1904 | nmdc:mga03n38_1307_c3 | 3300050490 | Bacteria | 3308 |
| 1905 | nmdc:mga00v17_12_c1 | 3300050491 | Bacteria | 129050 |
| 1906 | nmdc:mga00v17_62963_c1 | 3300050491 | Bacteria | 2283 |
| 1907 | nmdc:mga00v17_639_c1 | 3300050491 | Bacteria | 19367 |
| 1908 | nmdc:mga0yw44_1397_c1 | 3300050492 | Bacteria | 9573 |
| 1909 | nmdc:mga0yw44_16757_c1 | 3300050492 | Bacteria | 3968 |
| 1910 | nmdc:mga0yw44_291_c1 | 3300050492 | Bacteria | 17253 |
| 1911 | nmdc:mga0yw44_5474_c1 | 3300050492 | Bacteria | 6006 |
| 1912 | nmdc:mga0yw44_64749_c1 | 3300050492 | Bacteria | 2250 |
| 1913 | nmdc:mga0k408_19986_c1 | 3300050493 | Bacteria | 2244 |
| 1914 | nmdc:mga0k408_43409_c1 | 3300050493 | Bacteria | 2591 |
| 1915 | nmdc:mga0k408_54844_c1 | 3300050493 | Bacteria | 2310 |
| 1916 | nmdc:mga06z11_59933_c1 | 3300050494 | Bacteria | 1980 |
| 1917 | nmdc:mga04h51_21673_c1 | 3300050495 | Bacteria | 1936 |
| 1918 | nmdc:mga07m45_33942_c1 | 3300050496 | Bacteria | 2835 |
| 1919 | nmdc:mga05p37_140758_c1 | 3300050507 | Bacteria | 2956 |
| 1920 | nmdc:mga05p37_16389_c1 | 3300050507 | Bacteria | 8927 |
| 1921 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 1922 | nmdc:mga05p37_62404_c1 | 3300050507 | Bacteria | 4586 |
| 1923 | nmdc:mga05p37_66173_c1 | 3300050507 | Bacteria | 4445 |
| 1924 | nmdc:mga05p37_71679_c1 | 3300050507 | Bacteria | 4263 |
| 1925 | nmdc:mga09592_813_c1 | 3300050508 | Bacteria | 24096 |
| 1926 | nmdc:mga0qj67_101_c1 | 3300050509 | Bacteria | 57355 |
| 1927 | nmdc:mga0qj67_1453_c1 | 3300050509 | Bacteria | 16598 |
| 1928 | nmdc:mga08y16_1715_c1 | 3300050511 | Bacteria | 22248 |
| 1929 | nmdc:mga08y16_2882_c1 | 3300050511 | Bacteria | 17696 |
| 1930 | nmdc:mga08y16_42428_c1 | 3300050511 | Bacteria | 4765 |
| 1931 | nmdc:mga0n895_1392_c1 | 3300050512 | Bacteria | 18016 |
| 1932 | nmdc:mga0n895_30575_c1 | 3300050512 | Bacteria | 5148 |
| 1933 | nmdc:mga0n895_58282_c1 | 3300050512 | Bacteria | 3807 |
| 1934 | nmdc:mga0n895_971_c1 | 3300050512 | Bacteria | 20812 |
| 1935 | nmdc:mga0rr50_78964_c1 | 3300050513 | Bacteria | 2534 |
| 1936 | nmdc:mga08x19_25741_c1 | 3300050514 | Bacteria | 3667 |
| 1937 | nmdc:mga08x19_66_c1 | 3300050514 | Bacteria | 105609 |
| 1938 | nmdc:mga0a205_1026_c1 | 3300050515 | Bacteria | 23240 |
| 1939 | nmdc:mga0a205_27448_c1 | 3300050515 | Bacteria | 5437 |
| 1940 | nmdc:mga0a205_687_c1 | 3300050515 | Bacteria | 27032 |
| 1941 | nmdc:mga0sz30_1084_c1 | 3300050516 | Bacteria | 9781 |
| 1942 | nmdc:mga0sz30_47039_c1 | 3300050516 | Bacteria | 1823 |
| 1943 | nmdc:mga0sz30_5454_c1 | 3300050516 | Bacteria | 4666 |
| 1944 | Ga0495601_0000020 | 3300053077 | Bacteria | 160011 |
| 1945 | Ga0495601_0002032 | 3300053077 | Bacteria | 11359 |
| 1946 | Ga0495601_0002166 | 3300053077 | Bacteria | 11055 |
| 1947 | Ga0495601_0009529 | 3300053077 | Bacteria | 5749 |
| 1948 | Ga0495601_0024023 | 3300053077 | Bacteria | 3750 |
| 1949 | Ga0495601_0025589 | 3300053077 | Bacteria | 3640 |
| 1950 | Ga0495612_0000030 | 3300053078 | Bacteria | 81917 |
| 1951 | Ga0495612_0000095 | 3300053078 | Bacteria | 38147 |
| 1952 | Ga0495612_0000616 | 3300053078 | Bacteria | 14330 |
| 1953 | Ga0495612_0005510 | 3300053078 | Bacteria | 5231 |
| 1954 | Ga0495612_0013166 | 3300053078 | Bacteria | 3331 |
| 1955 | Ga0495612_0014874 | 3300053078 | Bacteria | 3122 |
| 1956 | Ga0495612_0015258 | 3300053078 | Bacteria | 3080 |
| 1957 | Ga0495595_0000125 | 3300053084 | Bacteria | 33101 |
| 1958 | Ga0495595_0002085 | 3300053084 | Bacteria | 7774 |
| 1959 | Ga0495595_0003032 | 3300053084 | Bacteria | 6641 |
| 1960 | Ga0495595_0004343 | 3300053084 | Bacteria | 5706 |
| 1961 | Ga0495595_0005397 | 3300053084 | Bacteria | 5178 |
| 1962 | Ga0495595_0012561 | 3300053084 | Bacteria | 3562 |
| 1963 | Ga0495595_0028530 | 3300053084 | Bacteria | 2493 |
| 1964 | Ga0495595_0029769 | 3300053084 | Bacteria | 2445 |
| 1965 | Ga0495619_0000151 | 3300053085 | Bacteria | 51364 |
| 1966 | Ga0495619_0000216 | 3300053085 | Bacteria | 41892 |
| 1967 | Ga0495619_0000419 | 3300053085 | Bacteria | 28779 |
| 1968 | Ga0495619_0000504 | 3300053085 | Bacteria | 26022 |
| 1969 | Ga0495619_0001557 | 3300053085 | Bacteria | 15086 |
| 1970 | Ga0495619_0001606 | 3300053085 | Bacteria | 14870 |
| 1971 | Ga0495619_0005274 | 3300053085 | Bacteria | 8189 |
| 1972 | Ga0495619_0005598 | 3300053085 | Bacteria | 7970 |
| 1973 | Ga0495619_0009643 | 3300053085 | Bacteria | 6089 |
| 1974 | Ga0495619_0010322 | 3300053085 | Bacteria | 5877 |
| 1975 | Ga0495619_0012726 | 3300053085 | Bacteria | 5294 |
| 1976 | Ga0495619_0012816 | 3300053085 | Bacteria | 5280 |
| 1977 | Ga0495619_0065533 | 3300053085 | Bacteria | 2423 |
| 1978 | Ga0500578_0035303 | 3300053086 | Bacteria | 3213 |
| 1979 | Ga0500643_000267 | 3300053087 | Bacteria | 46005 |
| 1980 | Ga0500643_013683 | 3300053087 | Bacteria | 2855 |
| 1981 | Ga0500643_022533 | 3300053087 | Bacteria | 2026 |
| 1982 | Ga0500647_0016593 | 3300053091 | Bacteria | 3386 |
| 1983 | Ga0500651_0000861 | 3300053093 | Bacteria | 14855 |
| 1984 | Ga0500651_0006227 | 3300053093 | Bacteria | 6866 |
| 1985 | Ga0500651_0035377 | 3300053093 | Bacteria | 3147 |
| 1986 | Ga0500651_0081820 | 3300053093 | Bacteria | 1999 |
| 1987 | Ga0500651_0086679 | 3300053093 | Bacteria | 1934 |
| 1988 | Ga0500566_0000157 | 3300053094 | Bacteria | 34534 |
| 1989 | Ga0500566_0000185 | 3300053094 | Bacteria | 32171 |
| 1990 | Ga0500566_0000925 | 3300053094 | Bacteria | 16797 |
| 1991 | Ga0500641_0001160 | 3300053096 | Bacteria | 9388 |
| 1992 | Ga0500641_0006535 | 3300053096 | Bacteria | 4135 |
| 1993 | Ga0500641_0024451 | 3300053096 | Bacteria | 2329 |
| 1994 | Ga0500641_0028182 | 3300053096 | Bacteria | 2192 |
| 1995 | Ga0500554_000718 | 3300053102 | Bacteria | 6703 |
| 1996 | Ga0500556_0000413 | 3300053104 | Bacteria | 31142 |
| 1997 | Ga0500556_0005856 | 3300053104 | Bacteria | 3479 |
| 1998 | Ga0500556_0008713 | 3300053104 | Bacteria | 2931 |
| 1999 | Ga0500557_000041 | 3300053105 | Bacteria | 64885 |
| 2000 | Ga0500560_007025 | 3300053107 | Bacteria | 2625 |
| 2001 | Ga0500562_011056 | 3300053108 | Bacteria | 2290 |
| 2002 | Ga0500572_001865 | 3300053111 | Bacteria | 5335 |
| 2003 | Ga0500572_003851 | 3300053111 | Bacteria | 3410 |
| 2004 | Ga0500592_008834 | 3300053116 | Bacteria | 1601 |
| 2005 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 2006 | Ga0500595_003935 | 3300053119 | Bacteria | 6804 |
| 2007 | Ga0500595_006228 | 3300053119 | Bacteria | 5095 |
| 2008 | Ga0500595_018179 | 3300053119 | Bacteria | 2576 |
| 2009 | Ga0500595_023855 | 3300053119 | Bacteria | 2143 |
| 2010 | Ga0500614_001219 | 3300053123 | Bacteria | 6263 |
| 2011 | Ga0500618_006718 | 3300053125 | Bacteria | 3350 |
| 2012 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 2013 | Ga0500642_0000140 | 3300053130 | Bacteria | 32282 |
| 2014 | Ga0500652_000011 | 3300053131 | Bacteria | 160704 |
| 2015 | Ga0500652_000531 | 3300053131 | Bacteria | 13423 |
| 2016 | Ga0500658_0004847 | 3300053134 | Bacteria | 5018 |
| 2017 | Ga0500559_0002089 | 3300053136 | Bacteria | 10664 |
| 2018 | Ga0500559_0004041 | 3300053136 | Bacteria | 7042 |
| 2019 | Ga0500559_0004212 | 3300053136 | Bacteria | 6885 |
| 2020 | Ga0500561_0000098 | 3300053137 | Bacteria | 16671 |
| 2021 | Ga0500568_0002109 | 3300053139 | Bacteria | 12007 |
| 2022 | Ga0500577_0000693 | 3300053142 | Bacteria | 8639 |
| 2023 | Ga0500590_083058 | 3300053148 | Bacteria | 1570 |
| 2024 | Ga0500603_000277 | 3300053150 | Bacteria | 13486 |
| 2025 | Ga0500603_001226 | 3300053150 | Bacteria | 5959 |
| 2026 | Ga0500604_0019289 | 3300053151 | Bacteria | 1908 |
| 2027 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 2028 | Ga0500616_0000166 | 3300053153 | Bacteria | 110141 |
| 2029 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 2030 | Ga0500616_0004617 | 3300053153 | Bacteria | 9730 |
| 2031 | Ga0500616_0009939 | 3300053153 | Bacteria | 5726 |
| 2032 | Ga0500622_0000458 | 3300053156 | Bacteria | 38693 |
| 2033 | Ga0500622_0029561 | 3300053156 | Bacteria | 2881 |
| 2034 | Ga0500622_0037547 | 3300053156 | Bacteria | 2530 |
| 2035 | Ga0500622_0045943 | 3300053156 | Bacteria | 2260 |
| 2036 | Ga0500638_078740 | 3300053162 | Bacteria | 1567 |
| 2037 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 2038 | Ga0500639_063951 | 3300053163 | Bacteria | 1891 |
| 2039 | Ga0500636_0000180 | 3300053177 | Bacteria | 33813 |
| 2040 | Ga0500636_0001459 | 3300053177 | Bacteria | 12853 |
| 2041 | Ga0500636_0001916 | 3300053177 | Bacteria | 11425 |
| 2042 | Ga0500636_0004158 | 3300053177 | Bacteria | 8191 |
| 2043 | Ga0500637_0002840 | 3300053178 | Bacteria | 7802 |
| 2044 | Ga0500637_0029199 | 3300053178 | Bacteria | 3057 |
| 2045 | Ga0500625_003212 | 3300053729 | Bacteria | 6395 |
| 2046 | Ga0500645_001299 | 3300053730 | Bacteria | 12970 |
| 2047 | Ga0500645_002180 | 3300053730 | Bacteria | 8957 |
| 2048 | Ga0500645_013842 | 3300053730 | Bacteria | 2581 |
| 2049 | Ga0500599_000459 | 3300053736 | Bacteria | 4213 |
| 2050 | Ga0500601_000076 | 3300053737 | Bacteria | 20083 |
| 2051 | Ga0501084_0003972 | 3300054114 | Bacteria | 12046 |
| 2052 | Ga0501084_0073507 | 3300054114 | Bacteria | 2863 |
| 2053 | Ga0501084_0114235 | 3300054114 | Bacteria | 2270 |
| 2054 | Ga0501084_0148146 | 3300054114 | Bacteria | 1977 |
| 2055 | Ga0501082_0001096 | 3300060353 | Bacteria | 23952 |
| 2056 | Ga0501082_0011183 | 3300060353 | Bacteria | 7713 |
| 2057 | Ga0501082_0011925 | 3300060353 | Bacteria | 7474 |
| 2058 | Ga0501082_0040978 | 3300060353 | Bacteria | 3993 |
| 2059 | Ga0501082_0051160 | 3300060353 | Bacteria | 3561 |
| 2060 | Ga0501082_0111109 | 3300060353 | Bacteria | 2372 |
| 2061 | Ga0466962_0032239 | 3300061719 | Bacteria | 2508 |
| 2062 | Ga0530510_0024936 | 3300061734 | Bacteria | 4274 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0024662 | Ga0496122_0024662_212_1456 | 412 |
| 2 | iso_pu_bacteria | 2964670856 | 2964676078 | 415 |
| 3 | 3300049568 | Ga0501031_0050735 | Ga0501031_0050735_13_1284 | 422 |
| 4 | 3300009094 | Ga0111539_10000581 | Ga0111539_1000058113 | 430 |
| 5 | 3300049586 | Ga0501070_0142755 | Ga0501070_0142755_195_1616 | 439 |
| 6 | iso_pu_bacteria | 8019687851 | 8019694112 | 439 |
| 7 | 3300049569 | Ga0501032_0094501 | Ga0501032_0094501_579_1961 | 444 |
| 8 | 3300035695 | Ga0373927_0085954 | Ga0373927_0085954_683_2026 | 447 |
| 9 | 3300046455 | Ga0495603_0142376 | Ga0495603_0142376_39_1382 | 447 |
| 10 | 3300047315 | Ga0495581_0077776 | Ga0495581_0077776_11_1363 | 447 |
| 11 | 3300048917 | Ga0496114_0130075 | Ga0496114_0130075_11_1354 | 447 |
| 12 | 3300049589 | Ga0501073_0113520 | Ga0501073_0113520_514_1866 | 447 |
| 13 | 3300026035 | Ga0207703_10097783 | Ga0207703_100977832 | 451 |
| 14 | 3300049571 | Ga0501034_0032008 | Ga0501034_0032008_210_1619 | 453 |
| 15 | 3300049581 | Ga0501047_0012864 | Ga0501047_0012864_1606_3015 | 453 |
| 16 | 3300049823 | Ga0501044_0013740 | Ga0501044_0013740_1900_3309 | 453 |
| 17 | iso_pu_bacteria | 2957437181 | 2957440838 | 453 |
| 18 | 3300046475 | Ga0495639_0002472 | Ga0495639_0002472_6502_7905 | 454 |
| 19 | 3300046517 | Ga0495630_0060622 | Ga0495630_0060622_111_1514 | 454 |
| 20 | 3300031240 | Ga0265320_10028632 | Ga0265320_100286322 | 456 |
| 21 | 3300031241 | Ga0265325_10036991 | Ga0265325_100369912 | 456 |
| 22 | 3300031247 | Ga0265340_10008228 | Ga0265340_100082285 | 456 |
| 23 | 3300005436 | Ga0070713_100135610 | Ga0070713_1001356102 | 457 |
| 24 | 3300049588 | Ga0501072_0005621 | Ga0501072_0005621_6194_7603 | 457 |
| 25 | 3300060353 | Ga0501082_0001096 | Ga0501082_0001096_18726_20129 | 457 |
| 26 | 3300039447 | Ga0436361_1025841 | Ga0436361_1025841_19_1416 | 458 |
| 27 | 3300005535 | Ga0070684_100005206 | Ga0070684_1000052066 | 459 |
| 28 | 3300013105 | Ga0157369_10186475 | Ga0157369_101864752 | 459 |
| 29 | 3300025917 | Ga0207660_10014180 | Ga0207660_100141805 | 459 |
| 30 | 3300031247 | Ga0265340_10007603 | Ga0265340_100076032 | 459 |
| 31 | 3300049571 | Ga0501034_0085798 | Ga0501034_0085798_955_2382 | 459 |
| 32 | iso_pu_bacteria | 2508501050 | 2508729295 | 461 |
| 33 | iso_pu_bacteria | 2508501114 | 2509077892 | 461 |
| 34 | iso_pu_bacteria | 2545555834 | 2545678990 | 461 |
| 35 | iso_pu_bacteria | 2595698237 | 2596374192 | 461 |
| 36 | iso_pu_bacteria | 2773857925 | 2774872874 | 461 |
| 37 | iso_pu_bacteria | 2775506901 | 2776258754 | 461 |
| 38 | iso_pu_bacteria | 2835312727 | 2835312919 | 461 |
| 39 | iso_pu_bacteria | 2841957949 | 2841960219 | 461 |
| 40 | iso_pu_bacteria | 2882456835 | 2882457970 | 461 |
| 41 | iso_pu_bacteria | 2884298095 | 2884300827 | 461 |
| 42 | iso_pu_bacteria | 2889306138 | 2889307150 | 461 |
| 43 | iso_pu_bacteria | 2891048133 | 2891050865 | 461 |
| 44 | iso_pu_bacteria | 2902330777 | 2902333016 | 461 |
| 45 | iso_pu_bacteria | 2902405164 | 2902411941 | 461 |
| 46 | iso_pu_bacteria | 2928125067 | 2928129777 | 461 |
| 47 | iso_pu_bacteria | 2995392953 | 2995393042 | 461 |
| 48 | iso_pu_bacteria | 3003665799 | 3003667624 | 461 |
| 49 | iso_pu_bacteria | 641522639 | 641646788 | 461 |
| 50 | iso_pu_bacteria | 643348564 | 643604996 | 461 |
| 51 | 3300013307 | Ga0157372_10271572 | Ga0157372_102715722 | 462 |
| 52 | iso_pu_bacteria | 2507262055 | 2507511011 | 462 |
| 53 | iso_pu_bacteria | 2508501009 | 2508544832 | 462 |
| 54 | iso_pu_bacteria | 2508501042 | 2508696940 | 462 |
| 55 | iso_pu_bacteria | 2508501122 | 2509108404 | 462 |
| 56 | iso_pu_bacteria | 2508501128 | 2509148874 | 462 |
| 57 | iso_pu_bacteria | 2509276019 | 2509376463 | 462 |
| 58 | iso_pu_bacteria | 2509276021 | 2509392064 | 462 |
| 59 | iso_pu_bacteria | 2509276033 | 2509445655 | 462 |
| 60 | iso_pu_bacteria | 2509276033 | 2509447044 | 462 |
| 61 | iso_pu_bacteria | 2510065019 | 2510133946 | 462 |
| 62 | iso_pu_bacteria | 2510065057 | 2510306447 | 462 |
| 63 | iso_pu_bacteria | 2510461076 | 2510895364 | 462 |
| 64 | iso_pu_bacteria | 2510917028 | 2511187046 | 462 |
| 65 | iso_pu_bacteria | 2510917030 | 2511199020 | 462 |
| 66 | iso_pu_bacteria | 2511231028 | 2511395188 | 462 |
| 67 | iso_pu_bacteria | 2511231052 | 2511502237 | 462 |
| 68 | iso_pu_bacteria | 2512047086 | 2512533610 | 462 |
| 69 | iso_pu_bacteria | 2512875026 | 2512970701 | 462 |
| 70 | iso_pu_bacteria | 2513237084 | 2513567981 | 462 |
| 71 | iso_pu_bacteria | 2513237085 | 2513576933 | 462 |
| 72 | iso_pu_bacteria | 2513237086 | 2513584391 | 462 |
| 73 | iso_pu_bacteria | 2513237087 | 2513590303 | 462 |
| 74 | iso_pu_bacteria | 2513237088 | 2513596466 | 462 |
| 75 | iso_pu_bacteria | 2513237089 | 2513604255 | 462 |
| 76 | iso_pu_bacteria | 2513237091 | 2513618797 | 462 |
| 77 | iso_pu_bacteria | 2513237092 | 2513623485 | 462 |
| 78 | iso_pu_bacteria | 2513237093 | 2513633395 | 462 |
| 79 | iso_pu_bacteria | 2513237094 | 2513637469 | 462 |
| 80 | iso_pu_bacteria | 2513237095 | 2513649681 | 462 |
| 81 | iso_pu_bacteria | 2513237096 | 2513655025 | 462 |
| 82 | iso_pu_bacteria | 2513237098 | 2513677795 | 462 |
| 83 | iso_pu_bacteria | 2513237101 | 2513697432 | 462 |
| 84 | iso_pu_bacteria | 2513237102 | 2513699954 | 462 |
| 85 | iso_pu_bacteria | 2513237103 | 2513708057 | 462 |
| 86 | iso_pu_bacteria | 2513237104 | 2513716917 | 462 |
| 87 | iso_pu_bacteria | 2513237137 | 2513861041 | 462 |
| 88 | iso_pu_bacteria | 2513237138 | 2513865591 | 462 |
| 89 | iso_pu_bacteria | 2513237139 | 2513874651 | 462 |
| 90 | iso_pu_bacteria | 2513237140 | 2513884412 | 462 |
| 91 | iso_pu_bacteria | 2513237141 | 2513892084 | 462 |
| 92 | iso_pu_bacteria | 2513237143 | 2513905002 | 462 |
| 93 | iso_pu_bacteria | 2513237145 | 2513915952 | 462 |
| 94 | iso_pu_bacteria | 2513237146 | 2513925393 | 462 |
| 95 | iso_pu_bacteria | 2513237156 | 2513986832 | 462 |
| 96 | iso_pu_bacteria | 2513237159 | 2514001511 | 462 |
| 97 | iso_pu_bacteria | 2513237160 | 2514006396 | 462 |
| 98 | iso_pu_bacteria | 2513237161 | 2514010633 | 462 |
| 99 | iso_pu_bacteria | 2513237162 | 2514020016 | 462 |
| 100 | iso_pu_bacteria | 2515075009 | 2515112995 | 462 |
| 101 | iso_pu_bacteria | 2515154107 | 2515609013 | 462 |
| 102 | iso_pu_bacteria | 2515154113 | 2515638505 | 462 |
| 103 | iso_pu_bacteria | 2515154114 | 2515640954 | 462 |
| 104 | iso_pu_bacteria | 2515154116 | 2515655364 | 462 |
| 105 | iso_pu_bacteria | 2515154134 | 2515739473 | 462 |
| 106 | iso_pu_bacteria | 2516653046 | 2516893616 | 462 |
| 107 | iso_pu_bacteria | 2516653077 | 2517036695 | 462 |
| 108 | iso_pu_bacteria | 2516653085 | 2517077054 | 462 |
| 109 | iso_pu_bacteria | 2517093000 | 2517095822 | 462 |
| 110 | iso_pu_bacteria | 2517093001 | 2517100590 | 462 |
| 111 | iso_pu_bacteria | 2517287029 | 2517407394 | 462 |
| 112 | iso_pu_bacteria | 2517487022 | 2517570328 | 462 |
| 113 | iso_pu_bacteria | 2517572143 | 2517894743 | 462 |
| 114 | iso_pu_bacteria | 2519899620 | 2520377200 | 462 |
| 115 | iso_pu_bacteria | 2524023205 | 2524438186 | 462 |
| 116 | iso_pu_bacteria | 2524023207 | 2524448563 | 462 |
| 117 | iso_pu_bacteria | 2524023209 | 2524459580 | 462 |
| 118 | iso_pu_bacteria | 2524023210 | 2524464074 | 462 |
| 119 | iso_pu_bacteria | 2524023228 | 2524534491 | 462 |
| 120 | iso_pu_bacteria | 2528768022 | 2528849821 | 462 |
| 121 | iso_pu_bacteria | 2529292951 | 2530645962 | 462 |
| 122 | iso_pu_bacteria | 2537561587 | 2537875442 | 462 |
| 123 | iso_pu_bacteria | 2551306084 | 2551674551 | 462 |
| 124 | iso_pu_bacteria | 2551306084 | 2551677932 | 462 |
| 125 | iso_pu_bacteria | 2551306085 | 2551687745 | 462 |
| 126 | iso_pu_bacteria | 2551306093 | 2551741373 | 462 |
| 127 | iso_pu_bacteria | 2554235003 | 2554248224 | 462 |
| 128 | iso_pu_bacteria | 2558860100 | 2558864470 | 462 |
| 129 | iso_pu_bacteria | 2558860242 | 2559295340 | 462 |
| 130 | iso_pu_bacteria | 2582581283 | 2585166340 | 462 |
| 131 | iso_pu_bacteria | 2582581294 | 2585202279 | 462 |
| 132 | iso_pu_bacteria | 2582581298 | 2585222823 | 462 |
| 133 | iso_pu_bacteria | 2582581304 | 2585255075 | 462 |
| 134 | iso_pu_bacteria | 2582581306 | 2585267432 | 462 |
| 135 | iso_pu_bacteria | 2582581308 | 2585277474 | 462 |
| 136 | iso_pu_bacteria | 2582581315 | 2585323342 | 462 |
| 137 | iso_pu_bacteria | 2582581865 | 2585386500 | 462 |
| 138 | iso_pu_bacteria | 2582581866 | 2585393248 | 462 |
| 139 | iso_pu_bacteria | 2582581867 | 2585402406 | 462 |
| 140 | iso_pu_bacteria | 2585427526 | 2585527434 | 462 |
| 141 | iso_pu_bacteria | 2585427527 | 2585535101 | 462 |
| 142 | iso_pu_bacteria | 2585427528 | 2585538175 | 462 |
| 143 | iso_pu_bacteria | 2585427529 | 2585545406 | 462 |
| 144 | iso_pu_bacteria | 2585427530 | 2585555951 | 462 |
| 145 | iso_pu_bacteria | 2585427590 | 2585822907 | 462 |
| 146 | iso_pu_bacteria | 2585427593 | 2585836124 | 462 |
| 147 | iso_pu_bacteria | 2585427594 | 2585843218 | 462 |
| 148 | iso_pu_bacteria | 2599185156 | 2599331743 | 462 |
| 149 | iso_pu_bacteria | 2599185170 | 2599417309 | 462 |
| 150 | iso_pu_bacteria | 2599185210 | 2599601652 | 462 |
| 151 | iso_pu_bacteria | 2599185236 | 2599721920 | 462 |
| 152 | iso_pu_bacteria | 2600255279 | 2601610088 | 462 |
| 153 | iso_pu_bacteria | 2600255308 | 2601746863 | 462 |
| 154 | iso_pu_bacteria | 2602042107 | 2603862618 | 462 |
| 155 | iso_pu_bacteria | 2615840624 | 2616293373 | 462 |
| 156 | iso_pu_bacteria | 2615840626 | 2616308949 | 462 |
| 157 | iso_pu_bacteria | 2617270735 | 2617350775 | 462 |
| 158 | iso_pu_bacteria | 2617270741 | 2617373144 | 462 |
| 159 | iso_pu_bacteria | 2643221547 | 2643755172 | 462 |
| 160 | iso_pu_bacteria | 2643221568 | 2643856779 | 462 |
| 161 | iso_pu_bacteria | 2643221582 | 2643920352 | 462 |
| 162 | iso_pu_bacteria | 2643221599 | 2644003166 | 462 |
| 163 | iso_pu_bacteria | 2643221607 | 2644050527 | 462 |
| 164 | iso_pu_bacteria | 2643221618 | 2644107287 | 462 |
| 165 | iso_pu_bacteria | 2643221626 | 2644150853 | 462 |
| 166 | iso_pu_bacteria | 2643221634 | 2644193500 | 462 |
| 167 | iso_pu_bacteria | 2643221636 | 2644205755 | 462 |
| 168 | iso_pu_bacteria | 2643221637 | 2644209037 | 462 |
| 169 | iso_pu_bacteria | 2643221643 | 2644238688 | 462 |
| 170 | iso_pu_bacteria | 2643221651 | 2644287347 | 462 |
| 171 | iso_pu_bacteria | 2643221655 | 2644308682 | 462 |
| 172 | iso_pu_bacteria | 2643221659 | 2644335500 | 462 |
| 173 | iso_pu_bacteria | 2643221686 | 2644483445 | 462 |
| 174 | iso_pu_bacteria | 2643221688 | 2644492022 | 462 |
| 175 | iso_pu_bacteria | 2643221689 | 2644499656 | 462 |
| 176 | iso_pu_bacteria | 2643221693 | 2644521966 | 462 |
| 177 | iso_pu_bacteria | 2643221698 | 2644539905 | 462 |
| 178 | iso_pu_bacteria | 2643221712 | 2644614623 | 462 |
| 179 | iso_pu_bacteria | 2643221718 | 2644652567 | 462 |
| 180 | iso_pu_bacteria | 2643221733 | 2644732236 | 462 |
| 181 | iso_pu_bacteria | 2643221734 | 2644734965 | 462 |
| 182 | iso_pu_bacteria | 2643221736 | 2644745373 | 462 |
| 183 | iso_pu_bacteria | 2657244999 | 2657681552 | 462 |
| 184 | iso_pu_bacteria | 2667528174 | 2671111438 | 462 |
| 185 | iso_pu_bacteria | 2667528175 | 2671119156 | 462 |
| 186 | iso_pu_bacteria | 2718217927 | 2719386400 | 462 |
| 187 | iso_pu_bacteria | 2718217997 | 2719666148 | 462 |
| 188 | iso_pu_bacteria | 2718218199 | 2720492568 | 462 |
| 189 | iso_pu_bacteria | 2718218232 | 2720614003 | 462 |
| 190 | iso_pu_bacteria | 2718218233 | 2720620808 | 462 |
| 191 | iso_pu_bacteria | 2718218235 | 2720632133 | 462 |
| 192 | iso_pu_bacteria | 2718218269 | 2720775861 | 462 |
| 193 | iso_pu_bacteria | 2718218423 | 2721400104 | 462 |
| 194 | iso_pu_bacteria | 2721755556 | 2723027465 | 462 |
| 195 | iso_pu_bacteria | 2721755684 | 2723561084 | 462 |
| 196 | iso_pu_bacteria | 2721755685 | 2723567680 | 462 |
| 197 | iso_pu_bacteria | 2721755755 | 2723843077 | 462 |
| 198 | iso_pu_bacteria | 2721755809 | 2724038917 | 462 |
| 199 | iso_pu_bacteria | 2721755819 | 2724090468 | 462 |
| 200 | iso_pu_bacteria | 2721755822 | 2724104945 | 462 |
| 201 | iso_pu_bacteria | 2721755823 | 2724110804 | 462 |
| 202 | iso_pu_bacteria | 2724679232 | 2725952570 | 462 |
| 203 | iso_pu_bacteria | 2728368998 | 2728747602 | 462 |
| 204 | iso_pu_bacteria | 2728369352 | 2730108401 | 462 |
| 205 | iso_pu_bacteria | 2738541281 | 2738744682 | 462 |
| 206 | iso_pu_bacteria | 2738541317 | 2738947343 | 462 |
| 207 | iso_pu_bacteria | 2738541333 | 2739032832 | 462 |
| 208 | iso_pu_bacteria | 2738543032 | 2739353912 | 462 |
| 209 | iso_pu_bacteria | 2744054633 | 2745076932 | 462 |
| 210 | iso_pu_bacteria | 2751185821 | 2753462020 | 462 |
| 211 | iso_pu_bacteria | 2765235942 | 2766065860 | 462 |
| 212 | iso_pu_bacteria | 2767802442 | 2770195434 | 462 |
| 213 | iso_pu_bacteria | 2775506902 | 2776270629 | 462 |
| 214 | iso_pu_bacteria | 2775506904 | 2776280548 | 462 |
| 215 | iso_pu_bacteria | 2791355082 | 2792585135 | 462 |
| 216 | iso_pu_bacteria | 2791355196 | 2793064663 | 462 |
| 217 | iso_pu_bacteria | 2791355197 | 2793071217 | 462 |
| 218 | iso_pu_bacteria | 2791355199 | 2793079516 | 462 |
| 219 | iso_pu_bacteria | 2791355253 | 2793280312 | 462 |
| 220 | iso_pu_bacteria | 2791355256 | 2793294446 | 462 |
| 221 | iso_pu_bacteria | 2791355259 | 2793314552 | 462 |
| 222 | iso_pu_bacteria | 2791355260 | 2793320380 | 462 |
| 223 | iso_pu_bacteria | 2791355261 | 2793329549 | 462 |
| 224 | iso_pu_bacteria | 2791355262 | 2793334481 | 462 |
| 225 | iso_pu_bacteria | 2791355263 | 2793339198 | 462 |
| 226 | iso_pu_bacteria | 2791355265 | 2793351841 | 462 |
| 227 | iso_pu_bacteria | 2791355266 | 2793362593 | 462 |
| 228 | iso_pu_bacteria | 2791355267 | 2793368883 | 462 |
| 229 | iso_pu_bacteria | 2802428858 | 2802720023 | 462 |
| 230 | iso_pu_bacteria | 2802428859 | 2802727044 | 462 |
| 231 | iso_pu_bacteria | 2802428860 | 2802731953 | 462 |
| 232 | iso_pu_bacteria | 2802428861 | 2802739284 | 462 |
| 233 | iso_pu_bacteria | 2802428862 | 2802745735 | 462 |
| 234 | iso_pu_bacteria | 2802428863 | 2802752336 | 462 |
| 235 | iso_pu_bacteria | 2802429268 | 2804752744 | 462 |
| 236 | iso_pu_bacteria | 2802429603 | 2805916648 | 462 |
| 237 | iso_pu_bacteria | 2802429605 | 2805928810 | 462 |
| 238 | iso_pu_bacteria | 2802429606 | 2805935092 | 462 |
| 239 | iso_pu_bacteria | 2802429633 | 2806043812 | 462 |
| 240 | iso_pu_bacteria | 2802429634 | 2806050257 | 462 |
| 241 | iso_pu_bacteria | 2802429635 | 2806057073 | 462 |
| 242 | iso_pu_bacteria | 2802429636 | 2806064455 | 462 |
| 243 | iso_pu_bacteria | 2802429637 | 2806071722 | 462 |
| 244 | iso_pu_bacteria | 2808606387 | 2808987926 | 462 |
| 245 | iso_pu_bacteria | 2816332527 | 2818238152 | 462 |
| 246 | iso_pu_bacteria | 2818991439 | 2819559053 | 462 |
| 247 | iso_pu_bacteria | 2818991448 | 2819609140 | 462 |
| 248 | iso_pu_bacteria | 2818991453 | 2819637632 | 462 |
| 249 | iso_pu_bacteria | 2818991461 | 2819684903 | 462 |
| 250 | iso_pu_bacteria | 2818991467 | 2819719516 | 462 |
| 251 | iso_pu_bacteria | 2824600985 | 2824607729 | 462 |
| 252 | iso_pu_bacteria | 2824609381 | 2824617133 | 462 |
| 253 | iso_pu_bacteria | 2824617872 | 2824624259 | 462 |
| 254 | iso_pu_bacteria | 2824626560 | 2824633059 | 462 |
| 255 | iso_pu_bacteria | 2824635225 | 2824643386 | 462 |
| 256 | iso_pu_bacteria | 2824644064 | 2824648777 | 462 |
| 257 | iso_pu_bacteria | 2824653114 | 2824658710 | 462 |
| 258 | iso_pu_bacteria | 2824661429 | 2824668265 | 462 |
| 259 | iso_pu_bacteria | 2824671348 | 2824676177 | 462 |
| 260 | iso_pu_bacteria | 2824679649 | 2824682886 | 462 |
| 261 | iso_pu_bacteria | 2824687955 | 2824692365 | 462 |
| 262 | iso_pu_bacteria | 2824696289 | 2824704002 | 462 |
| 263 | iso_pu_bacteria | 2824704595 | 2824713586 | 462 |
| 264 | iso_pu_bacteria | 2824714736 | 2824722394 | 462 |
| 265 | iso_pu_bacteria | 2824723954 | 2824731667 | 462 |
| 266 | iso_pu_bacteria | 2824732956 | 2824740351 | 462 |
| 267 | iso_pu_bacteria | 2824746037 | 2824751539 | 462 |
| 268 | iso_pu_bacteria | 2824753945 | 2824761223 | 462 |
| 269 | iso_pu_bacteria | 2824763712 | 2824771852 | 462 |
| 270 | iso_pu_bacteria | 2824773399 | 2824780543 | 462 |
| 271 | iso_pu_bacteria | 2828305725 | 2828308675 | 462 |
| 272 | iso_pu_bacteria | 2829745981 | 2829749745 | 462 |
| 273 | iso_pu_bacteria | 2837678835 | 2837683126 | 462 |
| 274 | iso_pu_bacteria | 2838016132 | 2838017662 | 462 |
| 275 | iso_pu_bacteria | 2838022645 | 2838027537 | 462 |
| 276 | iso_pu_bacteria | 2838029111 | 2838029814 | 462 |
| 277 | iso_pu_bacteria | 2838035591 | 2838038491 | 462 |
| 278 | iso_pu_bacteria | 2838042994 | 2838043959 | 462 |
| 279 | iso_pu_bacteria | 2838048938 | 2838054395 | 462 |
| 280 | iso_pu_bacteria | 2838061910 | 2838068024 | 462 |
| 281 | iso_pu_bacteria | 2838068647 | 2838070152 | 462 |
| 282 | iso_pu_bacteria | 2838074704 | 2838076867 | 462 |
| 283 | iso_pu_bacteria | 2838122688 | 2838127895 | 462 |
| 284 | iso_pu_bacteria | 2838661181 | 2838661598 | 462 |
| 285 | iso_pu_bacteria | 2838668709 | 2838670351 | 462 |
| 286 | iso_pu_bacteria | 2838675328 | 2838675785 | 462 |
| 287 | iso_pu_bacteria | 2838680041 | 2838683477 | 462 |
| 288 | iso_pu_bacteria | 2838686498 | 2838687064 | 462 |
| 289 | iso_pu_bacteria | 2838694306 | 2838697580 | 462 |
| 290 | iso_pu_bacteria | 2838701080 | 2838702722 | 462 |
| 291 | iso_pu_bacteria | 2838707686 | 2838710696 | 462 |
| 292 | iso_pu_bacteria | 2838714209 | 2838714667 | 462 |
| 293 | iso_pu_bacteria | 2838719591 | 2838721532 | 462 |
| 294 | iso_pu_bacteria | 2838724970 | 2838725427 | 462 |
| 295 | iso_pu_bacteria | 2838729681 | 2838729963 | 462 |
| 296 | iso_pu_bacteria | 2838742623 | 2838743022 | 462 |
| 297 | iso_pu_bacteria | 2840764183 | 2840767422 | 462 |
| 298 | iso_pu_bacteria | 2841760612 | 2841760885 | 462 |
| 299 | iso_pu_bacteria | 2841846520 | 2841848484 | 462 |
| 300 | iso_pu_bacteria | 2841851746 | 2841852508 | 462 |
| 301 | iso_pu_bacteria | 2841859092 | 2841862115 | 462 |
| 302 | iso_pu_bacteria | 2841864319 | 2841870773 | 462 |
| 303 | iso_pu_bacteria | 2841911363 | 2841912877 | 462 |
| 304 | iso_pu_bacteria | 2841917233 | 2841918624 | 462 |
| 305 | iso_pu_bacteria | 2841941048 | 2841943188 | 462 |
| 306 | iso_pu_bacteria | 2841949485 | 2841954081 | 462 |
| 307 | iso_pu_bacteria | 2841966195 | 2841968171 | 462 |
| 308 | iso_pu_bacteria | 2841974524 | 2841976619 | 462 |
| 309 | iso_pu_bacteria | 2841983080 | 2841987992 | 462 |
| 310 | iso_pu_bacteria | 2842038055 | 2842042705 | 462 |
| 311 | iso_pu_bacteria | 2842045827 | 2842050748 | 462 |
| 312 | iso_pu_bacteria | 2842077413 | 2842078869 | 462 |
| 313 | iso_pu_bacteria | 2842110456 | 2842113279 | 462 |
| 314 | iso_pu_bacteria | 2842118031 | 2842118621 | 462 |
| 315 | iso_pu_bacteria | 2842124991 | 2842125485 | 462 |
| 316 | iso_pu_bacteria | 2842130223 | 2842130680 | 462 |
| 317 | iso_pu_bacteria | 2842146304 | 2842148020 | 462 |
| 318 | iso_pu_bacteria | 2842152218 | 2842154150 | 462 |
| 319 | iso_pu_bacteria | 2842156927 | 2842158032 | 462 |
| 320 | iso_pu_bacteria | 2842163707 | 2842168804 | 462 |
| 321 | iso_pu_bacteria | 2842170452 | 2842170911 | 462 |
| 322 | iso_pu_bacteria | 2842175837 | 2842177770 | 462 |
| 323 | iso_pu_bacteria | 2842180545 | 2842181651 | 462 |
| 324 | iso_pu_bacteria | 2842187318 | 2842187776 | 462 |
| 325 | iso_pu_bacteria | 2842192696 | 2842197348 | 462 |
| 326 | iso_pu_bacteria | 2842198810 | 2842203547 | 462 |
| 327 | iso_pu_bacteria | 2842205361 | 2842205489 | 462 |
| 328 | iso_pu_bacteria | 2842211629 | 2842212087 | 462 |
| 329 | iso_pu_bacteria | 2842217011 | 2842217927 | 462 |
| 330 | iso_pu_bacteria | 2842224351 | 2842226294 | 462 |
| 331 | iso_pu_bacteria | 2842229732 | 2842230298 | 462 |
| 332 | iso_pu_bacteria | 2842237096 | 2842240533 | 462 |
| 333 | iso_pu_bacteria | 2842243621 | 2842244200 | 462 |
| 334 | iso_pu_bacteria | 2842250916 | 2842253086 | 462 |
| 335 | iso_pu_bacteria | 2842257432 | 2842257714 | 462 |
| 336 | iso_pu_bacteria | 2842264693 | 2842266257 | 462 |
| 337 | iso_pu_bacteria | 2842271015 | 2842271398 | 462 |
| 338 | iso_pu_bacteria | 2842278818 | 2842278946 | 462 |
| 339 | iso_pu_bacteria | 2842285085 | 2842285610 | 462 |
| 340 | iso_pu_bacteria | 2842291075 | 2842292531 | 462 |
| 341 | iso_pu_bacteria | 2842298080 | 2842301361 | 462 |
| 342 | iso_pu_bacteria | 2842304105 | 2842305026 | 462 |
| 343 | iso_pu_bacteria | 2842311132 | 2842314922 | 462 |
| 344 | iso_pu_bacteria | 2842317721 | 2842320700 | 462 |
| 345 | iso_pu_bacteria | 2842341865 | 2842346449 | 462 |
| 346 | iso_pu_bacteria | 2842357229 | 2842357898 | 462 |
| 347 | iso_pu_bacteria | 2842363717 | 2842368972 | 462 |
| 348 | iso_pu_bacteria | 2842370503 | 2842374108 | 462 |
| 349 | iso_pu_bacteria | 2842377471 | 2842378929 | 462 |
| 350 | iso_pu_bacteria | 2842384541 | 2842385132 | 462 |
| 351 | iso_pu_bacteria | 2842395702 | 2842399893 | 462 |
| 352 | iso_pu_bacteria | 2842402390 | 2842402970 | 462 |
| 353 | iso_pu_bacteria | 2842409023 | 2842409658 | 462 |
| 354 | iso_pu_bacteria | 2842415677 | 2842416309 | 462 |
| 355 | iso_pu_bacteria | 2842422224 | 2842423766 | 462 |
| 356 | iso_pu_bacteria | 2842428310 | 2842430720 | 462 |
| 357 | iso_pu_bacteria | 2842434925 | 2842437293 | 462 |
| 358 | iso_pu_bacteria | 2842441272 | 2842443663 | 462 |
| 359 | iso_pu_bacteria | 2842447887 | 2842454042 | 462 |
| 360 | iso_pu_bacteria | 2842462802 | 2842464863 | 462 |
| 361 | iso_pu_bacteria | 2842469257 | 2842471911 | 462 |
| 362 | iso_pu_bacteria | 2842475841 | 2842476901 | 462 |
| 363 | iso_pu_bacteria | 2842482326 | 2842484569 | 462 |
| 364 | iso_pu_bacteria | 2842489311 | 2842491968 | 462 |
| 365 | iso_pu_bacteria | 2842495871 | 2842496836 | 462 |
| 366 | iso_pu_bacteria | 2842502639 | 2842503342 | 462 |
| 367 | iso_pu_bacteria | 2842509118 | 2842511138 | 462 |
| 368 | iso_pu_bacteria | 2842515876 | 2842518899 | 462 |
| 369 | iso_pu_bacteria | 2842521101 | 2842521806 | 462 |
| 370 | iso_pu_bacteria | 2842694124 | 2842697046 | 462 |
| 371 | iso_pu_bacteria | 2842698319 | 2842702400 | 462 |
| 372 | iso_pu_bacteria | 2842922631 | 2842924148 | 462 |
| 373 | iso_pu_bacteria | 2844104063 | 2844106542 | 462 |
| 374 | iso_pu_bacteria | 2844163670 | 2844164564 | 462 |
| 375 | iso_pu_bacteria | 2844315083 | 2844316915 | 462 |
| 376 | iso_pu_bacteria | 2844454524 | 2844458431 | 462 |
| 377 | iso_pu_bacteria | 2847417321 | 2847419389 | 462 |
| 378 | iso_pu_bacteria | 2847930680 | 2847938562 | 462 |
| 379 | iso_pu_bacteria | 2847939898 | 2847944238 | 462 |
| 380 | iso_pu_bacteria | 2848992105 | 2848994416 | 462 |
| 381 | iso_pu_bacteria | 2849076700 | 2849081529 | 462 |
| 382 | iso_pu_bacteria | 2850079185 | 2850081459 | 462 |
| 383 | iso_pu_bacteria | 2851182111 | 2851187535 | 462 |
| 384 | iso_pu_bacteria | 2851246043 | 2851246898 | 462 |
| 385 | iso_pu_bacteria | 2852387548 | 2852390215 | 462 |
| 386 | iso_pu_bacteria | 2855825444 | 2855826336 | 462 |
| 387 | iso_pu_bacteria | 2855839649 | 2855841726 | 462 |
| 388 | iso_pu_bacteria | 2855872281 | 2855872529 | 462 |
| 389 | iso_pu_bacteria | 2857509624 | 2857512188 | 462 |
| 390 | iso_pu_bacteria | 2857516855 | 2857517443 | 462 |
| 391 | iso_pu_bacteria | 2857524615 | 2857529966 | 462 |
| 392 | iso_pu_bacteria | 2858800743 | 2858802511 | 462 |
| 393 | iso_pu_bacteria | 2861691609 | 2861693453 | 462 |
| 394 | iso_pu_bacteria | 2874604998 | 2874612592 | 462 |
| 395 | iso_pu_bacteria | 2874612657 | 2874617698 | 462 |
| 396 | iso_pu_bacteria | 2874620515 | 2874623436 | 462 |
| 397 | iso_pu_bacteria | 2874628541 | 2874630654 | 462 |
| 398 | iso_pu_bacteria | 2876761206 | 2876762403 | 462 |
| 399 | iso_pu_bacteria | 2876808645 | 2876812894 | 462 |
| 400 | iso_pu_bacteria | 2879099564 | 2879101349 | 462 |
| 401 | iso_pu_bacteria | 2879110137 | 2879118033 | 462 |
| 402 | iso_pu_bacteria | 2879127579 | 2879130504 | 462 |
| 403 | iso_pu_bacteria | 2879142872 | 2879146390 | 462 |
| 404 | iso_pu_bacteria | 2881364244 | 2881370680 | 462 |
| 405 | iso_pu_bacteria | 2881665667 | 2881672685 | 462 |
| 406 | iso_pu_bacteria | 2885366525 | 2885366935 | 462 |
| 407 | iso_pu_bacteria | 2885374607 | 2885378765 | 462 |
| 408 | iso_pu_bacteria | 2885383462 | 2885384489 | 462 |
| 409 | iso_pu_bacteria | 2885409591 | 2885413433 | 462 |
| 410 | iso_pu_bacteria | 2888378607 | 2888381525 | 462 |
| 411 | iso_pu_bacteria | 2888388044 | 2888389114 | 462 |
| 412 | iso_pu_bacteria | 2888419890 | 2888421928 | 462 |
| 413 | iso_pu_bacteria | 2889033259 | 2889033622 | 462 |
| 414 | iso_pu_bacteria | 2891373044 | 2891373339 | 462 |
| 415 | iso_pu_bacteria | 2893066018 | 2893069391 | 462 |
| 416 | iso_pu_bacteria | 2894817345 | 2894820350 | 462 |
| 417 | iso_pu_bacteria | 2896384573 | 2896389034 | 462 |
| 418 | iso_pu_bacteria | 2899792073 | 2899796061 | 462 |
| 419 | iso_pu_bacteria | 2899845264 | 2899850639 | 462 |
| 420 | iso_pu_bacteria | 2903727486 | 2903733965 | 462 |
| 421 | iso_pu_bacteria | 2903748898 | 2903751425 | 462 |
| 422 | iso_pu_bacteria | 2903768456 | 2903773625 | 462 |
| 423 | iso_pu_bacteria | 2904666416 | 2904667333 | 462 |
| 424 | iso_pu_bacteria | 2904690495 | 2904697726 | 462 |
| 425 | iso_pu_bacteria | 2904699407 | 2904705788 | 462 |
| 426 | iso_pu_bacteria | 2904711408 | 2904719227 | 462 |
| 427 | iso_pu_bacteria | 2906602504 | 2906604581 | 462 |
| 428 | iso_pu_bacteria | 2906610324 | 2906611462 | 462 |
| 429 | iso_pu_bacteria | 2906626472 | 2906635178 | 462 |
| 430 | iso_pu_bacteria | 2906635258 | 2906641700 | 462 |
| 431 | iso_pu_bacteria | 2906643746 | 2906651201 | 462 |
| 432 | iso_pu_bacteria | 2906660503 | 2906660802 | 462 |
| 433 | iso_pu_bacteria | 2908739725 | 2908745054 | 462 |
| 434 | iso_pu_bacteria | 2908756301 | 2908757177 | 462 |
| 435 | iso_pu_bacteria | 2908775508 | 2908781599 | 462 |
| 436 | iso_pu_bacteria | 2909042592 | 2909044262 | 462 |
| 437 | iso_pu_bacteria | 2913295892 | 2913299319 | 462 |
| 438 | iso_pu_bacteria | 2913308742 | 2913312559 | 462 |
| 439 | iso_pu_bacteria | 2915980308 | 2915981435 | 462 |
| 440 | iso_pu_bacteria | 2915986958 | 2915988285 | 462 |
| 441 | iso_pu_bacteria | 2915993759 | 2915998696 | 462 |
| 442 | iso_pu_bacteria | 2916000859 | 2916003491 | 462 |
| 443 | iso_pu_bacteria | 2916007675 | 2916011661 | 462 |
| 444 | iso_pu_bacteria | 2916014648 | 2916020773 | 462 |
| 445 | iso_pu_bacteria | 2916021584 | 2916024962 | 462 |
| 446 | iso_pu_bacteria | 2916028427 | 2916033775 | 462 |
| 447 | iso_pu_bacteria | 2916035215 | 2916037862 | 462 |
| 448 | iso_pu_bacteria | 2916041962 | 2916045338 | 462 |
| 449 | iso_pu_bacteria | 2916048683 | 2916049038 | 462 |
| 450 | iso_pu_bacteria | 2916055098 | 2916055724 | 462 |
| 451 | iso_pu_bacteria | 2916061851 | 2916064908 | 462 |
| 452 | iso_pu_bacteria | 2916068649 | 2916073999 | 462 |
| 453 | iso_pu_bacteria | 2916076590 | 2916082594 | 462 |
| 454 | iso_pu_bacteria | 2917699015 | 2917704755 | 462 |
| 455 | iso_pu_bacteria | 2919073203 | 2919077181 | 462 |
| 456 | iso_pu_bacteria | 2919100787 | 2919107666 | 462 |
| 457 | iso_pu_bacteria | 2919114240 | 2919114705 | 462 |
| 458 | iso_pu_bacteria | 2919166419 | 2919169234 | 462 |
| 459 | iso_pu_bacteria | 2919408235 | 2919409971 | 462 |
| 460 | iso_pu_bacteria | 2919450847 | 2919452462 | 462 |
| 461 | iso_pu_bacteria | 2921201388 | 2921203056 | 462 |
| 462 | iso_pu_bacteria | 2921208531 | 2921211116 | 462 |
| 463 | iso_pu_bacteria | 2921237296 | 2921240934 | 462 |
| 464 | iso_pu_bacteria | 2921244191 | 2921246778 | 462 |
| 465 | iso_pu_bacteria | 2921250672 | 2921252082 | 462 |
| 466 | iso_pu_bacteria | 2921257292 | 2921261403 | 462 |
| 467 | iso_pu_bacteria | 2921263974 | 2921266205 | 462 |
| 468 | iso_pu_bacteria | 2921282425 | 2921287971 | 462 |
| 469 | iso_pu_bacteria | 2921289301 | 2921290960 | 462 |
| 470 | iso_pu_bacteria | 2921296804 | 2921298406 | 462 |
| 471 | iso_pu_bacteria | 2922361189 | 2922366990 | 462 |
| 472 | iso_pu_bacteria | 2922368715 | 2922371193 | 462 |
| 473 | iso_pu_bacteria | 2922386360 | 2922390228 | 462 |
| 474 | iso_pu_bacteria | 2922393267 | 2922393565 | 462 |
| 475 | iso_pu_bacteria | 2922425934 | 2922427895 | 462 |
| 476 | iso_pu_bacteria | 2923556063 | 2923558564 | 462 |
| 477 | iso_pu_bacteria | 2924144063 | 2924146758 | 462 |
| 478 | iso_pu_bacteria | 2924150972 | 2924157996 | 462 |
| 479 | iso_pu_bacteria | 2924158325 | 2924159270 | 462 |
| 480 | iso_pu_bacteria | 2924165586 | 2924169165 | 462 |
| 481 | iso_pu_bacteria | 2924172951 | 2924174573 | 462 |
| 482 | iso_pu_bacteria | 2924179722 | 2924183004 | 462 |
| 483 | iso_pu_bacteria | 2924186466 | 2924192715 | 462 |
| 484 | iso_pu_bacteria | 2924193448 | 2924195380 | 462 |
| 485 | iso_pu_bacteria | 2924200457 | 2924203329 | 462 |
| 486 | iso_pu_bacteria | 2924207177 | 2924210748 | 462 |
| 487 | iso_pu_bacteria | 2924214083 | 2924217481 | 462 |
| 488 | iso_pu_bacteria | 2924221636 | 2924223298 | 462 |
| 489 | iso_pu_bacteria | 2924228884 | 2924230516 | 462 |
| 490 | iso_pu_bacteria | 2926754445 | 2926755721 | 462 |
| 491 | iso_pu_bacteria | 2926760298 | 2926762836 | 462 |
| 492 | iso_pu_bacteria | 2929615660 | 2929619577 | 462 |
| 493 | iso_pu_bacteria | 2929624759 | 2929627953 | 462 |
| 494 | iso_pu_bacteria | 2932784394 | 2932785907 | 462 |
| 495 | iso_pu_bacteria | 2932794094 | 2932798313 | 462 |
| 496 | iso_pu_bacteria | 2932801729 | 2932804109 | 462 |
| 497 | iso_pu_bacteria | 2932809354 | 2932817277 | 462 |
| 498 | iso_pu_bacteria | 2932818245 | 2932826874 | 462 |
| 499 | iso_pu_bacteria | 2932828146 | 2932830951 | 462 |
| 500 | iso_pu_bacteria | 2933006813 | 2933008795 | 462 |
| 501 | iso_pu_bacteria | 2933011516 | 2933014927 | 462 |
| 502 | iso_pu_bacteria | 2933016740 | 2933019436 | 462 |
| 503 | iso_pu_bacteria | 2933570622 | 2933570834 | 462 |
| 504 | iso_pu_bacteria | 2933577622 | 2933581497 | 462 |
| 505 | iso_pu_bacteria | 2933586486 | 2933588665 | 462 |
| 506 | iso_pu_bacteria | 2933594066 | 2933596604 | 462 |
| 507 | iso_pu_bacteria | 2933599457 | 2933600958 | 462 |
| 508 | iso_pu_bacteria | 2935608549 | 2935612752 | 462 |
| 509 | iso_pu_bacteria | 2935616580 | 2935621016 | 462 |
| 510 | iso_pu_bacteria | 2935630451 | 2935632178 | 462 |
| 511 | iso_pu_bacteria | 2935638405 | 2935640092 | 462 |
| 512 | iso_pu_bacteria | 2935648319 | 2935656720 | 462 |
| 513 | iso_pu_bacteria | 2935656913 | 2935665541 | 462 |
| 514 | iso_pu_bacteria | 2935665750 | 2935667069 | 462 |
| 515 | iso_pu_bacteria | 2935675223 | 2935680288 | 462 |
| 516 | iso_pu_bacteria | 2935684952 | 2935690201 | 462 |
| 517 | iso_pu_bacteria | 2935694250 | 2935699713 | 462 |
| 518 | iso_pu_bacteria | 2935703347 | 2935704825 | 462 |
| 519 | iso_pu_bacteria | 2935713505 | 2935718102 | 462 |
| 520 | iso_pu_bacteria | 2935722832 | 2935726748 | 462 |
| 521 | iso_pu_bacteria | 2935732158 | 2935735517 | 462 |
| 522 | iso_pu_bacteria | 2935741537 | 2935745212 | 462 |
| 523 | iso_pu_bacteria | 2935750917 | 2935755212 | 462 |
| 524 | iso_pu_bacteria | 2935760218 | 2935762270 | 462 |
| 525 | iso_pu_bacteria | 2935769743 | 2935773658 | 462 |
| 526 | iso_pu_bacteria | 2935777560 | 2935780213 | 462 |
| 527 | iso_pu_bacteria | 2935785616 | 2935788437 | 462 |
| 528 | iso_pu_bacteria | 2935793552 | 2935796593 | 462 |
| 529 | iso_pu_bacteria | 2935801545 | 2935803773 | 462 |
| 530 | iso_pu_bacteria | 2935810662 | 2935811688 | 462 |
| 531 | iso_pu_bacteria | 2935819856 | 2935824241 | 462 |
| 532 | iso_pu_bacteria | 2935827899 | 2935829575 | 462 |
| 533 | iso_pu_bacteria | 2935837841 | 2935843091 | 462 |
| 534 | iso_pu_bacteria | 2935847175 | 2935852612 | 462 |
| 535 | iso_pu_bacteria | 2935855204 | 2935858823 | 462 |
| 536 | iso_pu_bacteria | 2935864058 | 2935866779 | 462 |
| 537 | iso_pu_bacteria | 2935873716 | 2935876910 | 462 |
| 538 | iso_pu_bacteria | 2935883170 | 2935884085 | 462 |
| 539 | iso_pu_bacteria | 2935894831 | 2935897035 | 462 |
| 540 | iso_pu_bacteria | 2935901341 | 2935901968 | 462 |
| 541 | iso_pu_bacteria | 2935908558 | 2935912242 | 462 |
| 542 | iso_pu_bacteria | 2935916978 | 2935924084 | 462 |
| 543 | iso_pu_bacteria | 2935926038 | 2935929271 | 462 |
| 544 | iso_pu_bacteria | 2935934488 | 2935935902 | 462 |
| 545 | iso_pu_bacteria | 2935942939 | 2935950410 | 462 |
| 546 | iso_pu_bacteria | 2935951376 | 2935957432 | 462 |
| 547 | iso_pu_bacteria | 2935959822 | 2935962045 | 462 |
| 548 | iso_pu_bacteria | 2935967501 | 2935968463 | 462 |
| 549 | iso_pu_bacteria | 2935984226 | 2935990724 | 462 |
| 550 | iso_pu_bacteria | 2935992306 | 2935993453 | 462 |
| 551 | iso_pu_bacteria | 2936002035 | 2936004348 | 462 |
| 552 | iso_pu_bacteria | 2936011229 | 2936019583 | 462 |
| 553 | iso_pu_bacteria | 2936019824 | 2936028199 | 462 |
| 554 | iso_pu_bacteria | 2936028420 | 2936037072 | 462 |
| 555 | iso_pu_bacteria | 2936037263 | 2936038270 | 462 |
| 556 | iso_pu_bacteria | 2936046547 | 2936055056 | 462 |
| 557 | iso_pu_bacteria | 2936055302 | 2936058608 | 462 |
| 558 | iso_pu_bacteria | 2936367885 | 2936372047 | 462 |
| 559 | iso_pu_bacteria | 2936375103 | 2936379910 | 462 |
| 560 | iso_pu_bacteria | 2936381700 | 2936382814 | 462 |
| 561 | iso_pu_bacteria | 2936996657 | 2937000700 | 462 |
| 562 | iso_pu_bacteria | 2937002841 | 2937004564 | 462 |
| 563 | iso_pu_bacteria | 2937009748 | 2937011192 | 462 |
| 564 | iso_pu_bacteria | 2937016420 | 2937019829 | 462 |
| 565 | iso_pu_bacteria | 2937023124 | 2937024578 | 462 |
| 566 | iso_pu_bacteria | 2937029754 | 2937030281 | 462 |
| 567 | iso_pu_bacteria | 2937036028 | 2937042663 | 462 |
| 568 | iso_pu_bacteria | 2937042894 | 2937045534 | 462 |
| 569 | iso_pu_bacteria | 2937049772 | 2937055111 | 462 |
| 570 | iso_pu_bacteria | 2937056579 | 2937063576 | 462 |
| 571 | iso_pu_bacteria | 2937063883 | 2937067768 | 462 |
| 572 | iso_pu_bacteria | 2937071275 | 2937074385 | 462 |
| 573 | iso_pu_bacteria | 2937078374 | 2937080281 | 462 |
| 574 | iso_pu_bacteria | 2937084907 | 2937086020 | 462 |
| 575 | iso_pu_bacteria | 2937091812 | 2937097215 | 462 |
| 576 | iso_pu_bacteria | 2937098957 | 2937103041 | 462 |
| 577 | iso_pu_bacteria | 2937106411 | 2937113295 | 462 |
| 578 | iso_pu_bacteria | 2937113482 | 2937116150 | 462 |
| 579 | iso_pu_bacteria | 2937119839 | 2937121979 | 462 |
| 580 | iso_pu_bacteria | 2937126314 | 2937128820 | 462 |
| 581 | iso_pu_bacteria | 2937843397 | 2937847998 | 462 |
| 582 | iso_pu_bacteria | 2940556831 | 2940561507 | 462 |
| 583 | iso_pu_bacteria | 2941499720 | 2941502145 | 462 |
| 584 | iso_pu_bacteria | 2941507105 | 2941508126 | 462 |
| 585 | iso_pu_bacteria | 2941515067 | 2941515369 | 462 |
| 586 | iso_pu_bacteria | 2941523033 | 2941524056 | 462 |
| 587 | iso_pu_bacteria | 2941531003 | 2941533697 | 462 |
| 588 | iso_pu_bacteria | 2941538514 | 2941544315 | 462 |
| 589 | iso_pu_bacteria | 2957375807 | 2957376390 | 462 |
| 590 | iso_pu_bacteria | 2957382221 | 2957384283 | 462 |
| 591 | iso_pu_bacteria | 2957388812 | 2957390746 | 462 |
| 592 | iso_pu_bacteria | 2957395598 | 2957395902 | 462 |
| 593 | iso_pu_bacteria | 2957402308 | 2957404508 | 462 |
| 594 | iso_pu_bacteria | 2957408893 | 2957412095 | 462 |
| 595 | iso_pu_bacteria | 2957415311 | 2957421203 | 462 |
| 596 | iso_pu_bacteria | 2957430029 | 2957431710 | 462 |
| 597 | iso_pu_bacteria | 2957443900 | 2957446914 | 462 |
| 598 | iso_pu_bacteria | 2957450854 | 2957453756 | 462 |
| 599 | iso_pu_bacteria | 2957457609 | 2957461619 | 462 |
| 600 | iso_pu_bacteria | 2957464669 | 2957467050 | 462 |
| 601 | iso_pu_bacteria | 2957471148 | 2957476394 | 462 |
| 602 | iso_pu_bacteria | 2957478035 | 2957479610 | 462 |
| 603 | iso_pu_bacteria | 2957484790 | 2957490468 | 462 |
| 604 | iso_pu_bacteria | 2957491536 | 2957494101 | 462 |
| 605 | iso_pu_bacteria | 2957498199 | 2957503304 | 462 |
| 606 | iso_pu_bacteria | 2957505466 | 2957510608 | 462 |
| 607 | iso_pu_bacteria | 2960584000 | 2960585412 | 462 |
| 608 | iso_pu_bacteria | 2960591022 | 2960592081 | 462 |
| 609 | iso_pu_bacteria | 2960597568 | 2960599999 | 462 |
| 610 | iso_pu_bacteria | 2960603979 | 2960610583 | 462 |
| 611 | iso_pu_bacteria | 2960610863 | 2960612322 | 462 |
| 612 | iso_pu_bacteria | 2960617483 | 2960620458 | 462 |
| 613 | iso_pu_bacteria | 2960624210 | 2960624487 | 462 |
| 614 | iso_pu_bacteria | 2960631154 | 2960632041 | 462 |
| 615 | iso_pu_bacteria | 2960637947 | 2960644130 | 462 |
| 616 | iso_pu_bacteria | 2960645483 | 2960648421 | 462 |
| 617 | iso_pu_bacteria | 2960652885 | 2960656532 | 462 |
| 618 | iso_pu_bacteria | 2960660292 | 2960665573 | 462 |
| 619 | iso_pu_bacteria | 2960667422 | 2960669652 | 462 |
| 620 | iso_pu_bacteria | 2960674078 | 2960675166 | 462 |
| 621 | iso_pu_bacteria | 2960680706 | 2960681616 | 462 |
| 622 | iso_pu_bacteria | 2960687367 | 2960691474 | 462 |
| 623 | iso_pu_bacteria | 2960693952 | 2960694808 | 462 |
| 624 | iso_pu_bacteria | 2964607997 | 2964609778 | 462 |
| 625 | iso_pu_bacteria | 2964615318 | 2964617754 | 462 |
| 626 | iso_pu_bacteria | 2964621998 | 2964623639 | 462 |
| 627 | iso_pu_bacteria | 2964628898 | 2964632580 | 462 |
| 628 | iso_pu_bacteria | 2964636051 | 2964640825 | 462 |
| 629 | iso_pu_bacteria | 2964643177 | 2964645692 | 462 |
| 630 | iso_pu_bacteria | 2964649959 | 2964651549 | 462 |
| 631 | iso_pu_bacteria | 2964656573 | 2964660519 | 462 |
| 632 | iso_pu_bacteria | 2964663802 | 2964666929 | 462 |
| 633 | iso_pu_bacteria | 2964678106 | 2964682868 | 462 |
| 634 | iso_pu_bacteria | 2964685014 | 2964688476 | 462 |
| 635 | iso_pu_bacteria | 2964691889 | 2964692473 | 462 |
| 636 | iso_pu_bacteria | 2964698721 | 2964701649 | 462 |
| 637 | iso_pu_bacteria | 2964705432 | 2964711099 | 462 |
| 638 | iso_pu_bacteria | 2964712639 | 2964715166 | 462 |
| 639 | iso_pu_bacteria | 2964719344 | 2964720672 | 462 |
| 640 | iso_pu_bacteria | 2967664464 | 2967666387 | 462 |
| 641 | iso_pu_bacteria | 2967671571 | 2967678420 | 462 |
| 642 | iso_pu_bacteria | 2967678726 | 2967684432 | 462 |
| 643 | iso_pu_bacteria | 2967686174 | 2967689722 | 462 |
| 644 | iso_pu_bacteria | 2967693043 | 2967694637 | 462 |
| 645 | iso_pu_bacteria | 2967699805 | 2967704072 | 462 |
| 646 | iso_pu_bacteria | 2967706974 | 2967708615 | 462 |
| 647 | iso_pu_bacteria | 2967714385 | 2967714868 | 462 |
| 648 | iso_pu_bacteria | 2967721400 | 2967726130 | 462 |
| 649 | iso_pu_bacteria | 2967728569 | 2967729000 | 462 |
| 650 | iso_pu_bacteria | 2967735183 | 2967737141 | 462 |
| 651 | iso_pu_bacteria | 2967748971 | 2967751609 | 462 |
| 652 | iso_pu_bacteria | 2967755722 | 2967760011 | 462 |
| 653 | iso_pu_bacteria | 2967762386 | 2967767508 | 462 |
| 654 | iso_pu_bacteria | 2967769361 | 2967772127 | 462 |
| 655 | iso_pu_bacteria | 2967775926 | 2967782233 | 462 |
| 656 | iso_pu_bacteria | 2970019648 | 2970021068 | 462 |
| 657 | iso_pu_bacteria | 2970026789 | 2970028350 | 462 |
| 658 | iso_pu_bacteria | 2970033650 | 2970040283 | 462 |
| 659 | iso_pu_bacteria | 2970040964 | 2970042633 | 462 |
| 660 | iso_pu_bacteria | 2970047711 | 2970050964 | 462 |
| 661 | iso_pu_bacteria | 2970054988 | 2970056694 | 462 |
| 662 | iso_pu_bacteria | 2970061556 | 2970067136 | 462 |
| 663 | iso_pu_bacteria | 2970068827 | 2970071580 | 462 |
| 664 | iso_pu_bacteria | 2970076120 | 2970078256 | 462 |
| 665 | iso_pu_bacteria | 2970082768 | 2970085238 | 462 |
| 666 | iso_pu_bacteria | 2970088815 | 2970092540 | 462 |
| 667 | iso_pu_bacteria | 2970095765 | 2970102162 | 462 |
| 668 | iso_pu_bacteria | 2970102677 | 2970108005 | 462 |
| 669 | iso_pu_bacteria | 2970109326 | 2970110702 | 462 |
| 670 | iso_pu_bacteria | 2970116247 | 2970117348 | 462 |
| 671 | iso_pu_bacteria | 2970122695 | 2970125829 | 462 |
| 672 | iso_pu_bacteria | 2970129317 | 2970131172 | 462 |
| 673 | iso_pu_bacteria | 2970136068 | 2970136286 | 462 |
| 674 | iso_pu_bacteria | 2970143518 | 2970146735 | 462 |
| 675 | iso_pu_bacteria | 2970149975 | 2970151622 | 462 |
| 676 | iso_pu_bacteria | 2970156795 | 2970159561 | 462 |
| 677 | iso_pu_bacteria | 2970164137 | 2970166984 | 462 |
| 678 | iso_pu_bacteria | 2970170962 | 2970174236 | 462 |
| 679 | iso_pu_bacteria | 2970177841 | 2970180818 | 462 |
| 680 | iso_pu_bacteria | 2970184632 | 2970189163 | 462 |
| 681 | iso_pu_bacteria | 2970191845 | 2970193593 | 462 |
| 682 | iso_pu_bacteria | 2977516862 | 2977519109 | 462 |
| 683 | iso_pu_bacteria | 2977523885 | 2977526322 | 462 |
| 684 | iso_pu_bacteria | 2977530762 | 2977534062 | 462 |
| 685 | iso_pu_bacteria | 2977537788 | 2977539619 | 462 |
| 686 | iso_pu_bacteria | 2977544691 | 2977546353 | 462 |
| 687 | iso_pu_bacteria | 2977551784 | 2977558425 | 462 |
| 688 | iso_pu_bacteria | 2977558990 | 2977564446 | 462 |
| 689 | iso_pu_bacteria | 2977565890 | 2977567658 | 462 |
| 690 | iso_pu_bacteria | 2977572785 | 2977575753 | 462 |
| 691 | iso_pu_bacteria | 2977579622 | 2977582004 | 462 |
| 692 | iso_pu_bacteria | 2978969890 | 2978974610 | 462 |
| 693 | iso_pu_bacteria | 2979089926 | 2979094671 | 462 |
| 694 | iso_pu_bacteria | 2979095461 | 2979100764 | 462 |
| 695 | iso_pu_bacteria | 2979100975 | 2979103906 | 462 |
| 696 | iso_pu_bacteria | 2984509177 | 2984511527 | 462 |
| 697 | iso_pu_bacteria | 2984518228 | 2984522112 | 462 |
| 698 | iso_pu_bacteria | 2984537506 | 2984541410 | 462 |
| 699 | iso_pu_bacteria | 2984587000 | 2984589931 | 462 |
| 700 | iso_pu_bacteria | 2984601300 | 2984603688 | 462 |
| 701 | iso_pu_bacteria | 2989349275 | 2989349663 | 462 |
| 702 | iso_pu_bacteria | 2989771324 | 2989774278 | 462 |
| 703 | iso_pu_bacteria | 2996887358 | 2996889047 | 462 |
| 704 | iso_pu_bacteria | 2996893221 | 2996894340 | 462 |
| 705 | iso_pu_bacteria | 3002141150 | 3002144748 | 462 |
| 706 | iso_pu_bacteria | 3005416602 | 3005419479 | 462 |
| 707 | iso_pu_bacteria | 3005445848 | 3005448437 | 462 |
| 708 | iso_pu_bacteria | 3005452660 | 3005454627 | 462 |
| 709 | iso_pu_bacteria | 3005483717 | 3005486184 | 462 |
| 710 | iso_pu_bacteria | 3005506211 | 3005507125 | 462 |
| 711 | iso_pu_bacteria | 3005587118 | 3005588497 | 462 |
| 712 | iso_pu_bacteria | 3005594810 | 3005596549 | 462 |
| 713 | iso_pu_bacteria | 3005710791 | 3005712617 | 462 |
| 714 | iso_pu_bacteria | 3005718088 | 3005719678 | 462 |
| 715 | iso_pu_bacteria | 639633055 | 639649179 | 462 |
| 716 | iso_pu_bacteria | 648276728 | 648739205 | 462 |
| 717 | iso_pu_bacteria | 650716007 | 650740550 | 462 |
| 718 | iso_pu_bacteria | 8001845381 | 8001846144 | 462 |
| 719 | iso_pu_bacteria | 8002060224 | 8002062555 | 462 |
| 720 | iso_pu_bacteria | 8003570095 | 8003571615 | 462 |
| 721 | iso_pu_bacteria | 8003992118 | 8003994159 | 462 |
| 722 | iso_pu_bacteria | 8003999396 | 8004001791 | 462 |
| 723 | iso_pu_bacteria | 8005258706 | 8005260296 | 462 |
| 724 | iso_pu_bacteria | 8005275841 | 8005281197 | 462 |
| 725 | iso_pu_bacteria | 8005282627 | 8005283267 | 462 |
| 726 | iso_pu_bacteria | 8005289223 | 8005293627 | 462 |
| 727 | iso_pu_bacteria | 8005301065 | 8005303112 | 462 |
| 728 | iso_pu_bacteria | 8005307578 | 8005312821 | 462 |
| 729 | iso_pu_bacteria | 8005314921 | 8005316770 | 462 |
| 730 | iso_pu_bacteria | 8005321885 | 8005323574 | 462 |
| 731 | iso_pu_bacteria | 8005376324 | 8005380915 | 462 |
| 732 | iso_pu_bacteria | 8005382845 | 8005389135 | 462 |
| 733 | iso_pu_bacteria | 8005395548 | 8005396115 | 462 |
| 734 | iso_pu_bacteria | 8005430974 | 8005435144 | 462 |
| 735 | iso_pu_bacteria | 8005460587 | 8005463674 | 462 |
| 736 | iso_pu_bacteria | 8005484373 | 8005489196 | 462 |
| 737 | iso_pu_bacteria | 8005497431 | 8005500886 | 462 |
| 738 | iso_pu_bacteria | 8005556819 | 8005557028 | 462 |
| 739 | iso_pu_bacteria | 8005563573 | 8005567980 | 462 |
| 740 | iso_pu_bacteria | 8005570704 | 8005573475 | 462 |
| 741 | iso_pu_bacteria | 8005619151 | 8005622259 | 462 |
| 742 | iso_pu_bacteria | 8005626139 | 8005632261 | 462 |
| 743 | iso_pu_bacteria | 8005645114 | 8005648128 | 462 |
| 744 | iso_pu_bacteria | 8005668836 | 8005672303 | 462 |
| 745 | iso_pu_bacteria | 8005682033 | 8005682898 | 462 |
| 746 | iso_pu_bacteria | 8005688590 | 8005692120 | 462 |
| 747 | iso_pu_bacteria | 8005695170 | 8005697387 | 462 |
| 748 | iso_pu_bacteria | 8006933436 | 8006933613 | 462 |
| 749 | iso_pu_bacteria | 8006964411 | 8006966526 | 462 |
| 750 | iso_pu_bacteria | 8006973647 | 8006983286 | 462 |
| 751 | iso_pu_bacteria | 8006984368 | 8006989354 | 462 |
| 752 | iso_pu_bacteria | 8006994254 | 8006997836 | 462 |
| 753 | iso_pu_bacteria | 8016511872 | 8016516434 | 462 |
| 754 | iso_pu_bacteria | 8016522445 | 8016523834 | 462 |
| 755 | iso_pu_bacteria | 8016530956 | 8016537366 | 462 |
| 756 | iso_pu_bacteria | 8016539877 | 8016541635 | 462 |
| 757 | iso_pu_bacteria | 8016548790 | 8016551633 | 462 |
| 758 | iso_pu_bacteria | 8016557553 | 8016560019 | 462 |
| 759 | iso_pu_bacteria | 8016566248 | 8016567021 | 462 |
| 760 | iso_pu_bacteria | 8016575299 | 8016579741 | 462 |
| 761 | iso_pu_bacteria | 8016583857 | 8016589132 | 462 |
| 762 | iso_pu_bacteria | 8016595262 | 8016597944 | 462 |
| 763 | iso_pu_bacteria | 8016603502 | 8016604084 | 462 |
| 764 | iso_pu_bacteria | 8016613128 | 8016620666 | 462 |
| 765 | iso_pu_bacteria | 8016622563 | 8016629332 | 462 |
| 766 | iso_pu_bacteria | 8016630954 | 8016633847 | 462 |
| 767 | iso_pu_bacteria | 8017057580 | 8017060103 | 462 |
| 768 | iso_pu_bacteria | 8018127388 | 8018134081 | 462 |
| 769 | iso_pu_bacteria | 8018163183 | 8018164639 | 462 |
| 770 | iso_pu_bacteria | 8018176218 | 8018181338 | 462 |
| 771 | iso_pu_bacteria | 8019530166 | 8019537049 | 462 |
| 772 | iso_pu_bacteria | 8019538911 | 8019542491 | 462 |
| 773 | iso_pu_bacteria | 8019565922 | 8019569653 | 462 |
| 774 | iso_pu_bacteria | 8019576017 | 8019579613 | 462 |
| 775 | iso_pu_bacteria | 8019597564 | 8019604017 | 462 |
| 776 | iso_pu_bacteria | 8019608314 | 8019614511 | 462 |
| 777 | iso_pu_bacteria | 8019648815 | 8019650024 | 462 |
| 778 | iso_pu_bacteria | 8023680758 | 8023683181 | 462 |
| 779 | iso_pu_bacteria | 8024479707 | 8024482876 | 462 |
| 780 | iso_pu_bacteria | 8024486573 | 8024488018 | 462 |
| 781 | iso_pu_bacteria | 8024501048 | 8024504410 | 462 |
| 782 | iso_pu_bacteria | 8045864390 | 8045864590 | 462 |
| 783 | iso_pu_bacteria | 8049293176 | 8049295313 | 462 |
| 784 | iso_pu_bacteria | 8054558443 | 8054562936 | 462 |
| 785 | iso_pu_bacteria | 8055742211 | 8055749165 | 462 |
| 786 | iso_pu_bacteria | 8056375014 | 8056375921 | 462 |
| 787 | iso_pu_bacteria | 8056382006 | 8056386712 | 462 |
| 788 | iso_pu_bacteria | 8056681323 | 8056682383 | 462 |
| 789 | iso_pu_bacteria | 8056689827 | 8056695170 | 462 |
| 790 | iso_pu_bacteria | 8056967851 | 8056969722 | 462 |
| 791 | iso_pu_bacteria | 8057529695 | 8057530898 | 462 |
| 792 | iso_pu_bacteria | 8057575449 | 8057575746 | 462 |
| 793 | iso_pu_bacteria | 8057874678 | 8057877687 | 462 |
| 794 | 3300005563 | Ga0068855_100092034 | Ga0068855_1000920342 | 464 |
| 795 | 3300025912 | Ga0207707_10030844 | Ga0207707_100308442 | 464 |
| 796 | 3300025913 | Ga0207695_10264854 | Ga0207695_102648541 | 464 |
| 797 | 3300025921 | Ga0207652_10055858 | Ga0207652_100558583 | 464 |
| 798 | 3300025949 | Ga0207667_10020500 | Ga0207667_100205002 | 464 |
| 799 | 3300042145 | Ga0450906_003061 | Ga0450906_003061_1996_3405 | 464 |
| 800 | 3300046512 | Ga0495610_0012085 | Ga0495610_0012085_1044_2453 | 464 |
| 801 | 3300048925 | Ga0496122_0017720 | Ga0496122_0017720_1075_2484 | 464 |
| 802 | 3300048926 | Ga0496123_0011423 | Ga0496123_0011423_2534_3943 | 464 |
| 803 | 3300048927 | Ga0496124_0037114 | Ga0496124_0037114_2722_4131 | 464 |
| 804 | 3300048928 | Ga0496125_0006049 | Ga0496125_0006049_7753_9162 | 464 |
| 805 | iso_pu_bacteria | 8054563764 | 8054568615 | 464 |
| 806 | 3300002987 | JGI25159J45721_1002735 | JGI25159J45721_10027353 | 465 |
| 807 | 3300005262 | Ga0065165_1000141 | Ga0065165_100014124 | 465 |
| 808 | 3300025284 | Ga0209130_1000178 | Ga0209130_100017824 | 465 |
| 809 | 3300025302 | Ga0207426_1027642 | Ga0207426_10276422 | 465 |
| 810 | 3300025901 | Ga0207688_10045412 | Ga0207688_100454122 | 465 |
| 811 | 3300031548 | Ga0307408_100145955 | Ga0307408_1001459552 | 465 |
| 812 | 3300032126 | Ga0307415_100156342 | Ga0307415_1001563422 | 465 |
| 813 | 3300039450 | Ga0436363_0693856 | Ga0436363_0693856_67_1485 | 465 |
| 814 | 3300044735 | Ga0466968_0003374 | Ga0466968_0003374_969_2375 | 465 |
| 815 | 3300045049 | Ga0466959_0026291 | Ga0466959_0026291_2453_3862 | 465 |
| 816 | 3300046533 | Ga0495640_0018229 | Ga0495640_0018229_1988_3397 | 465 |
| 817 | 3300048922 | Ga0496119_0000903 | Ga0496119_0000903_37239_38636 | 465 |
| 818 | 3300048925 | Ga0496122_0004307 | Ga0496122_0004307_16403_17800 | 465 |
| 819 | 3300053104 | Ga0500556_0005856 | Ga0500556_0005856_1968_3365 | 465 |
| 820 | 3300053730 | Ga0500645_001299 | Ga0500645_001299_10077_11474 | 465 |
| 821 | 3300000041 | ARcpr5oldR_c000516 | ARcpr5oldR_0005162 | 466 |
| 822 | 3300000042 | ARSoilYngRDRAFT_c00728 | ARSoilYngRDRAFT_007283 | 466 |
| 823 | 3300000043 | ARcpr5yngRDRAFT_c000549 | ARcpr5yngRDRAFT_0005492 | 466 |
| 824 | 3300000044 | ARSoilOldRDRAFT_c000275 | ARSoilOldRDRAFT_0002752 | 466 |
| 825 | 3300000652 | ARCol0yngRDRAFT_1000490 | ARCol0yngRDRAFT_10004902 | 466 |
| 826 | 3300001977 | JGI24746J21847_1000658 | JGI24746J21847_10006584 | 466 |
| 827 | 3300001979 | JGI24740J21852_10002709 | JGI24740J21852_100027092 | 466 |
| 828 | 3300001989 | JGI24739J22299_10000203 | JGI24739J22299_100002033 | 466 |
| 829 | 3300001990 | JGI24737J22298_10003052 | JGI24737J22298_100030526 | 466 |
| 830 | 3300002070 | JGI24750J21931_1000206 | JGI24750J21931_10002066 | 466 |
| 831 | 3300002070 | JGI24750J21931_1000813 | JGI24750J21931_10008134 | 466 |
| 832 | 3300002073 | JGI24745J21846_1000036 | JGI24745J21846_10000362 | 466 |
| 833 | 3300002074 | JGI24748J21848_1000461 | JGI24748J21848_10004613 | 466 |
| 834 | 3300002075 | JGI24738J21930_10001355 | JGI24738J21930_100013556 | 466 |
| 835 | 3300002076 | JGI24749J21850_1001705 | JGI24749J21850_10017052 | 466 |
| 836 | 3300002077 | JGI24744J21845_10006569 | JGI24744J21845_100065692 | 466 |
| 837 | 3300002126 | JGI24035J26624_1000184 | JGI24035J26624_10001845 | 466 |
| 838 | 3300002239 | JGI24034J26672_10001100 | JGI24034J26672_100011003 | 466 |
| 839 | 3300002244 | JGI24742J22300_10000210 | JGI24742J22300_100002102 | 466 |
| 840 | 3300002459 | JGI24751J29686_10014198 | JGI24751J29686_100141981 | 466 |
| 841 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_100000148 | 466 |
| 842 | 3300002738 | JGI25154J39366_1000122 | JGI25154J39366_10001229 | 466 |
| 843 | 3300002738 | JGI25154J39366_1000150 | JGI25154J39366_100015050 | 466 |
| 844 | 3300002739 | JGI25158J39367_1000038 | JGI25158J39367_10000388 | 466 |
| 845 | 3300002741 | JGI25157J39369_1000044 | JGI25157J39369_100004447 | 466 |
| 846 | 3300002773 | JGI25152J39213_1001384 | JGI25152J39213_10013848 | 466 |
| 847 | 3300002774 | JGI25150J39212_1000107 | JGI25150J39212_100010714 | 466 |
| 848 | 3300002774 | JGI25150J39212_1003225 | JGI25150J39212_10032254 | 466 |
| 849 | 3300002774 | JGI25150J39212_1004915 | JGI25150J39212_10049152 | 466 |
| 850 | 3300002987 | JGI25159J45721_1000154 | JGI25159J45721_10001546 | 466 |
| 851 | 3300003187 | JGI25151J46595_10000028 | JGI25151J46595_10000028134 | 466 |
| 852 | 3300003187 | JGI25151J46595_10000374 | JGI25151J46595_1000037432 | 466 |
| 853 | 3300003187 | JGI25151J46595_10000839 | JGI25151J46595_1000083912 | 466 |
| 854 | 3300003187 | JGI25151J46595_10016744 | JGI25151J46595_100167442 | 466 |
| 855 | 3300003187 | JGI25151J46595_10029284 | JGI25151J46595_100292841 | 466 |
| 856 | 3300003203 | JGI25406J46586_10000392 | JGI25406J46586_100003921 | 466 |
| 857 | 3300003203 | JGI25406J46586_10003218 | JGI25406J46586_100032183 | 466 |
| 858 | 3300003214 | JGI25165J46597_1001042 | JGI25165J46597_10010427 | 466 |
| 859 | 3300003214 | JGI25165J46597_1006320 | JGI25165J46597_10063202 | 466 |
| 860 | 3300003215 | JGI25153J46596_10000696 | JGI25153J46596_1000069610 | 466 |
| 861 | 3300003215 | JGI25153J46596_10003837 | JGI25153J46596_100038375 | 466 |
| 862 | 3300003215 | JGI25153J46596_10004141 | JGI25153J46596_100041412 | 466 |
| 863 | 3300003215 | JGI25153J46596_10004246 | JGI25153J46596_100042463 | 466 |
| 864 | 3300003215 | JGI25153J46596_10006403 | JGI25153J46596_100064037 | 466 |
| 865 | 3300003215 | JGI25153J46596_10015480 | JGI25153J46596_100154802 | 466 |
| 866 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001661 | 466 |
| 867 | 3300003354 | JGI25160J50197_1001885 | JGI25160J50197_10018853 | 466 |
| 868 | 3300003354 | JGI25160J50197_1003307 | JGI25160J50197_10033073 | 466 |
| 869 | 3300003354 | JGI25160J50197_1004587 | JGI25160J50197_10045872 | 466 |
| 870 | 3300003354 | JGI25160J50197_1008344 | JGI25160J50197_10083443 | 466 |
| 871 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_100000192 | 466 |
| 872 | 3300003374 | JGI25161J50226_1000174 | JGI25161J50226_100017430 | 466 |
| 873 | 3300003659 | JGI25404J52841_10002804 | JGI25404J52841_100028041 | 466 |
| 874 | 3300003659 | JGI25404J52841_10015585 | JGI25404J52841_100155851 | 466 |
| 875 | 3300003771 | Ga0055526_1000597 | Ga0055526_100059717 | 466 |
| 876 | 3300003771 | Ga0055526_1000802 | Ga0055526_10008028 | 466 |
| 877 | 3300003771 | Ga0055526_1001522 | Ga0055526_100152211 | 466 |
| 878 | 3300003771 | Ga0055526_1003626 | Ga0055526_10036267 | 466 |
| 879 | 3300003771 | Ga0055526_1007634 | Ga0055526_10076342 | 466 |
| 880 | 3300003771 | Ga0055526_1020097 | Ga0055526_10200972 | 466 |
| 881 | 3300003775 | Ga0055524_1000020 | Ga0055524_1000020211 | 466 |
| 882 | 3300003775 | Ga0055524_1004279 | Ga0055524_10042792 | 466 |
| 883 | 3300003775 | Ga0055524_1004359 | Ga0055524_10043593 | 466 |
| 884 | 3300003775 | Ga0055524_1004387 | Ga0055524_10043875 | 466 |
| 885 | 3300003775 | Ga0055524_1014554 | Ga0055524_10145543 | 466 |
| 886 | 3300003790 | Ga0055528_1001199 | Ga0055528_10011994 | 466 |
| 887 | 3300003790 | Ga0055528_1002181 | Ga0055528_10021817 | 466 |
| 888 | 3300003790 | Ga0055528_1005051 | Ga0055528_10050514 | 466 |
| 889 | 3300003792 | Ga0055540_1000929 | Ga0055540_10009297 | 466 |
| 890 | 3300003792 | Ga0055540_1003312 | Ga0055540_10033125 | 466 |
| 891 | 3300003794 | Ga0055531_10005281 | Ga0055531_100052815 | 466 |
| 892 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003108 | 466 |
| 893 | 3300004625 | Ga0055543_1000350 | Ga0055543_10003503 | 466 |
| 894 | 3300004625 | Ga0055543_1000500 | Ga0055543_100050012 | 466 |
| 895 | 3300005262 | Ga0065165_1000068 | Ga0065165_100006861 | 466 |
| 896 | 3300005262 | Ga0065165_1004626 | Ga0065165_10046265 | 466 |
| 897 | 3300005262 | Ga0065165_1004931 | Ga0065165_10049313 | 466 |
| 898 | 3300005262 | Ga0065165_1011468 | Ga0065165_10114681 | 466 |
| 899 | 3300005262 | Ga0065165_1014773 | Ga0065165_10147732 | 466 |
| 900 | 3300005290 | Ga0065712_10001033 | Ga0065712_100010337 | 466 |
| 901 | 3300005290 | Ga0065712_10003647 | Ga0065712_100036474 | 466 |
| 902 | 3300005293 | Ga0065715_10006009 | Ga0065715_100060091 | 466 |
| 903 | 3300005293 | Ga0065715_10091317 | Ga0065715_100913171 | 466 |
| 904 | 3300005295 | Ga0065707_10131552 | Ga0065707_101315522 | 466 |
| 905 | 3300005327 | Ga0070658_10038187 | Ga0070658_100381873 | 466 |
| 906 | 3300005328 | Ga0070676_10000499 | Ga0070676_1000049913 | 466 |
| 907 | 3300005328 | Ga0070676_10007528 | Ga0070676_100075286 | 466 |
| 908 | 3300005329 | Ga0070683_100000265 | Ga0070683_10000026514 | 466 |
| 909 | 3300005329 | Ga0070683_100150071 | Ga0070683_1001500712 | 466 |
| 910 | 3300005330 | Ga0070690_100000718 | Ga0070690_1000007183 | 466 |
| 911 | 3300005330 | Ga0070690_100026323 | Ga0070690_1000263233 | 466 |
| 912 | 3300005331 | Ga0070670_100006298 | Ga0070670_1000062985 | 466 |
| 913 | 3300005331 | Ga0070670_100014626 | Ga0070670_1000146263 | 466 |
| 914 | 3300005331 | Ga0070670_100039987 | Ga0070670_1000399873 | 466 |
| 915 | 3300005331 | Ga0070670_100090453 | Ga0070670_1000904532 | 466 |
| 916 | 3300005331 | Ga0070670_100102718 | Ga0070670_1001027182 | 466 |
| 917 | 3300005333 | Ga0070677_10001854 | Ga0070677_100018542 | 466 |
| 918 | 3300005334 | Ga0068869_100000792 | Ga0068869_1000007921 | 466 |
| 919 | 3300005335 | Ga0070666_10018983 | Ga0070666_100189833 | 466 |
| 920 | 3300005336 | Ga0070680_100001359 | Ga0070680_1000013594 | 466 |
| 921 | 3300005336 | Ga0070680_100007344 | Ga0070680_1000073443 | 466 |
| 922 | 3300005336 | Ga0070680_100016152 | Ga0070680_1000161526 | 466 |
| 923 | 3300005336 | Ga0070680_100067602 | Ga0070680_1000676022 | 466 |
| 924 | 3300005336 | Ga0070680_100075252 | Ga0070680_1000752522 | 466 |
| 925 | 3300005337 | Ga0070682_100000745 | Ga0070682_10000074513 | 466 |
| 926 | 3300005337 | Ga0070682_100037232 | Ga0070682_1000372322 | 466 |
| 927 | 3300005338 | Ga0068868_100007218 | Ga0068868_1000072182 | 466 |
| 928 | 3300005338 | Ga0068868_100012356 | Ga0068868_1000123565 | 466 |
| 929 | 3300005338 | Ga0068868_100119237 | Ga0068868_1001192371 | 466 |
| 930 | 3300005338 | Ga0068868_100133070 | Ga0068868_1001330702 | 466 |
| 931 | 3300005339 | Ga0070660_100000136 | Ga0070660_10000013632 | 466 |
| 932 | 3300005339 | Ga0070660_100002003 | Ga0070660_1000020039 | 466 |
| 933 | 3300005339 | Ga0070660_100043329 | Ga0070660_1000433292 | 466 |
| 934 | 3300005340 | Ga0070689_100000722 | Ga0070689_10000072213 | 466 |
| 935 | 3300005340 | Ga0070689_100001379 | Ga0070689_1000013794 | 466 |
| 936 | 3300005341 | Ga0070691_10000148 | Ga0070691_1000014813 | 466 |
| 937 | 3300005343 | Ga0070687_100000080 | Ga0070687_10000008013 | 466 |
| 938 | 3300005343 | Ga0070687_100057571 | Ga0070687_1000575712 | 466 |
| 939 | 3300005344 | Ga0070661_100000425 | Ga0070661_1000004255 | 466 |
| 940 | 3300005344 | Ga0070661_100059571 | Ga0070661_1000595712 | 466 |
| 941 | 3300005345 | Ga0070692_10000893 | Ga0070692_100008936 | 466 |
| 942 | 3300005345 | Ga0070692_10042477 | Ga0070692_100424772 | 466 |
| 943 | 3300005345 | Ga0070692_10063725 | Ga0070692_100637252 | 466 |
| 944 | 3300005353 | Ga0070669_100000276 | Ga0070669_10000027614 | 466 |
| 945 | 3300005353 | Ga0070669_100002660 | Ga0070669_1000026608 | 466 |
| 946 | 3300005353 | Ga0070669_100053883 | Ga0070669_1000538832 | 466 |
| 947 | 3300005354 | Ga0070675_100000271 | Ga0070675_10000027113 | 466 |
| 948 | 3300005354 | Ga0070675_100097097 | Ga0070675_1000970972 | 466 |
| 949 | 3300005354 | Ga0070675_100154622 | Ga0070675_1001546222 | 466 |
| 950 | 3300005355 | Ga0070671_100000389 | Ga0070671_10000038913 | 466 |
| 951 | 3300005355 | Ga0070671_100018200 | Ga0070671_1000182005 | 466 |
| 952 | 3300005355 | Ga0070671_100023087 | Ga0070671_1000230872 | 466 |
| 953 | 3300005355 | Ga0070671_100051379 | Ga0070671_1000513794 | 466 |
| 954 | 3300005356 | Ga0070674_100000928 | Ga0070674_10000092813 | 466 |
| 955 | 3300005356 | Ga0070674_100040050 | Ga0070674_1000400502 | 466 |
| 956 | 3300005356 | Ga0070674_100124249 | Ga0070674_1001242492 | 466 |
| 957 | 3300005364 | Ga0070673_100001722 | Ga0070673_1000017227 | 466 |
| 958 | 3300005364 | Ga0070673_100008972 | Ga0070673_1000089724 | 466 |
| 959 | 3300005364 | Ga0070673_100175780 | Ga0070673_1001757802 | 466 |
| 960 | 3300005365 | Ga0070688_100001551 | Ga0070688_1000015516 | 466 |
| 961 | 3300005365 | Ga0070688_100005937 | Ga0070688_1000059376 | 466 |
| 962 | 3300005365 | Ga0070688_100023145 | Ga0070688_1000231453 | 466 |
| 963 | 3300005365 | Ga0070688_100046475 | Ga0070688_1000464752 | 466 |
| 964 | 3300005365 | Ga0070688_100090147 | Ga0070688_1000901472 | 466 |
| 965 | 3300005366 | Ga0070659_100006384 | Ga0070659_1000063844 | 466 |
| 966 | 3300005366 | Ga0070659_100023831 | Ga0070659_1000238312 | 466 |
| 967 | 3300005367 | Ga0070667_100001569 | Ga0070667_10000156913 | 466 |
| 968 | 3300005367 | Ga0070667_100049567 | Ga0070667_1000495673 | 466 |
| 969 | 3300005367 | Ga0070667_100071904 | Ga0070667_1000719042 | 466 |
| 970 | 3300005367 | Ga0070667_100106790 | Ga0070667_1001067901 | 466 |
| 971 | 3300005406 | Ga0070703_10001527 | Ga0070703_100015275 | 466 |
| 972 | 3300005406 | Ga0070703_10032910 | Ga0070703_100329101 | 466 |
| 973 | 3300005434 | Ga0070709_10001417 | Ga0070709_100014177 | 466 |
| 974 | 3300005434 | Ga0070709_10009235 | Ga0070709_100092353 | 466 |
| 975 | 3300005434 | Ga0070709_10036252 | Ga0070709_100362522 | 466 |
| 976 | 3300005434 | Ga0070709_10061585 | Ga0070709_100615852 | 466 |
| 977 | 3300005434 | Ga0070709_10068113 | Ga0070709_100681132 | 466 |
| 978 | 3300005434 | Ga0070709_10088435 | Ga0070709_100884352 | 466 |
| 979 | 3300005435 | Ga0070714_100000678 | Ga0070714_10000067810 | 466 |
| 980 | 3300005435 | Ga0070714_100013931 | Ga0070714_1000139314 | 466 |
| 981 | 3300005435 | Ga0070714_100018262 | Ga0070714_1000182623 | 466 |
| 982 | 3300005435 | Ga0070714_100048804 | Ga0070714_1000488043 | 466 |
| 983 | 3300005435 | Ga0070714_100058991 | Ga0070714_1000589912 | 466 |
| 984 | 3300005436 | Ga0070713_100002582 | Ga0070713_1000025824 | 466 |
| 985 | 3300005436 | Ga0070713_100017559 | Ga0070713_1000175592 | 466 |
| 986 | 3300005436 | Ga0070713_100022313 | Ga0070713_1000223131 | 466 |
| 987 | 3300005436 | Ga0070713_100033799 | Ga0070713_1000337993 | 466 |
| 988 | 3300005436 | Ga0070713_100074835 | Ga0070713_1000748352 | 466 |
| 989 | 3300005436 | Ga0070713_100240790 | Ga0070713_1002407902 | 466 |
| 990 | 3300005437 | Ga0070710_10000633 | Ga0070710_100006339 | 466 |
| 991 | 3300005437 | Ga0070710_10002407 | Ga0070710_100024077 | 466 |
| 992 | 3300005437 | Ga0070710_10002708 | Ga0070710_100027084 | 466 |
| 993 | 3300005437 | Ga0070710_10006364 | Ga0070710_100063643 | 466 |
| 994 | 3300005437 | Ga0070710_10019478 | Ga0070710_100194782 | 466 |
| 995 | 3300005437 | Ga0070710_10026128 | Ga0070710_100261283 | 466 |
| 996 | 3300005437 | Ga0070710_10046292 | Ga0070710_100462922 | 466 |
| 997 | 3300005438 | Ga0070701_10000457 | Ga0070701_100004577 | 466 |
| 998 | 3300005438 | Ga0070701_10004482 | Ga0070701_100044824 | 466 |
| 999 | 3300005438 | Ga0070701_10011127 | Ga0070701_100111272 | 466 |
| 1000 | 3300005439 | Ga0070711_100001478 | Ga0070711_1000014782 | 466 |
| 1001 | 3300005439 | Ga0070711_100002216 | Ga0070711_1000022162 | 466 |
| 1002 | 3300005439 | Ga0070711_100007229 | Ga0070711_1000072293 | 466 |
| 1003 | 3300005439 | Ga0070711_100011186 | Ga0070711_1000111862 | 466 |
| 1004 | 3300005439 | Ga0070711_100055922 | Ga0070711_1000559222 | 466 |
| 1005 | 3300005439 | Ga0070711_100092586 | Ga0070711_1000925862 | 466 |
| 1006 | 3300005439 | Ga0070711_100166193 | Ga0070711_1001661932 | 466 |
| 1007 | 3300005440 | Ga0070705_100000579 | Ga0070705_1000005796 | 466 |
| 1008 | 3300005440 | Ga0070705_100044359 | Ga0070705_1000443591 | 466 |
| 1009 | 3300005441 | Ga0070700_100000515 | Ga0070700_1000005155 | 466 |
| 1010 | 3300005441 | Ga0070700_100010386 | Ga0070700_1000103865 | 466 |
| 1011 | 3300005441 | Ga0070700_100030563 | Ga0070700_1000305633 | 466 |
| 1012 | 3300005444 | Ga0070694_100004976 | Ga0070694_1000049762 | 466 |
| 1013 | 3300005444 | Ga0070694_100052391 | Ga0070694_1000523913 | 466 |
| 1014 | 3300005445 | Ga0070708_100041592 | Ga0070708_1000415923 | 466 |
| 1015 | 3300005455 | Ga0070663_100000580 | Ga0070663_10000058013 | 466 |
| 1016 | 3300005455 | Ga0070663_100027924 | Ga0070663_1000279243 | 466 |
| 1017 | 3300005455 | Ga0070663_100067369 | Ga0070663_1000673693 | 466 |
| 1018 | 3300005455 | Ga0070663_100091152 | Ga0070663_1000911522 | 466 |
| 1019 | 3300005455 | Ga0070663_100132571 | Ga0070663_1001325711 | 466 |
| 1020 | 3300005456 | Ga0070678_100000016 | Ga0070678_10000001613 | 466 |
| 1021 | 3300005456 | Ga0070678_100008371 | Ga0070678_1000083712 | 466 |
| 1022 | 3300005456 | Ga0070678_100025343 | Ga0070678_1000253433 | 466 |
| 1023 | 3300005457 | Ga0070662_100001325 | Ga0070662_10000132513 | 466 |
| 1024 | 3300005457 | Ga0070662_100015684 | Ga0070662_1000156844 | 466 |
| 1025 | 3300005457 | Ga0070662_100016017 | Ga0070662_1000160172 | 466 |
| 1026 | 3300005457 | Ga0070662_100021879 | Ga0070662_1000218792 | 466 |
| 1027 | 3300005457 | Ga0070662_100063250 | Ga0070662_1000632502 | 466 |
| 1028 | 3300005458 | Ga0070681_10001764 | Ga0070681_1000176413 | 466 |
| 1029 | 3300005458 | Ga0070681_10003323 | Ga0070681_100033238 | 466 |
| 1030 | 3300005458 | Ga0070681_10025407 | Ga0070681_100254072 | 466 |
| 1031 | 3300005458 | Ga0070681_10043509 | Ga0070681_100435093 | 466 |
| 1032 | 3300005458 | Ga0070681_10166077 | Ga0070681_101660771 | 466 |
| 1033 | 3300005459 | Ga0068867_100012945 | Ga0068867_1000129452 | 466 |
| 1034 | 3300005459 | Ga0068867_100073028 | Ga0068867_1000730282 | 466 |
| 1035 | 3300005466 | Ga0070685_10000344 | Ga0070685_1000034422 | 466 |
| 1036 | 3300005466 | Ga0070685_10013452 | Ga0070685_100134523 | 466 |
| 1037 | 3300005466 | Ga0070685_10024049 | Ga0070685_100240492 | 466 |
| 1038 | 3300005467 | Ga0070706_100130741 | Ga0070706_1001307412 | 466 |
| 1039 | 3300005471 | Ga0070698_100019627 | Ga0070698_1000196272 | 466 |
| 1040 | 3300005530 | Ga0070679_100001267 | Ga0070679_10000126713 | 466 |
| 1041 | 3300005530 | Ga0070679_100008695 | Ga0070679_1000086952 | 466 |
| 1042 | 3300005530 | Ga0070679_100024858 | Ga0070679_1000248582 | 466 |
| 1043 | 3300005530 | Ga0070679_100031436 | Ga0070679_1000314365 | 466 |
| 1044 | 3300005530 | Ga0070679_100092503 | Ga0070679_1000925032 | 466 |
| 1045 | 3300005530 | Ga0070679_100169723 | Ga0070679_1001697231 | 466 |
| 1046 | 3300005535 | Ga0070684_100004054 | Ga0070684_1000040541 | 466 |
| 1047 | 3300005535 | Ga0070684_100014119 | Ga0070684_1000141194 | 466 |
| 1048 | 3300005535 | Ga0070684_100020270 | Ga0070684_1000202702 | 466 |
| 1049 | 3300005536 | Ga0070697_100000413 | Ga0070697_10000041315 | 466 |
| 1050 | 3300005539 | Ga0068853_100001111 | Ga0068853_10000111114 | 466 |
| 1051 | 3300005539 | Ga0068853_100006219 | Ga0068853_1000062195 | 466 |
| 1052 | 3300005539 | Ga0068853_100008362 | Ga0068853_1000083622 | 466 |
| 1053 | 3300005539 | Ga0068853_100010311 | Ga0068853_1000103114 | 466 |
| 1054 | 3300005539 | Ga0068853_100010423 | Ga0068853_1000104232 | 466 |
| 1055 | 3300005543 | Ga0070672_100000233 | Ga0070672_10000023313 | 466 |
| 1056 | 3300005543 | Ga0070672_100009467 | Ga0070672_1000094675 | 466 |
| 1057 | 3300005544 | Ga0070686_100000699 | Ga0070686_1000006995 | 466 |
| 1058 | 3300005544 | Ga0070686_100009615 | Ga0070686_1000096155 | 466 |
| 1059 | 3300005544 | Ga0070686_100059868 | Ga0070686_1000598682 | 466 |
| 1060 | 3300005545 | Ga0070695_100000624 | Ga0070695_10000062414 | 466 |
| 1061 | 3300005546 | Ga0070696_100001198 | Ga0070696_1000011984 | 466 |
| 1062 | 3300005547 | Ga0070693_100000594 | Ga0070693_1000005945 | 466 |
| 1063 | 3300005547 | Ga0070693_100022952 | Ga0070693_1000229522 | 466 |
| 1064 | 3300005548 | Ga0070665_100005019 | Ga0070665_10000501911 | 466 |
| 1065 | 3300005548 | Ga0070665_100021991 | Ga0070665_1000219916 | 466 |
| 1066 | 3300005548 | Ga0070665_100025615 | Ga0070665_1000256154 | 466 |
| 1067 | 3300005548 | Ga0070665_100028235 | Ga0070665_1000282352 | 466 |
| 1068 | 3300005548 | Ga0070665_100035418 | Ga0070665_1000354182 | 466 |
| 1069 | 3300005548 | Ga0070665_100047437 | Ga0070665_1000474373 | 466 |
| 1070 | 3300005548 | Ga0070665_100053711 | Ga0070665_1000537112 | 466 |
| 1071 | 3300005548 | Ga0070665_100102127 | Ga0070665_1001021272 | 466 |
| 1072 | 3300005548 | Ga0070665_100107111 | Ga0070665_1001071112 | 466 |
| 1073 | 3300005548 | Ga0070665_100166239 | Ga0070665_1001662392 | 466 |
| 1074 | 3300005549 | Ga0070704_100000112 | Ga0070704_10000011214 | 466 |
| 1075 | 3300005549 | Ga0070704_100001736 | Ga0070704_1000017365 | 466 |
| 1076 | 3300005549 | Ga0070704_100008535 | Ga0070704_1000085354 | 466 |
| 1077 | 3300005563 | Ga0068855_100007243 | Ga0068855_1000072437 | 466 |
| 1078 | 3300005563 | Ga0068855_100030914 | Ga0068855_1000309144 | 466 |
| 1079 | 3300005563 | Ga0068855_100033133 | Ga0068855_1000331338 | 466 |
| 1080 | 3300005563 | Ga0068855_100049698 | Ga0068855_1000496984 | 466 |
| 1081 | 3300005563 | Ga0068855_100209747 | Ga0068855_1002097472 | 466 |
| 1082 | 3300005563 | Ga0068855_100217628 | Ga0068855_1002176282 | 466 |
| 1083 | 3300005564 | Ga0070664_100000924 | Ga0070664_1000009244 | 466 |
| 1084 | 3300005564 | Ga0070664_100075219 | Ga0070664_1000752193 | 466 |
| 1085 | 3300005564 | Ga0070664_100087965 | Ga0070664_1000879652 | 466 |
| 1086 | 3300005564 | Ga0070664_100247502 | Ga0070664_1002475022 | 466 |
| 1087 | 3300005577 | Ga0068857_100000371 | Ga0068857_10000037123 | 466 |
| 1088 | 3300005577 | Ga0068857_100021812 | Ga0068857_1000218125 | 466 |
| 1089 | 3300005577 | Ga0068857_100135199 | Ga0068857_1001351992 | 466 |
| 1090 | 3300005578 | Ga0068854_100000735 | Ga0068854_10000073513 | 466 |
| 1091 | 3300005578 | Ga0068854_100050602 | Ga0068854_1000506023 | 466 |
| 1092 | 3300005614 | Ga0068856_100000091 | Ga0068856_10000009161 | 466 |
| 1093 | 3300005614 | Ga0068856_100000520 | Ga0068856_10000052037 | 466 |
| 1094 | 3300005614 | Ga0068856_100042057 | Ga0068856_1000420572 | 466 |
| 1095 | 3300005614 | Ga0068856_100131878 | Ga0068856_1001318782 | 466 |
| 1096 | 3300005615 | Ga0070702_100002320 | Ga0070702_1000023202 | 466 |
| 1097 | 3300005615 | Ga0070702_100009804 | Ga0070702_1000098044 | 466 |
| 1098 | 3300005615 | Ga0070702_100072947 | Ga0070702_1000729472 | 466 |
| 1099 | 3300005616 | Ga0068852_100001599 | Ga0068852_1000015994 | 466 |
| 1100 | 3300005616 | Ga0068852_100164473 | Ga0068852_1001644732 | 466 |
| 1101 | 3300005616 | Ga0068852_100196972 | Ga0068852_1001969721 | 466 |
| 1102 | 3300005617 | Ga0068859_100010201 | Ga0068859_1000102014 | 466 |
| 1103 | 3300005617 | Ga0068859_100030056 | Ga0068859_1000300561 | 466 |
| 1104 | 3300005618 | Ga0068864_100000333 | Ga0068864_10000033332 | 466 |
| 1105 | 3300005618 | Ga0068864_100022846 | Ga0068864_1000228462 | 466 |
| 1106 | 3300005618 | Ga0068864_100099199 | Ga0068864_1000991992 | 466 |
| 1107 | 3300005718 | Ga0068866_10000143 | Ga0068866_100001433 | 466 |
| 1108 | 3300005718 | Ga0068866_10019797 | Ga0068866_100197972 | 466 |
| 1109 | 3300005718 | Ga0068866_10025614 | Ga0068866_100256142 | 466 |
| 1110 | 3300005719 | Ga0068861_100000417 | Ga0068861_10000041713 | 466 |
| 1111 | 3300005719 | Ga0068861_100050057 | Ga0068861_1000500572 | 466 |
| 1112 | 3300005719 | Ga0068861_100101383 | Ga0068861_1001013832 | 466 |
| 1113 | 3300005834 | Ga0068851_10001608 | Ga0068851_100016087 | 466 |
| 1114 | 3300005840 | Ga0068870_10000113 | Ga0068870_1000011311 | 466 |
| 1115 | 3300005840 | Ga0068870_10011422 | Ga0068870_100114222 | 466 |
| 1116 | 3300005841 | Ga0068863_100022133 | Ga0068863_1000221335 | 466 |
| 1117 | 3300005841 | Ga0068863_100133244 | Ga0068863_1001332442 | 466 |
| 1118 | 3300005841 | Ga0068863_100257570 | Ga0068863_1002575702 | 466 |
| 1119 | 3300005842 | Ga0068858_100000975 | Ga0068858_10000097521 | 466 |
| 1120 | 3300005842 | Ga0068858_100010175 | Ga0068858_1000101756 | 466 |
| 1121 | 3300005842 | Ga0068858_100021103 | Ga0068858_1000211034 | 466 |
| 1122 | 3300005842 | Ga0068858_100103476 | Ga0068858_1001034762 | 466 |
| 1123 | 3300005842 | Ga0068858_100197856 | Ga0068858_1001978561 | 466 |
| 1124 | 3300005843 | Ga0068860_100000254 | Ga0068860_10000025444 | 466 |
| 1125 | 3300005843 | Ga0068860_100001740 | Ga0068860_1000017407 | 466 |
| 1126 | 3300005843 | Ga0068860_100015730 | Ga0068860_1000157306 | 466 |
| 1127 | 3300005843 | Ga0068860_100032250 | Ga0068860_1000322504 | 466 |
| 1128 | 3300005843 | Ga0068860_100033225 | Ga0068860_1000332253 | 466 |
| 1129 | 3300005843 | Ga0068860_100051464 | Ga0068860_1000514644 | 466 |
| 1130 | 3300005844 | Ga0068862_100001457 | Ga0068862_1000014574 | 466 |
| 1131 | 3300005844 | Ga0068862_100201283 | Ga0068862_1002012832 | 466 |
| 1132 | 3300005937 | Ga0081455_10000110 | Ga0081455_1000011039 | 466 |
| 1133 | 3300005937 | Ga0081455_10004210 | Ga0081455_1000421014 | 466 |
| 1134 | 3300005937 | Ga0081455_10007679 | Ga0081455_100076798 | 466 |
| 1135 | 3300005937 | Ga0081455_10026261 | Ga0081455_100262614 | 466 |
| 1136 | 3300005937 | Ga0081455_10037122 | Ga0081455_100371224 | 466 |
| 1137 | 3300005937 | Ga0081455_10042135 | Ga0081455_100421353 | 466 |
| 1138 | 3300005981 | Ga0081538_10040034 | Ga0081538_100400342 | 466 |
| 1139 | 3300005981 | Ga0081538_10050519 | Ga0081538_100505192 | 466 |
| 1140 | 3300005983 | Ga0081540_1000414 | Ga0081540_10004146 | 466 |
| 1141 | 3300005983 | Ga0081540_1001143 | Ga0081540_100114310 | 466 |
| 1142 | 3300005983 | Ga0081540_1003272 | Ga0081540_10032725 | 466 |
| 1143 | 3300005983 | Ga0081540_1009836 | Ga0081540_10098364 | 466 |
| 1144 | 3300005983 | Ga0081540_1012356 | Ga0081540_10123562 | 466 |
| 1145 | 3300005983 | Ga0081540_1018061 | Ga0081540_10180612 | 466 |
| 1146 | 3300005983 | Ga0081540_1032645 | Ga0081540_10326453 | 466 |
| 1147 | 3300005983 | Ga0081540_1071123 | Ga0081540_10711231 | 466 |
| 1148 | 3300005985 | Ga0081539_10000191 | Ga0081539_10000191144 | 466 |
| 1149 | 3300005985 | Ga0081539_10000321 | Ga0081539_1000032186 | 466 |
| 1150 | 3300005985 | Ga0081539_10001091 | Ga0081539_1000109143 | 466 |
| 1151 | 3300005985 | Ga0081539_10005255 | Ga0081539_1000525512 | 466 |
| 1152 | 3300005985 | Ga0081539_10047810 | Ga0081539_100478102 | 466 |
| 1153 | 3300006028 | Ga0070717_10000355 | Ga0070717_100003551 | 466 |
| 1154 | 3300006028 | Ga0070717_10002936 | Ga0070717_100029366 | 466 |
| 1155 | 3300006028 | Ga0070717_10005443 | Ga0070717_100054435 | 466 |
| 1156 | 3300006028 | Ga0070717_10027278 | Ga0070717_100272783 | 466 |
| 1157 | 3300006038 | Ga0075365_10004585 | Ga0075365_100045856 | 466 |
| 1158 | 3300006038 | Ga0075365_10013658 | Ga0075365_100136584 | 466 |
| 1159 | 3300006038 | Ga0075365_10023762 | Ga0075365_100237623 | 466 |
| 1160 | 3300006038 | Ga0075365_10026332 | Ga0075365_100263323 | 466 |
| 1161 | 3300006042 | Ga0075368_10002184 | Ga0075368_100021842 | 466 |
| 1162 | 3300006042 | Ga0075368_10055946 | Ga0075368_100559462 | 466 |
| 1163 | 3300006048 | Ga0075363_100045637 | Ga0075363_1000456372 | 466 |
| 1164 | 3300006048 | Ga0075363_100074545 | Ga0075363_1000745452 | 466 |
| 1165 | 3300006051 | Ga0075364_10046742 | Ga0075364_100467422 | 466 |
| 1166 | 3300006051 | Ga0075364_10064038 | Ga0075364_100640382 | 466 |
| 1167 | 3300006058 | Ga0075432_10004478 | Ga0075432_100044783 | 466 |
| 1168 | 3300006163 | Ga0070715_10000078 | Ga0070715_1000007815 | 466 |
| 1169 | 3300006163 | Ga0070715_10000694 | Ga0070715_100006946 | 466 |
| 1170 | 3300006163 | Ga0070715_10001339 | Ga0070715_100013394 | 466 |
| 1171 | 3300006173 | Ga0070716_100004734 | Ga0070716_1000047344 | 466 |
| 1172 | 3300006173 | Ga0070716_100009188 | Ga0070716_1000091884 | 466 |
| 1173 | 3300006173 | Ga0070716_100026212 | Ga0070716_1000262122 | 466 |
| 1174 | 3300006173 | Ga0070716_100077810 | Ga0070716_1000778102 | 466 |
| 1175 | 3300006173 | Ga0070716_100095048 | Ga0070716_1000950481 | 466 |
| 1176 | 3300006175 | Ga0070712_100002213 | Ga0070712_1000022137 | 466 |
| 1177 | 3300006175 | Ga0070712_100011086 | Ga0070712_1000110863 | 466 |
| 1178 | 3300006175 | Ga0070712_100020143 | Ga0070712_1000201433 | 466 |
| 1179 | 3300006175 | Ga0070712_100055443 | Ga0070712_1000554432 | 466 |
| 1180 | 3300006175 | Ga0070712_100082881 | Ga0070712_1000828812 | 466 |
| 1181 | 3300006175 | Ga0070712_100149373 | Ga0070712_1001493731 | 466 |
| 1182 | 3300006177 | Ga0075362_10010631 | Ga0075362_100106313 | 466 |
| 1183 | 3300006178 | Ga0075367_10001860 | Ga0075367_100018607 | 466 |
| 1184 | 3300006186 | Ga0075369_10001434 | Ga0075369_100014344 | 466 |
| 1185 | 3300006186 | Ga0075369_10016884 | Ga0075369_100168842 | 466 |
| 1186 | 3300006194 | Ga0075427_10000813 | Ga0075427_100008133 | 466 |
| 1187 | 3300006195 | Ga0075366_10058476 | Ga0075366_100584762 | 466 |
| 1188 | 3300006195 | Ga0075366_10082098 | Ga0075366_100820981 | 466 |
| 1189 | 3300006237 | Ga0097621_100000203 | Ga0097621_1000002035 | 466 |
| 1190 | 3300006237 | Ga0097621_100017219 | Ga0097621_1000172193 | 466 |
| 1191 | 3300006237 | Ga0097621_100062009 | Ga0097621_1000620092 | 466 |
| 1192 | 3300006237 | Ga0097621_100108603 | Ga0097621_1001086032 | 466 |
| 1193 | 3300006237 | Ga0097621_100201177 | Ga0097621_1002011771 | 466 |
| 1194 | 3300006353 | Ga0075370_10033371 | Ga0075370_100333713 | 466 |
| 1195 | 3300006358 | Ga0068871_100000575 | Ga0068871_1000005752 | 466 |
| 1196 | 3300006358 | Ga0068871_100028379 | Ga0068871_1000283793 | 466 |
| 1197 | 3300006358 | Ga0068871_100177992 | Ga0068871_1001779922 | 466 |
| 1198 | 3300006844 | Ga0075428_100008481 | Ga0075428_1000084813 | 466 |
| 1199 | 3300006844 | Ga0075428_100089794 | Ga0075428_1000897942 | 466 |
| 1200 | 3300006844 | Ga0075428_100111243 | Ga0075428_1001112432 | 466 |
| 1201 | 3300006846 | Ga0075430_100000012 | Ga0075430_10000001216 | 466 |
| 1202 | 3300006846 | Ga0075430_100000778 | Ga0075430_10000077819 | 466 |
| 1203 | 3300006847 | Ga0075431_100003622 | Ga0075431_10000362212 | 466 |
| 1204 | 3300006852 | Ga0075433_10005842 | Ga0075433_100058426 | 466 |
| 1205 | 3300006852 | Ga0075433_10009181 | Ga0075433_100091817 | 466 |
| 1206 | 3300006871 | Ga0075434_100000114 | Ga0075434_10000011440 | 466 |
| 1207 | 3300006871 | Ga0075434_100010989 | Ga0075434_1000109894 | 466 |
| 1208 | 3300006880 | Ga0075429_100002694 | Ga0075429_10000269412 | 466 |
| 1209 | 3300006881 | Ga0068865_100000654 | Ga0068865_10000065413 | 466 |
| 1210 | 3300006881 | Ga0068865_100020024 | Ga0068865_1000200243 | 466 |
| 1211 | 3300006881 | Ga0068865_100051878 | Ga0068865_1000518782 | 466 |
| 1212 | 3300006881 | Ga0068865_100106538 | Ga0068865_1001065382 | 466 |
| 1213 | 3300006881 | Ga0068865_100107012 | Ga0068865_1001070122 | 466 |
| 1214 | 3300006914 | Ga0075436_100013589 | Ga0075436_1000135893 | 466 |
| 1215 | 3300006931 | Ga0097620_100010201 | Ga0097620_1000102014 | 466 |
| 1216 | 3300006931 | Ga0097620_100030056 | Ga0097620_1000300561 | 466 |
| 1217 | 3300006941 | Ga0099825_1018997 | Ga0099825_10189973 | 466 |
| 1218 | 3300006943 | Ga0099822_1000022 | Ga0099822_100002210 | 466 |
| 1219 | 3300006944 | Ga0099823_1027652 | Ga0099823_10276524 | 466 |
| 1220 | 3300006946 | Ga0079104_1001253 | Ga0079104_10012535 | 466 |
| 1221 | 3300006948 | Ga0099826_10001254 | Ga0099826_100012546 | 466 |
| 1222 | 3300007076 | Ga0075435_100021841 | Ga0075435_1000218412 | 466 |
| 1223 | 3300007076 | Ga0075435_100041943 | Ga0075435_1000419432 | 466 |
| 1224 | 3300007076 | Ga0075435_100113929 | Ga0075435_1001139292 | 466 |
| 1225 | 3300009011 | Ga0105251_10015950 | Ga0105251_100159501 | 466 |
| 1226 | 3300009036 | Ga0105244_10022702 | Ga0105244_100227022 | 466 |
| 1227 | 3300009092 | Ga0105250_10005564 | Ga0105250_100055644 | 466 |
| 1228 | 3300009092 | Ga0105250_10020816 | Ga0105250_100208162 | 466 |
| 1229 | 3300009093 | Ga0105240_10000076 | Ga0105240_10000076154 | 466 |
| 1230 | 3300009093 | Ga0105240_10017201 | Ga0105240_100172016 | 466 |
| 1231 | 3300009093 | Ga0105240_10022325 | Ga0105240_100223253 | 466 |
| 1232 | 3300009093 | Ga0105240_10092446 | Ga0105240_100924462 | 466 |
| 1233 | 3300009093 | Ga0105240_10095268 | Ga0105240_100952682 | 466 |
| 1234 | 3300009094 | Ga0111539_10002232 | Ga0111539_100022329 | 466 |
| 1235 | 3300009094 | Ga0111539_10004022 | Ga0111539_1000402213 | 466 |
| 1236 | 3300009094 | Ga0111539_10141164 | Ga0111539_101411642 | 466 |
| 1237 | 3300009098 | Ga0105245_10000230 | Ga0105245_1000023036 | 466 |
| 1238 | 3300009098 | Ga0105245_10071520 | Ga0105245_100715201 | 466 |
| 1239 | 3300009098 | Ga0105245_10104265 | Ga0105245_101042652 | 466 |
| 1240 | 3300009101 | Ga0105247_10016289 | Ga0105247_100162894 | 466 |
| 1241 | 3300009101 | Ga0105247_10019830 | Ga0105247_100198303 | 466 |
| 1242 | 3300009101 | Ga0105247_10041342 | Ga0105247_100413422 | 466 |
| 1243 | 3300009147 | Ga0114129_10002372 | Ga0114129_1000237224 | 466 |
| 1244 | 3300009147 | Ga0114129_10008877 | Ga0114129_100088778 | 466 |
| 1245 | 3300009147 | Ga0114129_10010926 | Ga0114129_100109269 | 466 |
| 1246 | 3300009147 | Ga0114129_10250894 | Ga0114129_102508942 | 466 |
| 1247 | 3300009148 | Ga0105243_10002755 | Ga0105243_100027555 | 466 |
| 1248 | 3300009148 | Ga0105243_10012152 | Ga0105243_100121522 | 466 |
| 1249 | 3300009148 | Ga0105243_10013810 | Ga0105243_100138105 | 466 |
| 1250 | 3300009148 | Ga0105243_10085562 | Ga0105243_100855622 | 466 |
| 1251 | 3300009148 | Ga0105243_10202847 | Ga0105243_102028472 | 466 |
| 1252 | 3300009174 | Ga0105241_10001308 | Ga0105241_100013085 | 466 |
| 1253 | 3300009174 | Ga0105241_10009439 | Ga0105241_100094394 | 466 |
| 1254 | 3300009174 | Ga0105241_10029800 | Ga0105241_100298002 | 466 |
| 1255 | 3300009176 | Ga0105242_10000696 | Ga0105242_1000069613 | 466 |
| 1256 | 3300009176 | Ga0105242_10012804 | Ga0105242_100128042 | 466 |
| 1257 | 3300009176 | Ga0105242_10062111 | Ga0105242_100621112 | 466 |
| 1258 | 3300009177 | Ga0105248_10000015 | Ga0105248_10000015267 | 466 |
| 1259 | 3300009177 | Ga0105248_10001593 | Ga0105248_1000159319 | 466 |
| 1260 | 3300009177 | Ga0105248_10031210 | Ga0105248_100312105 | 466 |
| 1261 | 3300009177 | Ga0105248_10032633 | Ga0105248_100326335 | 466 |
| 1262 | 3300009177 | Ga0105248_10043884 | Ga0105248_100438844 | 466 |
| 1263 | 3300009177 | Ga0105248_10122049 | Ga0105248_101220492 | 466 |
| 1264 | 3300009177 | Ga0105248_10241696 | Ga0105248_102416962 | 466 |
| 1265 | 3300009545 | Ga0105237_10000226 | Ga0105237_1000022641 | 466 |
| 1266 | 3300009545 | Ga0105237_10011347 | Ga0105237_100113474 | 466 |
| 1267 | 3300009545 | Ga0105237_10015378 | Ga0105237_100153785 | 466 |
| 1268 | 3300009545 | Ga0105237_10024176 | Ga0105237_100241763 | 466 |
| 1269 | 3300009545 | Ga0105237_10033806 | Ga0105237_100338062 | 466 |
| 1270 | 3300009551 | Ga0105238_10043849 | Ga0105238_100438493 | 466 |
| 1271 | 3300009551 | Ga0105238_10097424 | Ga0105238_100974242 | 466 |
| 1272 | 3300009553 | Ga0105249_10001642 | Ga0105249_1000164213 | 466 |
| 1273 | 3300009553 | Ga0105249_10096005 | Ga0105249_100960052 | 466 |
| 1274 | 3300009553 | Ga0105249_10101988 | Ga0105249_101019882 | 466 |
| 1275 | 3300009553 | Ga0105249_10151667 | Ga0105249_101516672 | 466 |
| 1276 | 3300009765 | Ga0123341_1000007 | Ga0123341_100000791 | 466 |
| 1277 | 3300009765 | Ga0123341_1047554 | Ga0123341_10475542 | 466 |
| 1278 | 3300009766 | Ga0123342_1004784 | Ga0123342_100478417 | 466 |
| 1279 | 3300010159 | Ga0099796_10001922 | Ga0099796_100019223 | 466 |
| 1280 | 3300010375 | Ga0105239_10000641 | Ga0105239_1000064113 | 466 |
| 1281 | 3300010375 | Ga0105239_10053854 | Ga0105239_100538543 | 466 |
| 1282 | 3300010375 | Ga0105239_10077673 | Ga0105239_100776732 | 466 |
| 1283 | 3300010375 | Ga0105239_10128804 | Ga0105239_101288042 | 466 |
| 1284 | 3300010375 | Ga0105239_10158078 | Ga0105239_101580781 | 466 |
| 1285 | 3300010375 | Ga0105239_10160874 | Ga0105239_101608742 | 466 |
| 1286 | 3300010375 | Ga0105239_10201375 | Ga0105239_102013752 | 466 |
| 1287 | 3300010375 | Ga0105239_10376400 | Ga0105239_103764002 | 466 |
| 1288 | 3300011119 | Ga0105246_10000550 | Ga0105246_100005506 | 466 |
| 1289 | 3300011119 | Ga0105246_10027908 | Ga0105246_100279082 | 466 |
| 1290 | 3300011119 | Ga0105246_10028278 | Ga0105246_100282783 | 466 |
| 1291 | 3300011119 | Ga0105246_10130207 | Ga0105246_101302072 | 466 |
| 1292 | 3300013100 | Ga0157373_10011236 | Ga0157373_100112362 | 466 |
| 1293 | 3300013100 | Ga0157373_10051657 | Ga0157373_100516572 | 466 |
| 1294 | 3300013102 | Ga0157371_10000017 | Ga0157371_1000001749 | 466 |
| 1295 | 3300013102 | Ga0157371_10004510 | Ga0157371_100045108 | 466 |
| 1296 | 3300013102 | Ga0157371_10054681 | Ga0157371_100546812 | 466 |
| 1297 | 3300013104 | Ga0157370_10000455 | Ga0157370_1000045535 | 466 |
| 1298 | 3300013104 | Ga0157370_10000461 | Ga0157370_1000046131 | 466 |
| 1299 | 3300013104 | Ga0157370_10044331 | Ga0157370_100443313 | 466 |
| 1300 | 3300013104 | Ga0157370_10071190 | Ga0157370_100711903 | 466 |
| 1301 | 3300013104 | Ga0157370_10110355 | Ga0157370_101103552 | 466 |
| 1302 | 3300013250 | Ga0171462_1066 | Ga0171462_106610 | 466 |
| 1303 | 3300013296 | Ga0157374_10016190 | Ga0157374_100161903 | 466 |
| 1304 | 3300013296 | Ga0157374_10032938 | Ga0157374_100329383 | 466 |
| 1305 | 3300013296 | Ga0157374_10036846 | Ga0157374_100368464 | 466 |
| 1306 | 3300013296 | Ga0157374_10220423 | Ga0157374_102204232 | 466 |
| 1307 | 3300013297 | Ga0157378_10000864 | Ga0157378_100008646 | 466 |
| 1308 | 3300013297 | Ga0157378_10034605 | Ga0157378_100346053 | 466 |
| 1309 | 3300013306 | Ga0163162_10000420 | Ga0163162_100004205 | 466 |
| 1310 | 3300013306 | Ga0163162_10016129 | Ga0163162_100161296 | 466 |
| 1311 | 3300013306 | Ga0163162_10072401 | Ga0163162_100724012 | 466 |
| 1312 | 3300013306 | Ga0163162_10253519 | Ga0163162_102535191 | 466 |
| 1313 | 3300013307 | Ga0157372_10011691 | Ga0157372_100116912 | 466 |
| 1314 | 3300013307 | Ga0157372_10024037 | Ga0157372_100240374 | 466 |
| 1315 | 3300013308 | Ga0157375_10001626 | Ga0157375_100016265 | 466 |
| 1316 | 3300013308 | Ga0157375_10025283 | Ga0157375_100252834 | 466 |
| 1317 | 3300013308 | Ga0157375_10037694 | Ga0157375_100376942 | 466 |
| 1318 | 3300014325 | Ga0163163_10067324 | Ga0163163_100673243 | 466 |
| 1319 | 3300014325 | Ga0163163_10206841 | Ga0163163_102068412 | 466 |
| 1320 | 3300014326 | Ga0157380_10000511 | Ga0157380_100005118 | 466 |
| 1321 | 3300014745 | Ga0157377_10000053 | Ga0157377_1000005355 | 466 |
| 1322 | 3300014745 | Ga0157377_10046260 | Ga0157377_100462602 | 466 |
| 1323 | 3300014745 | Ga0157377_10058121 | Ga0157377_100581212 | 466 |
| 1324 | 3300014968 | Ga0157379_10001333 | Ga0157379_1000133313 | 466 |
| 1325 | 3300014968 | Ga0157379_10016704 | Ga0157379_100167044 | 466 |
| 1326 | 3300014968 | Ga0157379_10094343 | Ga0157379_100943432 | 466 |
| 1327 | 3300014968 | Ga0157379_10169012 | Ga0157379_101690121 | 466 |
| 1328 | 3300014969 | Ga0157376_10000436 | Ga0157376_1000043610 | 466 |
| 1329 | 3300014969 | Ga0157376_10114255 | Ga0157376_101142552 | 466 |
| 1330 | 3300015262 | Ga0182007_10001815 | Ga0182007_100018156 | 466 |
| 1331 | 3300015265 | Ga0182005_1005015 | Ga0182005_10050153 | 466 |
| 1332 | 3300017792 | Ga0163161_10001352 | Ga0163161_1000135214 | 466 |
| 1333 | 3300017792 | Ga0163161_10007604 | Ga0163161_100076044 | 466 |
| 1334 | 3300017792 | Ga0163161_10023487 | Ga0163161_100234873 | 466 |
| 1335 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001332 | 466 |
| 1336 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005332 | 466 |
| 1337 | 3300021321 | Ga0214542_1024229 | Ga0214542_10242292 | 466 |
| 1338 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003432 | 466 |
| 1339 | 3300021324 | Ga0214545_1023657 | Ga0214545_10236572 | 466 |
| 1340 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002334 | 466 |
| 1341 | 3300021327 | Ga0214543_1000024 | Ga0214543_100002496 | 466 |
| 1342 | 3300021327 | Ga0214543_1000038 | Ga0214543_100003874 | 466 |
| 1343 | 3300021327 | Ga0214543_1026030 | Ga0214543_10260302 | 466 |
| 1344 | 3300021358 | Ga0213873_10011292 | Ga0213873_100112922 | 466 |
| 1345 | 3300021377 | Ga0213874_10007096 | Ga0213874_100070962 | 466 |
| 1346 | 3300021384 | Ga0213876_10021408 | Ga0213876_100214083 | 466 |
| 1347 | 3300021388 | Ga0213875_10002982 | Ga0213875_100029823 | 466 |
| 1348 | 3300021388 | Ga0213875_10008179 | Ga0213875_100081792 | 466 |
| 1349 | 3300022739 | Ga0228711_1000008 | Ga0228711_100000845 | 466 |
| 1350 | 3300022740 | Ga0228710_1000009 | Ga0228710_100000944 | 466 |
| 1351 | 3300024225 | Ga0224572_1001441 | Ga0224572_10014413 | 466 |
| 1352 | 3300024227 | Ga0228598_1001219 | Ga0228598_10012191 | 466 |
| 1353 | 3300025206 | Ga0209435_100012 | Ga0209435_100012336 | 466 |
| 1354 | 3300025208 | Ga0209436_100150 | Ga0209436_10015028 | 466 |
| 1355 | 3300025230 | Ga0209563_103061 | Ga0209563_1030612 | 466 |
| 1356 | 3300025233 | Ga0209437_100051 | Ga0209437_100051335 | 466 |
| 1357 | 3300025233 | Ga0209437_100098 | Ga0209437_100098175 | 466 |
| 1358 | 3300025245 | Ga0207425_1000075 | Ga0207425_100007566 | 466 |
| 1359 | 3300025245 | Ga0207425_1001337 | Ga0207425_10013379 | 466 |
| 1360 | 3300025245 | Ga0207425_1004121 | Ga0207425_10041212 | 466 |
| 1361 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026336 | 466 |
| 1362 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014336 | 466 |
| 1363 | 3300025253 | Ga0209677_101595 | Ga0209677_1015956 | 466 |
| 1364 | 3300025253 | Ga0209677_102022 | Ga0209677_1020226 | 466 |
| 1365 | 3300025254 | Ga0209148_1000424 | Ga0209148_100042440 | 466 |
| 1366 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012336 | 466 |
| 1367 | 3300025258 | Ga0209129_1000156 | Ga0209129_100015632 | 466 |
| 1368 | 3300025258 | Ga0209129_1000524 | Ga0209129_10005244 | 466 |
| 1369 | 3300025258 | Ga0209129_1000903 | Ga0209129_100090313 | 466 |
| 1370 | 3300025258 | Ga0209129_1001820 | Ga0209129_10018202 | 466 |
| 1371 | 3300025258 | Ga0209129_1001868 | Ga0209129_10018686 | 466 |
| 1372 | 3300025258 | Ga0209129_1002344 | Ga0209129_10023443 | 466 |
| 1373 | 3300025258 | Ga0209129_1004509 | Ga0209129_10045094 | 466 |
| 1374 | 3300025261 | Ga0209233_1000095 | Ga0209233_1000095292 | 466 |
| 1375 | 3300025261 | Ga0209233_1000113 | Ga0209233_10001138 | 466 |
| 1376 | 3300025261 | Ga0209233_1000427 | Ga0209233_100042711 | 466 |
| 1377 | 3300025261 | Ga0209233_1001485 | Ga0209233_10014857 | 466 |
| 1378 | 3300025261 | Ga0209233_1002935 | Ga0209233_10029352 | 466 |
| 1379 | 3300025261 | Ga0209233_1004610 | Ga0209233_10046102 | 466 |
| 1380 | 3300025261 | Ga0209233_1006596 | Ga0209233_10065963 | 466 |
| 1381 | 3300025271 | Ga0207666_1000348 | Ga0207666_10003486 | 466 |
| 1382 | 3300025272 | Ga0209455_1003259 | Ga0209455_10032595 | 466 |
| 1383 | 3300025272 | Ga0209455_1003833 | Ga0209455_10038333 | 466 |
| 1384 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010206 | 466 |
| 1385 | 3300025273 | Ga0209673_1000117 | Ga0209673_100011788 | 466 |
| 1386 | 3300025273 | Ga0209673_1000151 | Ga0209673_100015163 | 466 |
| 1387 | 3300025273 | Ga0209673_1000863 | Ga0209673_100086322 | 466 |
| 1388 | 3300025273 | Ga0209673_1001685 | Ga0209673_100168511 | 466 |
| 1389 | 3300025273 | Ga0209673_1002134 | Ga0209673_100213411 | 466 |
| 1390 | 3300025273 | Ga0209673_1026911 | Ga0209673_10269112 | 466 |
| 1391 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003116 | 466 |
| 1392 | 3300025284 | Ga0209130_1000020 | Ga0209130_1000020260 | 466 |
| 1393 | 3300025284 | Ga0209130_1010600 | Ga0209130_10106002 | 466 |
| 1394 | 3300025290 | Ga0207673_1000043 | Ga0207673_100004311 | 466 |
| 1395 | 3300025291 | Ga0209675_1001344 | Ga0209675_10013447 | 466 |
| 1396 | 3300025291 | Ga0209675_1011031 | Ga0209675_10110313 | 466 |
| 1397 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008776 | 466 |
| 1398 | 3300025294 | Ga0209025_1000070 | Ga0209025_1000070245 | 466 |
| 1399 | 3300025294 | Ga0209025_1000140 | Ga0209025_100014078 | 466 |
| 1400 | 3300025294 | Ga0209025_1000506 | Ga0209025_100050611 | 466 |
| 1401 | 3300025294 | Ga0209025_1001869 | Ga0209025_100186913 | 466 |
| 1402 | 3300025294 | Ga0209025_1003183 | Ga0209025_10031838 | 466 |
| 1403 | 3300025294 | Ga0209025_1005402 | Ga0209025_10054028 | 466 |
| 1404 | 3300025294 | Ga0209025_1010282 | Ga0209025_10102822 | 466 |
| 1405 | 3300025294 | Ga0209025_1028383 | Ga0209025_10283831 | 466 |
| 1406 | 3300025295 | Ga0209564_1000049 | Ga0209564_1000049335 | 466 |
| 1407 | 3300025295 | Ga0209564_1000065 | Ga0209564_1000065105 | 466 |
| 1408 | 3300025295 | Ga0209564_1000485 | Ga0209564_100048525 | 466 |
| 1409 | 3300025295 | Ga0209564_1000647 | Ga0209564_100064720 | 466 |
| 1410 | 3300025295 | Ga0209564_1001780 | Ga0209564_10017807 | 466 |
| 1411 | 3300025295 | Ga0209564_1001993 | Ga0209564_10019938 | 466 |
| 1412 | 3300025295 | Ga0209564_1006799 | Ga0209564_10067995 | 466 |
| 1413 | 3300025295 | Ga0209564_1009159 | Ga0209564_10091593 | 466 |
| 1414 | 3300025295 | Ga0209564_1012956 | Ga0209564_10129562 | 466 |
| 1415 | 3300025297 | Ga0209758_1000141 | Ga0209758_1000141155 | 466 |
| 1416 | 3300025297 | Ga0209758_1000186 | Ga0209758_100018664 | 466 |
| 1417 | 3300025297 | Ga0209758_1000655 | Ga0209758_100065511 | 466 |
| 1418 | 3300025297 | Ga0209758_1000758 | Ga0209758_100075811 | 466 |
| 1419 | 3300025297 | Ga0209758_1001882 | Ga0209758_10018829 | 466 |
| 1420 | 3300025297 | Ga0209758_1002154 | Ga0209758_100215411 | 466 |
| 1421 | 3300025297 | Ga0209758_1002420 | Ga0209758_10024207 | 466 |
| 1422 | 3300025297 | Ga0209758_1003547 | Ga0209758_10035478 | 466 |
| 1423 | 3300025297 | Ga0209758_1005684 | Ga0209758_10056846 | 466 |
| 1424 | 3300025297 | Ga0209758_1006158 | Ga0209758_10061584 | 466 |
| 1425 | 3300025297 | Ga0209758_1006453 | Ga0209758_10064535 | 466 |
| 1426 | 3300025297 | Ga0209758_1021515 | Ga0209758_10215152 | 466 |
| 1427 | 3300025298 | Ga0209050_1005467 | Ga0209050_10054677 | 466 |
| 1428 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014304 | 466 |
| 1429 | 3300025299 | Ga0209256_1000208 | Ga0209256_1000208102 | 466 |
| 1430 | 3300025299 | Ga0209256_1001653 | Ga0209256_100165317 | 466 |
| 1431 | 3300025299 | Ga0209256_1001736 | Ga0209256_100173617 | 466 |
| 1432 | 3300025299 | Ga0209256_1002712 | Ga0209256_10027125 | 466 |
| 1433 | 3300025299 | Ga0209256_1003882 | Ga0209256_10038827 | 466 |
| 1434 | 3300025299 | Ga0209256_1012913 | Ga0209256_10129133 | 466 |
| 1435 | 3300025299 | Ga0209256_1023617 | Ga0209256_10236171 | 466 |
| 1436 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008328 | 466 |
| 1437 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011663 | 466 |
| 1438 | 3300025302 | Ga0207426_1000221 | Ga0207426_1000221119 | 466 |
| 1439 | 3300025302 | Ga0207426_1000425 | Ga0207426_100042561 | 466 |
| 1440 | 3300025302 | Ga0207426_1000869 | Ga0207426_10008694 | 466 |
| 1441 | 3300025302 | Ga0207426_1003443 | Ga0207426_10034434 | 466 |
| 1442 | 3300025302 | Ga0207426_1004449 | Ga0207426_10044492 | 466 |
| 1443 | 3300025303 | Ga0209051_1000097 | Ga0209051_100009754 | 466 |
| 1444 | 3300025303 | Ga0209051_1004880 | Ga0209051_10048804 | 466 |
| 1445 | 3300025303 | Ga0209051_1008689 | Ga0209051_10086893 | 466 |
| 1446 | 3300025304 | Ga0209257_1000426 | Ga0209257_100042633 | 466 |
| 1447 | 3300025304 | Ga0209257_1001142 | Ga0209257_100114218 | 466 |
| 1448 | 3300025304 | Ga0209257_1018731 | Ga0209257_10187312 | 466 |
| 1449 | 3300025315 | Ga0207697_10000672 | Ga0207697_100006726 | 466 |
| 1450 | 3300025315 | Ga0207697_10019395 | Ga0207697_100193952 | 466 |
| 1451 | 3300025711 | Ga0207696_1024092 | Ga0207696_10240922 | 466 |
| 1452 | 3300025885 | Ga0207653_10000963 | Ga0207653_100009636 | 466 |
| 1453 | 3300025885 | Ga0207653_10042695 | Ga0207653_100426951 | 466 |
| 1454 | 3300025893 | Ga0207682_10000154 | Ga0207682_1000015429 | 466 |
| 1455 | 3300025898 | Ga0207692_10000468 | Ga0207692_1000046812 | 466 |
| 1456 | 3300025898 | Ga0207692_10001055 | Ga0207692_100010557 | 466 |
| 1457 | 3300025898 | Ga0207692_10003318 | Ga0207692_100033183 | 466 |
| 1458 | 3300025898 | Ga0207692_10005603 | Ga0207692_100056032 | 466 |
| 1459 | 3300025898 | Ga0207692_10009587 | Ga0207692_100095872 | 466 |
| 1460 | 3300025898 | Ga0207692_10040569 | Ga0207692_100405692 | 466 |
| 1461 | 3300025899 | Ga0207642_10002038 | Ga0207642_100020383 | 466 |
| 1462 | 3300025899 | Ga0207642_10006639 | Ga0207642_100066393 | 466 |
| 1463 | 3300025899 | Ga0207642_10012667 | Ga0207642_100126672 | 466 |
| 1464 | 3300025900 | Ga0207710_10001145 | Ga0207710_1000114511 | 466 |
| 1465 | 3300025900 | Ga0207710_10012463 | Ga0207710_100124633 | 466 |
| 1466 | 3300025900 | Ga0207710_10035140 | Ga0207710_100351402 | 466 |
| 1467 | 3300025901 | Ga0207688_10000817 | Ga0207688_100008173 | 466 |
| 1468 | 3300025901 | Ga0207688_10003295 | Ga0207688_100032957 | 466 |
| 1469 | 3300025901 | Ga0207688_10070420 | Ga0207688_100704201 | 466 |
| 1470 | 3300025901 | Ga0207688_10077050 | Ga0207688_100770502 | 466 |
| 1471 | 3300025903 | Ga0207680_10014997 | Ga0207680_100149972 | 466 |
| 1472 | 3300025904 | Ga0207647_10005421 | Ga0207647_100054214 | 466 |
| 1473 | 3300025904 | Ga0207647_10067916 | Ga0207647_100679162 | 466 |
| 1474 | 3300025906 | Ga0207699_10000390 | Ga0207699_100003907 | 466 |
| 1475 | 3300025906 | Ga0207699_10004930 | Ga0207699_100049304 | 466 |
| 1476 | 3300025906 | Ga0207699_10008578 | Ga0207699_100085784 | 466 |
| 1477 | 3300025906 | Ga0207699_10012034 | Ga0207699_100120342 | 466 |
| 1478 | 3300025906 | Ga0207699_10031512 | Ga0207699_100315122 | 466 |
| 1479 | 3300025906 | Ga0207699_10042253 | Ga0207699_100422531 | 466 |
| 1480 | 3300025906 | Ga0207699_10074694 | Ga0207699_100746942 | 466 |
| 1481 | 3300025907 | Ga0207645_10000182 | Ga0207645_1000018244 | 466 |
| 1482 | 3300025907 | Ga0207645_10011610 | Ga0207645_100116106 | 466 |
| 1483 | 3300025907 | Ga0207645_10027683 | Ga0207645_100276833 | 466 |
| 1484 | 3300025907 | Ga0207645_10107850 | Ga0207645_101078502 | 466 |
| 1485 | 3300025908 | Ga0207643_10000405 | Ga0207643_1000040515 | 466 |
| 1486 | 3300025908 | Ga0207643_10000416 | Ga0207643_100004166 | 466 |
| 1487 | 3300025909 | Ga0207705_10065686 | Ga0207705_100656862 | 466 |
| 1488 | 3300025910 | Ga0207684_10089462 | Ga0207684_100894622 | 466 |
| 1489 | 3300025911 | Ga0207654_10000323 | Ga0207654_1000032310 | 466 |
| 1490 | 3300025911 | Ga0207654_10000889 | Ga0207654_1000088912 | 466 |
| 1491 | 3300025911 | Ga0207654_10054127 | Ga0207654_100541272 | 466 |
| 1492 | 3300025911 | Ga0207654_10143963 | Ga0207654_101439632 | 466 |
| 1493 | 3300025912 | Ga0207707_10000178 | Ga0207707_1000017810 | 466 |
| 1494 | 3300025912 | Ga0207707_10001762 | Ga0207707_1000176214 | 466 |
| 1495 | 3300025912 | Ga0207707_10003772 | Ga0207707_100037728 | 466 |
| 1496 | 3300025912 | Ga0207707_10006911 | Ga0207707_100069111 | 466 |
| 1497 | 3300025912 | Ga0207707_10151946 | Ga0207707_101519461 | 466 |
| 1498 | 3300025913 | Ga0207695_10000011 | Ga0207695_1000001147 | 466 |
| 1499 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062273 | 466 |
| 1500 | 3300025913 | Ga0207695_10000497 | Ga0207695_1000049714 | 466 |
| 1501 | 3300025913 | Ga0207695_10085113 | Ga0207695_100851132 | 466 |
| 1502 | 3300025913 | Ga0207695_10088253 | Ga0207695_100882531 | 466 |
| 1503 | 3300025913 | Ga0207695_10106889 | Ga0207695_101068891 | 466 |
| 1504 | 3300025914 | Ga0207671_10000093 | Ga0207671_1000009385 | 466 |
| 1505 | 3300025914 | Ga0207671_10004982 | Ga0207671_100049827 | 466 |
| 1506 | 3300025914 | Ga0207671_10009091 | Ga0207671_100090916 | 466 |
| 1507 | 3300025914 | Ga0207671_10011831 | Ga0207671_100118312 | 466 |
| 1508 | 3300025915 | Ga0207693_10000842 | Ga0207693_1000084216 | 466 |
| 1509 | 3300025915 | Ga0207693_10003503 | Ga0207693_100035038 | 466 |
| 1510 | 3300025915 | Ga0207693_10004344 | Ga0207693_100043445 | 466 |
| 1511 | 3300025915 | Ga0207693_10005530 | Ga0207693_100055304 | 466 |
| 1512 | 3300025915 | Ga0207693_10007487 | Ga0207693_100074872 | 466 |
| 1513 | 3300025915 | Ga0207693_10007572 | Ga0207693_100075725 | 466 |
| 1514 | 3300025915 | Ga0207693_10013345 | Ga0207693_100133454 | 466 |
| 1515 | 3300025915 | Ga0207693_10018008 | Ga0207693_100180084 | 466 |
| 1516 | 3300025915 | Ga0207693_10019662 | Ga0207693_100196624 | 466 |
| 1517 | 3300025915 | Ga0207693_10027789 | Ga0207693_100277893 | 466 |
| 1518 | 3300025915 | Ga0207693_10039213 | Ga0207693_100392133 | 466 |
| 1519 | 3300025915 | Ga0207693_10098850 | Ga0207693_100988502 | 466 |
| 1520 | 3300025916 | Ga0207663_10001979 | Ga0207663_100019791 | 466 |
| 1521 | 3300025916 | Ga0207663_10006434 | Ga0207663_100064342 | 466 |
| 1522 | 3300025916 | Ga0207663_10006811 | Ga0207663_100068115 | 466 |
| 1523 | 3300025916 | Ga0207663_10014546 | Ga0207663_100145461 | 466 |
| 1524 | 3300025917 | Ga0207660_10000007 | Ga0207660_1000000736 | 466 |
| 1525 | 3300025917 | Ga0207660_10078989 | Ga0207660_100789891 | 466 |
| 1526 | 3300025917 | Ga0207660_10129943 | Ga0207660_101299432 | 466 |
| 1527 | 3300025918 | Ga0207662_10009169 | Ga0207662_100091692 | 466 |
| 1528 | 3300025918 | Ga0207662_10117357 | Ga0207662_101173572 | 466 |
| 1529 | 3300025919 | Ga0207657_10002910 | Ga0207657_100029107 | 466 |
| 1530 | 3300025919 | Ga0207657_10010114 | Ga0207657_100101144 | 466 |
| 1531 | 3300025919 | Ga0207657_10022087 | Ga0207657_100220875 | 466 |
| 1532 | 3300025919 | Ga0207657_10023020 | Ga0207657_100230205 | 466 |
| 1533 | 3300025919 | Ga0207657_10029030 | Ga0207657_100290303 | 466 |
| 1534 | 3300025919 | Ga0207657_10088502 | Ga0207657_100885022 | 466 |
| 1535 | 3300025920 | Ga0207649_10000305 | Ga0207649_100003052 | 466 |
| 1536 | 3300025920 | Ga0207649_10083213 | Ga0207649_100832131 | 466 |
| 1537 | 3300025921 | Ga0207652_10000459 | Ga0207652_1000045935 | 466 |
| 1538 | 3300025921 | Ga0207652_10057241 | Ga0207652_100572413 | 466 |
| 1539 | 3300025921 | Ga0207652_10074104 | Ga0207652_100741043 | 466 |
| 1540 | 3300025921 | Ga0207652_10176007 | Ga0207652_101760072 | 466 |
| 1541 | 3300025923 | Ga0207681_10000116 | Ga0207681_1000011666 | 466 |
| 1542 | 3300025923 | Ga0207681_10063702 | Ga0207681_100637021 | 466 |
| 1543 | 3300025923 | Ga0207681_10093833 | Ga0207681_100938332 | 466 |
| 1544 | 3300025924 | Ga0207694_10000212 | Ga0207694_1000021242 | 466 |
| 1545 | 3300025924 | Ga0207694_10020078 | Ga0207694_100200781 | 466 |
| 1546 | 3300025924 | Ga0207694_10117303 | Ga0207694_101173032 | 466 |
| 1547 | 3300025925 | Ga0207650_10004276 | Ga0207650_100042764 | 466 |
| 1548 | 3300025925 | Ga0207650_10004547 | Ga0207650_100045475 | 466 |
| 1549 | 3300025925 | Ga0207650_10009331 | Ga0207650_100093312 | 466 |
| 1550 | 3300025925 | Ga0207650_10063498 | Ga0207650_100634982 | 466 |
| 1551 | 3300025925 | Ga0207650_10068276 | Ga0207650_100682762 | 466 |
| 1552 | 3300025925 | Ga0207650_10079346 | Ga0207650_100793462 | 466 |
| 1553 | 3300025926 | Ga0207659_10000015 | Ga0207659_10000015137 | 466 |
| 1554 | 3300025926 | Ga0207659_10045278 | Ga0207659_100452783 | 466 |
| 1555 | 3300025926 | Ga0207659_10156748 | Ga0207659_101567482 | 466 |
| 1556 | 3300025927 | Ga0207687_10000357 | Ga0207687_100003578 | 466 |
| 1557 | 3300025927 | Ga0207687_10004506 | Ga0207687_100045066 | 466 |
| 1558 | 3300025927 | Ga0207687_10016432 | Ga0207687_100164323 | 466 |
| 1559 | 3300025927 | Ga0207687_10087510 | Ga0207687_100875102 | 466 |
| 1560 | 3300025928 | Ga0207700_10001137 | Ga0207700_1000113713 | 466 |
| 1561 | 3300025928 | Ga0207700_10031891 | Ga0207700_100318913 | 466 |
| 1562 | 3300025928 | Ga0207700_10037199 | Ga0207700_100371992 | 466 |
| 1563 | 3300025928 | Ga0207700_10038868 | Ga0207700_100388682 | 466 |
| 1564 | 3300025928 | Ga0207700_10051582 | Ga0207700_100515822 | 466 |
| 1565 | 3300025928 | Ga0207700_10073940 | Ga0207700_100739402 | 466 |
| 1566 | 3300025928 | Ga0207700_10096958 | Ga0207700_100969582 | 466 |
| 1567 | 3300025928 | Ga0207700_10124373 | Ga0207700_101243732 | 466 |
| 1568 | 3300025929 | Ga0207664_10007701 | Ga0207664_100077011 | 466 |
| 1569 | 3300025929 | Ga0207664_10017466 | Ga0207664_100174664 | 466 |
| 1570 | 3300025929 | Ga0207664_10033246 | Ga0207664_100332463 | 466 |
| 1571 | 3300025929 | Ga0207664_10036057 | Ga0207664_100360573 | 466 |
| 1572 | 3300025929 | Ga0207664_10038518 | Ga0207664_100385182 | 466 |
| 1573 | 3300025929 | Ga0207664_10134816 | Ga0207664_101348162 | 466 |
| 1574 | 3300025931 | Ga0207644_10000251 | Ga0207644_1000025131 | 466 |
| 1575 | 3300025931 | Ga0207644_10002852 | Ga0207644_100028528 | 466 |
| 1576 | 3300025931 | Ga0207644_10005542 | Ga0207644_100055423 | 466 |
| 1577 | 3300025931 | Ga0207644_10005898 | Ga0207644_100058985 | 466 |
| 1578 | 3300025931 | Ga0207644_10041109 | Ga0207644_100411092 | 466 |
| 1579 | 3300025932 | Ga0207690_10000320 | Ga0207690_1000032029 | 466 |
| 1580 | 3300025932 | Ga0207690_10083028 | Ga0207690_100830282 | 466 |
| 1581 | 3300025932 | Ga0207690_10095950 | Ga0207690_100959502 | 466 |
| 1582 | 3300025932 | Ga0207690_10133314 | Ga0207690_101333142 | 466 |
| 1583 | 3300025933 | Ga0207706_10002583 | Ga0207706_1000258313 | 466 |
| 1584 | 3300025933 | Ga0207706_10003309 | Ga0207706_100033098 | 466 |
| 1585 | 3300025933 | Ga0207706_10012590 | Ga0207706_100125904 | 466 |
| 1586 | 3300025933 | Ga0207706_10020107 | Ga0207706_100201072 | 466 |
| 1587 | 3300025933 | Ga0207706_10023317 | Ga0207706_100233173 | 466 |
| 1588 | 3300025933 | Ga0207706_10088609 | Ga0207706_100886092 | 466 |
| 1589 | 3300025934 | Ga0207686_10000234 | Ga0207686_1000023418 | 466 |
| 1590 | 3300025935 | Ga0207709_10000081 | Ga0207709_10000081124 | 466 |
| 1591 | 3300025935 | Ga0207709_10046601 | Ga0207709_100466013 | 466 |
| 1592 | 3300025936 | Ga0207670_10000620 | Ga0207670_100006205 | 466 |
| 1593 | 3300025936 | Ga0207670_10000760 | Ga0207670_100007606 | 466 |
| 1594 | 3300025936 | Ga0207670_10006459 | Ga0207670_100064595 | 466 |
| 1595 | 3300025936 | Ga0207670_10008745 | Ga0207670_100087453 | 466 |
| 1596 | 3300025937 | Ga0207669_10000008 | Ga0207669_1000000825 | 466 |
| 1597 | 3300025937 | Ga0207669_10004053 | Ga0207669_100040532 | 466 |
| 1598 | 3300025938 | Ga0207704_10000215 | Ga0207704_100002152 | 466 |
| 1599 | 3300025938 | Ga0207704_10058982 | Ga0207704_100589822 | 466 |
| 1600 | 3300025938 | Ga0207704_10066628 | Ga0207704_100666282 | 466 |
| 1601 | 3300025938 | Ga0207704_10125936 | Ga0207704_101259361 | 466 |
| 1602 | 3300025939 | Ga0207665_10000361 | Ga0207665_1000036112 | 466 |
| 1603 | 3300025939 | Ga0207665_10001484 | Ga0207665_100014846 | 466 |
| 1604 | 3300025939 | Ga0207665_10045676 | Ga0207665_100456762 | 466 |
| 1605 | 3300025940 | Ga0207691_10000482 | Ga0207691_100004829 | 466 |
| 1606 | 3300025940 | Ga0207691_10002588 | Ga0207691_1000258811 | 466 |
| 1607 | 3300025940 | Ga0207691_10040950 | Ga0207691_100409504 | 466 |
| 1608 | 3300025941 | Ga0207711_10000003 | Ga0207711_10000003861 | 466 |
| 1609 | 3300025941 | Ga0207711_10000005 | Ga0207711_10000005273 | 466 |
| 1610 | 3300025941 | Ga0207711_10000009 | Ga0207711_10000009383 | 466 |
| 1611 | 3300025941 | Ga0207711_10012426 | Ga0207711_100124265 | 466 |
| 1612 | 3300025941 | Ga0207711_10040725 | Ga0207711_100407253 | 466 |
| 1613 | 3300025941 | Ga0207711_10062352 | Ga0207711_100623522 | 466 |
| 1614 | 3300025941 | Ga0207711_10062950 | Ga0207711_100629502 | 466 |
| 1615 | 3300025941 | Ga0207711_10070788 | Ga0207711_100707883 | 466 |
| 1616 | 3300025941 | Ga0207711_10082864 | Ga0207711_100828642 | 466 |
| 1617 | 3300025941 | Ga0207711_10100986 | Ga0207711_101009862 | 466 |
| 1618 | 3300025942 | Ga0207689_10000749 | Ga0207689_1000074913 | 466 |
| 1619 | 3300025944 | Ga0207661_10000170 | Ga0207661_1000017033 | 466 |
| 1620 | 3300025944 | Ga0207661_10004270 | Ga0207661_100042703 | 466 |
| 1621 | 3300025944 | Ga0207661_10032345 | Ga0207661_100323454 | 466 |
| 1622 | 3300025944 | Ga0207661_10089875 | Ga0207661_100898752 | 466 |
| 1623 | 3300025945 | Ga0207679_10000046 | Ga0207679_1000004677 | 466 |
| 1624 | 3300025945 | Ga0207679_10010295 | Ga0207679_100102953 | 466 |
| 1625 | 3300025949 | Ga0207667_10007538 | Ga0207667_100075387 | 466 |
| 1626 | 3300025949 | Ga0207667_10010820 | Ga0207667_100108208 | 466 |
| 1627 | 3300025949 | Ga0207667_10038259 | Ga0207667_100382592 | 466 |
| 1628 | 3300025960 | Ga0207651_10000200 | Ga0207651_1000020015 | 466 |
| 1629 | 3300025960 | Ga0207651_10051209 | Ga0207651_100512092 | 466 |
| 1630 | 3300025960 | Ga0207651_10059710 | Ga0207651_100597103 | 466 |
| 1631 | 3300025960 | Ga0207651_10111193 | Ga0207651_101111932 | 466 |
| 1632 | 3300025961 | Ga0207712_10000495 | Ga0207712_100004952 | 466 |
| 1633 | 3300025961 | Ga0207712_10087561 | Ga0207712_100875612 | 466 |
| 1634 | 3300025961 | Ga0207712_10088828 | Ga0207712_100888282 | 466 |
| 1635 | 3300025961 | Ga0207712_10149277 | Ga0207712_101492772 | 466 |
| 1636 | 3300025972 | Ga0207668_10000133 | Ga0207668_1000013330 | 466 |
| 1637 | 3300025972 | Ga0207668_10084712 | Ga0207668_100847123 | 466 |
| 1638 | 3300025972 | Ga0207668_10103475 | Ga0207668_101034752 | 466 |
| 1639 | 3300025981 | Ga0207640_10000191 | Ga0207640_1000019134 | 466 |
| 1640 | 3300025981 | Ga0207640_10016944 | Ga0207640_100169441 | 466 |
| 1641 | 3300025981 | Ga0207640_10042013 | Ga0207640_100420133 | 466 |
| 1642 | 3300025981 | Ga0207640_10058017 | Ga0207640_100580172 | 466 |
| 1643 | 3300025986 | Ga0207658_10000535 | Ga0207658_1000053527 | 466 |
| 1644 | 3300025986 | Ga0207658_10059229 | Ga0207658_100592293 | 466 |
| 1645 | 3300025986 | Ga0207658_10144152 | Ga0207658_101441522 | 466 |
| 1646 | 3300026023 | Ga0207677_10000806 | Ga0207677_1000080613 | 466 |
| 1647 | 3300026023 | Ga0207677_10075864 | Ga0207677_100758642 | 466 |
| 1648 | 3300026035 | Ga0207703_10001617 | Ga0207703_100016172 | 466 |
| 1649 | 3300026035 | Ga0207703_10003074 | Ga0207703_100030746 | 466 |
| 1650 | 3300026035 | Ga0207703_10012070 | Ga0207703_100120702 | 466 |
| 1651 | 3300026041 | Ga0207639_10002809 | Ga0207639_100028096 | 466 |
| 1652 | 3300026041 | Ga0207639_10009638 | Ga0207639_100096383 | 466 |
| 1653 | 3300026041 | Ga0207639_10009726 | Ga0207639_100097266 | 466 |
| 1654 | 3300026041 | Ga0207639_10010472 | Ga0207639_100104721 | 466 |
| 1655 | 3300026041 | Ga0207639_10019773 | Ga0207639_100197733 | 466 |
| 1656 | 3300026041 | Ga0207639_10237420 | Ga0207639_102374202 | 466 |
| 1657 | 3300026067 | Ga0207678_10001859 | Ga0207678_100018595 | 466 |
| 1658 | 3300026067 | Ga0207678_10016738 | Ga0207678_100167386 | 466 |
| 1659 | 3300026067 | Ga0207678_10054411 | Ga0207678_100544112 | 466 |
| 1660 | 3300026067 | Ga0207678_10109849 | Ga0207678_101098491 | 466 |
| 1661 | 3300026075 | Ga0207708_10001031 | Ga0207708_100010311 | 466 |
| 1662 | 3300026075 | Ga0207708_10018880 | Ga0207708_100188805 | 466 |
| 1663 | 3300026075 | Ga0207708_10019057 | Ga0207708_100190571 | 466 |
| 1664 | 3300026075 | Ga0207708_10104329 | Ga0207708_101043292 | 466 |
| 1665 | 3300026075 | Ga0207708_10150977 | Ga0207708_101509772 | 466 |
| 1666 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003389 | 466 |
| 1667 | 3300026078 | Ga0207702_10000041 | Ga0207702_1000004174 | 466 |
| 1668 | 3300026078 | Ga0207702_10003065 | Ga0207702_1000306513 | 466 |
| 1669 | 3300026088 | Ga0207641_10000593 | Ga0207641_1000059314 | 466 |
| 1670 | 3300026088 | Ga0207641_10019300 | Ga0207641_100193004 | 466 |
| 1671 | 3300026089 | Ga0207648_10002417 | Ga0207648_100024176 | 466 |
| 1672 | 3300026089 | Ga0207648_10013629 | Ga0207648_100136294 | 466 |
| 1673 | 3300026095 | Ga0207676_10009283 | Ga0207676_100092835 | 466 |
| 1674 | 3300026095 | Ga0207676_10011206 | Ga0207676_100112062 | 466 |
| 1675 | 3300026095 | Ga0207676_10011983 | Ga0207676_100119834 | 466 |
| 1676 | 3300026116 | Ga0207674_10003381 | Ga0207674_100033816 | 466 |
| 1677 | 3300026116 | Ga0207674_10004756 | Ga0207674_100047569 | 466 |
| 1678 | 3300026116 | Ga0207674_10026464 | Ga0207674_100264647 | 466 |
| 1679 | 3300026116 | Ga0207674_10031482 | Ga0207674_100314822 | 466 |
| 1680 | 3300026116 | Ga0207674_10165937 | Ga0207674_101659372 | 466 |
| 1681 | 3300026118 | Ga0207675_100002182 | Ga0207675_10000218213 | 466 |
| 1682 | 3300026118 | Ga0207675_100029789 | Ga0207675_1000297892 | 466 |
| 1683 | 3300026118 | Ga0207675_100033143 | Ga0207675_1000331432 | 466 |
| 1684 | 3300026118 | Ga0207675_100038306 | Ga0207675_1000383062 | 466 |
| 1685 | 3300026121 | Ga0207683_10000002 | Ga0207683_10000002259 | 466 |
| 1686 | 3300026121 | Ga0207683_10006919 | Ga0207683_100069195 | 466 |
| 1687 | 3300026121 | Ga0207683_10041959 | Ga0207683_100419592 | 466 |
| 1688 | 3300026121 | Ga0207683_10042740 | Ga0207683_100427404 | 466 |
| 1689 | 3300026121 | Ga0207683_10072340 | Ga0207683_100723403 | 466 |
| 1690 | 3300026142 | Ga0207698_10000545 | Ga0207698_1000054511 | 466 |
| 1691 | 3300026142 | Ga0207698_10004110 | Ga0207698_100041105 | 466 |
| 1692 | 3300026142 | Ga0207698_10021924 | Ga0207698_100219243 | 466 |
| 1693 | 3300026142 | Ga0207698_10054008 | Ga0207698_100540083 | 466 |
| 1694 | 3300026142 | Ga0207698_10214656 | Ga0207698_102146562 | 466 |
| 1695 | 3300027111 | Ga0209281_1000106 | Ga0209281_1000106187 | 466 |
| 1696 | 3300027111 | Ga0209281_1000318 | Ga0209281_100031832 | 466 |
| 1697 | 3300027296 | Ga0209389_1000004 | Ga0209389_10000044 | 466 |
| 1698 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002311 | 466 |
| 1699 | 3300027312 | Ga0209371_1000022 | Ga0209371_100002277 | 466 |
| 1700 | 3300027312 | Ga0209371_1001019 | Ga0209371_100101919 | 466 |
| 1701 | 3300027312 | Ga0209371_1004133 | Ga0209371_10041332 | 466 |
| 1702 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006372 | 466 |
| 1703 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010148 | 466 |
| 1704 | 3300027361 | Ga0209489_100007 | Ga0209489_100007372 | 466 |
| 1705 | 3300027361 | Ga0209489_100011 | Ga0209489_10001188 | 466 |
| 1706 | 3300027361 | Ga0209489_100295 | Ga0209489_1002953 | 466 |
| 1707 | 3300027363 | Ga0209700_100008 | Ga0209700_100008372 | 466 |
| 1708 | 3300027363 | Ga0209700_100013 | Ga0209700_10001391 | 466 |
| 1709 | 3300027512 | Ga0209179_1002939 | Ga0209179_10029392 | 466 |
| 1710 | 3300027666 | Ga0209282_1000024 | Ga0209282_1000024118 | 466 |
| 1711 | 3300027666 | Ga0209282_1000531 | Ga0209282_10005315 | 466 |
| 1712 | 3300027695 | Ga0209966_1000800 | Ga0209966_10008004 | 466 |
| 1713 | 3300027695 | Ga0209966_1004060 | Ga0209966_10040601 | 466 |
| 1714 | 3300027717 | Ga0209998_10015195 | Ga0209998_100151951 | 466 |
| 1715 | 3300027866 | Ga0209813_10002584 | Ga0209813_100025843 | 466 |
| 1716 | 3300027866 | Ga0209813_10032067 | Ga0209813_100320671 | 466 |
| 1717 | 3300027876 | Ga0209974_10000944 | Ga0209974_100009445 | 466 |
| 1718 | 3300027876 | Ga0209974_10009960 | Ga0209974_100099602 | 466 |
| 1719 | 3300027907 | Ga0207428_10000011 | Ga0207428_1000001143 | 466 |
| 1720 | 3300027907 | Ga0207428_10000046 | Ga0207428_10000046138 | 466 |
| 1721 | 3300027907 | Ga0207428_10000058 | Ga0207428_1000005878 | 466 |
| 1722 | 3300027907 | Ga0207428_10001276 | Ga0207428_1000127610 | 466 |
| 1723 | 3300027907 | Ga0207428_10032257 | Ga0207428_100322572 | 466 |
| 1724 | 3300028379 | Ga0268266_10004900 | Ga0268266_100049008 | 466 |
| 1725 | 3300028379 | Ga0268266_10006027 | Ga0268266_100060274 | 466 |
| 1726 | 3300028379 | Ga0268266_10008843 | Ga0268266_100088437 | 466 |
| 1727 | 3300028379 | Ga0268266_10013893 | Ga0268266_100138933 | 466 |
| 1728 | 3300028379 | Ga0268266_10019605 | Ga0268266_100196054 | 466 |
| 1729 | 3300028379 | Ga0268266_10039703 | Ga0268266_100397032 | 466 |
| 1730 | 3300028379 | Ga0268266_10124277 | Ga0268266_101242771 | 466 |
| 1731 | 3300028380 | Ga0268265_10010132 | Ga0268265_100101324 | 466 |
| 1732 | 3300028380 | Ga0268265_10011194 | Ga0268265_100111945 | 466 |
| 1733 | 3300028380 | Ga0268265_10060191 | Ga0268265_100601911 | 466 |
| 1734 | 3300028380 | Ga0268265_10232093 | Ga0268265_102320931 | 466 |
| 1735 | 3300028381 | Ga0268264_10000093 | Ga0268264_10000093115 | 466 |
| 1736 | 3300028381 | Ga0268264_10000340 | Ga0268264_100003407 | 466 |
| 1737 | 3300028381 | Ga0268264_10013402 | Ga0268264_100134023 | 466 |
| 1738 | 3300028381 | Ga0268264_10016659 | Ga0268264_100166594 | 466 |
| 1739 | 3300028381 | Ga0268264_10102505 | Ga0268264_101025052 | 466 |
| 1740 | 3300028381 | Ga0268264_10140599 | Ga0268264_101405991 | 466 |
| 1741 | 3300028666 | Ga0265336_10005296 | Ga0265336_100052962 | 466 |
| 1742 | 3300028786 | Ga0307517_10000085 | Ga0307517_10000085112 | 466 |
| 1743 | 3300028786 | Ga0307517_10098343 | Ga0307517_100983432 | 466 |
| 1744 | 3300028794 | Ga0307515_10001978 | Ga0307515_1000197821 | 466 |
| 1745 | 3300028794 | Ga0307515_10007368 | Ga0307515_100073689 | 466 |
| 1746 | 3300028794 | Ga0307515_10030752 | Ga0307515_100307525 | 466 |
| 1747 | 3300028794 | Ga0307515_10039862 | Ga0307515_100398626 | 466 |
| 1748 | 3300028800 | Ga0265338_10000328 | Ga0265338_1000032825 | 466 |
| 1749 | 3300028800 | Ga0265338_10030731 | Ga0265338_100307315 | 466 |
| 1750 | 3300028800 | Ga0265338_10033564 | Ga0265338_100335641 | 466 |
| 1751 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019443 | 466 |
| 1752 | 3300030500 | Ga0268256_1003875 | Ga0268256_10038752 | 466 |
| 1753 | 3300030500 | Ga0268256_1016593 | Ga0268256_10165932 | 466 |
| 1754 | 3300030521 | Ga0307511_10057782 | Ga0307511_100577822 | 466 |
| 1755 | 3300031235 | Ga0265330_10016569 | Ga0265330_100165692 | 466 |
| 1756 | 3300031235 | Ga0265330_10034309 | Ga0265330_100343092 | 466 |
| 1757 | 3300031238 | Ga0265332_10011026 | Ga0265332_100110262 | 466 |
| 1758 | 3300031239 | Ga0265328_10000047 | Ga0265328_1000004758 | 466 |
| 1759 | 3300031239 | Ga0265328_10004803 | Ga0265328_100048036 | 466 |
| 1760 | 3300031239 | Ga0265328_10011003 | Ga0265328_100110033 | 466 |
| 1761 | 3300031240 | Ga0265320_10000209 | Ga0265320_1000020924 | 466 |
| 1762 | 3300031241 | Ga0265325_10000117 | Ga0265325_1000011738 | 466 |
| 1763 | 3300031241 | Ga0265325_10000855 | Ga0265325_100008556 | 466 |
| 1764 | 3300031241 | Ga0265325_10005212 | Ga0265325_100052124 | 466 |
| 1765 | 3300031241 | Ga0265325_10011412 | Ga0265325_100114122 | 466 |
| 1766 | 3300031241 | Ga0265325_10013215 | Ga0265325_100132154 | 466 |
| 1767 | 3300031241 | Ga0265325_10046783 | Ga0265325_100467832 | 466 |
| 1768 | 3300031242 | Ga0265329_10036621 | Ga0265329_100366212 | 466 |
| 1769 | 3300031247 | Ga0265340_10002779 | Ga0265340_100027796 | 466 |
| 1770 | 3300031247 | Ga0265340_10006860 | Ga0265340_100068604 | 466 |
| 1771 | 3300031247 | Ga0265340_10009498 | Ga0265340_100094983 | 466 |
| 1772 | 3300031247 | Ga0265340_10017347 | Ga0265340_100173472 | 466 |
| 1773 | 3300031249 | Ga0265339_10000084 | Ga0265339_1000008472 | 466 |
| 1774 | 3300031249 | Ga0265339_10000450 | Ga0265339_1000045023 | 466 |
| 1775 | 3300031249 | Ga0265339_10021175 | Ga0265339_100211752 | 466 |
| 1776 | 3300031250 | Ga0265331_10000707 | Ga0265331_100007077 | 466 |
| 1777 | 3300031250 | Ga0265331_10013005 | Ga0265331_100130053 | 466 |
| 1778 | 3300031250 | Ga0265331_10014674 | Ga0265331_100146742 | 466 |
| 1779 | 3300031251 | Ga0265327_10015402 | Ga0265327_100154022 | 466 |
| 1780 | 3300031344 | Ga0265316_10002618 | Ga0265316_100026183 | 466 |
| 1781 | 3300031456 | Ga0307513_10010539 | Ga0307513_100105397 | 466 |
| 1782 | 3300031456 | Ga0307513_10077997 | Ga0307513_100779973 | 466 |
| 1783 | 3300031456 | Ga0307513_10082118 | Ga0307513_100821183 | 466 |
| 1784 | 3300031456 | Ga0307513_10228700 | Ga0307513_102287001 | 466 |
| 1785 | 3300031548 | Ga0307408_100056480 | Ga0307408_1000564802 | 466 |
| 1786 | 3300031595 | Ga0265313_10000242 | Ga0265313_1000024215 | 466 |
| 1787 | 3300031595 | Ga0265313_10000340 | Ga0265313_1000034028 | 466 |
| 1788 | 3300031595 | Ga0265313_10005463 | Ga0265313_1000546310 | 466 |
| 1789 | 3300031595 | Ga0265313_10009155 | Ga0265313_100091555 | 466 |
| 1790 | 3300031595 | Ga0265313_10064921 | Ga0265313_100649212 | 466 |
| 1791 | 3300031616 | Ga0307508_10000034 | Ga0307508_10000034125 | 466 |
| 1792 | 3300031616 | Ga0307508_10047091 | Ga0307508_100470913 | 466 |
| 1793 | 3300031616 | Ga0307508_10057194 | Ga0307508_100571942 | 466 |
| 1794 | 3300031691 | Ga0316579_10007101 | Ga0316579_100071016 | 466 |
| 1795 | 3300031711 | Ga0265314_10001245 | Ga0265314_1000124510 | 466 |
| 1796 | 3300031711 | Ga0265314_10005302 | Ga0265314_100053025 | 466 |
| 1797 | 3300031711 | Ga0265314_10067583 | Ga0265314_100675832 | 466 |
| 1798 | 3300031712 | Ga0265342_10000211 | Ga0265342_1000021116 | 466 |
| 1799 | 3300031712 | Ga0265342_10006824 | Ga0265342_100068245 | 466 |
| 1800 | 3300031712 | Ga0265342_10009227 | Ga0265342_100092274 | 466 |
| 1801 | 3300031712 | Ga0265342_10022614 | Ga0265342_100226143 | 466 |
| 1802 | 3300031712 | Ga0265342_10076179 | Ga0265342_100761792 | 466 |
| 1803 | 3300031731 | Ga0307405_10067890 | Ga0307405_100678902 | 466 |
| 1804 | 3300031824 | Ga0307413_10046953 | Ga0307413_100469531 | 466 |
| 1805 | 3300031901 | Ga0307406_10092557 | Ga0307406_100925572 | 466 |
| 1806 | 3300031967 | Ga0315914_1000012 | Ga0315914_100001245 | 466 |
| 1807 | 3300031995 | Ga0307409_100020095 | Ga0307409_1000200953 | 466 |
| 1808 | 3300031995 | Ga0307409_100057238 | Ga0307409_1000572382 | 466 |
| 1809 | 3300032004 | Ga0307414_10058321 | Ga0307414_100583212 | 466 |
| 1810 | 3300032133 | Ga0316583_10002698 | Ga0316583_100026984 | 466 |
| 1811 | 3300033180 | Ga0307510_10004348 | Ga0307510_100043487 | 466 |
| 1812 | 3300033180 | Ga0307510_10036621 | Ga0307510_100366213 | 466 |
| 1813 | 3300033430 | Ga0315913_1000006 | Ga0315913_100000645 | 466 |
| 1814 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010164 | 466 |
| 1815 | 3300033464 | Ga0315915_1000010 | Ga0315915_1000010220 | 466 |
| 1816 | 3300034816 | Ga0373930_0003116 | Ga0373930_0003116_185_1585 | 466 |
| 1817 | 3300034816 | Ga0373930_0010266 | Ga0373930_0010266_19_1422 | 466 |
| 1818 | 3300034817 | Ga0373948_0000885 | Ga0373948_0000885_768_2168 | 466 |
| 1819 | 3300034817 | Ga0373948_0010641 | Ga0373948_0010641_126_1526 | 466 |
| 1820 | 3300034818 | Ga0373950_0001808 | Ga0373950_0001808_1231_2631 | 466 |
| 1821 | 3300034818 | Ga0373950_0002959 | Ga0373950_0002959_72_1472 | 466 |
| 1822 | 3300034819 | Ga0373958_0000097 | Ga0373958_0000097_3358_4758 | 466 |
| 1823 | 3300034820 | Ga0373959_0000831 | Ga0373959_0000831_162_1562 | 466 |
| 1824 | 3300034957 | Ga0373938_0000032 | Ga0373938_0000032_4272_5672 | 466 |
| 1825 | 3300034957 | Ga0373938_0000454 | Ga0373938_0000454_698_2098 | 466 |
| 1826 | 3300034957 | Ga0373938_0005302 | Ga0373938_0005302_352_1752 | 466 |
| 1827 | 3300035083 | Ga0373926_0004868 | Ga0373926_0004868_534_1934 | 466 |
| 1828 | 3300035083 | Ga0373926_0012760 | Ga0373926_0012760_837_2249 | 466 |
| 1829 | 3300035085 | Ga0373929_0001755 | Ga0373929_0001755_1729_3129 | 466 |
| 1830 | 3300035085 | Ga0373929_0003006 | Ga0373929_0003006_189_1589 | 466 |
| 1831 | 3300035086 | Ga0373934_0037578 | Ga0373934_0037578_491_1894 | 466 |
| 1832 | 3300035090 | Ga0373949_0001084 | Ga0373949_0001084_1481_2881 | 466 |
| 1833 | 3300035091 | Ga0373951_0000472 | Ga0373951_0000472_6746_8146 | 466 |
| 1834 | 3300035091 | Ga0373951_0002239 | Ga0373951_0002239_2891_4291 | 466 |
| 1835 | 3300035092 | Ga0373952_0000675 | Ga0373952_0000675_2071_3471 | 466 |
| 1836 | 3300035092 | Ga0373952_0000857 | Ga0373952_0000857_120_1520 | 466 |
| 1837 | 3300035111 | Ga0373923_0001236 | Ga0373923_0001236_4747_6222 | 466 |
| 1838 | 3300035111 | Ga0373923_0002149 | Ga0373923_0002149_2410_3861 | 466 |
| 1839 | 3300035112 | Ga0373932_0000180 | Ga0373932_0000180_4144_5544 | 466 |
| 1840 | 3300035112 | Ga0373932_0004968 | Ga0373932_0004968_959_2359 | 466 |
| 1841 | 3300035113 | Ga0373936_0005755 | Ga0373936_0005755_705_2156 | 466 |
| 1842 | 3300035113 | Ga0373936_0016254 | Ga0373936_0016254_1183_2586 | 466 |
| 1843 | 3300035113 | Ga0373936_0020061 | Ga0373936_0020061_1181_2584 | 466 |
| 1844 | 3300035114 | Ga0373939_0000151 | Ga0373939_0000151_13664_15064 | 466 |
| 1845 | 3300035114 | Ga0373939_0001404 | Ga0373939_0001404_4272_5672 | 466 |
| 1846 | 3300035115 | Ga0373941_0001811 | Ga0373941_0001811_1535_2938 | 466 |
| 1847 | 3300035115 | Ga0373941_0002963 | Ga0373941_0002963_1407_2807 | 466 |
| 1848 | 3300035115 | Ga0373941_0003543 | Ga0373941_0003543_1432_2832 | 466 |
| 1849 | 3300035116 | Ga0373945_0001892 | Ga0373945_0001892_596_2047 | 466 |
| 1850 | 3300035116 | Ga0373945_0014158 | Ga0373945_0014158_645_2045 | 466 |
| 1851 | 3300035117 | Ga0373953_0001359 | Ga0373953_0001359_4984_6393 | 466 |
| 1852 | 3300035117 | Ga0373953_0001859 | Ga0373953_0001859_3337_4737 | 466 |
| 1853 | 3300035118 | Ga0373954_0001664 | Ga0373954_0001664_7204_8679 | 466 |
| 1854 | 3300035118 | Ga0373954_0002584 | Ga0373954_0002584_5978_7381 | 466 |
| 1855 | 3300035118 | Ga0373954_0004556 | Ga0373954_0004556_3495_4904 | 466 |
| 1856 | 3300035118 | Ga0373954_0023646 | Ga0373954_0023646_188_1591 | 466 |
| 1857 | 3300035118 | Ga0373954_0054205 | Ga0373954_0054205_183_1634 | 466 |
| 1858 | 3300035118 | Ga0373954_0056759 | Ga0373954_0056759_147_1550 | 466 |
| 1859 | 3300035119 | Ga0373956_0034829 | Ga0373956_0034829_274_1677 | 466 |
| 1860 | 3300035120 | Ga0373957_0001068 | Ga0373957_0001068_1899_3308 | 466 |
| 1861 | 3300035120 | Ga0373957_0015263 | Ga0373957_0015263_755_2158 | 466 |
| 1862 | 3300035121 | Ga0373960_0000184 | Ga0373960_0000184_6937_8337 | 466 |
| 1863 | 3300035121 | Ga0373960_0003038 | Ga0373960_0003038_1462_2862 | 466 |
| 1864 | 3300035170 | Ga0373943_0000072 | Ga0373943_0000072_4885_6294 | 466 |
| 1865 | 3300035170 | Ga0373943_0006580 | Ga0373943_0006580_2398_3801 | 466 |
| 1866 | 3300035170 | Ga0373943_0007994 | Ga0373943_0007994_1478_2881 | 466 |
| 1867 | 3300035170 | Ga0373943_0024755 | Ga0373943_0024755_230_1633 | 466 |
| 1868 | 3300035170 | Ga0373943_0046399 | Ga0373943_0046399_276_1676 | 466 |
| 1869 | 3300035171 | Ga0373946_0009681 | Ga0373946_0009681_954_2354 | 466 |
| 1870 | 3300035171 | Ga0373946_0012729 | Ga0373946_0012729_355_1755 | 466 |
| 1871 | 3300035171 | Ga0373946_0035330 | Ga0373946_0035330_548_1960 | 466 |
| 1872 | 3300035172 | Ga0373955_0000880 | Ga0373955_0000880_7777_9186 | 466 |
| 1873 | 3300035172 | Ga0373955_0004332 | Ga0373955_0004332_2126_3601 | 466 |
| 1874 | 3300035172 | Ga0373955_0006574 | Ga0373955_0006574_2548_3951 | 466 |
| 1875 | 3300035172 | Ga0373955_0014225 | Ga0373955_0014225_10_1422 | 466 |
| 1876 | 3300035172 | Ga0373955_0050101 | Ga0373955_0050101_110_1510 | 466 |
| 1877 | 3300035172 | Ga0373955_0054012 | Ga0373955_0054012_634_2034 | 466 |
| 1878 | 3300035172 | Ga0373955_0059876 | Ga0373955_0059876_680_2083 | 466 |
| 1879 | 3300035207 | Ga0373942_0000288 | Ga0373942_0000288_855_2255 | 466 |
| 1880 | 3300035207 | Ga0373942_0005465 | Ga0373942_0005465_1198_2598 | 466 |
| 1881 | 3300035241 | Ga0373961_0003973 | Ga0373961_0003973_820_2223 | 466 |
| 1882 | 3300035242 | Ga0373962_0000113 | Ga0373962_0000113_12077_13477 | 466 |
| 1883 | 3300035242 | Ga0373962_0000606 | Ga0373962_0000606_161_1561 | 466 |
| 1884 | 3300035242 | Ga0373962_0002013 | Ga0373962_0002013_99_1499 | 466 |
| 1885 | 3300035398 | Ga0316574_0001675 | Ga0316574_0001675_7363_8778 | 466 |
| 1886 | 3300035410 | Ga0373924_0002398 | Ga0373924_0002398_782_2191 | 466 |
| 1887 | 3300035410 | Ga0373924_0006697 | Ga0373924_0006697_375_1778 | 466 |
| 1888 | 3300035410 | Ga0373924_0007407 | Ga0373924_0007407_1808_3259 | 466 |
| 1889 | 3300035691 | Ga0373931_0000290 | Ga0373931_0000290_13552_14952 | 466 |
| 1890 | 3300035691 | Ga0373931_0004295 | Ga0373931_0004295_324_1730 | 466 |
| 1891 | 3300035691 | Ga0373931_0009129 | Ga0373931_0009129_1996_3396 | 466 |
| 1892 | 3300035691 | Ga0373931_0053672 | Ga0373931_0053672_731_2134 | 466 |
| 1893 | 3300035692 | Ga0373935_0000185 | Ga0373935_0000185_10529_12004 | 466 |
| 1894 | 3300035692 | Ga0373935_0000259 | Ga0373935_0000259_14963_16366 | 466 |
| 1895 | 3300035692 | Ga0373935_0007559 | Ga0373935_0007559_4907_6316 | 466 |
| 1896 | 3300035692 | Ga0373935_0010080 | Ga0373935_0010080_2744_4147 | 466 |
| 1897 | 3300035692 | Ga0373935_0015153 | Ga0373935_0015153_448_1848 | 466 |
| 1898 | 3300035692 | Ga0373935_0018309 | Ga0373935_0018309_1889_3298 | 466 |
| 1899 | 3300035692 | Ga0373935_0023830 | Ga0373935_0023830_1674_3074 | 466 |
| 1900 | 3300035692 | Ga0373935_0032229 | Ga0373935_0032229_304_1755 | 466 |
| 1901 | 3300035692 | Ga0373935_0035977 | Ga0373935_0035977_1340_2752 | 466 |
| 1902 | 3300035692 | Ga0373935_0046704 | Ga0373935_0046704_1078_2478 | 466 |
| 1903 | 3300035692 | Ga0373935_0111083 | Ga0373935_0111083_259_1671 | 466 |
| 1904 | 3300035695 | Ga0373927_0000350 | Ga0373927_0000350_31803_33218 | 466 |
| 1905 | 3300035695 | Ga0373927_0002379 | Ga0373927_0002379_5450_6853 | 466 |
| 1906 | 3300035695 | Ga0373927_0005383 | Ga0373927_0005383_2519_3928 | 466 |
| 1907 | 3300035695 | Ga0373927_0009651 | Ga0373927_0009651_1172_2581 | 466 |
| 1908 | 3300035695 | Ga0373927_0012786 | Ga0373927_0012786_2084_3559 | 466 |
| 1909 | 3300035695 | Ga0373927_0016655 | Ga0373927_0016655_2817_4220 | 466 |
| 1910 | 3300035695 | Ga0373927_0040366 | Ga0373927_0040366_908_2320 | 466 |
| 1911 | 3300035695 | Ga0373927_0095089 | Ga0373927_0095089_129_1532 | 466 |
| 1912 | 3300035724 | Ga0373933_0000672 | Ga0373933_0000672_3155_4555 | 466 |
| 1913 | 3300035724 | Ga0373933_0001150 | Ga0373933_0001150_13984_15387 | 466 |
| 1914 | 3300035724 | Ga0373933_0002191 | Ga0373933_0002191_3340_4749 | 466 |
| 1915 | 3300035724 | Ga0373933_0008994 | Ga0373933_0008994_1194_2669 | 466 |
| 1916 | 3300035724 | Ga0373933_0015628 | Ga0373933_0015628_199_1599 | 466 |
| 1917 | 3300035725 | Ga0373947_0000217 | Ga0373947_0000217_12929_14332 | 466 |
| 1918 | 3300035725 | Ga0373947_0002658 | Ga0373947_0002658_800_2200 | 466 |
| 1919 | 3300035725 | Ga0373947_0010938 | Ga0373947_0010938_3455_4858 | 466 |
| 1920 | 3300035725 | Ga0373947_0012207 | Ga0373947_0012207_753_2156 | 466 |
| 1921 | 3300035725 | Ga0373947_0012703 | Ga0373947_0012703_35_1438 | 466 |
| 1922 | 3300035725 | Ga0373947_0013046 | Ga0373947_0013046_2879_4282 | 466 |
| 1923 | 3300035725 | Ga0373947_0025550 | Ga0373947_0025550_1691_3142 | 466 |
| 1924 | 3300035725 | Ga0373947_0060565 | Ga0373947_0060565_355_1767 | 466 |
| 1925 | 3300035725 | Ga0373947_0073931 | Ga0373947_0073931_270_1673 | 466 |
| 1926 | 3300036401 | Ga0373937_0000068 | Ga0373937_0000068_79769_81244 | 466 |
| 1927 | 3300036401 | Ga0373937_0003441 | Ga0373937_0003441_7740_9152 | 466 |
| 1928 | 3300036401 | Ga0373937_0005533 | Ga0373937_0005533_4221_5624 | 466 |
| 1929 | 3300036401 | Ga0373937_0006578 | Ga0373937_0006578_5447_6856 | 466 |
| 1930 | 3300036401 | Ga0373937_0019412 | Ga0373937_0019412_1367_2767 | 466 |
| 1931 | 3300036401 | Ga0373937_0022213 | Ga0373937_0022213_2721_4124 | 466 |
| 1932 | 3300036401 | Ga0373937_0022578 | Ga0373937_0022578_925_2325 | 466 |
| 1933 | 3300036401 | Ga0373937_0048658 | Ga0373937_0048658_1079_2482 | 466 |
| 1934 | 3300036401 | Ga0373937_0051281 | Ga0373937_0051281_1551_2954 | 466 |
| 1935 | 3300036401 | Ga0373937_0062102 | Ga0373937_0062102_119_1519 | 466 |
| 1936 | 3300036401 | Ga0373937_0154886 | Ga0373937_0154886_127_1530 | 466 |
| 1937 | 3300036401 | Ga0373937_0160985 | Ga0373937_0160985_282_1685 | 466 |
| 1938 | 3300036712 | Ga0316584_0000295 | Ga0316584_0000295_9391_10806 | 466 |
| 1939 | 3300037068 | Ga0373925_0002114 | Ga0373925_0002114_13688_15097 | 466 |
| 1940 | 3300037068 | Ga0373925_0002364 | Ga0373925_0002364_640_2115 | 466 |
| 1941 | 3300037068 | Ga0373925_0004501 | Ga0373925_0004501_4984_6387 | 466 |
| 1942 | 3300037068 | Ga0373925_0012856 | Ga0373925_0012856_534_1943 | 466 |
| 1943 | 3300037068 | Ga0373925_0026107 | Ga0373925_0026107_151_1560 | 466 |
| 1944 | 3300037068 | Ga0373925_0027981 | Ga0373925_0027981_1302_2705 | 466 |
| 1945 | 3300037068 | Ga0373925_0032521 | Ga0373925_0032521_1131_2531 | 466 |
| 1946 | 3300037068 | Ga0373925_0032858 | Ga0373925_0032858_279_1694 | 466 |
| 1947 | 3300037068 | Ga0373925_0045644 | Ga0373925_0045644_1007_2416 | 466 |
| 1948 | 3300037068 | Ga0373925_0055362 | Ga0373925_0055362_117_1529 | 466 |
| 1949 | 3300037068 | Ga0373925_0109575 | Ga0373925_0109575_304_1755 | 466 |
| 1950 | 3300037068 | Ga0373925_0144718 | Ga0373925_0144718_37_1440 | 466 |
| 1951 | 3300037312 | Ga0395899_0011711 | Ga0395899_0011711_3656_5068 | 466 |
| 1952 | 3300037418 | Ga0395900_0001924 | Ga0395900_0001924_10262_11665 | 466 |
| 1953 | 3300037418 | Ga0395900_0002400 | Ga0395900_0002400_13062_14474 | 466 |
| 1954 | 3300037418 | Ga0395900_0006327 | Ga0395900_0006327_818_2218 | 466 |
| 1955 | 3300037418 | Ga0395900_0070134 | Ga0395900_0070134_507_1910 | 466 |
| 1956 | 3300037418 | Ga0395900_0086570 | Ga0395900_0086570_1100_2503 | 466 |
| 1957 | 3300037466 | Ga0395898_0007812 | Ga0395898_0007812_4193_5605 | 466 |
| 1958 | 3300037466 | Ga0395898_0020243 | Ga0395898_0020243_4670_6073 | 466 |
| 1959 | 3300037471 | Ga0395905_0019046 | Ga0395905_0019046_642_2087 | 466 |
| 1960 | 3300037853 | Ga0436364_0351366 | Ga0436364_0351366_372_1781 | 466 |
| 1961 | 3300037853 | Ga0436364_0387248 | Ga0436364_0387248_119_1522 | 466 |
| 1962 | 3300037853 | Ga0436364_0578778 | Ga0436364_0578778_1912_3315 | 466 |
| 1963 | 3300037853 | Ga0436364_0719813 | Ga0436364_0719813_630_2042 | 466 |
| 1964 | 3300037853 | Ga0436364_0789056 | Ga0436364_0789056_2643_4052 | 466 |
| 1965 | 3300038443 | Ga0395901_0015985 | Ga0395901_0015985_3088_4491 | 466 |
| 1966 | 3300038443 | Ga0395901_0021552 | Ga0395901_0021552_837_2249 | 466 |
| 1967 | 3300038443 | Ga0395901_0116262 | Ga0395901_0116262_720_2123 | 466 |
| 1968 | 3300038443 | Ga0395901_0142816 | Ga0395901_0142816_818_2221 | 466 |
| 1969 | 3300038443 | Ga0395901_0161217 | Ga0395901_0161217_896_2302 | 466 |
| 1970 | 3300039437 | Ga0436365_0141715 | Ga0436365_0141715_4785_6233 | 466 |
| 1971 | 3300039437 | Ga0436365_0179847 | Ga0436365_0179847_2039_3451 | 466 |
| 1972 | 3300039437 | Ga0436365_0247802 | Ga0436365_0247802_5498_6910 | 466 |
| 1973 | 3300039437 | Ga0436365_1010704 | Ga0436365_1010704_3923_5323 | 466 |
| 1974 | 3300039437 | Ga0436365_1100914 | Ga0436365_1100914_682_2094 | 466 |
| 1975 | 3300039437 | Ga0436365_1359797 | Ga0436365_1359797_342_1757 | 466 |
| 1976 | 3300039437 | Ga0436365_1926106 | Ga0436365_1926106_40_1452 | 466 |
| 1977 | 3300039438 | Ga0436360_0147860 | Ga0436360_0147860_265_1668 | 466 |
| 1978 | 3300039438 | Ga0436360_0973324 | Ga0436360_0973324_1379_2782 | 466 |
| 1979 | 3300039447 | Ga0436361_0343104 | Ga0436361_0343104_124_1536 | 466 |
| 1980 | 3300039447 | Ga0436361_0532916 | Ga0436361_0532916_270_1679 | 466 |
| 1981 | 3300039447 | Ga0436361_1121961 | Ga0436361_1121961_1425_2828 | 466 |
| 1982 | 3300039450 | Ga0436363_0405250 | Ga0436363_0405250_11395_12807 | 466 |
| 1983 | 3300039450 | Ga0436363_0602817 | Ga0436363_0602817_477_1889 | 466 |
| 1984 | 3300039453 | Ga0436362_0646134 | Ga0436362_0646134_3640_5043 | 466 |
| 1985 | 3300039453 | Ga0436362_1096230 | Ga0436362_1096230_13381_14829 | 466 |
| 1986 | 3300041441 | Ga0451787_254401 | Ga0451787_254401_792_2207 | 466 |
| 1987 | 3300041491 | Ga0451833_0066605 | Ga0451833_0066605_1681_3096 | 466 |
| 1988 | 3300041507 | Ga0451851_1088920 | Ga0451851_1088920_296_1711 | 466 |
| 1989 | 3300041509 | Ga0451843_0599573 | Ga0451843_0599573_402_1817 | 466 |
| 1990 | 3300042007 | Ga0439449_0005174 | Ga0439449_0005174_893_2308 | 466 |
| 1991 | 3300042122 | Ga0450920_001623 | Ga0450920_001623_1702_3117 | 466 |
| 1992 | 3300044658 | Ga0466972_0000520 | Ga0466972_0000520_4661_6103 | 466 |
| 1993 | 3300044658 | Ga0466972_0004454 | Ga0466972_0004454_2743_4185 | 466 |
| 1994 | 3300044693 | Ga0466961_0000149 | Ga0466961_0000149_44890_46293 | 466 |
| 1995 | 3300044694 | Ga0466963_0006409 | Ga0466963_0006409_4944_6350 | 466 |
| 1996 | 3300044694 | Ga0466963_0006941 | Ga0466963_0006941_4929_6332 | 466 |
| 1997 | 3300044694 | Ga0466963_0073365 | Ga0466963_0073365_571_1971 | 466 |
| 1998 | 3300044735 | Ga0466968_0026660 | Ga0466968_0026660_270_1712 | 466 |
| 1999 | 3300044842 | Ga0466957_0017500 | Ga0466957_0017500_2657_4060 | 466 |
| 2000 | 3300044842 | Ga0466957_0049612 | Ga0466957_0049612_191_1597 | 466 |
| 2001 | 3300044842 | Ga0466957_0050773 | Ga0466957_0050773_170_1573 | 466 |
| 2002 | 3300044901 | Ga0466960_0053233 | Ga0466960_0053233_527_1930 | 466 |
| 2003 | 3300045049 | Ga0466959_0004087 | Ga0466959_0004087_2628_4031 | 466 |
| 2004 | 3300045049 | Ga0466959_0083136 | Ga0466959_0083136_469_1872 | 466 |
| 2005 | 3300045051 | Ga0451576_0145916 | Ga0451576_0145916_772_2190 | 466 |
| 2006 | 3300045836 | Ga0466958_0005656 | Ga0466958_0005656_1421_2824 | 466 |
| 2007 | 3300045976 | Ga0466967_0022781 | Ga0466967_0022781_1686_3089 | 466 |
| 2008 | 3300045976 | Ga0466967_0040762 | Ga0466967_0040762_119_1522 | 466 |
| 2009 | 3300045976 | Ga0466967_0073074 | Ga0466967_0073074_1261_2664 | 466 |
| 2010 | 3300046454 | Ga0495592_0000488 | Ga0495592_0000488_997_2472 | 466 |
| 2011 | 3300046454 | Ga0495592_0001276 | Ga0495592_0001276_3155_4555 | 466 |
| 2012 | 3300046454 | Ga0495592_0008207 | Ga0495592_0008207_2895_4304 | 466 |
| 2013 | 3300046454 | Ga0495592_0013719 | Ga0495592_0013719_642_2045 | 466 |
| 2014 | 3300046454 | Ga0495592_0029636 | Ga0495592_0029636_1628_3031 | 466 |
| 2015 | 3300046454 | Ga0495592_0035414 | Ga0495592_0035414_183_1634 | 466 |
| 2016 | 3300046454 | Ga0495592_0076319 | Ga0495592_0076319_656_2056 | 466 |
| 2017 | 3300046455 | Ga0495603_0000352 | Ga0495603_0000352_8617_10020 | 466 |
| 2018 | 3300046455 | Ga0495603_0019849 | Ga0495603_0019849_1653_3056 | 466 |
| 2019 | 3300046459 | Ga0495629_0001536 | Ga0495629_0001536_5497_6897 | 466 |
| 2020 | 3300046459 | Ga0495629_0002961 | Ga0495629_0002961_6565_7968 | 466 |
| 2021 | 3300046459 | Ga0495629_0003719 | Ga0495629_0003719_7449_8852 | 466 |
| 2022 | 3300046459 | Ga0495629_0006765 | Ga0495629_0006765_473_1882 | 466 |
| 2023 | 3300046459 | Ga0495629_0011224 | Ga0495629_0011224_890_2365 | 466 |
| 2024 | 3300046459 | Ga0495629_0017083 | Ga0495629_0017083_668_2068 | 466 |
| 2025 | 3300046459 | Ga0495629_0035281 | Ga0495629_0035281_1924_3336 | 466 |
| 2026 | 3300046459 | Ga0495629_0047563 | Ga0495629_0047563_470_1873 | 466 |
| 2027 | 3300046460 | Ga0495638_0014321 | Ga0495638_0014321_652_2055 | 466 |
| 2028 | 3300046460 | Ga0495638_0018200 | Ga0495638_0018200_1027_2430 | 466 |
| 2029 | 3300046461 | Ga0495641_0005001 | Ga0495641_0005001_2090_3541 | 466 |
| 2030 | 3300046461 | Ga0495641_0006337 | Ga0495641_0006337_999_2402 | 466 |
| 2031 | 3300046461 | Ga0495641_0010439 | Ga0495641_0010439_2550_3962 | 466 |
| 2032 | 3300046461 | Ga0495641_0041907 | Ga0495641_0041907_534_1943 | 466 |
| 2033 | 3300046462 | Ga0495651_0000655 | Ga0495651_0000655_5746_7149 | 466 |
| 2034 | 3300046462 | Ga0495651_0001053 | Ga0495651_0001053_11664_13064 | 466 |
| 2035 | 3300046462 | Ga0495651_0002415 | Ga0495651_0002415_6880_8355 | 466 |
| 2036 | 3300046462 | Ga0495651_0006660 | Ga0495651_0006660_7284_8684 | 466 |
| 2037 | 3300046462 | Ga0495651_0008150 | Ga0495651_0008150_1395_2804 | 466 |
| 2038 | 3300046462 | Ga0495651_0009605 | Ga0495651_0009605_5369_6772 | 466 |
| 2039 | 3300046462 | Ga0495651_0028771 | Ga0495651_0028771_33_1436 | 466 |
| 2040 | 3300046462 | Ga0495651_0063230 | Ga0495651_0063230_311_1717 | 466 |
| 2041 | 3300046463 | Ga0495653_0000199 | Ga0495653_0000199_2669_4144 | 466 |
| 2042 | 3300046463 | Ga0495653_0002222 | Ga0495653_0002222_13450_14853 | 466 |
| 2043 | 3300046463 | Ga0495653_0002829 | Ga0495653_0002829_7951_9402 | 466 |
| 2044 | 3300046463 | Ga0495653_0012753 | Ga0495653_0012753_4037_5446 | 466 |
| 2045 | 3300046463 | Ga0495653_0024422 | Ga0495653_0024422_1584_2984 | 466 |
| 2046 | 3300046463 | Ga0495653_0025837 | Ga0495653_0025837_1512_2954 | 466 |
| 2047 | 3300046463 | Ga0495653_0041780 | Ga0495653_0041780_478_1878 | 466 |
| 2048 | 3300046463 | Ga0495653_0071890 | Ga0495653_0071890_847_2247 | 466 |
| 2049 | 3300046472 | Ga0495580_0083053 | Ga0495580_0083053_775_2178 | 466 |
| 2050 | 3300046473 | Ga0495582_0000245 | Ga0495582_0000245_27071_28474 | 466 |
| 2051 | 3300046473 | Ga0495582_0001755 | Ga0495582_0001755_4696_6096 | 466 |
| 2052 | 3300046473 | Ga0495582_0017971 | Ga0495582_0017971_1516_2916 | 466 |
| 2053 | 3300046473 | Ga0495582_0024440 | Ga0495582_0024440_1802_3205 | 466 |
| 2054 | 3300046474 | Ga0495605_0001952 | Ga0495605_0001952_11367_12782 | 466 |
| 2055 | 3300046475 | Ga0495639_0015671 | Ga0495639_0015671_955_2367 | 466 |
| 2056 | 3300046475 | Ga0495639_0056596 | Ga0495639_0056596_230_1630 | 466 |
| 2057 | 3300046476 | Ga0495662_0000872 | Ga0495662_0000872_8326_9729 | 466 |
| 2058 | 3300046476 | Ga0495662_0001370 | Ga0495662_0001370_8517_9926 | 466 |
| 2059 | 3300046476 | Ga0495662_0009090 | Ga0495662_0009090_2925_4400 | 466 |
| 2060 | 3300046476 | Ga0495662_0034272 | Ga0495662_0034272_750_2153 | 466 |
| 2061 | 3300046476 | Ga0495662_0088210 | Ga0495662_0088210_87_1490 | 466 |
| 2062 | 3300046477 | Ga0495664_0000105 | Ga0495664_0000105_12901_14376 | 466 |
| 2063 | 3300046477 | Ga0495664_0000848 | Ga0495664_0000848_12142_13551 | 466 |
| 2064 | 3300046477 | Ga0495664_0002940 | Ga0495664_0002940_4366_5766 | 466 |
| 2065 | 3300046477 | Ga0495664_0004666 | Ga0495664_0004666_4401_5804 | 466 |
| 2066 | 3300046477 | Ga0495664_0013868 | Ga0495664_0013868_2514_4049 | 466 |
| 2067 | 3300046477 | Ga0495664_0019650 | Ga0495664_0019650_1573_3024 | 466 |
| 2068 | 3300046477 | Ga0495664_0041648 | Ga0495664_0041648_679_2082 | 466 |
| 2069 | 3300046491 | Ga0495584_0010859 | Ga0495584_0010859_3196_4647 | 466 |
| 2070 | 3300046491 | Ga0495584_0055575 | Ga0495584_0055575_574_1974 | 466 |
| 2071 | 3300046492 | Ga0495585_0015360 | Ga0495585_0015360_1635_3086 | 466 |
| 2072 | 3300046492 | Ga0495585_0021569 | Ga0495585_0021569_873_2285 | 466 |
| 2073 | 3300046492 | Ga0495585_0050268 | Ga0495585_0050268_610_2052 | 466 |
| 2074 | 3300046500 | Ga0495596_0049656 | Ga0495596_0049656_98_1501 | 466 |
| 2075 | 3300046501 | Ga0495607_0046374 | Ga0495607_0046374_380_1795 | 466 |
| 2076 | 3300046501 | Ga0495607_0058102 | Ga0495607_0058102_441_1853 | 466 |
| 2077 | 3300046511 | Ga0495608_0000020 | Ga0495608_0000020_26403_27878 | 466 |
| 2078 | 3300046511 | Ga0495608_0005839 | Ga0495608_0005839_5188_6591 | 466 |
| 2079 | 3300046511 | Ga0495608_0006424 | Ga0495608_0006424_801_2201 | 466 |
| 2080 | 3300046511 | Ga0495608_0015143 | Ga0495608_0015143_3904_5304 | 466 |
| 2081 | 3300046511 | Ga0495608_0019409 | Ga0495608_0019409_2562_3965 | 466 |
| 2082 | 3300046511 | Ga0495608_0025279 | Ga0495608_0025279_2024_3433 | 466 |
| 2083 | 3300046511 | Ga0495608_0041347 | Ga0495608_0041347_1495_2898 | 466 |
| 2084 | 3300046511 | Ga0495608_0044765 | Ga0495608_0044765_704_2107 | 466 |
| 2085 | 3300046511 | Ga0495608_0063772 | Ga0495608_0063772_122_1525 | 466 |
| 2086 | 3300046512 | Ga0495610_0078313 | Ga0495610_0078313_97_1500 | 466 |
| 2087 | 3300046513 | Ga0495616_0035673 | Ga0495616_0035673_939_2351 | 466 |
| 2088 | 3300046514 | Ga0495618_0001074 | Ga0495618_0001074_4256_5731 | 466 |
| 2089 | 3300046514 | Ga0495618_0009256 | Ga0495618_0009256_1003_2406 | 466 |
| 2090 | 3300046514 | Ga0495618_0014797 | Ga0495618_0014797_1890_3290 | 466 |
| 2091 | 3300046514 | Ga0495618_0039877 | Ga0495618_0039877_1338_2741 | 466 |
| 2092 | 3300046514 | Ga0495618_0049512 | Ga0495618_0049512_931_2334 | 466 |
| 2093 | 3300046515 | Ga0495620_0020509 | Ga0495620_0020509_1750_3153 | 466 |
| 2094 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_79599_81074 | 466 |
| 2095 | 3300046516 | Ga0495628_0003193 | Ga0495628_0003193_1270_2670 | 466 |
| 2096 | 3300046516 | Ga0495628_0005097 | Ga0495628_0005097_6730_8139 | 466 |
| 2097 | 3300046516 | Ga0495628_0019614 | Ga0495628_0019614_3066_4469 | 466 |
| 2098 | 3300046516 | Ga0495628_0052582 | Ga0495628_0052582_607_2058 | 466 |
| 2099 | 3300046516 | Ga0495628_0058839 | Ga0495628_0058839_587_1993 | 466 |
| 2100 | 3300046517 | Ga0495630_0001784 | Ga0495630_0001784_3093_4568 | 466 |
| 2101 | 3300046517 | Ga0495630_0043306 | Ga0495630_0043306_565_1974 | 466 |
| 2102 | 3300046517 | Ga0495630_0043308 | Ga0495630_0043308_1467_2867 | 466 |
| 2103 | 3300046518 | Ga0495631_0064912 | Ga0495631_0064912_142_1554 | 466 |
| 2104 | 3300046522 | Ga0495643_0002725 | Ga0495643_0002725_6205_7620 | 466 |
| 2105 | 3300046523 | Ga0495644_0003283 | Ga0495644_0003283_2359_3810 | 466 |
| 2106 | 3300046524 | Ga0495648_0001680 | Ga0495648_0001680_11786_13189 | 466 |
| 2107 | 3300046524 | Ga0495648_0044051 | Ga0495648_0044051_944_2359 | 466 |
| 2108 | 3300046526 | Ga0495666_0015592 | Ga0495666_0015592_1571_2971 | 466 |
| 2109 | 3300046526 | Ga0495666_0068918 | Ga0495666_0068918_91_1500 | 466 |
| 2110 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_998070_999545 | 466 |
| 2111 | 3300046529 | Ga0495652_0001783 | Ga0495652_0001783_3738_5141 | 466 |
| 2112 | 3300046529 | Ga0495652_0007926 | Ga0495652_0007926_3250_4650 | 466 |
| 2113 | 3300046529 | Ga0495652_0010443 | Ga0495652_0010443_949_2349 | 466 |
| 2114 | 3300046529 | Ga0495652_0036021 | Ga0495652_0036021_249_1652 | 466 |
| 2115 | 3300046529 | Ga0495652_0036122 | Ga0495652_0036122_575_1984 | 466 |
| 2116 | 3300046529 | Ga0495652_0101270 | Ga0495652_0101270_222_1622 | 466 |
| 2117 | 3300046531 | Ga0495665_0000361 | Ga0495665_0000361_4068_5471 | 466 |
| 2118 | 3300046531 | Ga0495665_0016782 | Ga0495665_0016782_159_1568 | 466 |
| 2119 | 3300046531 | Ga0495665_0023775 | Ga0495665_0023775_843_2246 | 466 |
| 2120 | 3300046533 | Ga0495640_0000027 | Ga0495640_0000027_76341_77816 | 466 |
| 2121 | 3300046533 | Ga0495640_0002916 | Ga0495640_0002916_2131_3540 | 466 |
| 2122 | 3300046533 | Ga0495640_0003002 | Ga0495640_0003002_4067_5470 | 466 |
| 2123 | 3300046533 | Ga0495640_0008459 | Ga0495640_0008459_876_2276 | 466 |
| 2124 | 3300046533 | Ga0495640_0008740 | Ga0495640_0008740_2463_3863 | 466 |
| 2125 | 3300046533 | Ga0495640_0010157 | Ga0495640_0010157_1108_2511 | 466 |
| 2126 | 3300046533 | Ga0495640_0017400 | Ga0495640_0017400_2899_4302 | 466 |
| 2127 | 3300046533 | Ga0495640_0034231 | Ga0495640_0034231_1012_2415 | 466 |
| 2128 | 3300046535 | Ga0495586_0013373 | Ga0495586_0013373_921_2330 | 466 |
| 2129 | 3300046536 | Ga0495587_0000017 | Ga0495587_0000017_28794_30269 | 466 |
| 2130 | 3300046536 | Ga0495587_0001634 | Ga0495587_0001634_4313_5716 | 466 |
| 2131 | 3300046536 | Ga0495587_0004533 | Ga0495587_0004533_1995_3395 | 466 |
| 2132 | 3300046536 | Ga0495587_0011251 | Ga0495587_0011251_118_1518 | 466 |
| 2133 | 3300046536 | Ga0495587_0017008 | Ga0495587_0017008_2936_4339 | 466 |
| 2134 | 3300046536 | Ga0495587_0018218 | Ga0495587_0018218_2372_3781 | 466 |
| 2135 | 3300046536 | Ga0495587_0059072 | Ga0495587_0059072_813_2213 | 466 |
| 2136 | 3300046536 | Ga0495587_0117126 | Ga0495587_0117126_28_1434 | 466 |
| 2137 | 3300046537 | Ga0495598_0000989 | Ga0495598_0000989_785_2197 | 466 |
| 2138 | 3300046543 | Ga0495645_0000212 | Ga0495645_0000212_27463_28938 | 466 |
| 2139 | 3300046543 | Ga0495645_0001744 | Ga0495645_0001744_6144_7553 | 466 |
| 2140 | 3300046543 | Ga0495645_0020761 | Ga0495645_0020761_1961_3403 | 466 |
| 2141 | 3300046543 | Ga0495645_0023607 | Ga0495645_0023607_2422_3957 | 466 |
| 2142 | 3300046543 | Ga0495645_0031817 | Ga0495645_0031817_1937_3337 | 466 |
| 2143 | 3300046543 | Ga0495645_0055550 | Ga0495645_0055550_622_2025 | 466 |
| 2144 | 3300046543 | Ga0495645_0140832 | Ga0495645_0140832_198_1601 | 466 |
| 2145 | 3300046557 | Ga0495622_0006317 | Ga0495622_0006317_1857_3260 | 466 |
| 2146 | 3300046558 | Ga0495633_0012648 | Ga0495633_0012648_2097_3548 | 466 |
| 2147 | 3300046558 | Ga0495633_0016697 | Ga0495633_0016697_1600_3015 | 466 |
| 2148 | 3300046558 | Ga0495633_0042755 | Ga0495633_0042755_612_2024 | 466 |
| 2149 | 3300046559 | Ga0495667_0000031 | Ga0495667_0000031_118409_119884 | 466 |
| 2150 | 3300046559 | Ga0495667_0002154 | Ga0495667_0002154_7487_8890 | 466 |
| 2151 | 3300046559 | Ga0495667_0005829 | Ga0495667_0005829_575_1984 | 466 |
| 2152 | 3300046559 | Ga0495667_0008100 | Ga0495667_0008100_1731_3131 | 466 |
| 2153 | 3300046559 | Ga0495667_0008220 | Ga0495667_0008220_485_1936 | 466 |
| 2154 | 3300046559 | Ga0495667_0012248 | Ga0495667_0012248_4036_5439 | 466 |
| 2155 | 3300046559 | Ga0495667_0017063 | Ga0495667_0017063_58_1458 | 466 |
| 2156 | 3300046615 | Ga0495656_0000812 | Ga0495656_0000812_3631_5082 | 466 |
| 2157 | 3300046615 | Ga0495656_0017683 | Ga0495656_0017683_470_1882 | 466 |
| 2158 | 3300046615 | Ga0495656_0039808 | Ga0495656_0039808_489_1892 | 466 |
| 2159 | 3300046616 | Ga0495668_0020542 | Ga0495668_0020542_1141_2544 | 466 |
| 2160 | 3300046616 | Ga0495668_0101055 | Ga0495668_0101055_75_1490 | 466 |
| 2161 | 3300046642 | Ga0495634_0000006 | Ga0495634_0000006_125862_127337 | 466 |
| 2162 | 3300046642 | Ga0495634_0000249 | Ga0495634_0000249_7921_9324 | 466 |
| 2163 | 3300046642 | Ga0495634_0004120 | Ga0495634_0004120_4413_5816 | 466 |
| 2164 | 3300046642 | Ga0495634_0019062 | Ga0495634_0019062_1504_2913 | 466 |
| 2165 | 3300046642 | Ga0495634_0102277 | Ga0495634_0102277_287_1690 | 466 |
| 2166 | 3300046648 | Ga0495611_0006846 | Ga0495611_0006846_3213_4685 | 466 |
| 2167 | 3300046663 | Ga0495635_0000154 | Ga0495635_0000154_12908_14383 | 466 |
| 2168 | 3300046663 | Ga0495635_0000239 | Ga0495635_0000239_5580_6983 | 466 |
| 2169 | 3300046663 | Ga0495635_0000681 | Ga0495635_0000681_4921_6330 | 466 |
| 2170 | 3300046663 | Ga0495635_0001492 | Ga0495635_0001492_13790_15193 | 466 |
| 2171 | 3300046663 | Ga0495635_0003846 | Ga0495635_0003846_4987_6396 | 466 |
| 2172 | 3300046663 | Ga0495635_0014377 | Ga0495635_0014377_4075_5478 | 466 |
| 2173 | 3300046663 | Ga0495635_0019133 | Ga0495635_0019133_433_1842 | 466 |
| 2174 | 3300046663 | Ga0495635_0031183 | Ga0495635_0031183_2064_3464 | 466 |
| 2175 | 3300046663 | Ga0495635_0037865 | Ga0495635_0037865_1839_3239 | 466 |
| 2176 | 3300046663 | Ga0495635_0055286 | Ga0495635_0055286_157_1560 | 466 |
| 2177 | 3300046663 | Ga0495635_0082315 | Ga0495635_0082315_668_2068 | 466 |
| 2178 | 3300046664 | Ga0495659_0021922 | Ga0495659_0021922_258_1709 | 466 |
| 2179 | 3300046665 | Ga0495661_0031412 | Ga0495661_0031412_1764_3215 | 466 |
| 2180 | 3300046674 | Ga0495588_0002364 | Ga0495588_0002364_4230_5681 | 466 |
| 2181 | 3300046674 | Ga0495588_0014080 | Ga0495588_0014080_2394_3797 | 466 |
| 2182 | 3300046674 | Ga0495588_0051178 | Ga0495588_0051178_475_1890 | 466 |
| 2183 | 3300046674 | Ga0495588_0098105 | Ga0495588_0098105_99_1508 | 466 |
| 2184 | 3300046675 | Ga0495657_0000828 | Ga0495657_0000828_12776_14251 | 466 |
| 2185 | 3300046675 | Ga0495657_0003492 | Ga0495657_0003492_5878_7320 | 466 |
| 2186 | 3300046675 | Ga0495657_0004137 | Ga0495657_0004137_8299_9699 | 466 |
| 2187 | 3300046675 | Ga0495657_0006927 | Ga0495657_0006927_3877_5286 | 466 |
| 2188 | 3300046675 | Ga0495657_0009432 | Ga0495657_0009432_1658_3061 | 466 |
| 2189 | 3300046675 | Ga0495657_0137070 | Ga0495657_0137070_90_1490 | 466 |
| 2190 | 3300046678 | Ga0495599_0000051 | Ga0495599_0000051_12820_14295 | 466 |
| 2191 | 3300046678 | Ga0495599_0001556 | Ga0495599_0001556_4115_5524 | 466 |
| 2192 | 3300046678 | Ga0495599_0001605 | Ga0495599_0001605_10045_11445 | 466 |
| 2193 | 3300046678 | Ga0495599_0008411 | Ga0495599_0008411_689_2092 | 466 |
| 2194 | 3300046678 | Ga0495599_0009208 | Ga0495599_0009208_2130_3533 | 466 |
| 2195 | 3300046678 | Ga0495599_0021267 | Ga0495599_0021267_118_1518 | 466 |
| 2196 | 3300046678 | Ga0495599_0025691 | Ga0495599_0025691_2237_3643 | 466 |
| 2197 | 3300046679 | Ga0495623_0001078 | Ga0495623_0001078_4131_5606 | 466 |
| 2198 | 3300046679 | Ga0495623_0002296 | Ga0495623_0002296_6374_7816 | 466 |
| 2199 | 3300046679 | Ga0495623_0004017 | Ga0495623_0004017_819_2219 | 466 |
| 2200 | 3300046679 | Ga0495623_0005074 | Ga0495623_0005074_4612_6015 | 466 |
| 2201 | 3300046679 | Ga0495623_0009107 | Ga0495623_0009107_3637_5046 | 466 |
| 2202 | 3300046679 | Ga0495623_0010478 | Ga0495623_0010478_3935_5338 | 466 |
| 2203 | 3300046679 | Ga0495623_0034442 | Ga0495623_0034442_1467_2873 | 466 |
| 2204 | 3300046680 | Ga0495646_0000102 | Ga0495646_0000102_12839_14314 | 466 |
| 2205 | 3300046680 | Ga0495646_0001918 | Ga0495646_0001918_6242_7651 | 466 |
| 2206 | 3300046680 | Ga0495646_0004146 | Ga0495646_0004146_3667_5067 | 466 |
| 2207 | 3300046680 | Ga0495646_0005453 | Ga0495646_0005453_3118_4521 | 466 |
| 2208 | 3300046680 | Ga0495646_0011250 | Ga0495646_0011250_2693_4096 | 466 |
| 2209 | 3300046680 | Ga0495646_0040366 | Ga0495646_0040366_1167_2570 | 466 |
| 2210 | 3300046681 | Ga0495647_0001979 | Ga0495647_0001979_4871_6271 | 466 |
| 2211 | 3300046683 | Ga0495658_0001058 | Ga0495658_0001058_6578_7981 | 466 |
| 2212 | 3300046683 | Ga0495658_0019298 | Ga0495658_0019298_42_1445 | 466 |
| 2213 | 3300046683 | Ga0495658_0046436 | Ga0495658_0046436_662_2074 | 466 |
| 2214 | 3300046684 | Ga0495669_0025636 | Ga0495669_0025636_142_1542 | 466 |
| 2215 | 3300046689 | Ga0495613_0000929 | Ga0495613_0000929_14425_15828 | 466 |
| 2216 | 3300046689 | Ga0495613_0003386 | Ga0495613_0003386_5865_7265 | 466 |
| 2217 | 3300046689 | Ga0495613_0018983 | Ga0495613_0018983_2858_4267 | 466 |
| 2218 | 3300046689 | Ga0495613_0030472 | Ga0495613_0030472_2123_3532 | 466 |
| 2219 | 3300046689 | Ga0495613_0032215 | Ga0495613_0032215_624_2066 | 466 |
| 2220 | 3300046689 | Ga0495613_0097810 | Ga0495613_0097810_566_1972 | 466 |
| 2221 | 3300046690 | Ga0495624_0000538 | Ga0495624_0000538_475_1878 | 466 |
| 2222 | 3300046690 | Ga0495624_0005667 | Ga0495624_0005667_5523_6974 | 466 |
| 2223 | 3300046690 | Ga0495624_0029990 | Ga0495624_0029990_805_2205 | 466 |
| 2224 | 3300046690 | Ga0495624_0056485 | Ga0495624_0056485_643_2046 | 466 |
| 2225 | 3300046690 | Ga0495624_0058970 | Ga0495624_0058970_133_1536 | 466 |
| 2226 | 3300046691 | Ga0495670_0002486 | Ga0495670_0002486_6880_8331 | 466 |
| 2227 | 3300046691 | Ga0495670_0013147 | Ga0495670_0013147_2175_3587 | 466 |
| 2228 | 3300046694 | Ga0495649_0012742 | Ga0495649_0012742_469_1884 | 466 |
| 2229 | 3300046809 | Ga0495600_0000069 | Ga0495600_0000069_44289_45764 | 466 |
| 2230 | 3300046809 | Ga0495600_0002229 | Ga0495600_0002229_7330_8739 | 466 |
| 2231 | 3300046809 | Ga0495600_0007632 | Ga0495600_0007632_3451_4854 | 466 |
| 2232 | 3300046809 | Ga0495600_0028766 | Ga0495600_0028766_389_1798 | 466 |
| 2233 | 3300046809 | Ga0495600_0046092 | Ga0495600_0046092_420_1820 | 466 |
| 2234 | 3300046809 | Ga0495600_0049335 | Ga0495600_0049335_168_1568 | 466 |
| 2235 | 3300046809 | Ga0495600_0054681 | Ga0495600_0054681_678_2093 | 466 |
| 2236 | 3300046809 | Ga0495600_0059314 | Ga0495600_0059314_345_1748 | 466 |
| 2237 | 3300047315 | Ga0495581_0001238 | Ga0495581_0001238_11067_12470 | 466 |
| 2238 | 3300047315 | Ga0495581_0013980 | Ga0495581_0013980_1168_2577 | 466 |
| 2239 | 3300047315 | Ga0495581_0016881 | Ga0495581_0016881_2118_3521 | 466 |
| 2240 | 3300047315 | Ga0495581_0033675 | Ga0495581_0033675_304_1755 | 466 |
| 2241 | 3300047315 | Ga0495581_0047949 | Ga0495581_0047949_490_1890 | 466 |
| 2242 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_365204_366679 | 466 |
| 2243 | 3300047317 | Ga0495604_0000198 | Ga0495604_0000198_32833_34236 | 466 |
| 2244 | 3300047317 | Ga0495604_0003926 | Ga0495604_0003926_2879_4279 | 466 |
| 2245 | 3300047317 | Ga0495604_0005469 | Ga0495604_0005469_3368_4810 | 466 |
| 2246 | 3300047317 | Ga0495604_0007916 | Ga0495604_0007916_621_2030 | 466 |
| 2247 | 3300047317 | Ga0495604_0013426 | Ga0495604_0013426_2237_3688 | 466 |
| 2248 | 3300047317 | Ga0495604_0126654 | Ga0495604_0126654_249_1652 | 466 |
| 2249 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_27503_28978 | 466 |
| 2250 | 3300047319 | Ga0495674_0001854 | Ga0495674_0001854_11039_12442 | 466 |
| 2251 | 3300047319 | Ga0495674_0004728 | Ga0495674_0004728_2451_3860 | 466 |
| 2252 | 3300047319 | Ga0495674_0018520 | Ga0495674_0018520_492_1895 | 466 |
| 2253 | 3300047319 | Ga0495674_0019302 | Ga0495674_0019302_1792_3192 | 466 |
| 2254 | 3300047319 | Ga0495674_0020768 | Ga0495674_0020768_1317_2720 | 466 |
| 2255 | 3300047319 | Ga0495674_0021792 | Ga0495674_0021792_3161_4570 | 466 |
| 2256 | 3300047319 | Ga0495674_0043222 | Ga0495674_0043222_876_2276 | 466 |
| 2257 | 3300047319 | Ga0495674_0060078 | Ga0495674_0060078_874_2316 | 466 |
| 2258 | 3300047320 | Ga0495672_0020040 | Ga0495672_0020040_1560_2963 | 466 |
| 2259 | 3300047320 | Ga0495672_0065823 | Ga0495672_0065823_71_1474 | 466 |
| 2260 | 3300047321 | Ga0495676_0027183 | Ga0495676_0027183_2610_4013 | 466 |
| 2261 | 3300047321 | Ga0495676_0034451 | Ga0495676_0034451_2643_4046 | 466 |
| 2262 | 3300047321 | Ga0495676_0123474 | Ga0495676_0123474_421_1824 | 466 |
| 2263 | 3300047322 | Ga0495680_0001692 | Ga0495680_0001692_6488_7891 | 466 |
| 2264 | 3300047322 | Ga0495680_0012862 | Ga0495680_0012862_1065_2474 | 466 |
| 2265 | 3300047322 | Ga0495680_0014111 | Ga0495680_0014111_4918_6318 | 466 |
| 2266 | 3300047322 | Ga0495680_0014519 | Ga0495680_0014519_118_1569 | 466 |
| 2267 | 3300047322 | Ga0495680_0021114 | Ga0495680_0021114_590_1993 | 466 |
| 2268 | 3300047444 | Ga0495675_0000216 | Ga0495675_0000216_12776_14251 | 466 |
| 2269 | 3300047444 | Ga0495675_0003321 | Ga0495675_0003321_7649_9058 | 466 |
| 2270 | 3300047444 | Ga0495675_0005926 | Ga0495675_0005926_2191_3591 | 466 |
| 2271 | 3300047444 | Ga0495675_0013295 | Ga0495675_0013295_2240_3643 | 466 |
| 2272 | 3300047444 | Ga0495675_0112366 | Ga0495675_0112366_55_1464 | 466 |
| 2273 | 3300047470 | Ga0495681_0010028 | Ga0495681_0010028_2461_3876 | 466 |
| 2274 | 3300047471 | Ga0495684_0000009 | Ga0495684_0000009_45488_46963 | 466 |
| 2275 | 3300047471 | Ga0495684_0000893 | Ga0495684_0000893_6753_8162 | 466 |
| 2276 | 3300047471 | Ga0495684_0008239 | Ga0495684_0008239_1752_3161 | 466 |
| 2277 | 3300047471 | Ga0495684_0012532 | Ga0495684_0012532_143_1546 | 466 |
| 2278 | 3300047471 | Ga0495684_0018847 | Ga0495684_0018847_1807_3216 | 466 |
| 2279 | 3300047471 | Ga0495684_0044818 | Ga0495684_0044818_1198_2601 | 466 |
| 2280 | 3300047471 | Ga0495684_0050814 | Ga0495684_0050814_660_2063 | 466 |
| 2281 | 3300047472 | Ga0495686_0002729 | Ga0495686_0002729_7129_8544 | 466 |
| 2282 | 3300047472 | Ga0495686_0021390 | Ga0495686_0021390_174_1577 | 466 |
| 2283 | 3300047472 | Ga0495686_0028426 | Ga0495686_0028426_1783_3186 | 466 |
| 2284 | 3300047673 | Ga0495593_0000034 | Ga0495593_0000034_49522_50925 | 466 |
| 2285 | 3300047673 | Ga0495593_0005065 | Ga0495593_0005065_5322_6797 | 466 |
| 2286 | 3300047673 | Ga0495593_0005088 | Ga0495593_0005088_2068_3477 | 466 |
| 2287 | 3300047673 | Ga0495593_0010592 | Ga0495593_0010592_1383_2834 | 466 |
| 2288 | 3300047673 | Ga0495593_0011441 | Ga0495593_0011441_776_2185 | 466 |
| 2289 | 3300047673 | Ga0495593_0030123 | Ga0495593_0030123_303_1706 | 466 |
| 2290 | 3300047673 | Ga0495593_0041683 | Ga0495593_0041683_779_2179 | 466 |
| 2291 | 3300048088 | Ga0495602_0000373 | Ga0495602_0000373_12830_14305 | 466 |
| 2292 | 3300048088 | Ga0495602_0002340 | Ga0495602_0002340_16793_18196 | 466 |
| 2293 | 3300048088 | Ga0495602_0010712 | Ga0495602_0010712_6236_7636 | 466 |
| 2294 | 3300048088 | Ga0495602_0029454 | Ga0495602_0029454_1648_3048 | 466 |
| 2295 | 3300048088 | Ga0495602_0030283 | Ga0495602_0030283_205_1614 | 466 |
| 2296 | 3300048089 | Ga0495614_0012962 | Ga0495614_0012962_1197_2648 | 466 |
| 2297 | 3300048903 | Ga0496100_0000171 | Ga0496100_0000171_29403_30803 | 466 |
| 2298 | 3300048903 | Ga0496100_0005513 | Ga0496100_0005513_3413_4813 | 466 |
| 2299 | 3300048903 | Ga0496100_0005621 | Ga0496100_0005621_4355_5767 | 466 |
| 2300 | 3300048903 | Ga0496100_0041911 | Ga0496100_0041911_1088_2509 | 466 |
| 2301 | 3300048904 | Ga0496101_0000246 | Ga0496101_0000246_15235_16635 | 466 |
| 2302 | 3300048904 | Ga0496101_0002583 | Ga0496101_0002583_6060_7472 | 466 |
| 2303 | 3300048904 | Ga0496101_0005889 | Ga0496101_0005889_2947_4350 | 466 |
| 2304 | 3300048904 | Ga0496101_0077962 | Ga0496101_0077962_74_1576 | 466 |
| 2305 | 3300048905 | Ga0496102_0003080 | Ga0496102_0003080_9908_11308 | 466 |
| 2306 | 3300048905 | Ga0496102_0015817 | Ga0496102_0015817_643_2055 | 466 |
| 2307 | 3300048905 | Ga0496102_0030603 | Ga0496102_0030603_2853_4265 | 466 |
| 2308 | 3300048905 | Ga0496102_0047397 | Ga0496102_0047397_1098_2510 | 466 |
| 2309 | 3300048905 | Ga0496102_0079901 | Ga0496102_0079901_1306_2709 | 466 |
| 2310 | 3300048905 | Ga0496102_0104172 | Ga0496102_0104172_1069_2469 | 466 |
| 2311 | 3300048905 | Ga0496102_0190699 | Ga0496102_0190699_220_1620 | 466 |
| 2312 | 3300048906 | Ga0496103_0000753 | Ga0496103_0000753_22155_23555 | 466 |
| 2313 | 3300048906 | Ga0496103_0001814 | Ga0496103_0001814_6070_7482 | 466 |
| 2314 | 3300048906 | Ga0496103_0019062 | Ga0496103_0019062_2468_3868 | 466 |
| 2315 | 3300048907 | Ga0496104_0000102 | Ga0496104_0000102_26775_28184 | 466 |
| 2316 | 3300048907 | Ga0496104_0000159 | Ga0496104_0000159_1183_2583 | 466 |
| 2317 | 3300048907 | Ga0496104_0000774 | Ga0496104_0000774_22965_24377 | 466 |
| 2318 | 3300048907 | Ga0496104_0001290 | Ga0496104_0001290_12937_14346 | 466 |
| 2319 | 3300048907 | Ga0496104_0003304 | Ga0496104_0003304_2383_3795 | 466 |
| 2320 | 3300048907 | Ga0496104_0004126 | Ga0496104_0004126_1415_2824 | 466 |
| 2321 | 3300048907 | Ga0496104_0004366 | Ga0496104_0004366_8176_9588 | 466 |
| 2322 | 3300048907 | Ga0496104_0015916 | Ga0496104_0015916_237_1742 | 466 |
| 2323 | 3300048907 | Ga0496104_0040399 | Ga0496104_0040399_2248_3654 | 466 |
| 2324 | 3300048907 | Ga0496104_0130937 | Ga0496104_0130937_563_1966 | 466 |
| 2325 | 3300048907 | Ga0496104_0208411 | Ga0496104_0208411_81_1481 | 466 |
| 2326 | 3300048908 | Ga0496105_0000066 | Ga0496105_0000066_28513_29922 | 466 |
| 2327 | 3300048908 | Ga0496105_0000410 | Ga0496105_0000410_15500_16900 | 466 |
| 2328 | 3300048908 | Ga0496105_0000660 | Ga0496105_0000660_9216_10625 | 466 |
| 2329 | 3300048908 | Ga0496105_0002875 | Ga0496105_0002875_1415_2824 | 466 |
| 2330 | 3300048908 | Ga0496105_0003208 | Ga0496105_0003208_3740_5152 | 466 |
| 2331 | 3300048908 | Ga0496105_0015677 | Ga0496105_0015677_1558_2970 | 466 |
| 2332 | 3300048908 | Ga0496105_0017518 | Ga0496105_0017518_138_1580 | 466 |
| 2333 | 3300048908 | Ga0496105_0021219 | Ga0496105_0021219_2377_3789 | 466 |
| 2334 | 3300048908 | Ga0496105_0029545 | Ga0496105_0029545_136_1557 | 466 |
| 2335 | 3300048908 | Ga0496105_0048636 | Ga0496105_0048636_1479_2879 | 466 |
| 2336 | 3300048908 | Ga0496105_0102015 | Ga0496105_0102015_400_1812 | 466 |
| 2337 | 3300048909 | Ga0496106_0000183 | Ga0496106_0000183_24631_26031 | 466 |
| 2338 | 3300048909 | Ga0496106_0000649 | Ga0496106_0000649_16726_18135 | 466 |
| 2339 | 3300048909 | Ga0496106_0000982 | Ga0496106_0000982_8220_9635 | 466 |
| 2340 | 3300048909 | Ga0496106_0001165 | Ga0496106_0001165_13763_15265 | 466 |
| 2341 | 3300048909 | Ga0496106_0003721 | Ga0496106_0003721_6216_7628 | 466 |
| 2342 | 3300048909 | Ga0496106_0013694 | Ga0496106_0013694_4283_5695 | 466 |
| 2343 | 3300048909 | Ga0496106_0015146 | Ga0496106_0015146_3979_5400 | 466 |
| 2344 | 3300048909 | Ga0496106_0046114 | Ga0496106_0046114_866_2275 | 466 |
| 2345 | 3300048909 | Ga0496106_0076130 | Ga0496106_0076130_1112_2512 | 466 |
| 2346 | 3300048910 | Ga0496107_0001430 | Ga0496107_0001430_453_1853 | 466 |
| 2347 | 3300048910 | Ga0496107_0008995 | Ga0496107_0008995_559_1959 | 466 |
| 2348 | 3300048910 | Ga0496107_0009499 | Ga0496107_0009499_4762_6174 | 466 |
| 2349 | 3300048910 | Ga0496107_0012532 | Ga0496107_0012532_1390_2802 | 466 |
| 2350 | 3300048910 | Ga0496107_0015904 | Ga0496107_0015904_3825_5225 | 466 |
| 2351 | 3300048910 | Ga0496107_0021046 | Ga0496107_0021046_2606_4018 | 466 |
| 2352 | 3300048910 | Ga0496107_0042322 | Ga0496107_0042322_1280_2680 | 466 |
| 2353 | 3300048910 | Ga0496107_0066510 | Ga0496107_0066510_43_1446 | 466 |
| 2354 | 3300048910 | Ga0496107_0090146 | Ga0496107_0090146_293_1693 | 466 |
| 2355 | 3300048911 | Ga0496108_0000436 | Ga0496108_0000436_30762_32174 | 466 |
| 2356 | 3300048911 | Ga0496108_0000931 | Ga0496108_0000931_16127_17536 | 466 |
| 2357 | 3300048911 | Ga0496108_0001856 | Ga0496108_0001856_11519_12919 | 466 |
| 2358 | 3300048911 | Ga0496108_0008443 | Ga0496108_0008443_2718_4130 | 466 |
| 2359 | 3300048911 | Ga0496108_0041092 | Ga0496108_0041092_1698_3119 | 466 |
| 2360 | 3300048911 | Ga0496108_0065905 | Ga0496108_0065905_1591_2994 | 466 |
| 2361 | 3300048911 | Ga0496108_0073828 | Ga0496108_0073828_945_2345 | 466 |
| 2362 | 3300048911 | Ga0496108_0137709 | Ga0496108_0137709_300_1700 | 466 |
| 2363 | 3300048912 | Ga0496109_0001350 | Ga0496109_0001350_17341_18741 | 466 |
| 2364 | 3300048912 | Ga0496109_0001766 | Ga0496109_0001766_7476_8978 | 466 |
| 2365 | 3300048912 | Ga0496109_0003286 | Ga0496109_0003286_6694_8106 | 466 |
| 2366 | 3300048912 | Ga0496109_0004165 | Ga0496109_0004165_1135_2535 | 466 |
| 2367 | 3300048912 | Ga0496109_0006221 | Ga0496109_0006221_2587_3996 | 466 |
| 2368 | 3300048912 | Ga0496109_0015570 | Ga0496109_0015570_4367_5788 | 466 |
| 2369 | 3300048912 | Ga0496109_0037548 | Ga0496109_0037548_674_2086 | 466 |
| 2370 | 3300048912 | Ga0496109_0044561 | Ga0496109_0044561_1988_3391 | 466 |
| 2371 | 3300048912 | Ga0496109_0050558 | Ga0496109_0050558_438_1838 | 466 |
| 2372 | 3300048912 | Ga0496109_0118867 | Ga0496109_0118867_675_2075 | 466 |
| 2373 | 3300048912 | Ga0496109_0129340 | Ga0496109_0129340_337_1758 | 466 |
| 2374 | 3300048913 | Ga0496110_0001937 | Ga0496110_0001937_859_2280 | 466 |
| 2375 | 3300048913 | Ga0496110_0003940 | Ga0496110_0003940_3799_5208 | 466 |
| 2376 | 3300048913 | Ga0496110_0004370 | Ga0496110_0004370_8099_9511 | 466 |
| 2377 | 3300048913 | Ga0496110_0006833 | Ga0496110_0006833_5306_6808 | 466 |
| 2378 | 3300048913 | Ga0496110_0020911 | Ga0496110_0020911_1112_2512 | 466 |
| 2379 | 3300048913 | Ga0496110_0051830 | Ga0496110_0051830_1802_3205 | 466 |
| 2380 | 3300048913 | Ga0496110_0056020 | Ga0496110_0056020_73_1476 | 466 |
| 2381 | 3300048913 | Ga0496110_0065660 | Ga0496110_0065660_1479_2894 | 466 |
| 2382 | 3300048913 | Ga0496110_0066495 | Ga0496110_0066495_578_1978 | 466 |
| 2383 | 3300048913 | Ga0496110_0107304 | Ga0496110_0107304_973_2385 | 466 |
| 2384 | 3300048913 | Ga0496110_0135255 | Ga0496110_0135255_31_1431 | 466 |
| 2385 | 3300048914 | Ga0496111_0001107 | Ga0496111_0001107_13344_14753 | 466 |
| 2386 | 3300048914 | Ga0496111_0001128 | Ga0496111_0001128_6210_7622 | 466 |
| 2387 | 3300048914 | Ga0496111_0001815 | Ga0496111_0001815_7998_9398 | 466 |
| 2388 | 3300048914 | Ga0496111_0021291 | Ga0496111_0021291_209_1621 | 466 |
| 2389 | 3300048914 | Ga0496111_0031351 | Ga0496111_0031351_1403_2803 | 466 |
| 2390 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_8641_10128 | 466 |
| 2391 | 3300048915 | Ga0496112_0000735 | Ga0496112_0000735_19966_21378 | 466 |
| 2392 | 3300048915 | Ga0496112_0002588 | Ga0496112_0002588_7342_8754 | 466 |
| 2393 | 3300048915 | Ga0496112_0002673 | Ga0496112_0002673_5912_7321 | 466 |
| 2394 | 3300048915 | Ga0496112_0003217 | Ga0496112_0003217_407_1828 | 466 |
| 2395 | 3300048915 | Ga0496112_0015968 | Ga0496112_0015968_5409_6812 | 466 |
| 2396 | 3300048915 | Ga0496112_0016298 | Ga0496112_0016298_3029_4429 | 466 |
| 2397 | 3300048915 | Ga0496112_0035334 | Ga0496112_0035334_60_1463 | 466 |
| 2398 | 3300048915 | Ga0496112_0050851 | Ga0496112_0050851_758_2161 | 466 |
| 2399 | 3300048915 | Ga0496112_0057762 | Ga0496112_0057762_2400_3806 | 466 |
| 2400 | 3300048915 | Ga0496112_0074587 | Ga0496112_0074587_1068_2471 | 466 |
| 2401 | 3300048915 | Ga0496112_0124520 | Ga0496112_0124520_223_1626 | 466 |
| 2402 | 3300048916 | Ga0496113_0001031 | Ga0496113_0001031_10893_12305 | 466 |
| 2403 | 3300048916 | Ga0496113_0001697 | Ga0496113_0001697_706_2118 | 466 |
| 2404 | 3300048916 | Ga0496113_0005725 | Ga0496113_0005725_2745_4145 | 466 |
| 2405 | 3300048916 | Ga0496113_0013405 | Ga0496113_0013405_424_1827 | 466 |
| 2406 | 3300048916 | Ga0496113_0020676 | Ga0496113_0020676_1519_2940 | 466 |
| 2407 | 3300048916 | Ga0496113_0032840 | Ga0496113_0032840_1594_2994 | 466 |
| 2408 | 3300048916 | Ga0496113_0167540 | Ga0496113_0167540_221_1621 | 466 |
| 2409 | 3300048917 | Ga0496114_0002224 | Ga0496114_0002224_687_2087 | 466 |
| 2410 | 3300048917 | Ga0496114_0028100 | Ga0496114_0028100_2998_4401 | 466 |
| 2411 | 3300048917 | Ga0496114_0034325 | Ga0496114_0034325_1430_2842 | 466 |
| 2412 | 3300048917 | Ga0496114_0228259 | Ga0496114_0228259_178_1590 | 466 |
| 2413 | 3300048918 | Ga0496115_0003582 | Ga0496115_0003582_6814_8226 | 466 |
| 2414 | 3300048918 | Ga0496115_0005349 | Ga0496115_0005349_3699_5111 | 466 |
| 2415 | 3300048918 | Ga0496115_0007272 | Ga0496115_0007272_5268_6671 | 466 |
| 2416 | 3300048918 | Ga0496115_0008771 | Ga0496115_0008771_1924_3324 | 466 |
| 2417 | 3300048918 | Ga0496115_0015832 | Ga0496115_0015832_1125_2528 | 466 |
| 2418 | 3300048918 | Ga0496115_0107107 | Ga0496115_0107107_591_2012 | 466 |
| 2419 | 3300048918 | Ga0496115_0117589 | Ga0496115_0117589_103_1506 | 466 |
| 2420 | 3300048918 | Ga0496115_0120660 | Ga0496115_0120660_295_1707 | 466 |
| 2421 | 3300048918 | Ga0496115_0131610 | Ga0496115_0131610_282_1694 | 466 |
| 2422 | 3300048918 | Ga0496115_0155460 | Ga0496115_0155460_111_1511 | 466 |
| 2423 | 3300048919 | Ga0496116_0000142 | Ga0496116_0000142_102479_103894 | 466 |
| 2424 | 3300048919 | Ga0496116_0003364 | Ga0496116_0003364_14379_15782 | 466 |
| 2425 | 3300048919 | Ga0496116_0051303 | Ga0496116_0051303_926_2341 | 466 |
| 2426 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_479779_481194 | 466 |
| 2427 | 3300048920 | Ga0496117_0001574 | Ga0496117_0001574_7450_8865 | 466 |
| 2428 | 3300048920 | Ga0496117_0019627 | Ga0496117_0019627_3967_5382 | 466 |
| 2429 | 3300048920 | Ga0496117_0020764 | Ga0496117_0020764_1788_3203 | 466 |
| 2430 | 3300048920 | Ga0496117_0035578 | Ga0496117_0035578_39_1448 | 466 |
| 2431 | 3300048920 | Ga0496117_0089219 | Ga0496117_0089219_57_1463 | 466 |
| 2432 | 3300048920 | Ga0496117_0098184 | Ga0496117_0098184_428_1831 | 466 |
| 2433 | 3300048921 | Ga0496118_0000087 | Ga0496118_0000087_91338_92753 | 466 |
| 2434 | 3300048921 | Ga0496118_0008894 | Ga0496118_0008894_7269_8684 | 466 |
| 2435 | 3300048921 | Ga0496118_0043982 | Ga0496118_0043982_1186_2589 | 466 |
| 2436 | 3300048921 | Ga0496118_0046917 | Ga0496118_0046917_1932_3335 | 466 |
| 2437 | 3300048921 | Ga0496118_0050959 | Ga0496118_0050959_822_2225 | 466 |
| 2438 | 3300048921 | Ga0496118_0061482 | Ga0496118_0061482_363_1766 | 466 |
| 2439 | 3300048921 | Ga0496118_0132718 | Ga0496118_0132718_16_1425 | 466 |
| 2440 | 3300048922 | Ga0496119_0001143 | Ga0496119_0001143_27181_28590 | 466 |
| 2441 | 3300048922 | Ga0496119_0029282 | Ga0496119_0029282_57_1472 | 466 |
| 2442 | 3300048922 | Ga0496119_0034940 | Ga0496119_0034940_755_2197 | 466 |
| 2443 | 3300048923 | Ga0496120_0000413 | Ga0496120_0000413_4767_6182 | 466 |
| 2444 | 3300048924 | Ga0496121_0000476 | Ga0496121_0000476_66075_67484 | 466 |
| 2445 | 3300048924 | Ga0496121_0001497 | Ga0496121_0001497_29644_31050 | 466 |
| 2446 | 3300048924 | Ga0496121_0001742 | Ga0496121_0001742_15771_17174 | 466 |
| 2447 | 3300048924 | Ga0496121_0003089 | Ga0496121_0003089_17053_18456 | 466 |
| 2448 | 3300048924 | Ga0496121_0015642 | Ga0496121_0015642_3369_4874 | 466 |
| 2449 | 3300048924 | Ga0496121_0017380 | Ga0496121_0017380_4460_5863 | 466 |
| 2450 | 3300048924 | Ga0496121_0021924 | Ga0496121_0021924_4658_6061 | 466 |
| 2451 | 3300048924 | Ga0496121_0037277 | Ga0496121_0037277_352_1755 | 466 |
| 2452 | 3300048924 | Ga0496121_0038697 | Ga0496121_0038697_149_1552 | 466 |
| 2453 | 3300048924 | Ga0496121_0049287 | Ga0496121_0049287_1858_3261 | 466 |
| 2454 | 3300048924 | Ga0496121_0051164 | Ga0496121_0051164_1859_3262 | 466 |
| 2455 | 3300048924 | Ga0496121_0134696 | Ga0496121_0134696_21_1436 | 466 |
| 2456 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_108664_110079 | 466 |
| 2457 | 3300048925 | Ga0496122_0000190 | Ga0496122_0000190_123227_124642 | 466 |
| 2458 | 3300048925 | Ga0496122_0029884 | Ga0496122_0029884_1580_2983 | 466 |
| 2459 | 3300048925 | Ga0496122_0056469 | Ga0496122_0056469_1147_2550 | 466 |
| 2460 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_108664_110079 | 466 |
| 2461 | 3300048926 | Ga0496123_0000336 | Ga0496123_0000336_7223_8638 | 466 |
| 2462 | 3300048926 | Ga0496123_0024244 | Ga0496123_0024244_1847_3262 | 466 |
| 2463 | 3300048926 | Ga0496123_0027440 | Ga0496123_0027440_982_2388 | 466 |
| 2464 | 3300048926 | Ga0496123_0031265 | Ga0496123_0031265_2420_3823 | 466 |
| 2465 | 3300048926 | Ga0496123_0032300 | Ga0496123_0032300_517_1920 | 466 |
| 2466 | 3300048926 | Ga0496123_0042101 | Ga0496123_0042101_515_1921 | 466 |
| 2467 | 3300048926 | Ga0496123_0065130 | Ga0496123_0065130_360_1775 | 466 |
| 2468 | 3300048926 | Ga0496123_0069502 | Ga0496123_0069502_698_2104 | 466 |
| 2469 | 3300048927 | Ga0496124_0001128 | Ga0496124_0001128_35181_36590 | 466 |
| 2470 | 3300048927 | Ga0496124_0009838 | Ga0496124_0009838_6387_7802 | 466 |
| 2471 | 3300048927 | Ga0496124_0011540 | Ga0496124_0011540_7230_8645 | 466 |
| 2472 | 3300048927 | Ga0496124_0075324 | Ga0496124_0075324_498_1901 | 466 |
| 2473 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_42112_43515 | 466 |
| 2474 | 3300048928 | Ga0496125_0000248 | Ga0496125_0000248_102049_103464 | 466 |
| 2475 | 3300048928 | Ga0496125_0000823 | Ga0496125_0000823_9244_10650 | 466 |
| 2476 | 3300048928 | Ga0496125_0015007 | Ga0496125_0015007_465_1874 | 466 |
| 2477 | 3300048928 | Ga0496125_0019665 | Ga0496125_0019665_2268_3683 | 466 |
| 2478 | 3300048928 | Ga0496125_0105364 | Ga0496125_0105364_155_1558 | 466 |
| 2479 | 3300048928 | Ga0496125_0143173 | Ga0496125_0143173_48_1451 | 466 |
| 2480 | 3300048929 | Ga0496126_0000866 | Ga0496126_0000866_7256_8671 | 466 |
| 2481 | 3300048929 | Ga0496126_0001294 | Ga0496126_0001294_6820_8235 | 466 |
| 2482 | 3300048929 | Ga0496126_0002744 | Ga0496126_0002744_18635_20038 | 466 |
| 2483 | 3300048929 | Ga0496126_0006113 | Ga0496126_0006113_2573_3976 | 466 |
| 2484 | 3300048929 | Ga0496126_0007435 | Ga0496126_0007435_9521_10930 | 466 |
| 2485 | 3300048929 | Ga0496126_0009402 | Ga0496126_0009402_3424_4827 | 466 |
| 2486 | 3300048929 | Ga0496126_0014931 | Ga0496126_0014931_6404_7819 | 466 |
| 2487 | 3300048929 | Ga0496126_0015910 | Ga0496126_0015910_4296_5702 | 466 |
| 2488 | 3300048929 | Ga0496126_0020832 | Ga0496126_0020832_1945_3348 | 466 |
| 2489 | 3300048929 | Ga0496126_0032430 | Ga0496126_0032430_1858_3261 | 466 |
| 2490 | 3300048929 | Ga0496126_0039244 | Ga0496126_0039244_2568_3971 | 466 |
| 2491 | 3300048929 | Ga0496126_0049254 | Ga0496126_0049254_1641_3050 | 466 |
| 2492 | 3300048929 | Ga0496126_0053931 | Ga0496126_0053931_96_1499 | 466 |
| 2493 | 3300048929 | Ga0496126_0057046 | Ga0496126_0057046_1416_2819 | 466 |
| 2494 | 3300049568 | Ga0501031_0009852 | Ga0501031_0009852_1355_2758 | 466 |
| 2495 | 3300049568 | Ga0501031_0028410 | Ga0501031_0028410_563_1978 | 466 |
| 2496 | 3300049569 | Ga0501032_0003534 | Ga0501032_0003534_4980_6383 | 466 |
| 2497 | 3300049569 | Ga0501032_0008293 | Ga0501032_0008293_4181_5584 | 466 |
| 2498 | 3300049569 | Ga0501032_0033503 | Ga0501032_0033503_1909_3324 | 466 |
| 2499 | 3300049569 | Ga0501032_0085772 | Ga0501032_0085772_352_1755 | 466 |
| 2500 | 3300049569 | Ga0501032_0105845 | Ga0501032_0105845_224_1627 | 466 |
| 2501 | 3300049570 | Ga0501033_0000249 | Ga0501033_0000249_26708_28111 | 466 |
| 2502 | 3300049570 | Ga0501033_0000951 | Ga0501033_0000951_20835_22238 | 466 |
| 2503 | 3300049570 | Ga0501033_0001862 | Ga0501033_0001862_6514_7920 | 466 |
| 2504 | 3300049570 | Ga0501033_0036294 | Ga0501033_0036294_1191_2606 | 466 |
| 2505 | 3300049570 | Ga0501033_0036543 | Ga0501033_0036543_11_1417 | 466 |
| 2506 | 3300049570 | Ga0501033_0057802 | Ga0501033_0057802_84_1487 | 466 |
| 2507 | 3300049570 | Ga0501033_0078757 | Ga0501033_0078757_666_2081 | 466 |
| 2508 | 3300049571 | Ga0501034_0000197 | Ga0501034_0000197_53193_54596 | 466 |
| 2509 | 3300049571 | Ga0501034_0001938 | Ga0501034_0001938_6659_8062 | 466 |
| 2510 | 3300049571 | Ga0501034_0003303 | Ga0501034_0003303_13110_14513 | 466 |
| 2511 | 3300049571 | Ga0501034_0003931 | Ga0501034_0003931_12091_13494 | 466 |
| 2512 | 3300049571 | Ga0501034_0018261 | Ga0501034_0018261_4577_5992 | 466 |
| 2513 | 3300049571 | Ga0501034_0029910 | Ga0501034_0029910_2209_3612 | 466 |
| 2514 | 3300049571 | Ga0501034_0060787 | Ga0501034_0060787_1541_2944 | 466 |
| 2515 | 3300049571 | Ga0501034_0063839 | Ga0501034_0063839_2117_3523 | 466 |
| 2516 | 3300049571 | Ga0501034_0063869 | Ga0501034_0063869_745_2160 | 466 |
| 2517 | 3300049571 | Ga0501034_0103631 | Ga0501034_0103631_42_1445 | 466 |
| 2518 | 3300049571 | Ga0501034_0240727 | Ga0501034_0240727_42_1445 | 466 |
| 2519 | 3300049571 | Ga0501034_0255686 | Ga0501034_0255686_126_1529 | 466 |
| 2520 | 3300049572 | Ga0501036_0001894 | Ga0501036_0001894_4941_6344 | 466 |
| 2521 | 3300049572 | Ga0501036_0004433 | Ga0501036_0004433_6575_7978 | 466 |
| 2522 | 3300049572 | Ga0501036_0014718 | Ga0501036_0014718_3223_4638 | 466 |
| 2523 | 3300049572 | Ga0501036_0020317 | Ga0501036_0020317_2799_4202 | 466 |
| 2524 | 3300049572 | Ga0501036_0026547 | Ga0501036_0026547_1276_2679 | 466 |
| 2525 | 3300049572 | Ga0501036_0121562 | Ga0501036_0121562_381_1784 | 466 |
| 2526 | 3300049572 | Ga0501036_0128420 | Ga0501036_0128420_710_2113 | 466 |
| 2527 | 3300049572 | Ga0501036_0132946 | Ga0501036_0132946_562_1974 | 466 |
| 2528 | 3300049573 | Ga0501037_0000112 | Ga0501037_0000112_28171_29574 | 466 |
| 2529 | 3300049573 | Ga0501037_0004019 | Ga0501037_0004019_8965_10368 | 466 |
| 2530 | 3300049573 | Ga0501037_0023027 | Ga0501037_0023027_1899_3302 | 466 |
| 2531 | 3300049573 | Ga0501037_0023753 | Ga0501037_0023753_150_1550 | 466 |
| 2532 | 3300049573 | Ga0501037_0025895 | Ga0501037_0025895_84_1487 | 466 |
| 2533 | 3300049573 | Ga0501037_0027054 | Ga0501037_0027054_1740_3143 | 466 |
| 2534 | 3300049573 | Ga0501037_0040501 | Ga0501037_0040501_926_2341 | 466 |
| 2535 | 3300049574 | Ga0501038_0000160 | Ga0501038_0000160_44175_45578 | 466 |
| 2536 | 3300049574 | Ga0501038_0002206 | Ga0501038_0002206_3126_4529 | 466 |
| 2537 | 3300049574 | Ga0501038_0004382 | Ga0501038_0004382_8495_9910 | 466 |
| 2538 | 3300049574 | Ga0501038_0019027 | Ga0501038_0019027_4486_5889 | 466 |
| 2539 | 3300049574 | Ga0501038_0072151 | Ga0501038_0072151_621_2024 | 466 |
| 2540 | 3300049574 | Ga0501038_0113818 | Ga0501038_0113818_215_1618 | 466 |
| 2541 | 3300049574 | Ga0501038_0144733 | Ga0501038_0144733_399_1802 | 466 |
| 2542 | 3300049574 | Ga0501038_0171569 | Ga0501038_0171569_311_1714 | 466 |
| 2543 | 3300049574 | Ga0501038_0192297 | Ga0501038_0192297_197_1600 | 466 |
| 2544 | 3300049575 | Ga0501039_0003318 | Ga0501039_0003318_2749_4164 | 466 |
| 2545 | 3300049575 | Ga0501039_0068601 | Ga0501039_0068601_407_1822 | 466 |
| 2546 | 3300049575 | Ga0501039_0068838 | Ga0501039_0068838_1097_2551 | 466 |
| 2547 | 3300049575 | Ga0501039_0109920 | Ga0501039_0109920_305_1711 | 466 |
| 2548 | 3300049576 | Ga0501040_0054530 | Ga0501040_0054530_1126_2529 | 466 |
| 2549 | 3300049578 | Ga0501042_0015592 | Ga0501042_0015592_881_2284 | 466 |
| 2550 | 3300049579 | Ga0501043_0000278 | Ga0501043_0000278_27332_28735 | 466 |
| 2551 | 3300049579 | Ga0501043_0003514 | Ga0501043_0003514_9607_11010 | 466 |
| 2552 | 3300049579 | Ga0501043_0007295 | Ga0501043_0007295_2353_3768 | 466 |
| 2553 | 3300049579 | Ga0501043_0008635 | Ga0501043_0008635_2379_3782 | 466 |
| 2554 | 3300049579 | Ga0501043_0009609 | Ga0501043_0009609_4223_5638 | 466 |
| 2555 | 3300049579 | Ga0501043_0022578 | Ga0501043_0022578_1600_3006 | 466 |
| 2556 | 3300049579 | Ga0501043_0022870 | Ga0501043_0022870_984_2387 | 466 |
| 2557 | 3300049579 | Ga0501043_0036587 | Ga0501043_0036587_1715_3118 | 466 |
| 2558 | 3300049579 | Ga0501043_0059303 | Ga0501043_0059303_1017_2420 | 466 |
| 2559 | 3300049580 | Ga0501046_0000937 | Ga0501046_0000937_2840_4243 | 466 |
| 2560 | 3300049580 | Ga0501046_0008812 | Ga0501046_0008812_4401_5807 | 466 |
| 2561 | 3300049580 | Ga0501046_0012556 | Ga0501046_0012556_5044_6447 | 466 |
| 2562 | 3300049580 | Ga0501046_0050515 | Ga0501046_0050515_492_1895 | 466 |
| 2563 | 3300049580 | Ga0501046_0054701 | Ga0501046_0054701_818_2233 | 466 |
| 2564 | 3300049581 | Ga0501047_0000275 | Ga0501047_0000275_37942_39345 | 466 |
| 2565 | 3300049581 | Ga0501047_0000688 | Ga0501047_0000688_27724_29127 | 466 |
| 2566 | 3300049581 | Ga0501047_0003823 | Ga0501047_0003823_8904_10307 | 466 |
| 2567 | 3300049581 | Ga0501047_0009938 | Ga0501047_0009938_4398_5804 | 466 |
| 2568 | 3300049581 | Ga0501047_0018665 | Ga0501047_0018665_685_2088 | 466 |
| 2569 | 3300049581 | Ga0501047_0038155 | Ga0501047_0038155_1198_2601 | 466 |
| 2570 | 3300049581 | Ga0501047_0040535 | Ga0501047_0040535_1718_3121 | 466 |
| 2571 | 3300049581 | Ga0501047_0050183 | Ga0501047_0050183_1651_3054 | 466 |
| 2572 | 3300049581 | Ga0501047_0089000 | Ga0501047_0089000_1527_2930 | 466 |
| 2573 | 3300049581 | Ga0501047_0115148 | Ga0501047_0115148_501_1958 | 466 |
| 2574 | 3300049581 | Ga0501047_0139295 | Ga0501047_0139295_380_1780 | 466 |
| 2575 | 3300049581 | Ga0501047_0181313 | Ga0501047_0181313_406_1809 | 466 |
| 2576 | 3300049581 | Ga0501047_0196182 | Ga0501047_0196182_94_1497 | 466 |
| 2577 | 3300049582 | Ga0501048_0001248 | Ga0501048_0001248_5439_6842 | 466 |
| 2578 | 3300049582 | Ga0501048_0002575 | Ga0501048_0002575_9396_10799 | 466 |
| 2579 | 3300049582 | Ga0501048_0011414 | Ga0501048_0011414_1184_2587 | 466 |
| 2580 | 3300049582 | Ga0501048_0022723 | Ga0501048_0022723_745_2148 | 466 |
| 2581 | 3300049582 | Ga0501048_0047682 | Ga0501048_0047682_1446_2861 | 466 |
| 2582 | 3300049582 | Ga0501048_0123764 | Ga0501048_0123764_318_1721 | 466 |
| 2583 | 3300049583 | Ga0501067_0000258 | Ga0501067_0000258_12158_13561 | 466 |
| 2584 | 3300049583 | Ga0501067_0007852 | Ga0501067_0007852_3119_4534 | 466 |
| 2585 | 3300049583 | Ga0501067_0037309 | Ga0501067_0037309_721_2124 | 466 |
| 2586 | 3300049583 | Ga0501067_0110334 | Ga0501067_0110334_60_1463 | 466 |
| 2587 | 3300049584 | Ga0501068_0004146 | Ga0501068_0004146_3062_4465 | 466 |
| 2588 | 3300049584 | Ga0501068_0013165 | Ga0501068_0013165_816_2231 | 466 |
| 2589 | 3300049584 | Ga0501068_0014609 | Ga0501068_0014609_450_1853 | 466 |
| 2590 | 3300049584 | Ga0501068_0026245 | Ga0501068_0026245_20_1423 | 466 |
| 2591 | 3300049585 | Ga0501069_0014567 | Ga0501069_0014567_519_1934 | 466 |
| 2592 | 3300049585 | Ga0501069_0071080 | Ga0501069_0071080_217_1620 | 466 |
| 2593 | 3300049586 | Ga0501070_0002548 | Ga0501070_0002548_5410_6813 | 466 |
| 2594 | 3300049586 | Ga0501070_0006200 | Ga0501070_0006200_1833_3236 | 466 |
| 2595 | 3300049586 | Ga0501070_0013214 | Ga0501070_0013214_3706_5109 | 466 |
| 2596 | 3300049586 | Ga0501070_0020554 | Ga0501070_0020554_3709_5112 | 466 |
| 2597 | 3300049586 | Ga0501070_0022267 | Ga0501070_0022267_926_2341 | 466 |
| 2598 | 3300049586 | Ga0501070_0024977 | Ga0501070_0024977_2631_4034 | 466 |
| 2599 | 3300049586 | Ga0501070_0025040 | Ga0501070_0025040_2341_3744 | 466 |
| 2600 | 3300049586 | Ga0501070_0156925 | Ga0501070_0156925_463_1866 | 466 |
| 2601 | 3300049586 | Ga0501070_0216337 | Ga0501070_0216337_122_1525 | 466 |
| 2602 | 3300049587 | Ga0501071_0011386 | Ga0501071_0011386_1778_3193 | 466 |
| 2603 | 3300049587 | Ga0501071_0059871 | Ga0501071_0059871_160_1563 | 466 |
| 2604 | 3300049588 | Ga0501072_0066240 | Ga0501072_0066240_681_2084 | 466 |
| 2605 | 3300049588 | Ga0501072_0067082 | Ga0501072_0067082_682_2088 | 466 |
| 2606 | 3300049589 | Ga0501073_0000103 | Ga0501073_0000103_18356_19759 | 466 |
| 2607 | 3300049589 | Ga0501073_0057275 | Ga0501073_0057275_502_1905 | 466 |
| 2608 | 3300049589 | Ga0501073_0059061 | Ga0501073_0059061_906_2321 | 466 |
| 2609 | 3300049589 | Ga0501073_0147488 | Ga0501073_0147488_180_1583 | 466 |
| 2610 | 3300049589 | Ga0501073_0151360 | Ga0501073_0151360_78_1493 | 466 |
| 2611 | 3300049590 | Ga0501074_0000456 | Ga0501074_0000456_21122_22525 | 466 |
| 2612 | 3300049590 | Ga0501074_0001612 | Ga0501074_0001612_505_1908 | 466 |
| 2613 | 3300049590 | Ga0501074_0005242 | Ga0501074_0005242_7004_8419 | 466 |
| 2614 | 3300049590 | Ga0501074_0025367 | Ga0501074_0025367_2775_4178 | 466 |
| 2615 | 3300049590 | Ga0501074_0029373 | Ga0501074_0029373_1656_3059 | 466 |
| 2616 | 3300049590 | Ga0501074_0047059 | Ga0501074_0047059_1153_2556 | 466 |
| 2617 | 3300049592 | Ga0501076_0002639 | Ga0501076_0002639_7596_9008 | 466 |
| 2618 | 3300049592 | Ga0501076_0089958 | Ga0501076_0089958_639_2054 | 466 |
| 2619 | 3300049592 | Ga0501076_0121843 | Ga0501076_0121843_663_2063 | 466 |
| 2620 | 3300049593 | Ga0501077_0003492 | Ga0501077_0003492_7828_9240 | 466 |
| 2621 | 3300049741 | Ga0501079_0000451 | Ga0501079_0000451_12849_14252 | 466 |
| 2622 | 3300049741 | Ga0501079_0010445 | Ga0501079_0010445_1021_2532 | 466 |
| 2623 | 3300049741 | Ga0501079_0038416 | Ga0501079_0038416_1980_3383 | 466 |
| 2624 | 3300049741 | Ga0501079_0042211 | Ga0501079_0042211_1415_2821 | 466 |
| 2625 | 3300049741 | Ga0501079_0125027 | Ga0501079_0125027_210_1613 | 466 |
| 2626 | 3300049741 | Ga0501079_0147849 | Ga0501079_0147849_376_1788 | 466 |
| 2627 | 3300049742 | Ga0501080_0000082 | Ga0501080_0000082_4921_6324 | 466 |
| 2628 | 3300049742 | Ga0501080_0000153 | Ga0501080_0000153_42754_44157 | 466 |
| 2629 | 3300049742 | Ga0501080_0002998 | Ga0501080_0002998_9106_10509 | 466 |
| 2630 | 3300049742 | Ga0501080_0011942 | Ga0501080_0011942_1958_3373 | 466 |
| 2631 | 3300049742 | Ga0501080_0016338 | Ga0501080_0016338_4569_5972 | 466 |
| 2632 | 3300049742 | Ga0501080_0019550 | Ga0501080_0019550_429_1844 | 466 |
| 2633 | 3300049742 | Ga0501080_0034657 | Ga0501080_0034657_2865_4268 | 466 |
| 2634 | 3300049742 | Ga0501080_0042442 | Ga0501080_0042442_2790_4193 | 466 |
| 2635 | 3300049742 | Ga0501080_0061381 | Ga0501080_0061381_1841_3241 | 466 |
| 2636 | 3300049742 | Ga0501080_0064923 | Ga0501080_0064923_1042_2445 | 466 |
| 2637 | 3300049742 | Ga0501080_0112736 | Ga0501080_0112736_624_2036 | 466 |
| 2638 | 3300049743 | Ga0501081_0000145 | Ga0501081_0000145_12609_14021 | 466 |
| 2639 | 3300049744 | Ga0501083_0003065 | Ga0501083_0003065_5950_7353 | 466 |
| 2640 | 3300049744 | Ga0501083_0009193 | Ga0501083_0009193_5410_6813 | 466 |
| 2641 | 3300049744 | Ga0501083_0013677 | Ga0501083_0013677_2676_4082 | 466 |
| 2642 | 3300049744 | Ga0501083_0024526 | Ga0501083_0024526_28_1434 | 466 |
| 2643 | 3300049744 | Ga0501083_0037937 | Ga0501083_0037937_1272_2687 | 466 |
| 2644 | 3300049822 | Ga0501035_0000584 | Ga0501035_0000584_1118_2524 | 466 |
| 2645 | 3300049822 | Ga0501035_0000766 | Ga0501035_0000766_18356_19759 | 466 |
| 2646 | 3300049822 | Ga0501035_0001708 | Ga0501035_0001708_20312_21712 | 466 |
| 2647 | 3300049822 | Ga0501035_0018251 | Ga0501035_0018251_4158_5561 | 466 |
| 2648 | 3300049822 | Ga0501035_0026906 | Ga0501035_0026906_1175_2590 | 466 |
| 2649 | 3300049822 | Ga0501035_0046712 | Ga0501035_0046712_1871_3274 | 466 |
| 2650 | 3300049822 | Ga0501035_0049300 | Ga0501035_0049300_429_1841 | 466 |
| 2651 | 3300049822 | Ga0501035_0054488 | Ga0501035_0054488_1044_2447 | 466 |
| 2652 | 3300049822 | Ga0501035_0112140 | Ga0501035_0112140_84_1487 | 466 |
| 2653 | 3300049822 | Ga0501035_0255715 | Ga0501035_0255715_50_1453 | 466 |
| 2654 | 3300049823 | Ga0501044_0000286 | Ga0501044_0000286_16757_18172 | 466 |
| 2655 | 3300049823 | Ga0501044_0000418 | Ga0501044_0000418_44488_45891 | 466 |
| 2656 | 3300049823 | Ga0501044_0007955 | Ga0501044_0007955_5915_7318 | 466 |
| 2657 | 3300049823 | Ga0501044_0013097 | Ga0501044_0013097_5119_6522 | 466 |
| 2658 | 3300049823 | Ga0501044_0024381 | Ga0501044_0024381_1556_2959 | 466 |
| 2659 | 3300049823 | Ga0501044_0028251 | Ga0501044_0028251_518_1924 | 466 |
| 2660 | 3300049823 | Ga0501044_0028517 | Ga0501044_0028517_889_2292 | 466 |
| 2661 | 3300049823 | Ga0501044_0034063 | Ga0501044_0034063_1732_3135 | 466 |
| 2662 | 3300049823 | Ga0501044_0051865 | Ga0501044_0051865_146_1561 | 466 |
| 2663 | 3300049823 | Ga0501044_0067195 | Ga0501044_0067195_1252_2709 | 466 |
| 2664 | 3300049823 | Ga0501044_0101689 | Ga0501044_0101689_108_1511 | 466 |
| 2665 | 3300049823 | Ga0501044_0102882 | Ga0501044_0102882_1440_2843 | 466 |
| 2666 | 3300049823 | Ga0501044_0121107 | Ga0501044_0121107_334_1734 | 466 |
| 2667 | 3300049823 | Ga0501044_0176428 | Ga0501044_0176428_393_1796 | 466 |
| 2668 | 3300049823 | Ga0501044_0188063 | Ga0501044_0188063_444_1847 | 466 |
| 2669 | 3300049824 | Ga0501045_0054354 | Ga0501045_0054354_564_1967 | 466 |
| 2670 | 3300049824 | Ga0501045_0056551 | Ga0501045_0056551_1320_2735 | 466 |
| 2671 | 3300050489 | nmdc:mga03683_2117_c1 | nmdc:mga03683_2117_c1_3679_5094 | 466 |
| 2672 | 3300050490 | nmdc:mga03n38_1307_c3 | nmdc:mga03n38_1307_c3_231_1637 | 466 |
| 2673 | 3300050491 | nmdc:mga00v17_12_c1 | nmdc:mga00v17_12_c1_27630_29045 | 466 |
| 2674 | 3300050491 | nmdc:mga00v17_62963_c1 | nmdc:mga00v17_62963_c1_848_2251 | 466 |
| 2675 | 3300050491 | nmdc:mga00v17_639_c1 | nmdc:mga00v17_639_c1_7320_8735 | 466 |
| 2676 | 3300050492 | nmdc:mga0yw44_1397_c1 | nmdc:mga0yw44_1397_c1_5082_6485 | 466 |
| 2677 | 3300050492 | nmdc:mga0yw44_16757_c1 | nmdc:mga0yw44_16757_c1_1371_2774 | 466 |
| 2678 | 3300050492 | nmdc:mga0yw44_291_c1 | nmdc:mga0yw44_291_c1_14510_15925 | 466 |
| 2679 | 3300050492 | nmdc:mga0yw44_5474_c1 | nmdc:mga0yw44_5474_c1_2454_3866 | 466 |
| 2680 | 3300050492 | nmdc:mga0yw44_64749_c1 | nmdc:mga0yw44_64749_c1_406_1809 | 466 |
| 2681 | 3300050493 | nmdc:mga0k408_19986_c1 | nmdc:mga0k408_19986_c1_110_1513 | 466 |
| 2682 | 3300050493 | nmdc:mga0k408_43409_c1 | nmdc:mga0k408_43409_c1_117_1532 | 466 |
| 2683 | 3300050493 | nmdc:mga0k408_54844_c1 | nmdc:mga0k408_54844_c1_199_1608 | 466 |
| 2684 | 3300050494 | nmdc:mga06z11_59933_c1 | nmdc:mga06z11_59933_c1_56_1459 | 466 |
| 2685 | 3300050495 | nmdc:mga04h51_21673_c1 | nmdc:mga04h51_21673_c1_16_1419 | 466 |
| 2686 | 3300050496 | nmdc:mga07m45_33942_c1 | nmdc:mga07m45_33942_c1_654_2057 | 466 |
| 2687 | 3300050507 | nmdc:mga05p37_140758_c1 | nmdc:mga05p37_140758_c1_896_2308 | 466 |
| 2688 | 3300050507 | nmdc:mga05p37_16389_c1 | nmdc:mga05p37_16389_c1_4456_5868 | 466 |
| 2689 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_39152_40552 | 466 |
| 2690 | 3300050507 | nmdc:mga05p37_62404_c1 | nmdc:mga05p37_62404_c1_590_1993 | 466 |
| 2691 | 3300050507 | nmdc:mga05p37_66173_c1 | nmdc:mga05p37_66173_c1_2775_4187 | 466 |
| 2692 | 3300050507 | nmdc:mga05p37_71679_c1 | nmdc:mga05p37_71679_c1_375_1787 | 466 |
| 2693 | 3300050508 | nmdc:mga09592_813_c1 | nmdc:mga09592_813_c1_11887_13287 | 466 |
| 2694 | 3300050509 | nmdc:mga0qj67_101_c1 | nmdc:mga0qj67_101_c1_38205_39617 | 466 |
| 2695 | 3300050509 | nmdc:mga0qj67_1453_c1 | nmdc:mga0qj67_1453_c1_11915_13315 | 466 |
| 2696 | 3300050511 | nmdc:mga08y16_1715_c1 | nmdc:mga08y16_1715_c1_8074_9474 | 466 |
| 2697 | 3300050511 | nmdc:mga08y16_2882_c1 | nmdc:mga08y16_2882_c1_15447_16847 | 466 |
| 2698 | 3300050511 | nmdc:mga08y16_42428_c1 | nmdc:mga08y16_42428_c1_2937_4349 | 466 |
| 2699 | 3300050512 | nmdc:mga0n895_1392_c1 | nmdc:mga0n895_1392_c1_4661_6061 | 466 |
| 2700 | 3300050512 | nmdc:mga0n895_30575_c1 | nmdc:mga0n895_30575_c1_3638_5044 | 466 |
| 2701 | 3300050512 | nmdc:mga0n895_58282_c1 | nmdc:mga0n895_58282_c1_2069_3472 | 466 |
| 2702 | 3300050512 | nmdc:mga0n895_971_c1 | nmdc:mga0n895_971_c1_12827_14227 | 466 |
| 2703 | 3300050513 | nmdc:mga0rr50_78964_c1 | nmdc:mga0rr50_78964_c1_261_1661 | 466 |
| 2704 | 3300050514 | nmdc:mga08x19_25741_c1 | nmdc:mga08x19_25741_c1_960_2360 | 466 |
| 2705 | 3300050514 | nmdc:mga08x19_66_c1 | nmdc:mga08x19_66_c1_39448_40866 | 466 |
| 2706 | 3300050515 | nmdc:mga0a205_1026_c1 | nmdc:mga0a205_1026_c1_6465_7865 | 466 |
| 2707 | 3300050515 | nmdc:mga0a205_27448_c1 | nmdc:mga0a205_27448_c1_237_1637 | 466 |
| 2708 | 3300050515 | nmdc:mga0a205_687_c1 | nmdc:mga0a205_687_c1_21768_23168 | 466 |
| 2709 | 3300050516 | nmdc:mga0sz30_1084_c1 | nmdc:mga0sz30_1084_c1_6054_7469 | 466 |
| 2710 | 3300050516 | nmdc:mga0sz30_47039_c1 | nmdc:mga0sz30_47039_c1_26_1429 | 466 |
| 2711 | 3300050516 | nmdc:mga0sz30_5454_c1 | nmdc:mga0sz30_5454_c1_317_1723 | 466 |
| 2712 | 3300053077 | Ga0495601_0000020 | Ga0495601_0000020_131047_132522 | 466 |
| 2713 | 3300053077 | Ga0495601_0002032 | Ga0495601_0002032_3950_5350 | 466 |
| 2714 | 3300053077 | Ga0495601_0002166 | Ga0495601_0002166_2091_3491 | 466 |
| 2715 | 3300053077 | Ga0495601_0009529 | Ga0495601_0009529_1992_3401 | 466 |
| 2716 | 3300053077 | Ga0495601_0024023 | Ga0495601_0024023_1353_2762 | 466 |
| 2717 | 3300053077 | Ga0495601_0025589 | Ga0495601_0025589_752_2152 | 466 |
| 2718 | 3300053078 | Ga0495612_0000030 | Ga0495612_0000030_67566_69041 | 466 |
| 2719 | 3300053078 | Ga0495612_0000095 | Ga0495612_0000095_85_1494 | 466 |
| 2720 | 3300053078 | Ga0495612_0000616 | Ga0495612_0000616_11733_13133 | 466 |
| 2721 | 3300053078 | Ga0495612_0005510 | Ga0495612_0005510_2928_4328 | 466 |
| 2722 | 3300053078 | Ga0495612_0013166 | Ga0495612_0013166_1916_3316 | 466 |
| 2723 | 3300053078 | Ga0495612_0014874 | Ga0495612_0014874_164_1564 | 466 |
| 2724 | 3300053078 | Ga0495612_0015258 | Ga0495612_0015258_778_2178 | 466 |
| 2725 | 3300053084 | Ga0495595_0000125 | Ga0495595_0000125_18717_20192 | 466 |
| 2726 | 3300053084 | Ga0495595_0002085 | Ga0495595_0002085_5301_6710 | 466 |
| 2727 | 3300053084 | Ga0495595_0003032 | Ga0495595_0003032_1857_3257 | 466 |
| 2728 | 3300053084 | Ga0495595_0004343 | Ga0495595_0004343_2973_4373 | 466 |
| 2729 | 3300053084 | Ga0495595_0005397 | Ga0495595_0005397_3131_4531 | 466 |
| 2730 | 3300053084 | Ga0495595_0012561 | Ga0495595_0012561_1040_2491 | 466 |
| 2731 | 3300053084 | Ga0495595_0028530 | Ga0495595_0028530_1013_2413 | 466 |
| 2732 | 3300053084 | Ga0495595_0029769 | Ga0495595_0029769_165_1568 | 466 |
| 2733 | 3300053085 | Ga0495619_0000151 | Ga0495619_0000151_34688_36088 | 466 |
| 2734 | 3300053085 | Ga0495619_0000216 | Ga0495619_0000216_27512_28987 | 466 |
| 2735 | 3300053085 | Ga0495619_0000419 | Ga0495619_0000419_12247_13647 | 466 |
| 2736 | 3300053085 | Ga0495619_0000504 | Ga0495619_0000504_14107_15510 | 466 |
| 2737 | 3300053085 | Ga0495619_0001557 | Ga0495619_0001557_10748_12157 | 466 |
| 2738 | 3300053085 | Ga0495619_0001606 | Ga0495619_0001606_9229_10629 | 466 |
| 2739 | 3300053085 | Ga0495619_0005274 | Ga0495619_0005274_5530_6933 | 466 |
| 2740 | 3300053085 | Ga0495619_0005598 | Ga0495619_0005598_1065_2474 | 466 |
| 2741 | 3300053085 | Ga0495619_0009643 | Ga0495619_0009643_1462_2862 | 466 |
| 2742 | 3300053085 | Ga0495619_0010322 | Ga0495619_0010322_4123_5574 | 466 |
| 2743 | 3300053085 | Ga0495619_0012726 | Ga0495619_0012726_904_2304 | 466 |
| 2744 | 3300053085 | Ga0495619_0012816 | Ga0495619_0012816_903_2303 | 466 |
| 2745 | 3300053085 | Ga0495619_0065533 | Ga0495619_0065533_81_1496 | 466 |
| 2746 | 3300053086 | Ga0500578_0035303 | Ga0500578_0035303_953_2368 | 466 |
| 2747 | 3300053087 | Ga0500643_000267 | Ga0500643_000267_11052_12455 | 466 |
| 2748 | 3300053087 | Ga0500643_013683 | Ga0500643_013683_156_1559 | 466 |
| 2749 | 3300053087 | Ga0500643_022533 | Ga0500643_022533_433_1836 | 466 |
| 2750 | 3300053091 | Ga0500647_0016593 | Ga0500647_0016593_35_1438 | 466 |
| 2751 | 3300053093 | Ga0500651_0000861 | Ga0500651_0000861_13295_14698 | 466 |
| 2752 | 3300053093 | Ga0500651_0006227 | Ga0500651_0006227_4732_6141 | 466 |
| 2753 | 3300053093 | Ga0500651_0035377 | Ga0500651_0035377_541_1944 | 466 |
| 2754 | 3300053093 | Ga0500651_0081820 | Ga0500651_0081820_147_1556 | 466 |
| 2755 | 3300053093 | Ga0500651_0086679 | Ga0500651_0086679_147_1550 | 466 |
| 2756 | 3300053094 | Ga0500566_0000157 | Ga0500566_0000157_3567_4970 | 466 |
| 2757 | 3300053094 | Ga0500566_0000185 | Ga0500566_0000185_379_1782 | 466 |
| 2758 | 3300053094 | Ga0500566_0000925 | Ga0500566_0000925_113_1516 | 466 |
| 2759 | 3300053096 | Ga0500641_0001160 | Ga0500641_0001160_3503_4909 | 466 |
| 2760 | 3300053096 | Ga0500641_0006535 | Ga0500641_0006535_317_1720 | 466 |
| 2761 | 3300053096 | Ga0500641_0024451 | Ga0500641_0024451_363_1766 | 466 |
| 2762 | 3300053096 | Ga0500641_0028182 | Ga0500641_0028182_731_2134 | 466 |
| 2763 | 3300053102 | Ga0500554_000718 | Ga0500554_000718_644_2047 | 466 |
| 2764 | 3300053104 | Ga0500556_0000413 | Ga0500556_0000413_157_1560 | 466 |
| 2765 | 3300053104 | Ga0500556_0008713 | Ga0500556_0008713_940_2343 | 466 |
| 2766 | 3300053105 | Ga0500557_000041 | Ga0500557_000041_41131_42534 | 466 |
| 2767 | 3300053107 | Ga0500560_007025 | Ga0500560_007025_923_2338 | 466 |
| 2768 | 3300053108 | Ga0500562_011056 | Ga0500562_011056_111_1514 | 466 |
| 2769 | 3300053111 | Ga0500572_001865 | Ga0500572_001865_139_1542 | 466 |
| 2770 | 3300053111 | Ga0500572_003851 | Ga0500572_003851_1823_3250 | 466 |
| 2771 | 3300053116 | Ga0500592_008834 | Ga0500592_008834_53_1456 | 466 |
| 2772 | 3300053119 | Ga0500595_000024 | Ga0500595_000024_109760_111163 | 466 |
| 2773 | 3300053119 | Ga0500595_003935 | Ga0500595_003935_2414_3817 | 466 |
| 2774 | 3300053119 | Ga0500595_006228 | Ga0500595_006228_1806_3209 | 466 |
| 2775 | 3300053119 | Ga0500595_018179 | Ga0500595_018179_597_2000 | 466 |
| 2776 | 3300053119 | Ga0500595_023855 | Ga0500595_023855_670_2073 | 466 |
| 2777 | 3300053123 | Ga0500614_001219 | Ga0500614_001219_3217_4620 | 466 |
| 2778 | 3300053125 | Ga0500618_006718 | Ga0500618_006718_781_2190 | 466 |
| 2779 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_29607_31010 | 466 |
| 2780 | 3300053130 | Ga0500642_0000140 | Ga0500642_0000140_25024_26457 | 466 |
| 2781 | 3300053131 | Ga0500652_000011 | Ga0500652_000011_7431_8837 | 466 |
| 2782 | 3300053131 | Ga0500652_000531 | Ga0500652_000531_3008_4411 | 466 |
| 2783 | 3300053134 | Ga0500658_0004847 | Ga0500658_0004847_1934_3337 | 466 |
| 2784 | 3300053136 | Ga0500559_0002089 | Ga0500559_0002089_5966_7369 | 466 |
| 2785 | 3300053136 | Ga0500559_0004041 | Ga0500559_0004041_1117_2529 | 466 |
| 2786 | 3300053136 | Ga0500559_0004212 | Ga0500559_0004212_4303_5706 | 466 |
| 2787 | 3300053137 | Ga0500561_0000098 | Ga0500561_0000098_4833_6248 | 466 |
| 2788 | 3300053139 | Ga0500568_0002109 | Ga0500568_0002109_4685_6088 | 466 |
| 2789 | 3300053142 | Ga0500577_0000693 | Ga0500577_0000693_5102_6505 | 466 |
| 2790 | 3300053148 | Ga0500590_083058 | Ga0500590_083058_153_1556 | 466 |
| 2791 | 3300053150 | Ga0500603_000277 | Ga0500603_000277_5928_7331 | 466 |
| 2792 | 3300053150 | Ga0500603_001226 | Ga0500603_001226_4373_5776 | 466 |
| 2793 | 3300053151 | Ga0500604_0019289 | Ga0500604_0019289_300_1703 | 466 |
| 2794 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_36069_37472 | 466 |
| 2795 | 3300053153 | Ga0500616_0000166 | Ga0500616_0000166_79903_81309 | 466 |
| 2796 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_75009_76412 | 466 |
| 2797 | 3300053153 | Ga0500616_0004617 | Ga0500616_0004617_6033_7448 | 466 |
| 2798 | 3300053153 | Ga0500616_0009939 | Ga0500616_0009939_4198_5613 | 466 |
| 2799 | 3300053156 | Ga0500622_0000458 | Ga0500622_0000458_29185_30600 | 466 |
| 2800 | 3300053156 | Ga0500622_0029561 | Ga0500622_0029561_10_1413 | 466 |
| 2801 | 3300053156 | Ga0500622_0037547 | Ga0500622_0037547_69_1472 | 466 |
| 2802 | 3300053156 | Ga0500622_0045943 | Ga0500622_0045943_317_1720 | 466 |
| 2803 | 3300053162 | Ga0500638_078740 | Ga0500638_078740_73_1476 | 466 |
| 2804 | 3300053163 | Ga0500639_000014 | Ga0500639_000014_145_1548 | 466 |
| 2805 | 3300053163 | Ga0500639_063951 | Ga0500639_063951_78_1505 | 466 |
| 2806 | 3300053177 | Ga0500636_0000180 | Ga0500636_0000180_21160_22575 | 466 |
| 2807 | 3300053177 | Ga0500636_0001459 | Ga0500636_0001459_4488_5903 | 466 |
| 2808 | 3300053177 | Ga0500636_0001916 | Ga0500636_0001916_5636_7078 | 466 |
| 2809 | 3300053177 | Ga0500636_0004158 | Ga0500636_0004158_4671_6074 | 466 |
| 2810 | 3300053178 | Ga0500637_0002840 | Ga0500637_0002840_5911_7314 | 466 |
| 2811 | 3300053178 | Ga0500637_0029199 | Ga0500637_0029199_963_2372 | 466 |
| 2812 | 3300053729 | Ga0500625_003212 | Ga0500625_003212_3373_4776 | 466 |
| 2813 | 3300053730 | Ga0500645_002180 | Ga0500645_002180_6730_8136 | 466 |
| 2814 | 3300053730 | Ga0500645_013842 | Ga0500645_013842_683_2086 | 466 |
| 2815 | 3300053736 | Ga0500599_000459 | Ga0500599_000459_396_1799 | 466 |
| 2816 | 3300053737 | Ga0500601_000076 | Ga0500601_000076_17350_18753 | 466 |
| 2817 | 3300054114 | Ga0501084_0003972 | Ga0501084_0003972_5508_6911 | 466 |
| 2818 | 3300054114 | Ga0501084_0073507 | Ga0501084_0073507_921_2324 | 466 |
| 2819 | 3300054114 | Ga0501084_0114235 | Ga0501084_0114235_59_1468 | 466 |
| 2820 | 3300054114 | Ga0501084_0148146 | Ga0501084_0148146_342_1754 | 466 |
| 2821 | 3300060353 | Ga0501082_0011183 | Ga0501082_0011183_818_2221 | 466 |
| 2822 | 3300060353 | Ga0501082_0011925 | Ga0501082_0011925_4136_5551 | 466 |
| 2823 | 3300060353 | Ga0501082_0040978 | Ga0501082_0040978_1925_3328 | 466 |
| 2824 | 3300060353 | Ga0501082_0051160 | Ga0501082_0051160_1886_3343 | 466 |
| 2825 | 3300060353 | Ga0501082_0111109 | Ga0501082_0111109_178_1581 | 466 |
| 2826 | 3300061719 | Ga0466962_0032239 | Ga0466962_0032239_940_2355 | 466 |
| 2827 | 3300061734 | Ga0530510_0024936 | Ga0530510_0024936_1126_2538 | 466 |
| 2828 | iso_pu_bacteria | 2515154112 | 2515625437 | 466 |
| 2829 | iso_pu_bacteria | 2874590934 | 2874597748 | 466 |
| 2830 | iso_pu_bacteria | 2874645413 | 2874651277 | 466 |
| 2831 | iso_pu_bacteria | 2876771140 | 2876776348 | 466 |
| 2832 | iso_pu_bacteria | 2876818435 | 2876820916 | 466 |
| 2833 | iso_pu_bacteria | 2879074833 | 2879081789 | 466 |
| 2834 | iso_pu_bacteria | 2935975950 | 2935976652 | 466 |
| 2835 | iso_pu_bacteria | 3005474847 | 3005477605 | 466 |
| 2836 | iso_pu_bacteria | 8006926726 | 8006932253 | 466 |
| 2837 | iso_pu_bacteria | 8019619141 | 8019625137 | 466 |
| 2838 | iso_pu_bacteria | 8019638758 | 8019642561 | 466 |
| 2839 | iso_pu_bacteria | 8019668869 | 8019674444 | 466 |
| 2840 | iso_pu_bacteria | 8019678201 | 8019681659 | 466 |
| 2841 | iso_pu_bacteria | 8056673599 | 8056674870 | 466 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cau-assembly1.cif.gz_A | udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp | 0.9569 | 1 | 317 |
| 6cau-assembly1.cif.gz_A | udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp | 0.9508 | 1 | 317 |
| 1gqy-assembly1.cif.gz_A | murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp | 0.9448 | 1 | 463 |
| 2f00-assembly1.cif.gz_B | escherichia coli murc | 0.9419 | 4 | 465 |
| 1p3d-assembly2.cif.gz_B | crystal structure of udp-n-acetylmuramic acid:l-alanine ligase (murc) in complex with uma and anp. | 0.9395 | 5 | 461 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gqqB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.986 | 11 | 94 | 3.40.50.720 |
| 1j6uA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9712 | 10 | 94 | 3.40.50.720 |
| 2f00B02 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9682 | 97 | 316 | 3.40.1190.10 |
| 1gqqB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9633 | 11 | 94 | 3.40.50.720 |
| af_P9WJL7_8_102_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9615 | 5 | 94 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G8PXB3-F1-model_v4 | Mur ligase N-terminal catalytic domain-containing protein | 0.9964 | 9 | 96 |
GO:0009058
GO:0016881 |
| AF-A0A382V739-F1-model_v4 | Mur ligase N-terminal catalytic domain-containing protein | 0.9912 | 20 | 100 |
GO:0009058
GO:0016881 |
| AF-A0A352GG65-F1-model_v4 | Mur ligase C-terminal domain-containing protein | 0.9902 | 361 | 464 |
GO:0009058
GO:0016881 |
| AF-Q98KB4-F1-model_v4 | UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8) (UDP-N-acetylmuramoyl-L-alanine synthetase) | 0.9872 | 1 | 465 |
GO:0005524
GO:0005737 GO:0008360 GO:0008763 GO:0009252 GO:0051301 GO:0071555 |
| AF-A0A528FJS9-F1-model_v4 | UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8) | 0.9864 | 316 | 463 |
GO:0008763
GO:0009058 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar