metagRoot

F496873

General Info

Members	Datasets	Scaffolds	Average Seq Length
2514	956	1940	67

Family's Representative Sequence

Representative Sequence	3300005289\|Ga0065704_10002481\|Ga0065704_100024818
Length	70
Sequence	MSNRQNGTVKWFNDEKGYGFITPQSGGDDLFVHFKAIESDGFKSLKEGQAVSFVAEKGQKGMQAAQVRPE

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
4	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
5	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
6	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
7	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
8	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
9	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
10	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
11	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
12	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
13	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
14	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
15	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
16	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
17	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
18	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
19	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
20	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
21	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
22	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
23	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
24	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
25	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
26	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
27	2524614729	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
28	2537561836	Rhodanobacter spathiphylli B39	Isolate	Unclassified
29	2547132130	Stenotrophomonas maltophilia RR-10	Isolate	Unclassified
30	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
31	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
32	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
33	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
34	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
35	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
36	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
37	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
38	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
39	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
40	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
41	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
42	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
43	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
44	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
45	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
46	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
47	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
48	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
49	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
50	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
51	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
52	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
53	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
54	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
55	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
56	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
57	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
58	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
59	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
60	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
61	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
62	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
63	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
64	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
65	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
66	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
67	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
68	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
69	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
70	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
71	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
72	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
73	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
74	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
75	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
76	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
77	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
78	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
79	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
80	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
81	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
82	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
83	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
84	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
85	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
86	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
87	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
88	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
89	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
90	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
91	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
92	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
93	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
94	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
95	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
96	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
97	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
98	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
99	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
100	2616644814	Streptomyces mirabilis OK461	Isolate	Rhizosphere
101	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
102	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
103	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
104	2627854209	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
105	2643221562	Rhodanobacter sp. Root561	Isolate	Unclassified
106	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
107	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
108	2643221577	Rhodanobacter sp. Root627	Isolate	Unclassified
109	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
110	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
111	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
112	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
113	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
114	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
115	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
116	2643221685	Rhodanobacter sp. Root480	Isolate	Unclassified
117	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
118	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
119	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
120	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
121	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
122	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
123	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
124	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
125	2687453130	Dyella thiooxydans ATSB10	Isolate	Unclassified
126	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
127	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
128	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
129	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
130	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
131	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
132	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
133	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
134	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
135	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
136	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
137	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
138	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
139	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
140	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
141	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
142	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
143	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
144	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
145	2747842428	Stenotrophomonas sp. WCS2014-113	Isolate	Unclassified
146	2747842501	Xanthomonas sp. WCS2014-23	Isolate	Unclassified
147	2765235840	Stenotrophomonas maltophilia AA1	Isolate	Unclassified
148	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
149	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
150	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
151	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
152	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
153	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
154	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
155	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
156	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
157	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
158	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
159	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
160	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
161	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
162	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
163	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
164	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
165	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
166	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
167	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
168	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
169	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
170	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
171	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
172	2816332141	Stenotrophomonas muris 1190 (v2) (version 2)	Isolate	Unclassified
173	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
174	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
175	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
176	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
177	2818991472	Kitasatospora viridis DSM 44826	Isolate	Rhizosphere
178	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
179	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
180	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
181	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
182	2842391507	Stenotrophomonas maltophilia SEMIA 4027	Isolate	Nodule
183	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
184	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
185	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
186	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
187	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
188	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
189	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
190	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
191	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
192	2842918807	Luteibacter sp. R-73110	Isolate	Unclassified
193	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
194	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
195	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
196	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
197	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
198	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
199	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
200	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
201	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
202	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
203	2894414249	Luteimonas sp. LNNU 24178	Isolate	Rhizosphere
204	2895395659	Rhodanobacter sp. T12-5	Isolate	Unclassified
205	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
206	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
207	2895522137	Pseudoxanthomonas sp. SGNA-20	Isolate	Rhizosphere
208	2895525241	Pseudoxanthomonas sp. SGT-18	Isolate	Rhizosphere
209	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
210	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
211	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
212	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
213	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
214	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
215	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
216	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
217	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
218	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
219	2919130084	Xanthomonas sp. 1678	Isolate	Rhizosphere
220	2919134579	Stenotrophomonas geniculata 1733	Isolate	Rhizosphere
221	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
222	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
223	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
224	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
225	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
226	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
227	2919513703	Luteimonas sp. 3794	Isolate	Unclassified
228	2919675420	Luteimonas terrae 4099	Isolate	Unclassified
229	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
230	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
231	2923516293	Pseudoxanthomonas mexicana SLBN-89	Isolate	Rhizosphere
232	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
233	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
234	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
235	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
236	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
237	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
238	2929195423	Xanthomonas sp. R-73098 Hybrid assembly	Isolate	Unclassified
239	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
240	2931380184	Stenotrophomonas sp. DR822	Isolate	Rhizosphere
241	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
242	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
243	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
244	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
245	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
246	2939611941	Rhodanobacter soli 1757	Isolate	Rhizosphere
247	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
248	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
249	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
250	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
251	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
252	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
253	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
254	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
255	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
256	2953994433	Luteibacter sp. W1I16	Isolate	Rhizosphere
257	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
258	2961064222	Stenotrophomonas maltophilia EP13	Isolate	Unclassified
259	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
260	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
261	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
262	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
263	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
264	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
265	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
266	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
267	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
268	2987605356	Stenotrophomonas sp. ATCM1_4	Isolate	Unclassified
269	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
270	2990196909	Pseudomonas mangrovi TC-11	Isolate	Unclassified
271	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
272	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
273	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
274	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
275	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
276	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
277	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
278	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
279	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
280	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
281	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
282	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
283	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
284	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
285	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
286	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
287	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
288	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
289	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
290	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
291	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
292	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
293	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
294	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
295	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
296	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
297	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
298	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
299	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
300	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
301	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
302	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
303	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
304	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
305	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
306	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
307	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
308	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
309	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
310	3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Metagenome	Rhizosphere
311	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
312	3300003391	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM	Metagenome	Rhizosphere
313	3300003405	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM	Metagenome	Rhizosphere
314	3300003502	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM	Metagenome	Rhizosphere
315	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
316	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
317	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
318	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
319	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
320	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
321	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
322	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
323	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
324	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
325	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
326	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
327	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
328	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
329	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
330	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
331	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
332	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
333	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
334	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
335	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
336	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
337	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
338	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
339	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
340	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
341	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
342	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
343	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
344	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
345	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
346	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
347	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
348	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
349	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
350	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
351	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
352	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
353	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
354	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
355	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
356	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
357	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
358	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
359	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
360	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
361	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
362	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
363	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
364	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
365	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
366	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
367	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
368	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
369	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
370	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
371	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
372	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
373	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
374	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
375	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
376	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
377	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
378	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
379	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
380	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
381	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
382	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
383	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
384	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
385	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
386	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
387	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
388	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
389	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
390	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
391	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
392	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
393	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
394	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
395	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
396	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
397	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
398	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
399	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
400	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
401	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
402	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
403	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
404	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
405	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
406	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
407	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
408	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
409	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
410	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
411	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
412	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
413	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
414	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
415	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
416	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
417	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
418	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
419	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
420	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
421	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
422	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
423	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
424	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
425	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
426	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
427	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
428	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
429	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
430	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
431	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
432	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
433	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
434	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
435	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
436	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
437	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
438	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
439	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
440	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
441	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
442	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
443	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
444	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
445	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
446	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
447	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
448	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
449	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
450	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
451	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
452	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
453	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
454	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
455	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
456	3300012482	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510	Metagenome	Rhizosphere
457	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
458	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
459	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
460	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
461	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
462	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
463	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
464	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
465	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
466	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
467	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
468	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
469	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
470	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
471	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
472	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
473	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
474	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
475	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
476	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
477	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
478	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
479	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
480	3300019176	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
481	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
482	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
483	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
484	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
485	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
486	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
487	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
488	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
489	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
490	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
491	3300022732	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1	Metagenome	Rhizosphere
492	3300022734	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3	Metagenome	Rhizosphere
493	3300023309	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1	Metatranscriptome	Rhizosphere
494	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
495	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
496	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
497	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
498	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
499	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
500	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
501	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
502	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
503	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
504	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
505	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
506	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
507	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
508	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
509	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
510	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
511	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
512	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
513	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
514	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
515	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
516	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
517	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
518	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
519	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
520	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
521	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
522	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
523	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
524	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
525	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
526	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
527	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
528	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
529	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
530	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
531	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
532	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
533	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
534	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
535	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
536	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
537	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
538	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
539	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
540	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
541	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
542	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
543	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
544	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
545	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
546	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
547	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
548	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
549	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
550	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
551	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
552	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
553	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
554	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
555	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
556	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
557	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
558	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
559	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
560	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
561	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
562	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
563	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
564	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
565	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
566	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
567	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
568	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
569	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
570	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
571	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
572	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
573	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
574	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
575	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
576	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
577	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
578	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
579	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
580	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
581	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
582	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
583	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
584	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
585	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
586	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
587	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
588	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
589	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
590	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
591	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
592	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
593	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
594	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
595	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
596	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
597	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
598	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
599	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
600	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
601	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
602	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
603	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
604	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
605	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
606	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
607	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
608	3300028010	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6	Metagenome	Rhizosphere
609	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
610	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
611	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
612	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
613	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
614	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
615	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
616	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
617	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
618	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
619	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
620	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
621	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
622	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
623	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
624	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
625	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
626	3300031018	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
627	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
628	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
629	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
630	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
631	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
632	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
633	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
634	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
635	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
636	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
637	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
638	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
639	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
640	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
641	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
642	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
643	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
644	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
645	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
646	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
647	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
648	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
649	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
650	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
651	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
652	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
653	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
654	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
655	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
656	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
657	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
658	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
659	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
660	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
661	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
662	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
663	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
664	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
665	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
666	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
667	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
668	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
669	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
670	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
671	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
672	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
673	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
674	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
675	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
676	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
677	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
678	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
679	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
680	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
681	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
682	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
683	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
684	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
685	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
686	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
687	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
688	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
689	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
690	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
691	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
692	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
693	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
694	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
695	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
696	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
697	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
698	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
699	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
700	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
701	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
702	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
703	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
704	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
705	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
706	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
707	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
708	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
709	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
710	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
711	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
712	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
713	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
714	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
715	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
716	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
717	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
718	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
719	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
720	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
721	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
722	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
723	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
724	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
725	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
726	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
727	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
728	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
729	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
730	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
731	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
732	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
733	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
734	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
735	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
736	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
737	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
738	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
739	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
740	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
741	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
742	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
743	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
744	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
745	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
746	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
747	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
748	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
749	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
750	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
751	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
752	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
753	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
754	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
755	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
756	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
757	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
758	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
759	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
760	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
761	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
762	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
763	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
764	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
765	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
766	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
767	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
768	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
769	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
770	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
771	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
772	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
773	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
774	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
775	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
776	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
777	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
778	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
779	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
780	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
781	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
782	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
783	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
784	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
785	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
786	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
787	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
788	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
789	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
790	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
791	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
792	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
793	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
794	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
795	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
796	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
797	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
798	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
799	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
800	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
801	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
802	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
803	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
804	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
805	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
806	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
807	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
808	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
809	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
810	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
811	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
812	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
813	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
814	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
815	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
816	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
817	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
818	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
819	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
820	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
821	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
822	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
823	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
824	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
825	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
826	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
827	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
828	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
829	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
830	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
831	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
832	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
833	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
834	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
835	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
836	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
837	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
838	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
839	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
840	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
841	3300049519	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought	Metagenome	Rhizosphere
842	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
843	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
844	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
845	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
846	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
847	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
848	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
849	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
850	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
851	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
852	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
853	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
854	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
855	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
856	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
857	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
858	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
859	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
860	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
861	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
862	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
863	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
864	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
865	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
866	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
867	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
868	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
869	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
870	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
871	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
872	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
873	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
874	3300049772	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control	Metagenome	Rhizosphere
875	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
876	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
877	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
878	3300049850	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control	Metagenome	Rhizosphere
879	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
880	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
881	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
882	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
883	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
884	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
885	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
886	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
887	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
888	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
889	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
890	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
891	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
892	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
893	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
894	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
895	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
896	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
897	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
898	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
899	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
900	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
901	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
902	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
903	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
904	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
905	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
906	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
907	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
908	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
909	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
910	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
911	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
912	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
913	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
914	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
915	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
916	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
917	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
918	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
919	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
920	3300059657	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
921	3300059659	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
922	3300060243	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
923	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
924	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
925	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
926	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
927	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
928	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
929	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
930	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
931	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
932	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
933	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
934	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
935	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
936	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
937	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
938	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
939	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
940	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
941	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
942	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
943	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
944	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
945	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
946	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
947	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
948	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
949	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
950	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
951	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
952	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
953	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
954	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
955	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
956	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	75.66
Metatranscriptomes	1.71
Isolates	22.63

Biome Distribution

Category	Percentage (%)
Aerial Root	0.16
Bulb	0
Endosphere	3.82
Nodule	1.99
Rhizoplane	8.11
Rhizosphere	74.9
Stem	0
Stem Tuber	0
Unclassified	11.02

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_1297	2124908027	Bacteria	12330
2	MRS2a_Contig_720	2124908027	Bacteria	19927
3	MRS2a_Contig_9080	2124908027	Bacteria	6069
4	SwRhRL2b_contig_655993	2162886007	Bacteria	4323
5	LJNas_1000537	3300000546	Bacteria	6597
6	JGI24741J21665_1002221	3300001915	Bacteria	5147
7	JGI24741J21665_1005274	3300001915	Bacteria	2732
8	JGI24741J21665_1017159	3300001915	Bacteria	1172
9	JGI24752J21851_1007937	3300001976	Bacteria	1383
10	JGI24746J21847_1047156	3300001977	Bacteria	604
11	JGI24740J21852_10000088	3300001979	Bacteria	31765
12	JGI24740J21852_10113317	3300001979	Bacteria	683
13	JGI24740J21852_10174118	3300001979	Bacteria	534
14	JGI24739J22299_10223195	3300001989	Bacteria	552
15	JGI24737J22298_10020425	3300001990	Bacteria	2114
16	JGI24743J22301_10001525	3300001991	Unclassified	3236
17	JGI24735J21928_10152024	3300002067	Bacteria	668
18	JGI24745J21846_1042922	3300002073	Bacteria	563
19	JGI24748J21848_1005076	3300002074	Bacteria	1523
20	JGI24749J21850_1018066	3300002076	Bacteria	995
21	JGI24035J26624_1030081	3300002126	Bacteria	590
22	JGI24033J26618_1010641	3300002155	Bacteria	1087
23	JGI24034J26672_10057963	3300002239	Bacteria	676
24	JGI24742J22300_10077282	3300002244	Bacteria	626
25	JGI24751J29686_10042892	3300002459	Bacteria	935
26	JGI25155J39150_1002347	3300002704	Bacteria	1043
27	JGI25156J39149_1043045	3300002705	Bacteria	615
28	JGI25156J39149_1044979	3300002705	Bacteria	595
29	JGI25154J39366_1002279	3300002738	Bacteria	5188
30	JGI25157J39369_1000282	3300002741	Bacteria	37121
31	rootH2_10016961	3300003320	Bacteria	5664
32	rootL2_10119882	3300003322	Bacteria	2359
33	rootH1_10015409	3300003323	Bacteria	1615
34	rootH1_10069979	3300003323	Bacteria	3874
35	JGI26145J50221_1022212	3300003371	Bacteria	618
36	JGI25407J50210_10019913	3300003373	Bacteria	1745
37	JGI26135J50243_103023	3300003391	Bacteria	506
38	JGI26132J50249_104563	3300003405	Bacteria	521
39	JGI26143J51219_1004854	3300003502	Bacteria	655
40	Ga0055538_1000096	3300003751	Bacteria	73286
41	Ga0055539_1000142	3300003752	Bacteria	73286
42	Ga0055533_1000146	3300003756	Bacteria	73286
43	Ga0055533_1012986	3300003756	Bacteria	864
44	Ga0055532_1000132	3300003758	Bacteria	73282
45	Ga0055535_1004683	3300003761	Bacteria	3234
46	Ga0055536_1000946	3300003781	Bacteria	18629
47	Ga0055536_1016807	3300003781	Bacteria	2427
48	Ga0055536_1055772	3300003781	Bacteria	843
49	Ga0055530_10000296	3300003791	Bacteria	45176
50	Ga0055530_10098704	3300003791	Bacteria	589
51	Ga0055540_1108355	3300003792	Bacteria	514
52	Ga0055531_10001697	3300003794	Bacteria	15794
53	Ga0055531_10008331	3300003794	Bacteria	5492
54	Ga0055531_10011186	3300003794	Bacteria	4362
55	Ga0055541_1000096	3300003841	Bacteria	73286
56	Ga0058692_1000002	3300003856	Bacteria	508401
57	Ga0058692_1026528	3300003856	Bacteria	1138
58	Ga0058861_10053130	3300004800	Bacteria	629
59	Ga0065714_10000562	3300005288	Bacteria	4077
60	Ga0065714_10071126	3300005288	Bacteria	3656
61	Ga0065704_10000467	3300005289	Bacteria	20171
62	Ga0065704_10002481	3300005289	Bacteria	6003
63	Ga0065704_10012125	3300005289	Bacteria	1926
64	Ga0065704_10250254	3300005289	Bacteria	991
65	Ga0065704_10353766	3300005289	Bacteria	806
66	Ga0065704_10575586	3300005289	Bacteria	621
67	Ga0065712_10007051	3300005290	Bacteria	2479
68	Ga0065712_10067808	3300005290	Bacteria	30719
69	Ga0065715_10118967	3300005293	Bacteria	2300
70	Ga0065715_10134922	3300005293	Bacteria	1946
71	Ga0065715_10262662	3300005293	Bacteria	1133
72	Ga0065715_10605238	3300005293	Bacteria	701
73	Ga0065715_10627484	3300005293	Bacteria	692
74	Ga0065715_10951252	3300005293	Bacteria	559
75	Ga0065707_10409039	3300005295	Bacteria	843
76	Ga0070658_10023584	3300005327	Bacteria	4937
77	Ga0070658_10122767	3300005327	Bacteria	2159
78	Ga0070658_10145769	3300005327	Bacteria	1980
79	Ga0070658_11036834	3300005327	Bacteria	713
80	Ga0070658_11067144	3300005327	Bacteria	703
81	Ga0070676_10008726	3300005328	Bacteria	5469
82	Ga0070676_10435238	3300005328	Bacteria	919
83	Ga0070676_10436134	3300005328	Bacteria	918
84	Ga0070676_11009789	3300005328	Bacteria	625
85	Ga0070683_100000480	3300005329	Bacteria	28094
86	Ga0070683_100674300	3300005329	Bacteria	990
87	Ga0070690_100008224	3300005330	Bacteria	6001
88	Ga0070690_101674413	3300005330	Bacteria	517
89	Ga0070670_100008310	3300005331	Bacteria	8845
90	Ga0070670_100128916	3300005331	Bacteria	2184
91	Ga0070670_100242687	3300005331	Bacteria	1569
92	Ga0070670_100506044	3300005331	Bacteria	1074
93	Ga0070677_10413671	3300005333	Bacteria	713
94	Ga0070677_10910416	3300005333	Bacteria	509
95	Ga0068869_100060522	3300005334	Bacteria	2775
96	Ga0068869_100120389	3300005334	Unclassified	2006
97	Ga0068869_100227170	3300005334	Bacteria	1482
98	Ga0068869_100976809	3300005334	Bacteria	736
99	Ga0070666_10020201	3300005335	Bacteria	4304
100	Ga0070666_10242647	3300005335	Unclassified	1274
101	Ga0070666_10435863	3300005335	Bacteria	945
102	Ga0070666_10923064	3300005335	Bacteria	646
103	Ga0070680_100000138	3300005336	Bacteria	44481
104	Ga0070680_100010092	3300005336	Bacteria	7277
105	Ga0070680_100295213	3300005336	Bacteria	1374
106	Ga0070680_100325524	3300005336	Bacteria	1305
107	Ga0070680_100739311	3300005336	Bacteria	847
108	Ga0070680_101378275	3300005336	Bacteria	610
109	Ga0070682_100002905	3300005337	Bacteria	9504
110	Ga0070682_100038059	3300005337	Bacteria	2949
111	Ga0070682_100138584	3300005337	Bacteria	1656
112	Ga0070682_100173330	3300005337	Bacteria	1501
113	Ga0070682_100332422	3300005337	Bacteria	1127
114	Ga0070682_100966569	3300005337	Bacteria	704
115	Ga0070682_102053318	3300005337	Bacteria	503
116	Ga0068868_100009755	3300005338	Bacteria	6927
117	Ga0068868_100011952	3300005338	Bacteria	6334
118	Ga0068868_100046578	3300005338	Bacteria	3395
119	Ga0068868_100051661	3300005338	Plasmid	3235
120	Ga0068868_100714372	3300005338	Bacteria	898
121	Ga0070660_100005909	3300005339	Bacteria	8464
122	Ga0070660_100058361	3300005339	Bacteria	2991
123	Ga0070660_100219665	3300005339	Bacteria	1544
124	Ga0070660_100575546	3300005339	Bacteria	940
125	Ga0070660_100895698	3300005339	Bacteria	748
126	Ga0070660_101181235	3300005339	Bacteria	648
127	Ga0070660_101594353	3300005339	Bacteria	555
128	Ga0070689_100045991	3300005340	Bacteria	3362
129	Ga0070689_100403475	3300005340	Bacteria	1156
130	Ga0070691_10693743	3300005341	Bacteria	610
131	Ga0070687_100004085	3300005343	Bacteria	5763
132	Ga0070687_100316848	3300005343	Bacteria	995
133	Ga0070687_100558159	3300005343	Bacteria	780
134	Ga0070687_101104910	3300005343	Bacteria	580
135	Ga0070661_100000306	3300005344	Bacteria	39537
136	Ga0070661_100005169	3300005344	Bacteria	8982
137	Ga0070661_100014683	3300005344	Bacteria	5523
138	Ga0070661_100215629	3300005344	Bacteria	1470
139	Ga0070661_100234058	3300005344	Bacteria	1412
140	Ga0070661_100274436	3300005344	Bacteria	1306
141	Ga0070661_100753315	3300005344	Bacteria	796
142	Ga0070692_10000478	3300005345	Bacteria	12287
143	Ga0070692_10034906	3300005345	Bacteria	2543
144	Ga0070692_10056636	3300005345	Bacteria	2053
145	Ga0070692_10122772	3300005345	Bacteria	1450
146	Ga0070692_10204302	3300005345	Bacteria	1159
147	Ga0070692_10656179	3300005345	Bacteria	701
148	Ga0070668_100012646	3300005347	Bacteria	6282
149	Ga0070668_100135989	3300005347	Bacteria	1977
150	Ga0070668_101094190	3300005347	Bacteria	719
151	Ga0070668_101937483	3300005347	Bacteria	543
152	Ga0070669_100022083	3300005353	Bacteria	4552
153	Ga0070669_100176976	3300005353	Bacteria	1667
154	Ga0070675_100019633	3300005354	Bacteria	5386
155	Ga0070675_100513237	3300005354	Bacteria	1081
156	Ga0070671_100073774	3300005355	Bacteria	2850
157	Ga0070671_100778124	3300005355	Bacteria	833
158	Ga0070671_101365293	3300005355	Bacteria	626
159	Ga0070674_100020531	3300005356	Plasmid	4224
160	Ga0070674_100416299	3300005356	Bacteria	1101
161	Ga0070674_100867680	3300005356	Bacteria	784
162	Ga0070673_100039122	3300005364	Bacteria	3627
163	Ga0070673_100082713	3300005364	Bacteria	2606
164	Ga0070673_100550278	3300005364	Bacteria	1048
165	Ga0070673_100843268	3300005364	Bacteria	848
166	Ga0070688_100003220	3300005365	Bacteria	8366
167	Ga0070688_100185632	3300005365	Bacteria	1445
168	Ga0070659_100015947	3300005366	Bacteria	5635
169	Ga0070659_100016511	3300005366	Bacteria	5543
170	Ga0070659_100137352	3300005366	Bacteria	1988
171	Ga0070659_100336883	3300005366	Bacteria	1263
172	Ga0070659_100670095	3300005366	Bacteria	895
173	Ga0070667_100488077	3300005367	Bacteria	1128
174	Ga0070667_100580919	3300005367	Bacteria	1031
175	Ga0070667_101509777	3300005367	Bacteria	631
176	Ga0070667_101601643	3300005367	Bacteria	612
177	Ga0070667_101726034	3300005367	Bacteria	589
178	Ga0070667_101834516	3300005367	Bacteria	571
179	Ga0070709_10060875	3300005434	Bacteria	2401
180	Ga0070709_10073011	3300005434	Bacteria	2220
181	Ga0070709_10228977	3300005434	Bacteria	1329
182	Ga0070709_10816874	3300005434	Bacteria	733
183	Ga0070709_10868952	3300005434	Unclassified	711
184	Ga0070709_11174952	3300005434	Bacteria	616
185	Ga0070709_11704193	3300005434	Bacteria	515
186	Ga0070709_11716077	3300005434	Bacteria	513
187	Ga0070714_100040834	3300005435	Bacteria	3911
188	Ga0070714_100283463	3300005435	Bacteria	1540
189	Ga0070714_100474855	3300005435	Bacteria	1190
190	Ga0070714_100690735	3300005435	Bacteria	984
191	Ga0070714_101389283	3300005435	Bacteria	686
192	Ga0070714_101433079	3300005435	Bacteria	674
193	Ga0070714_101656914	3300005435	Bacteria	625
194	Ga0070714_101740025	3300005435	Bacteria	609
195	Ga0070713_100003934	3300005436	Bacteria	9865
196	Ga0070713_100009415	3300005436	Bacteria	6993
197	Ga0070713_100069214	3300005436	Bacteria	2976
198	Ga0070713_100085120	3300005436	Bacteria	2707
199	Ga0070713_100141666	3300005436	Bacteria	2130
200	Ga0070713_100250486	3300005436	Bacteria	1615
201	Ga0070713_100320243	3300005436	Bacteria	1432
202	Ga0070713_100519325	3300005436	Bacteria	1125
203	Ga0070710_10001952	3300005437	Bacteria	9765
204	Ga0070710_10033126	3300005437	Bacteria	2804
205	Ga0070710_10042274	3300005437	Bacteria	2519
206	Ga0070710_10225128	3300005437	Bacteria	1195
207	Ga0070710_10670391	3300005437	Bacteria	729
208	Ga0070710_10837659	3300005437	Bacteria	660
209	Ga0070701_10016280	3300005438	Bacteria	3453
210	Ga0070701_10492970	3300005438	Bacteria	794
211	Ga0070711_100031931	3300005439	Bacteria	3499
212	Ga0070711_100046593	3300005439	Bacteria	2955
213	Ga0070711_100286601	3300005439	Bacteria	1305
214	Ga0070711_100505712	3300005439	Bacteria	997
215	Ga0070711_100701386	3300005439	Bacteria	852
216	Ga0070711_100758134	3300005439	Bacteria	821
217	Ga0070711_101043390	3300005439	Bacteria	703
218	Ga0070711_101339017	3300005439	Bacteria	622
219	Ga0070705_100170233	3300005440	Bacteria	1465
220	Ga0070705_100858111	3300005440	Bacteria	727
221	Ga0070694_101873168	3300005444	Bacteria	512
222	Ga0070708_100001577	3300005445	Bacteria	17466
223	Ga0070708_100020736	3300005445	Bacteria	5549
224	Ga0070708_100039485	3300005445	Bacteria	4130
225	Ga0070708_100092563	3300005445	Bacteria	2754
226	Ga0070708_100098504	3300005445	Bacteria	2673
227	Ga0070708_100119178	3300005445	Bacteria	2432
228	Ga0070708_100448592	3300005445	Bacteria	1217
229	Ga0070708_101194068	3300005445	Bacteria	712
230	Ga0070708_101335294	3300005445	Bacteria	669
231	Ga0070663_100010760	3300005455	Bacteria	5712
232	Ga0070663_100188372	3300005455	Bacteria	1605
233	Ga0070663_100300629	3300005455	Bacteria	1284
234	Ga0070663_100381217	3300005455	Bacteria	1148
235	Ga0070663_100450359	3300005455	Bacteria	1061
236	Ga0070663_100929881	3300005455	Bacteria	753
237	Ga0070663_101015470	3300005455	Bacteria	722
238	Ga0070678_100010887	3300005456	Bacteria	5579
239	Ga0070678_100206396	3300005456	Bacteria	1625
240	Ga0070678_100827669	3300005456	Bacteria	842
241	Ga0070678_100985527	3300005456	Bacteria	774
242	Ga0070678_101625787	3300005456	Bacteria	607
243	Ga0070662_100011657	3300005457	Bacteria	5804
244	Ga0070662_100079672	3300005457	Bacteria	2436
245	Ga0070662_100104237	3300005457	Bacteria	2152
246	Ga0070662_100208377	3300005457	Bacteria	1554
247	Ga0070662_100246691	3300005457	Bacteria	1434
248	Ga0070662_100655735	3300005457	Bacteria	886
249	Ga0070681_10011966	3300005458	Bacteria	8603
250	Ga0070681_10026572	3300005458	Bacteria	5818
251	Ga0070681_10048022	3300005458	Bacteria	4266
252	Ga0070681_10085350	3300005458	Bacteria	3109
253	Ga0070681_10109738	3300005458	Bacteria	2699
254	Ga0070681_10115453	3300005458	Bacteria	2623
255	Ga0070681_10154657	3300005458	Bacteria	2219
256	Ga0070681_10805194	3300005458	Bacteria	857
257	Ga0070681_11252303	3300005458	Bacteria	664
258	Ga0068867_100025261	3300005459	Unclassified	4262
259	Ga0068867_100162280	3300005459	Bacteria	1763
260	Ga0068867_100210574	3300005459	Bacteria	1561
261	Ga0068867_101428719	3300005459	Bacteria	642
262	Ga0070685_10000888	3300005466	Bacteria	16115
263	Ga0070685_10103747	3300005466	Bacteria	1740
264	Ga0070685_10481090	3300005466	Bacteria	875
265	Ga0070706_100018240	3300005467	Bacteria	6476
266	Ga0070706_100153563	3300005467	Bacteria	2149
267	Ga0070706_100188489	3300005467	Bacteria	1927
268	Ga0070706_100208226	3300005467	Bacteria	1826
269	Ga0070706_100406358	3300005467	Bacteria	1268
270	Ga0070706_100443662	3300005467	Bacteria	1208
271	Ga0070707_100001982	3300005468	Bacteria	19597
272	Ga0070707_100023559	3300005468	Bacteria	5822
273	Ga0070707_100087462	3300005468	Bacteria	3014
274	Ga0070707_100253013	3300005468	Bacteria	1714
275	Ga0070707_100277923	3300005468	Bacteria	1628
276	Ga0070707_100299122	3300005468	Bacteria	1564
277	Ga0070707_100428713	3300005468	Bacteria	1283
278	Ga0070707_100492567	3300005468	Bacteria	1187
279	Ga0070707_100966192	3300005468	Bacteria	817
280	Ga0070707_101424900	3300005468	Bacteria	659
281	Ga0070698_100009342	3300005471	Bacteria	10514
282	Ga0070698_100292476	3300005471	Bacteria	1560
283	Ga0070698_100682487	3300005471	Bacteria	969
284	Ga0070698_101191523	3300005471	Bacteria	711
285	Ga0070699_100001432	3300005518	Bacteria	21904
286	Ga0070699_100023314	3300005518	Bacteria	5331
287	Ga0070699_100039521	3300005518	Bacteria	4084
288	Ga0070699_100169639	3300005518	Bacteria	1933
289	Ga0070699_100400464	3300005518	Bacteria	1241
290	Ga0070699_101271930	3300005518	Bacteria	675
291	Ga0070699_102101584	3300005518	Bacteria	516
292	Ga0070679_100047747	3300005530	Bacteria	4266
293	Ga0070679_100049320	3300005530	Bacteria	4193
294	Ga0070679_100055346	3300005530	Bacteria	3950
295	Ga0070679_100165244	3300005530	Bacteria	2187
296	Ga0070679_100765336	3300005530	Bacteria	909
297	Ga0070679_100903627	3300005530	Bacteria	826
298	Ga0070684_100001628	3300005535	Bacteria	16241
299	Ga0070684_100012803	3300005535	Bacteria	6737
300	Ga0070684_100548743	3300005535	Bacteria	1072
301	Ga0070684_100687464	3300005535	Bacteria	953
302	Ga0070684_101203207	3300005535	Bacteria	713
303	Ga0070684_101361340	3300005535	Bacteria	668
304	Ga0070697_100000488	3300005536	Bacteria	30188
305	Ga0070697_100003392	3300005536	Bacteria	12254
306	Ga0070697_100015789	3300005536	Bacteria	5931
307	Ga0070697_101197833	3300005536	Bacteria	677
308	Ga0070697_102021976	3300005536	Bacteria	516
309	Ga0068853_100001671	3300005539	Bacteria	16238
310	Ga0068853_100007273	3300005539	Bacteria	8863
311	Ga0068853_100012022	3300005539	Bacteria	7041
312	Ga0068853_100030193	3300005539	Bacteria	4577
313	Ga0068853_100089372	3300005539	Bacteria	2705
314	Ga0068853_100126388	3300005539	Bacteria	2284
315	Ga0068853_100146115	3300005539	Bacteria	2125
316	Ga0068853_100190260	3300005539	Bacteria	1864
317	Ga0068853_101232703	3300005539	Bacteria	722
318	Ga0070672_100055330	3300005543	Bacteria	3108
319	Ga0070672_100545034	3300005543	Bacteria	1007
320	Ga0070686_100023280	3300005544	Unclassified	3700
321	Ga0070686_100149817	3300005544	Bacteria	1633
322	Ga0070686_101051439	3300005544	Bacteria	670
323	Ga0070695_100554437	3300005545	Bacteria	896
324	Ga0070695_101137920	3300005545	Bacteria	640
325	Ga0070696_100001623	3300005546	Bacteria	14751
326	Ga0070696_100162955	3300005546	Bacteria	1644
327	Ga0070696_100245167	3300005546	Bacteria	1353
328	Ga0070696_100298788	3300005546	Bacteria	1232
329	Ga0070696_100532364	3300005546	Bacteria	939
330	Ga0070696_100865012	3300005546	Bacteria	748
331	Ga0070696_101574876	3300005546	Bacteria	564
332	Ga0070693_100002601	3300005547	Bacteria	8310
333	Ga0070693_100003579	3300005547	Bacteria	7250
334	Ga0070693_100046828	3300005547	Bacteria	2458
335	Ga0070693_100165052	3300005547	Bacteria	1414
336	Ga0070693_100210534	3300005547	Bacteria	1268
337	Ga0070693_100599378	3300005547	Bacteria	795
338	Ga0070693_100961424	3300005547	Bacteria	644
339	Ga0070693_101149555	3300005547	Bacteria	594
340	Ga0070693_101571402	3300005547	Bacteria	516
341	Ga0070693_101672055	3300005547	Bacteria	501
342	Ga0070665_100172334	3300005548	Bacteria	2165
343	Ga0070665_100234379	3300005548	Bacteria	1836
344	Ga0070665_100367397	3300005548	Bacteria	1445
345	Ga0070665_100616924	3300005548	Bacteria	1098
346	Ga0070665_102521952	3300005548	Bacteria	515
347	Ga0070704_101592649	3300005549	Bacteria	602
348	Ga0068855_100003012	3300005563	Bacteria	20603
349	Ga0068855_100120157	3300005563	Bacteria	3007
350	Ga0068855_100228767	3300005563	Bacteria	2083
351	Ga0068855_100294872	3300005563	Bacteria	1797
352	Ga0068855_101673535	3300005563	Bacteria	649
353	Ga0070664_100000741	3300005564	Bacteria	25147
354	Ga0070664_100083674	3300005564	Bacteria	2753
355	Ga0070664_100096146	3300005564	Bacteria	2570
356	Ga0070664_100108355	3300005564	Bacteria	2422
357	Ga0070664_100166660	3300005564	Bacteria	1952
358	Ga0070664_100419789	3300005564	Bacteria	1225
359	Ga0070664_101001138	3300005564	Bacteria	785
360	Ga0068857_100012083	3300005577	Bacteria	7508
361	Ga0068857_100042098	3300005577	Bacteria	4051
362	Ga0068857_100081431	3300005577	Bacteria	2891
363	Ga0068857_100093128	3300005577	Bacteria	2698
364	Ga0068857_100169594	3300005577	Bacteria	1983
365	Ga0068857_100362383	3300005577	Bacteria	1344
366	Ga0068857_100454655	3300005577	Bacteria	1198
367	Ga0068854_100028524	3300005578	Bacteria	3858
368	Ga0068854_100067943	3300005578	Unclassified	2598
369	Ga0068854_100070528	3300005578	Bacteria	2554
370	Ga0068854_100247011	3300005578	Bacteria	1423
371	Ga0068854_100333610	3300005578	Bacteria	1236
372	Ga0068854_100360395	3300005578	Bacteria	1193
373	Ga0068854_100812164	3300005578	Bacteria	816
374	Ga0068854_101199204	3300005578	Bacteria	680
375	Ga0068854_101291595	3300005578	Bacteria	657
376	Ga0068856_100031611	3300005614	Bacteria	5180
377	Ga0068856_100034566	3300005614	Bacteria	4950
378	Ga0068856_100123164	3300005614	Bacteria	2595
379	Ga0068856_100162769	3300005614	Bacteria	2242
380	Ga0068856_100316992	3300005614	Bacteria	1577
381	Ga0070702_100046821	3300005615	Unclassified	2453
382	Ga0070702_100086814	3300005615	Bacteria	1888
383	Ga0070702_100311785	3300005615	Bacteria	1093
384	Ga0070702_100360434	3300005615	Bacteria	1027
385	Ga0070702_101565190	3300005615	Bacteria	544
386	Ga0070702_101742694	3300005615	Bacteria	519
387	Ga0068852_100011379	3300005616	Bacteria	6695
388	Ga0068852_100058742	3300005616	Bacteria	3333
389	Ga0068852_100116964	3300005616	Bacteria	2433
390	Ga0068852_100186991	3300005616	Bacteria	1951
391	Ga0068852_100393962	3300005616	Bacteria	1361
392	Ga0068852_100437521	3300005616	Bacteria	1292
393	Ga0068852_102169115	3300005616	Bacteria	577
394	Ga0068859_100022541	3300005617	Bacteria	6316
395	Ga0068859_100707626	3300005617	Bacteria	1098
396	Ga0068859_102428329	3300005617	Bacteria	577
397	Ga0068864_100321461	3300005618	Bacteria	1453
398	Ga0068864_100565326	3300005618	Bacteria	1101
399	Ga0068866_10018617	3300005718	Bacteria	3144
400	Ga0068866_10109454	3300005718	Unclassified	1539
401	Ga0068866_10797920	3300005718	Bacteria	656
402	Ga0068861_100063032	3300005719	Bacteria	2849
403	Ga0068851_10000019	3300005834	Bacteria	135877
404	Ga0068851_10002065	3300005834	Bacteria	8850
405	Ga0068851_10009484	3300005834	Unclassified	4528
406	Ga0068851_10043938	3300005834	Bacteria	2253
407	Ga0068851_10062567	3300005834	Bacteria	1910
408	Ga0068851_11043760	3300005834	Bacteria	517
409	Ga0068870_10003565	3300005840	Bacteria	6598
410	Ga0068863_100043264	3300005841	Bacteria	4276
411	Ga0068863_100046772	3300005841	Bacteria	4107
412	Ga0068863_100630481	3300005841	Bacteria	1062
413	Ga0068863_100796306	3300005841	Bacteria	943
414	Ga0068858_100000940	3300005842	Bacteria	30178
415	Ga0068858_100032974	3300005842	Bacteria	4810
416	Ga0068858_100117391	3300005842	Bacteria	2487
417	Ga0068860_100080630	3300005843	Bacteria	3094
418	Ga0068860_100204525	3300005843	Unclassified	1914
419	Ga0068860_101860948	3300005843	Bacteria	623
420	Ga0068860_102162198	3300005843	Bacteria	577
421	Ga0068862_100002744	3300005844	Bacteria	15457
422	Ga0068862_100013496	3300005844	Bacteria	6765
423	Ga0068862_100101081	3300005844	Bacteria	2522
424	Ga0081455_10147396	3300005937	Bacteria	1818
425	Ga0081538_10111050	3300005981	Bacteria	1346
426	Ga0081540_1063714	3300005983	Bacteria	1743
427	Ga0081540_1092912	3300005983	Bacteria	1323
428	Ga0081539_10184640	3300005985	Bacteria	975
429	Ga0070717_10000047	3300006028	Bacteria	106225
430	Ga0070717_10003516	3300006028	Bacteria	11223
431	Ga0070717_10005479	3300006028	Bacteria	9262
432	Ga0070717_10015655	3300006028	Bacteria	5861
433	Ga0070717_10018069	3300006028	Bacteria	5500
434	Ga0070717_10107944	3300006028	Bacteria	2371
435	Ga0070717_10291342	3300006028	Bacteria	1449
436	Ga0070717_10594655	3300006028	Unclassified	1004
437	Ga0070717_10664023	3300006028	Bacteria	946
438	Ga0070717_10703078	3300006028	Bacteria	918
439	Ga0070717_10871598	3300006028	Bacteria	819
440	Ga0070717_11059338	3300006028	Bacteria	738
441	Ga0075365_11014601	3300006038	Bacteria	585
442	Ga0075365_11067217	3300006038	Bacteria	569
443	Ga0075363_100000215	3300006048	Bacteria	15960
444	Ga0075363_100429621	3300006048	Bacteria	778
445	Ga0075364_10084588	3300006051	Bacteria	2101
446	Ga0075364_10185836	3300006051	Bacteria	1407
447	Ga0075364_10902665	3300006051	Bacteria	601
448	Ga0075364_10969202	3300006051	Bacteria	578
449	Ga0075432_10170318	3300006058	Bacteria	846
450	Ga0070715_10011304	3300006163	Bacteria	3212
451	Ga0070715_10199366	3300006163	Bacteria	1016
452	Ga0070716_100000590	3300006173	Bacteria	15265
453	Ga0070716_100102464	3300006173	Bacteria	1758
454	Ga0070716_100223086	3300006173	Bacteria	1268
455	Ga0070716_100290110	3300006173	Bacteria	1133
456	Ga0070716_100379707	3300006173	Bacteria	1010
457	Ga0070716_100444398	3300006173	Bacteria	944
458	Ga0070716_101011782	3300006173	Bacteria	658
459	Ga0070716_101218460	3300006173	Bacteria	605
460	Ga0070716_101286332	3300006173	Bacteria	591
461	Ga0070712_100028140	3300006175	Bacteria	3757
462	Ga0070712_100259079	3300006175	Bacteria	1393
463	Ga0070712_100515802	3300006175	Bacteria	1004
464	Ga0070712_101196930	3300006175	Bacteria	661
465	Ga0070712_101238096	3300006175	Unclassified	650
466	Ga0070712_101288617	3300006175	Bacteria	636
467	Ga0070712_101764739	3300006175	Bacteria	542
468	Ga0075362_10000026	3300006177	Bacteria	58544
469	Ga0075362_10689157	3300006177	Bacteria	532
470	Ga0075367_10279233	3300006178	Bacteria	1050
471	Ga0075367_10730605	3300006178	Bacteria	630
472	Ga0075369_10038429	3300006186	Bacteria	2042
473	Ga0075369_10475403	3300006186	Bacteria	593
474	Ga0075427_10034136	3300006194	Bacteria	843
475	Ga0075366_10000187	3300006195	Bacteria	27351
476	Ga0075366_10326262	3300006195	Bacteria	941
477	Ga0075366_10699793	3300006195	Bacteria	629
478	Ga0097621_100007053	3300006237	Bacteria	8005
479	Ga0097621_100071743	3300006237	Bacteria	2863
480	Ga0097621_100072360	3300006237	Bacteria	2851
481	Ga0097621_100201409	3300006237	Bacteria	1728
482	Ga0097621_100288371	3300006237	Bacteria	1446
483	Ga0097621_100294772	3300006237	Bacteria	1431
484	Ga0097621_100420048	3300006237	Bacteria	1200
485	Ga0097621_101650386	3300006237	Bacteria	610
486	Ga0075370_10000035	3300006353	Bacteria	42607
487	Ga0075370_11015545	3300006353	Bacteria	508
488	Ga0068871_100018101	3300006358	Bacteria	5348
489	Ga0068871_100021461	3300006358	Bacteria	4964
490	Ga0068871_100054783	3300006358	Bacteria	3236
491	Ga0068871_100152956	3300006358	Bacteria	1968
492	Ga0068871_100155816	3300006358	Bacteria	1950
493	Ga0068871_100316501	3300006358	Bacteria	1373
494	Ga0068871_100393403	3300006358	Bacteria	1233
495	Ga0068871_100413934	3300006358	Bacteria	1202
496	Ga0075428_100035125	3300006844	Bacteria	5527
497	Ga0075428_100038819	3300006844	Bacteria	5240
498	Ga0075428_101767397	3300006844	Bacteria	644
499	Ga0075433_10016225	3300006852	Bacteria	6128
500	Ga0075433_10018873	3300006852	Bacteria	5739
501	Ga0075433_10580980	3300006852	Bacteria	984
502	Ga0075434_100000594	3300006871	Bacteria	27988
503	Ga0075434_100000934	3300006871	Bacteria	23469
504	Ga0075434_100003422	3300006871	Bacteria	14192
505	Ga0075434_100014866	3300006871	Bacteria	7446
506	Ga0075434_100401930	3300006871	Bacteria	1391
507	Ga0075434_100653413	3300006871	Bacteria	1070
508	Ga0075434_100829020	3300006871	Bacteria	941
509	Ga0075429_101709394	3300006880	Bacteria	546
510	Ga0068865_100011703	3300006881	Bacteria	5496
511	Ga0068865_100286707	3300006881	Bacteria	1313
512	Ga0068865_100821761	3300006881	Bacteria	803
513	Ga0075436_100001972	3300006914	Bacteria	14147
514	Ga0075436_100007930	3300006914	Bacteria	7271
515	Ga0075436_100024376	3300006914	Bacteria	4158
516	Ga0075436_100025173	3300006914	Bacteria	4093
517	Ga0075436_100332497	3300006914	Bacteria	1093
518	Ga0075436_100610877	3300006914	Bacteria	804
519	Ga0075436_101312767	3300006914	Bacteria	547
520	Ga0097620_100022541	3300006931	Bacteria	6316
521	Ga0097620_100707504	3300006931	Bacteria	1098
522	Ga0097620_102428315	3300006931	Bacteria	577
523	Ga0099823_1000376	3300006944	Bacteria	28378
524	Ga0099823_1008670	3300006944	Bacteria	10338
525	Ga0099826_10000372	3300006948	Bacteria	20776
526	Ga0075435_100000208	3300007076	Bacteria	35592
527	Ga0075435_100006088	3300007076	Bacteria	8499
528	Ga0075435_100113151	3300007076	Bacteria	2258
529	Ga0075435_100211651	3300007076	Bacteria	1645
530	Ga0075435_100423340	3300007076	Bacteria	1147
531	Ga0075435_100525961	3300007076	Bacteria	1023
532	Ga0099794_10752335	3300007265	Bacteria	520
533	Ga0099795_10423035	3300007788	Bacteria	609
534	Ga0105251_10000123	3300009011	Bacteria	77428
535	Ga0105251_10043744	3300009011	Bacteria	2167
536	Ga0105251_10050875	3300009011	Bacteria	1978
537	Ga0105251_10059144	3300009011	Bacteria	1808
538	Ga0105244_10010350	3300009036	Bacteria	5660
539	Ga0105244_10015391	3300009036	Bacteria	4388
540	Ga0105244_10015842	3300009036	Bacteria	4311
541	Ga0105244_10051025	3300009036	Bacteria	2109
542	Ga0105244_10077459	3300009036	Bacteria	1650
543	Ga0105244_10095751	3300009036	Bacteria	1456
544	Ga0105244_10217361	3300009036	Bacteria	897
545	Ga0105244_10458006	3300009036	Bacteria	587
546	Ga0105244_10575492	3300009036	Bacteria	517
547	Ga0105250_10000254	3300009092	Bacteria	44259
548	Ga0105250_10029806	3300009092	Bacteria	2194
549	Ga0105250_10048269	3300009092	Bacteria	1708
550	Ga0105240_10044964	3300009093	Bacteria	5604
551	Ga0105240_10117121	3300009093	Bacteria	3213
552	Ga0105240_10165320	3300009093	Bacteria	2625
553	Ga0105240_10336613	3300009093	Bacteria	1715
554	Ga0105240_10870042	3300009093	Bacteria	971
555	Ga0105240_10875669	3300009093	Bacteria	968
556	Ga0105240_10879893	3300009093	Bacteria	965
557	Ga0111539_10582226	3300009094	Bacteria	1303
558	Ga0111539_11487241	3300009094	Bacteria	785
559	Ga0111539_12193973	3300009094	Bacteria	641
560	Ga0105245_10017626	3300009098	Bacteria	6234
561	Ga0105245_10114922	3300009098	Unclassified	2507
562	Ga0105245_10652730	3300009098	Bacteria	1082
563	Ga0105245_12399734	3300009098	Bacteria	581
564	Ga0105245_12729068	3300009098	Bacteria	547
565	Ga0105247_10001626	3300009101	Bacteria	15894
566	Ga0105247_10174401	3300009101	Bacteria	1431
567	Ga0105247_10240891	3300009101	Bacteria	1232
568	Ga0105247_11357661	3300009101	Bacteria	573
569	Ga0114129_10028292	3300009147	Bacteria	7941
570	Ga0114129_10171475	3300009147	Bacteria	2958
571	Ga0114129_10564879	3300009147	Bacteria	1478
572	Ga0114129_12796522	3300009147	Bacteria	580
573	Ga0105243_10012630	3300009148	Bacteria	6379
574	Ga0105243_10027778	3300009148	Bacteria	4339
575	Ga0105243_10059887	3300009148	Bacteria	3040
576	Ga0105243_10162156	3300009148	Bacteria	1929
577	Ga0105243_10347269	3300009148	Bacteria	1361
578	Ga0105243_12585106	3300009148	Bacteria	547
579	Ga0105243_12602966	3300009148	Bacteria	546
580	Ga0105241_10015494	3300009174	Bacteria	5586
581	Ga0105241_10055910	3300009174	Bacteria	3024
582	Ga0105241_10068216	3300009174	Bacteria	2755
583	Ga0105241_10093194	3300009174	Bacteria	2380
584	Ga0105241_10153877	3300009174	Bacteria	1884
585	Ga0105241_10267538	3300009174	Bacteria	1455
586	Ga0105241_10312244	3300009174	Bacteria	1353
587	Ga0105241_10454941	3300009174	Bacteria	1133
588	Ga0105241_10589555	3300009174	Bacteria	1003
589	Ga0105241_11536059	3300009174	Bacteria	642
590	Ga0105241_12209041	3300009174	Bacteria	546
591	Ga0105242_10001061	3300009176	Bacteria	21612
592	Ga0105242_10037301	3300009176	Unclassified	3903
593	Ga0105242_10312989	3300009176	Bacteria	1437
594	Ga0105242_10917073	3300009176	Bacteria	877
595	Ga0105242_12241925	3300009176	Bacteria	592
596	Ga0105248_10074642	3300009177	Bacteria	3812
597	Ga0105248_10101151	3300009177	Unclassified	3249
598	Ga0105248_10116081	3300009177	Bacteria	3019
599	Ga0105248_10421360	3300009177	Bacteria	1503
600	Ga0105248_10447137	3300009177	Bacteria	1456
601	Ga0105248_11311776	3300009177	Bacteria	819
602	Ga0105248_11773730	3300009177	Bacteria	700
603	Ga0105237_10002041	3300009545	Bacteria	25677
604	Ga0105237_10017049	3300009545	Bacteria	7538
605	Ga0105237_10045048	3300009545	Bacteria	4441
606	Ga0105237_10079744	3300009545	Bacteria	3264
607	Ga0105237_10095020	3300009545	Bacteria	2970
608	Ga0105237_10276200	3300009545	Bacteria	1683
609	Ga0105237_10568256	3300009545	Bacteria	1141
610	Ga0105237_10572067	3300009545	Bacteria	1137
611	Ga0105238_10009103	3300009551	Bacteria	9937
612	Ga0105238_10012750	3300009551	Bacteria	8486
613	Ga0105238_10072059	3300009551	Bacteria	3452
614	Ga0105238_10516092	3300009551	Bacteria	1197
615	Ga0105238_11599198	3300009551	Bacteria	682
616	Ga0105238_12184900	3300009551	Bacteria	588
617	Ga0105249_10068709	3300009553	Unclassified	3268
618	Ga0105249_10983299	3300009553	Bacteria	912
619	Ga0105249_11685673	3300009553	Bacteria	706
620	Ga0105249_13351060	3300009553	Bacteria	516
621	Ga0105028_105122	3300009993	Bacteria	1360
622	Ga0099796_10427190	3300010159	Bacteria	585
623	Ga0105239_10006319	3300010375	Bacteria	13785
624	Ga0105239_10007373	3300010375	Bacteria	12635
625	Ga0105239_10014032	3300010375	Bacteria	8894
626	Ga0105239_10028030	3300010375	Bacteria	6198
627	Ga0105239_10125770	3300010375	Bacteria	2849
628	Ga0105239_10526194	3300010375	Bacteria	1345
629	Ga0105239_10879991	3300010375	Bacteria	1028
630	Ga0105239_11003877	3300010375	Bacteria	959
631	Ga0105239_11074504	3300010375	Bacteria	926
632	Ga0105246_10025608	3300011119	Unclassified	3846
633	Ga0105246_10087205	3300011119	Bacteria	2240
634	Ga0105246_10487073	3300011119	Bacteria	1044
635	Ga0157318_1002084	3300012482	Bacteria	1060
636	Ga0157318_1034626	3300012482	Bacteria	515
637	Ga0157341_1009120	3300012494	Bacteria	821
638	Ga0157347_1034727	3300012502	Bacteria	645
639	Ga0157347_1046081	3300012502	Bacteria	589
640	Ga0157326_1028892	3300012513	Bacteria	724
641	Ga0157373_10034513	3300013100	Bacteria	3633
642	Ga0157373_10047843	3300013100	Bacteria	3050
643	Ga0157373_10052875	3300013100	Bacteria	2888
644	Ga0157373_10074378	3300013100	Bacteria	2397
645	Ga0157373_10119374	3300013100	Bacteria	1853
646	Ga0157373_10124806	3300013100	Bacteria	1810
647	Ga0157373_10197231	3300013100	Bacteria	1419
648	Ga0157373_10269288	3300013100	Bacteria	1206
649	Ga0157373_10788707	3300013100	Bacteria	700
650	Ga0157373_10857757	3300013100	Bacteria	672
651	Ga0157373_10991395	3300013100	Bacteria	627
652	Ga0157371_10000311	3300013102	Bacteria	63402
653	Ga0157371_10019689	3300013102	Bacteria	4970
654	Ga0157371_10028700	3300013102	Bacteria	4028
655	Ga0157371_10061733	3300013102	Bacteria	2657
656	Ga0157371_10079057	3300013102	Bacteria	2330
657	Ga0157371_10156471	3300013102	Bacteria	1627
658	Ga0157371_10206585	3300013102	Bacteria	1409
659	Ga0157371_10423407	3300013102	Bacteria	976
660	Ga0157371_10468856	3300013102	Bacteria	927
661	Ga0157370_10009913	3300013104	Bacteria	10094
662	Ga0157370_10058147	3300013104	Bacteria	3675
663	Ga0157370_10156026	3300013104	Bacteria	2124
664	Ga0157370_10283606	3300013104	Bacteria	1530
665	Ga0157370_10292904	3300013104	Bacteria	1503
666	Ga0157370_10331043	3300013104	Bacteria	1404
667	Ga0157370_10334111	3300013104	Bacteria	1397
668	Ga0157370_10587039	3300013104	Bacteria	1021
669	Ga0157370_11818812	3300013104	Bacteria	547
670	Ga0157369_10013112	3300013105	Bacteria	9380
671	Ga0157369_10031364	3300013105	Bacteria	5852
672	Ga0157369_10119332	3300013105	Bacteria	2799
673	Ga0157369_10140359	3300013105	Unclassified	2557
674	Ga0157369_10165135	3300013105	Bacteria	2336
675	Ga0157369_10187071	3300013105	Bacteria	2177
676	Ga0157369_10366896	3300013105	Bacteria	1495
677	Ga0157369_10497166	3300013105	Bacteria	1262
678	Ga0157369_10883319	3300013105	Bacteria	917
679	Ga0157369_11367670	3300013105	Bacteria	721
680	Ga0157369_12432511	3300013105	Bacteria	530
681	Ga0157374_10006067	3300013296	Bacteria	10229
682	Ga0157374_10024568	3300013296	Bacteria	5404
683	Ga0157374_10053813	3300013296	Bacteria	3753
684	Ga0157374_10147251	3300013296	Unclassified	2288
685	Ga0157374_11986834	3300013296	Bacteria	608
686	Ga0157374_12126751	3300013296	Bacteria	588
687	Ga0157378_10024794	3300013297	Bacteria	5281
688	Ga0157378_10082362	3300013297	Bacteria	2909
689	Ga0157378_10084730	3300013297	Bacteria	2870
690	Ga0157378_10796958	3300013297	Bacteria	970
691	Ga0157378_11513120	3300013297	Bacteria	716
692	Ga0157378_11586589	3300013297	Bacteria	700
693	Ga0163162_10020829	3300013306	Bacteria	6446
694	Ga0163162_10075935	3300013306	Unclassified	3421
695	Ga0163162_10255111	3300013306	Bacteria	1886
696	Ga0163162_10321584	3300013306	Bacteria	1679
697	Ga0163162_12901263	3300013306	Bacteria	552
698	Ga0157372_10000274	3300013307	Bacteria	57253
699	Ga0157372_10000640	3300013307	Bacteria	38414
700	Ga0157372_10043267	3300013307	Bacteria	4985
701	Ga0157372_10101166	3300013307	Bacteria	3290
702	Ga0157372_10218600	3300013307	Bacteria	2209
703	Ga0157372_10239647	3300013307	Bacteria	2104
704	Ga0157372_10250519	3300013307	Bacteria	2056
705	Ga0157372_10333179	3300013307	Bacteria	1767
706	Ga0157372_10506829	3300013307	Bacteria	1407
707	Ga0157372_10678275	3300013307	Bacteria	1199
708	Ga0157372_12432383	3300013307	Bacteria	601
709	Ga0157375_10285614	3300013308	Bacteria	1813
710	Ga0163163_10002860	3300014325	Bacteria	14598
711	Ga0163163_10077542	3300014325	Bacteria	3318
712	Ga0163163_10114751	3300014325	Bacteria	2725
713	Ga0163163_11544294	3300014325	Bacteria	725
714	Ga0157380_10204262	3300014326	Bacteria	1755
715	Ga0182008_10008768	3300014497	Bacteria	5496
716	Ga0182008_10013055	3300014497	Bacteria	4370
717	Ga0157377_10002085	3300014745	Bacteria	8788
718	Ga0157377_10060887	3300014745	Bacteria	2156
719	Ga0157379_10296364	3300014968	Bacteria	1473
720	Ga0157379_10914777	3300014968	Bacteria	833
721	Ga0157379_10960517	3300014968	Bacteria	813
722	Ga0157379_12204602	3300014968	Bacteria	547
723	Ga0157376_10055012	3300014969	Bacteria	3319
724	Ga0157376_10107521	3300014969	Bacteria	2449
725	Ga0157376_10155049	3300014969	Bacteria	2070
726	Ga0157376_10409558	3300014969	Bacteria	1313
727	Ga0157376_10468881	3300014969	Bacteria	1232
728	Ga0157376_10584179	3300014969	Bacteria	1110
729	Ga0157376_11629200	3300014969	Bacteria	680
730	Ga0157376_11800377	3300014969	Bacteria	648
731	Ga0182006_1000514	3300015261	Bacteria	29491
732	Ga0182006_1003926	3300015261	Bacteria	7445
733	Ga0182006_1013796	3300015261	Bacteria	3496
734	Ga0182007_10004310	3300015262	Bacteria	6476
735	Ga0182007_10157932	3300015262	Bacteria	774
736	Ga0182005_1014387	3300015265	Bacteria	2213
737	Ga0182005_1290424	3300015265	Bacteria	514
738	Ga0183369_1009	3300015685	Bacteria	346348
739	Ga0163161_10005387	3300017792	Bacteria	8890
740	Ga0163161_10023952	3300017792	Unclassified	4309
741	Ga0163161_10025004	3300017792	Bacteria	4222
742	Ga0163161_10104934	3300017792	Bacteria	2107
743	Ga0163161_10379286	3300017792	Bacteria	1130
744	Ga0184596_118748	3300019176	Bacteria	510
745	Ga0197907_10236480	3300020069	Bacteria	929
746	Ga0197907_10672939	3300020069	Bacteria	809
747	Ga0206356_11039573	3300020070	Bacteria	4101
748	Ga0206356_11678499	3300020070	Bacteria	503
749	Ga0206349_1698478	3300020075	Bacteria	739
750	Ga0206351_10324362	3300020077	Bacteria	595
751	Ga0206350_10000740	3300020080	Bacteria	1818
752	Ga0206353_10292816	3300020082	Bacteria	2603
753	Ga0206353_11578131	3300020082	Bacteria	3600
754	Ga0154015_1305770	3300020610	Bacteria	6608
755	Ga0154015_1500108	3300020610	Bacteria	591
756	Ga0213873_10034439	3300021358	Bacteria	1276
757	Ga0213874_10459831	3300021377	Bacteria	504
758	Ga0213875_10441551	3300021388	Bacteria	622
759	Ga0224569_100622	3300022732	Bacteria	3053
760	Ga0224569_101242	3300022732	Bacteria	2163
761	Ga0224571_105378	3300022734	Bacteria	840
762	Ga0256744_118603	3300023309	Bacteria	573
763	Ga0224572_1009106	3300024225	Bacteria	1847
764	Ga0224572_1061411	3300024225	Bacteria	695
765	Ga0224572_1109384	3300024225	Bacteria	512
766	Ga0228598_1001223	3300024227	Bacteria	5673
767	Ga0228598_1002814	3300024227	Bacteria	3772
768	Ga0209435_100393	3300025206	Bacteria	9481
769	Ga0209760_100099	3300025207	Bacteria	66726
770	Ga0209760_100111	3300025207	Bacteria	57882
771	Ga0209784_100015	3300025224	Bacteria	482117
772	Ga0209566_100012	3300025225	Bacteria	482281
773	Ga0209674_100027	3300025226	Bacteria	482281
774	Ga0209674_100519	3300025226	Bacteria	15666
775	Ga0209147_100019	3300025229	Bacteria	482139
776	Ga0209563_100031	3300025230	Bacteria	482281
777	Ga0207427_100001	3300025231	Bacteria	1410763
778	Ga0207427_100029	3300025231	Bacteria	376678
779	Ga0207427_100119	3300025231	Bacteria	101986
780	Ga0207427_100141	3300025231	Bacteria	83903
781	Ga0209437_100003	3300025233	Bacteria	1517827
782	Ga0209437_100005	3300025233	Bacteria	1071596
783	Ga0209437_100009	3300025233	Bacteria	915954
784	Ga0209437_100253	3300025233	Bacteria	83916
785	Ga0209258_100824	3300025242	Bacteria	17348
786	Ga0209258_108474	3300025242	Bacteria	1443
787	Ga0209646_1000220	3300025246	Bacteria	61752
788	Ga0209026_1000113	3300025250	Bacteria	139047
789	Ga0209677_100016	3300025253	Bacteria	482117
790	Ga0209759_1005930	3300025256	Bacteria	4175
791	Ga0209759_1007370	3300025256	Bacteria	3547
792	Ga0209759_1029468	3300025256	Bacteria	1098
793	Ga0209233_1000007	3300025261	Bacteria	1411234
794	Ga0209233_1000011	3300025261	Bacteria	1071611
795	Ga0209233_1000032	3300025261	Bacteria	623596
796	Ga0209233_1000046	3300025261	Bacteria	470971
797	Ga0207673_1007725	3300025290	Bacteria	1353
798	Ga0209676_1000016	3300025292	Bacteria	655561
799	Ga0209676_1000080	3300025292	Bacteria	287400
800	Ga0209676_1000086	3300025292	Bacteria	264155
801	Ga0209676_1000231	3300025292	Bacteria	120750
802	Ga0209676_1002984	3300025292	Bacteria	11009
803	Ga0209758_1031630	3300025297	Bacteria	2167
804	Ga0209050_1000117	3300025298	Bacteria	202979
805	Ga0209050_1001895	3300025298	Bacteria	20032
806	Ga0209050_1036452	3300025298	Bacteria	1435
807	Ga0209051_1000077	3300025303	Bacteria	202959
808	Ga0209051_1030544	3300025303	Bacteria	2089
809	Ga0209257_1000251	3300025304	Bacteria	123796
810	Ga0209257_1000342	3300025304	Bacteria	97045
811	Ga0209257_1000704	3300025304	Bacteria	51740
812	Ga0207697_10065320	3300025315	Bacteria	1518
813	Ga0207697_10072008	3300025315	Bacteria	1449
814	Ga0207656_10000042	3300025321	Bacteria	53832
815	Ga0207656_10030327	3300025321	Bacteria	2233
816	Ga0207656_10054038	3300025321	Bacteria	1745
817	Ga0207656_10147183	3300025321	Bacteria	1113
818	Ga0207656_10161253	3300025321	Bacteria	1067
819	Ga0207656_10383706	3300025321	Bacteria	705
820	Ga0207696_1000018	3300025711	Bacteria	478605
821	Ga0207696_1000022	3300025711	Bacteria	427529
822	Ga0207696_1000044	3300025711	Bacteria	300953
823	Ga0207696_1000063	3300025711	Bacteria	239123
824	Ga0207696_1006387	3300025711	Bacteria	4757
825	Ga0207696_1067735	3300025711	Bacteria	996
826	Ga0207655_1000021	3300025728	Bacteria	518596
827	Ga0207655_1000399	3300025728	Bacteria	60374
828	Ga0207655_1002739	3300025728	Bacteria	13759
829	Ga0207655_1002946	3300025728	Bacteria	13085
830	Ga0207655_1003971	3300025728	Bacteria	10699
831	Ga0207655_1004743	3300025728	Bacteria	9498
832	Ga0207655_1010619	3300025728	Bacteria	5567
833	Ga0207655_1021881	3300025728	Bacteria	3227
834	Ga0207655_1035804	3300025728	Bacteria	2210
835	Ga0207655_1037962	3300025728	Bacteria	2113
836	Ga0207655_1049084	3300025728	Bacteria	1727
837	Ga0207655_1054381	3300025728	Bacteria	1592
838	Ga0207655_1064963	3300025728	Bacteria	1388
839	Ga0207713_1000085	3300025735	Bacteria	160800
840	Ga0207713_1000230	3300025735	Bacteria	74936
841	Ga0207713_1000338	3300025735	Bacteria	51882
842	Ga0207713_1000697	3300025735	Bacteria	31485
843	Ga0207713_1002966	3300025735	Bacteria	11859
844	Ga0207713_1011272	3300025735	Bacteria	4875
845	Ga0207713_1016774	3300025735	Bacteria	3705
846	Ga0207713_1043167	3300025735	Bacteria	1865
847	Ga0207713_1077233	3300025735	Bacteria	1210
848	Ga0207713_1105716	3300025735	Bacteria	964
849	Ga0207713_1122472	3300025735	Bacteria	870
850	Ga0207682_10513034	3300025893	Bacteria	567
851	Ga0207692_10005309	3300025898	Bacteria	5153
852	Ga0207692_10031714	3300025898	Bacteria	2533
853	Ga0207692_10143584	3300025898	Bacteria	1360
854	Ga0207692_10379305	3300025898	Unclassified	877
855	Ga0207692_10547083	3300025898	Bacteria	739
856	Ga0207692_10639874	3300025898	Bacteria	686
857	Ga0207692_11215276	3300025898	Bacteria	501
858	Ga0207642_10021562	3300025899	Bacteria	2538
859	Ga0207642_10381382	3300025899	Bacteria	839
860	Ga0207710_10066537	3300025900	Bacteria	1644
861	Ga0207710_10306694	3300025900	Bacteria	803
862	Ga0207688_10024335	3300025901	Bacteria	3320
863	Ga0207688_10196857	3300025901	Bacteria	1207
864	Ga0207680_10005063	3300025903	Bacteria	6277
865	Ga0207680_10072290	3300025903	Unclassified	2141
866	Ga0207680_11361855	3300025903	Bacteria	504
867	Ga0207647_10001631	3300025904	Bacteria	17243
868	Ga0207647_10001634	3300025904	Bacteria	17228
869	Ga0207647_10011761	3300025904	Bacteria	6122
870	Ga0207647_10267584	3300025904	Bacteria	977
871	Ga0207647_10332931	3300025904	Bacteria	861
872	Ga0207647_10799759	3300025904	Bacteria	507
873	Ga0207685_10003197	3300025905	Bacteria	3938
874	Ga0207685_10244266	3300025905	Bacteria	865
875	Ga0207685_10821893	3300025905	Bacteria	513
876	Ga0207699_10019452	3300025906	Bacteria	3622
877	Ga0207699_10023858	3300025906	Bacteria	3335
878	Ga0207699_10191143	3300025906	Bacteria	1382
879	Ga0207699_10506736	3300025906	Bacteria	872
880	Ga0207645_10000038	3300025907	Bacteria	88349
881	Ga0207645_10378031	3300025907	Bacteria	950
882	Ga0207645_11188000	3300025907	Bacteria	512
883	Ga0207643_10015886	3300025908	Unclassified	4101
884	Ga0207705_10000146	3300025909	Bacteria	75353
885	Ga0207705_10000373	3300025909	Bacteria	40446
886	Ga0207705_10000900	3300025909	Bacteria	24321
887	Ga0207705_10007781	3300025909	Bacteria	7870
888	Ga0207705_10031894	3300025909	Bacteria	3764
889	Ga0207705_10038764	3300025909	Bacteria	3413
890	Ga0207705_10135171	3300025909	Bacteria	1837
891	Ga0207705_11013084	3300025909	Bacteria	641
892	Ga0207684_10000641	3300025910	Bacteria	41415
893	Ga0207684_10000716	3300025910	Bacteria	39003
894	Ga0207684_10014829	3300025910	Bacteria	6707
895	Ga0207684_10077034	3300025910	Unclassified	2835
896	Ga0207684_10080207	3300025910	Unclassified	2776
897	Ga0207684_10433818	3300025910	Bacteria	1129
898	Ga0207684_10521845	3300025910	Bacteria	1017
899	Ga0207654_10024569	3300025911	Bacteria	3241
900	Ga0207654_10059248	3300025911	Bacteria	2232
901	Ga0207654_10307108	3300025911	Bacteria	1080
902	Ga0207654_10442756	3300025911	Bacteria	910
903	Ga0207654_10568096	3300025911	Bacteria	807
904	Ga0207654_10760011	3300025911	Bacteria	699
905	Ga0207654_10916707	3300025911	Bacteria	636
906	Ga0207654_11064550	3300025911	Bacteria	589
907	Ga0207654_11118415	3300025911	Bacteria	574
908	Ga0207707_10000215	3300025912	Bacteria	61846
909	Ga0207707_10000725	3300025912	Bacteria	32573
910	Ga0207707_10000844	3300025912	Bacteria	30022
911	Ga0207707_10001158	3300025912	Bacteria	25008
912	Ga0207707_10001457	3300025912	Bacteria	21870
913	Ga0207707_10017431	3300025912	Bacteria	6261
914	Ga0207707_10026497	3300025912	Bacteria	5067
915	Ga0207707_10032018	3300025912	Bacteria	4603
916	Ga0207707_10037788	3300025912	Bacteria	4218
917	Ga0207707_10099756	3300025912	Bacteria	2538
918	Ga0207707_10728454	3300025912	Bacteria	831
919	Ga0207707_11439576	3300025912	Bacteria	548
920	Ga0207695_10006716	3300025913	Bacteria	14851
921	Ga0207695_10008344	3300025913	Bacteria	12977
922	Ga0207695_10061610	3300025913	Bacteria	3877
923	Ga0207695_10062723	3300025913	Bacteria	3836
924	Ga0207695_10195489	3300025913	Bacteria	1939
925	Ga0207695_11330652	3300025913	Bacteria	599
926	Ga0207695_11429238	3300025913	Bacteria	572
927	Ga0207695_11540309	3300025913	Bacteria	545
928	Ga0207671_10000420	3300025914	Bacteria	58883
929	Ga0207671_10050237	3300025914	Bacteria	3088
930	Ga0207671_10228873	3300025914	Bacteria	1458
931	Ga0207671_10231114	3300025914	Bacteria	1451
932	Ga0207671_10349891	3300025914	Bacteria	1172
933	Ga0207671_10574978	3300025914	Bacteria	898
934	Ga0207671_10890401	3300025914	Unclassified	704
935	Ga0207671_11242464	3300025914	Bacteria	582
936	Ga0207693_10002686	3300025915	Bacteria	15438
937	Ga0207693_10054800	3300025915	Bacteria	3127
938	Ga0207693_10417497	3300025915	Bacteria	1049
939	Ga0207693_11000275	3300025915	Bacteria	638
940	Ga0207693_11331860	3300025915	Bacteria	536
941	Ga0207663_10101704	3300025916	Bacteria	1931
942	Ga0207663_10240896	3300025916	Bacteria	1327
943	Ga0207663_10244537	3300025916	Bacteria	1317
944	Ga0207663_10325555	3300025916	Bacteria	1156
945	Ga0207663_10491766	3300025916	Bacteria	952
946	Ga0207663_11059641	3300025916	Bacteria	651
947	Ga0207660_10001193	3300025917	Bacteria	17439
948	Ga0207660_10002237	3300025917	Bacteria	12792
949	Ga0207660_10003750	3300025917	Bacteria	9893
950	Ga0207660_10012254	3300025917	Bacteria	5604
951	Ga0207660_10022199	3300025917	Bacteria	4275
952	Ga0207660_10061422	3300025917	Bacteria	2704
953	Ga0207660_10158367	3300025917	Bacteria	1745
954	Ga0207660_10231189	3300025917	Bacteria	1454
955	Ga0207660_10386727	3300025917	Bacteria	1125
956	Ga0207660_10870328	3300025917	Bacteria	735
957	Ga0207662_10001578	3300025918	Bacteria	11156
958	Ga0207662_10171220	3300025918	Bacteria	1392
959	Ga0207657_10000363	3300025919	Bacteria	47701
960	Ga0207657_10006033	3300025919	Bacteria	12598
961	Ga0207657_10029481	3300025919	Bacteria	4993
962	Ga0207657_10058734	3300025919	Bacteria	3308
963	Ga0207657_10091708	3300025919	Bacteria	2533
964	Ga0207649_10000002	3300025920	Bacteria	498633
965	Ga0207649_10000270	3300025920	Bacteria	41068
966	Ga0207649_10002626	3300025920	Bacteria	9976
967	Ga0207649_10016518	3300025920	Bacteria	4165
968	Ga0207649_10061227	3300025920	Bacteria	2368
969	Ga0207649_10063223	3300025920	Bacteria	2336
970	Ga0207649_10153798	3300025920	Bacteria	1587
971	Ga0207649_10333109	3300025920	Bacteria	1118
972	Ga0207652_10000409	3300025921	Bacteria	44486
973	Ga0207652_10001049	3300025921	Bacteria	25253
974	Ga0207652_10002979	3300025921	Bacteria	14151
975	Ga0207652_10003256	3300025921	Bacteria	13462
976	Ga0207652_10003709	3300025921	Bacteria	12539
977	Ga0207652_10018777	3300025921	Bacteria	5675
978	Ga0207652_10040309	3300025921	Bacteria	3966
979	Ga0207652_10214193	3300025921	Bacteria	1735
980	Ga0207652_10351926	3300025921	Bacteria	1329
981	Ga0207652_10811616	3300025921	Bacteria	830
982	Ga0207646_10000463	3300025922	Bacteria	54224
983	Ga0207646_10002779	3300025922	Bacteria	20442
984	Ga0207646_10059849	3300025922	Bacteria	3401
985	Ga0207646_10072177	3300025922	Bacteria	3083
986	Ga0207646_10301202	3300025922	Bacteria	1448
987	Ga0207646_10327773	3300025922	Bacteria	1383
988	Ga0207646_10622998	3300025922	Bacteria	968
989	Ga0207646_10744890	3300025922	Bacteria	874
990	Ga0207681_10000815	3300025923	Bacteria	20503
991	Ga0207681_10056945	3300025923	Bacteria	2668
992	Ga0207681_10672713	3300025923	Bacteria	859
993	Ga0207694_10014106	3300025924	Bacteria	6024
994	Ga0207694_10014405	3300025924	Bacteria	5960
995	Ga0207694_10020487	3300025924	Bacteria	5003
996	Ga0207694_10061900	3300025924	Bacteria	2913
997	Ga0207694_10112418	3300025924	Bacteria	2167
998	Ga0207694_11153904	3300025924	Bacteria	656
999	Ga0207694_11470911	3300025924	Bacteria	575
1000	Ga0207650_10000122	3300025925	Bacteria	99309
1001	Ga0207650_10000606	3300025925	Bacteria	28719
1002	Ga0207650_11585971	3300025925	Bacteria	556
1003	Ga0207659_10068914	3300025926	Bacteria	2574
1004	Ga0207659_11264548	3300025926	Bacteria	634
1005	Ga0207659_11539338	3300025926	Bacteria	568
1006	Ga0207687_10048003	3300025927	Unclassified	2962
1007	Ga0207687_10092933	3300025927	Unclassified	2204
1008	Ga0207687_10493349	3300025927	Bacteria	1021
1009	Ga0207700_10003011	3300025928	Bacteria	9713
1010	Ga0207700_10009203	3300025928	Bacteria	6159
1011	Ga0207700_10014363	3300025928	Bacteria	5187
1012	Ga0207700_10562522	3300025928	Bacteria	1013
1013	Ga0207700_10739256	3300025928	Bacteria	879
1014	Ga0207664_10000173	3300025929	Bacteria	50497
1015	Ga0207664_10000797	3300025929	Bacteria	21307
1016	Ga0207664_10274928	3300025929	Bacteria	1476
1017	Ga0207664_10292267	3300025929	Bacteria	1432
1018	Ga0207664_10856392	3300025929	Bacteria	817
1019	Ga0207664_10879986	3300025929	Bacteria	805
1020	Ga0207664_11032711	3300025929	Bacteria	736
1021	Ga0207664_11222304	3300025929	Bacteria	670
1022	Ga0207644_10007908	3300025931	Bacteria	6953
1023	Ga0207644_10194591	3300025931	Bacteria	1596
1024	Ga0207690_10006035	3300025932	Bacteria	7180
1025	Ga0207690_10006042	3300025932	Bacteria	7175
1026	Ga0207690_10009879	3300025932	Bacteria	5668
1027	Ga0207690_10010804	3300025932	Bacteria	5441
1028	Ga0207690_10015893	3300025932	Unclassified	4570
1029	Ga0207690_10045459	3300025932	Bacteria	2901
1030	Ga0207690_10099409	3300025932	Bacteria	2074
1031	Ga0207690_10592675	3300025932	Bacteria	904
1032	Ga0207690_10634554	3300025932	Bacteria	874
1033	Ga0207690_10996475	3300025932	Bacteria	697
1034	Ga0207690_11623266	3300025932	Bacteria	540
1035	Ga0207706_10002981	3300025933	Bacteria	16335
1036	Ga0207706_10004930	3300025933	Bacteria	12464
1037	Ga0207706_10020025	3300025933	Bacteria	6011
1038	Ga0207706_10029250	3300025933	Bacteria	4919
1039	Ga0207706_10130605	3300025933	Bacteria	2209
1040	Ga0207706_11245368	3300025933	Bacteria	617
1041	Ga0207686_10022071	3300025934	Bacteria	3661
1042	Ga0207686_10223477	3300025934	Bacteria	1361
1043	Ga0207686_10224301	3300025934	Bacteria	1359
1044	Ga0207686_10411394	3300025934	Bacteria	1033
1045	Ga0207686_10868519	3300025934	Bacteria	726
1046	Ga0207709_10000036	3300025935	Bacteria	292568
1047	Ga0207709_10011641	3300025935	Bacteria	4850
1048	Ga0207709_10048403	3300025935	Bacteria	2590
1049	Ga0207709_11125073	3300025935	Bacteria	645
1050	Ga0207709_11452816	3300025935	Bacteria	568
1051	Ga0207670_10285787	3300025936	Bacteria	1287
1052	Ga0207670_10656502	3300025936	Bacteria	865
1053	Ga0207670_11938490	3300025936	Bacteria	501
1054	Ga0207669_10187106	3300025937	Bacteria	1490
1055	Ga0207669_10796952	3300025937	Bacteria	783
1056	Ga0207704_10035346	3300025938	Bacteria	2862
1057	Ga0207704_10061288	3300025938	Bacteria	2333
1058	Ga0207704_10353225	3300025938	Bacteria	1145
1059	Ga0207704_10767736	3300025938	Bacteria	803
1060	Ga0207665_10001443	3300025939	Bacteria	15988
1061	Ga0207665_10080379	3300025939	Bacteria	2242
1062	Ga0207665_10165237	3300025939	Bacteria	1595
1063	Ga0207665_10314033	3300025939	Bacteria	1174
1064	Ga0207665_10550220	3300025939	Bacteria	897
1065	Ga0207665_10742699	3300025939	Bacteria	773
1066	Ga0207665_10929675	3300025939	Bacteria	690
1067	Ga0207691_10000912	3300025940	Bacteria	29285
1068	Ga0207691_10348692	3300025940	Bacteria	1267
1069	Ga0207711_10012585	3300025941	Bacteria	7027
1070	Ga0207711_10079195	3300025941	Bacteria	2868
1071	Ga0207711_10688456	3300025941	Bacteria	953
1072	Ga0207711_10997716	3300025941	Bacteria	777
1073	Ga0207711_11413950	3300025941	Bacteria	638
1074	Ga0207689_10000658	3300025942	Bacteria	32969
1075	Ga0207689_10001175	3300025942	Bacteria	25227
1076	Ga0207689_10967154	3300025942	Bacteria	718
1077	Ga0207689_11090928	3300025942	Bacteria	673
1078	Ga0207661_10009672	3300025944	Bacteria	6923
1079	Ga0207661_10011167	3300025944	Bacteria	6496
1080	Ga0207661_10013654	3300025944	Bacteria	5930
1081	Ga0207661_10028633	3300025944	Bacteria	4268
1082	Ga0207661_10031283	3300025944	Bacteria	4108
1083	Ga0207661_10040881	3300025944	Bacteria	3647
1084	Ga0207661_10584157	3300025944	Bacteria	1025
1085	Ga0207679_10000006	3300025945	Bacteria	498868
1086	Ga0207679_10000070	3300025945	Bacteria	91501
1087	Ga0207679_10004131	3300025945	Bacteria	9017
1088	Ga0207679_10022509	3300025945	Bacteria	4293
1089	Ga0207679_10089598	3300025945	Bacteria	2375
1090	Ga0207679_10142002	3300025945	Bacteria	1942
1091	Ga0207679_10321412	3300025945	Bacteria	1340
1092	Ga0207679_10409545	3300025945	Bacteria	1194
1093	Ga0207679_11178500	3300025945	Bacteria	703
1094	Ga0207679_11977257	3300025945	Bacteria	531
1095	Ga0207667_10000493	3300025949	Bacteria	52083
1096	Ga0207667_10005511	3300025949	Bacteria	15434
1097	Ga0207667_10006956	3300025949	Bacteria	13673
1098	Ga0207667_10007043	3300025949	Bacteria	13586
1099	Ga0207667_10008317	3300025949	Bacteria	12343
1100	Ga0207667_10015711	3300025949	Bacteria	8586
1101	Ga0207667_10021898	3300025949	Bacteria	7074
1102	Ga0207667_10111418	3300025949	Bacteria	2823
1103	Ga0207667_10121817	3300025949	Bacteria	2687
1104	Ga0207667_10123847	3300025949	Bacteria	2663
1105	Ga0207667_10312291	3300025949	Bacteria	1606
1106	Ga0207667_10323404	3300025949	Bacteria	1575
1107	Ga0207651_10001089	3300025960	Bacteria	12053
1108	Ga0207712_10030606	3300025961	Bacteria	3620
1109	Ga0207712_10230467	3300025961	Bacteria	1486
1110	Ga0207712_10323871	3300025961	Bacteria	1273
1111	Ga0207668_10012963	3300025972	Bacteria	5122
1112	Ga0207668_10165032	3300025972	Bacteria	1730
1113	Ga0207668_10303565	3300025972	Bacteria	1318
1114	Ga0207668_11603863	3300025972	Bacteria	587
1115	Ga0207668_12154892	3300025972	Bacteria	502
1116	Ga0207640_10003046	3300025981	Bacteria	9027
1117	Ga0207640_10003757	3300025981	Bacteria	8183
1118	Ga0207640_10008281	3300025981	Bacteria	5770
1119	Ga0207640_10009762	3300025981	Bacteria	5381
1120	Ga0207640_10014268	3300025981	Bacteria	4570
1121	Ga0207640_10040634	3300025981	Unclassified	2952
1122	Ga0207640_10044363	3300025981	Bacteria	2848
1123	Ga0207640_10094860	3300025981	Bacteria	2076
1124	Ga0207640_10366254	3300025981	Bacteria	1163
1125	Ga0207640_10658653	3300025981	Bacteria	893
1126	Ga0207640_10914140	3300025981	Bacteria	767
1127	Ga0207658_10405141	3300025986	Bacteria	1199
1128	Ga0207658_10677748	3300025986	Bacteria	931
1129	Ga0207658_12027426	3300025986	Bacteria	523
1130	Ga0207658_12137941	3300025986	Bacteria	508
1131	Ga0207677_10014901	3300026023	Bacteria	4554
1132	Ga0207677_10018066	3300026023	Bacteria	4225
1133	Ga0207677_10127426	3300026023	Bacteria	1926
1134	Ga0207677_10128209	3300026023	Unclassified	1921
1135	Ga0207677_10843215	3300026023	Bacteria	823
1136	Ga0207703_10019404	3300026035	Bacteria	5312
1137	Ga0207703_10028743	3300026035	Bacteria	4386
1138	Ga0207703_10123245	3300026035	Bacteria	2228
1139	Ga0207703_10207359	3300026035	Bacteria	1745
1140	Ga0207703_10787602	3300026035	Bacteria	907
1141	Ga0207639_10001583	3300026041	Bacteria	15284
1142	Ga0207639_10001932	3300026041	Bacteria	13918
1143	Ga0207639_10003948	3300026041	Bacteria	10010
1144	Ga0207639_10004691	3300026041	Bacteria	9197
1145	Ga0207639_10015209	3300026041	Bacteria	5423
1146	Ga0207639_10018104	3300026041	Bacteria	5000
1147	Ga0207639_10046943	3300026041	Bacteria	3261
1148	Ga0207639_10069591	3300026041	Bacteria	2746
1149	Ga0207639_10293595	3300026041	Bacteria	1434
1150	Ga0207639_10468702	3300026041	Bacteria	1146
1151	Ga0207639_10590552	3300026041	Bacteria	1023
1152	Ga0207639_12214693	3300026041	Bacteria	511
1153	Ga0207678_10001701	3300026067	Bacteria	20162
1154	Ga0207678_10004731	3300026067	Bacteria	12225
1155	Ga0207678_10055030	3300026067	Bacteria	3427
1156	Ga0207678_10081598	3300026067	Bacteria	2768
1157	Ga0207678_10101985	3300026067	Bacteria	2450
1158	Ga0207678_10155046	3300026067	Bacteria	1955
1159	Ga0207708_10082840	3300026075	Bacteria	2466
1160	Ga0207702_10002317	3300026078	Bacteria	18202
1161	Ga0207702_10011667	3300026078	Bacteria	7320
1162	Ga0207702_10040184	3300026078	Bacteria	3921
1163	Ga0207702_10144775	3300026078	Bacteria	2155
1164	Ga0207702_10195354	3300026078	Bacteria	1872
1165	Ga0207702_10499491	3300026078	Bacteria	1186
1166	Ga0207702_10573853	3300026078	Bacteria	1105
1167	Ga0207702_10666016	3300026078	Bacteria	1024
1168	Ga0207702_11036184	3300026078	Bacteria	814
1169	Ga0207702_11706449	3300026078	Bacteria	623
1170	Ga0207702_11754447	3300026078	Bacteria	613
1171	Ga0207641_10000020	3300026088	Bacteria	286415
1172	Ga0207641_10025048	3300026088	Bacteria	4920
1173	Ga0207641_10027048	3300026088	Bacteria	4736
1174	Ga0207641_10214449	3300026088	Bacteria	1782
1175	Ga0207648_10000218	3300026089	Bacteria	61980
1176	Ga0207648_10229313	3300026089	Bacteria	1652
1177	Ga0207648_11616301	3300026089	Bacteria	609
1178	Ga0207676_10000101	3300026095	Bacteria	77252
1179	Ga0207676_10046660	3300026095	Bacteria	3353
1180	Ga0207676_10576460	3300026095	Bacteria	1078
1181	Ga0207674_10001686	3300026116	Bacteria	28373
1182	Ga0207674_10006525	3300026116	Bacteria	13714
1183	Ga0207674_10006658	3300026116	Bacteria	13574
1184	Ga0207674_10036090	3300026116	Bacteria	5155
1185	Ga0207674_10188503	3300026116	Bacteria	2012
1186	Ga0207674_10594294	3300026116	Bacteria	1069
1187	Ga0207674_10646587	3300026116	Bacteria	1021
1188	Ga0207675_100008729	3300026118	Bacteria	9519
1189	Ga0207675_101378297	3300026118	Bacteria	726
1190	Ga0207683_10000780	3300026121	Bacteria	29026
1191	Ga0207683_10257681	3300026121	Bacteria	1592
1192	Ga0207683_10584390	3300026121	Bacteria	1033
1193	Ga0207683_10975252	3300026121	Bacteria	787
1194	Ga0207683_11100010	3300026121	Bacteria	737
1195	Ga0207683_11434771	3300026121	Bacteria	638
1196	Ga0207683_12038267	3300026121	Bacteria	522
1197	Ga0207698_10000753	3300026142	Bacteria	18795
1198	Ga0207698_10006967	3300026142	Bacteria	7073
1199	Ga0207698_10008224	3300026142	Bacteria	6582
1200	Ga0207698_10065940	3300026142	Bacteria	2847
1201	Ga0207698_10128843	3300026142	Bacteria	2158
1202	Ga0207698_10398152	3300026142	Bacteria	1315
1203	Ga0209281_1000013	3300027111	Bacteria	653449
1204	Ga0209281_1010348	3300027111	Bacteria	2140
1205	Ga0209973_1019543	3300027252	Bacteria	888
1206	Ga0209389_1000005	3300027296	Bacteria	232255
1207	Ga0209389_1000131	3300027296	Bacteria	66499
1208	Ga0209371_1000004	3300027312	Bacteria	1098197
1209	Ga0209371_1000135	3300027312	Bacteria	121718
1210	Ga0209371_1003230	3300027312	Bacteria	8152
1211	Ga0209371_1027105	3300027312	Bacteria	1294
1212	Ga0209967_1061365	3300027364	Bacteria	583
1213	Ga0209981_1022200	3300027378	Bacteria	909
1214	Ga0209996_1014148	3300027395	Bacteria	1082
1215	Ga0209996_1051888	3300027395	Bacteria	622
1216	Ga0209996_1074632	3300027395	Bacteria	529
1217	Ga0209984_1003970	3300027424	Bacteria	1722
1218	Ga0209984_1046072	3300027424	Bacteria	633
1219	Ga0210000_1007911	3300027462	Bacteria	1558
1220	Ga0209995_1005333	3300027471	Bacteria	2065
1221	Ga0209179_1052730	3300027512	Bacteria	874
1222	Ga0209968_1030014	3300027526	Bacteria	907
1223	Ga0209999_1007661	3300027543	Bacteria	1942
1224	Ga0209999_1049265	3300027543	Bacteria	795
1225	Ga0209982_1009739	3300027552	Bacteria	1422
1226	Ga0209982_1058158	3300027552	Bacteria	628
1227	Ga0209970_1015584	3300027614	Bacteria	1265
1228	Ga0210002_1037747	3300027617	Bacteria	815
1229	Ga0209983_1001258	3300027665	Bacteria	5634
1230	Ga0209983_1017501	3300027665	Bacteria	1484
1231	Ga0209282_1000019	3300027666	Bacteria	184034
1232	Ga0209282_1027977	3300027666	Bacteria	3498
1233	Ga0209971_1001741	3300027682	Bacteria	5339
1234	Ga0209974_10002695	3300027876	Bacteria	6437
1235	Ga0209974_10023431	3300027876	Bacteria	2043
1236	Ga0207428_10064990	3300027907	Bacteria	2879
1237	Ga0265358_105405	3300028010	Bacteria	503
1238	Ga0265354_1015073	3300028016	Bacteria	731
1239	Ga0265354_1018884	3300028016	Bacteria	654
1240	Ga0265356_1013424	3300028017	Bacteria	894
1241	Ga0265356_1035582	3300028017	Bacteria	545
1242	Ga0268266_10000911	3300028379	Bacteria	38048
1243	Ga0268266_10010436	3300028379	Bacteria	8116
1244	Ga0268266_10302564	3300028379	Bacteria	1492
1245	Ga0268266_10336447	3300028379	Bacteria	1416
1246	Ga0268266_10514397	3300028379	Bacteria	1144
1247	Ga0268265_10009799	3300028380	Bacteria	6467
1248	Ga0268265_10056737	3300028380	Bacteria	2981
1249	Ga0268265_10119813	3300028380	Bacteria	2166
1250	Ga0268264_10012909	3300028381	Bacteria	6867
1251	Ga0268264_10039140	3300028381	Bacteria	3917
1252	Ga0268264_10264875	3300028381	Bacteria	1603
1253	Ga0307515_10217506	3300028794	Bacteria	1738
1254	Ga0268256_1000005	3300030500	Bacteria	1082342
1255	Ga0268256_1000148	3300030500	Bacteria	94347
1256	Ga0268256_1002928	3300030500	Bacteria	8152
1257	Ga0268256_1030829	3300030500	Bacteria	1294
1258	Ga0316177_1107574	3300030731	Bacteria	4552
1259	Ga0316177_1132906	3300030731	Bacteria	1007
1260	Ga0316176_1211692	3300030732	Bacteria	1052
1261	Ga0314311_1069660	3300030733	Bacteria	1619
1262	Ga0316179_1120852	3300030734	Bacteria	1612
1263	Ga0316178_1003918	3300030735	Bacteria	11972
1264	Ga0316180_1173768	3300030736	Bacteria	1246
1265	Ga0316181_1039458	3300030744	Bacteria	638
1266	Ga0316181_1255556	3300030744	Bacteria	3808
1267	Ga0265762_1001568	3300030760	Bacteria	4159
1268	Ga0265762_1002940	3300030760	Bacteria	3043
1269	Ga0265763_1050400	3300030763	Bacteria	523
1270	Ga0265770_1006276	3300030878	Bacteria	1650
1271	Ga0265773_1040221	3300031018	Unclassified	533
1272	Ga0265760_10003135	3300031090	Bacteria	4833
1273	Ga0265760_10010197	3300031090	Bacteria	2679
1274	Ga0265760_10014986	3300031090	Bacteria	2221
1275	Ga0265332_10034898	3300031238	Bacteria	2186
1276	Ga0265316_10851911	3300031344	Bacteria	638
1277	Ga0307513_10072433	3300031456	Bacteria	3591
1278	Ga0307408_100000081	3300031548	Bacteria	106920
1279	Ga0307408_100027381	3300031548	Bacteria	3927
1280	Ga0307408_100119597	3300031548	Bacteria	2039
1281	Ga0307408_101232820	3300031548	Bacteria	699
1282	Ga0307408_101924856	3300031548	Bacteria	567
1283	Ga0316576_10000432	3300031727	Bacteria	19452
1284	Ga0316576_10907709	3300031727	Bacteria	631
1285	Ga0316578_10156724	3300031728	Unclassified	1372
1286	Ga0307405_10000116	3300031731	Bacteria	32023
1287	Ga0307405_10000608	3300031731	Bacteria	13772
1288	Ga0307405_10845591	3300031731	Bacteria	770
1289	Ga0307413_10001775	3300031824	Bacteria	8444
1290	Ga0307413_10040711	3300031824	Bacteria	2714
1291	Ga0307413_10085648	3300031824	Bacteria	2035
1292	Ga0307413_10713780	3300031824	Bacteria	834
1293	Ga0307406_10015544	3300031901	Bacteria	4406
1294	Ga0307406_10166102	3300031901	Bacteria	1592
1295	Ga0307406_11187013	3300031901	Bacteria	662
1296	Ga0307407_10005070	3300031903	Bacteria	5680
1297	Ga0307412_10043455	3300031911	Bacteria	2926
1298	Ga0307412_10567876	3300031911	Bacteria	955
1299	Ga0307409_100004715	3300031995	Bacteria	7719
1300	Ga0307409_102166198	3300031995	Bacteria	585
1301	Ga0307409_102603903	3300031995	Bacteria	534
1302	Ga0307416_100015583	3300032002	Bacteria	5255
1303	Ga0307416_100079472	3300032002	Bacteria	2764
1304	Ga0307416_100351188	3300032002	Bacteria	1492
1305	Ga0307416_100415552	3300032002	Bacteria	1387
1306	Ga0307416_100420817	3300032002	Bacteria	1380
1307	Ga0307414_10001089	3300032004	Bacteria	13868
1308	Ga0307414_10045617	3300032004	Bacteria	3003
1309	Ga0307414_10100632	3300032004	Bacteria	2174
1310	Ga0307414_10209377	3300032004	Bacteria	1592
1311	Ga0307414_10765441	3300032004	Bacteria	878
1312	Ga0307414_10849304	3300032004	Bacteria	835
1313	Ga0307411_10111593	3300032005	Bacteria	1958
1314	Ga0307411_11323788	3300032005	Bacteria	657
1315	Ga0307415_100009006	3300032126	Bacteria	5567
1316	Ga0307415_100011120	3300032126	Bacteria	5132
1317	Ga0307415_100188192	3300032126	Bacteria	1626
1318	Ga0307415_101937265	3300032126	Bacteria	573
1319	Ga0316214_1047746	3300033545	Bacteria	619
1320	Ga0316212_1036713	3300033547	Bacteria	691
1321	Ga0373958_0154960	3300034819	Bacteria	576
1322	Ga0373928_0051687	3300035084	Bacteria	972
1323	Ga0373928_0102208	3300035084	Bacteria	749
1324	Ga0373929_0052905	3300035085	Bacteria	932
1325	Ga0373929_0169344	3300035085	Bacteria	596
1326	Ga0373951_0196191	3300035091	Bacteria	586
1327	Ga0373932_0172006	3300035112	Bacteria	755
1328	Ga0373939_0298962	3300035114	Bacteria	641
1329	Ga0373943_0694169	3300035170	Bacteria	603
1330	Ga0373943_0831448	3300035170	Bacteria	550
1331	Ga0373946_0361847	3300035171	Bacteria	727
1332	Ga0373942_0065665	3300035207	Bacteria	1049
1333	Ga0373962_0079096	3300035242	Bacteria	995
1334	Ga0373962_0363351	3300035242	Bacteria	526
1335	Ga0316574_0037212	3300035398	Bacteria	2983
1336	Ga0316574_0067131	3300035398	Bacteria	2261
1337	Ga0373931_0074889	3300035691	Bacteria	1855
1338	Ga0373931_0212852	3300035691	Bacteria	1160
1339	Ga0373931_1014878	3300035691	Bacteria	562
1340	Ga0373935_0113161	3300035692	Bacteria	1804
1341	Ga0373935_0324419	3300035692	Bacteria	1093
1342	Ga0373927_0263585	3300035695	Bacteria	1133
1343	Ga0373927_0672051	3300035695	Unclassified	684
1344	Ga0373933_0042979	3300035724	Bacteria	2672
1345	Ga0373947_0165340	3300035725	Bacteria	1433
1346	Ga0373947_0382927	3300035725	Bacteria	947
1347	Ga0373947_1041201	3300035725	Bacteria	558
1348	Ga0373937_0168438	3300036401	Bacteria	2055
1349	Ga0373937_0606962	3300036401	Bacteria	1039
1350	Ga0373937_0693070	3300036401	Bacteria	965
1351	Ga0373925_0549044	3300037068	Unclassified	950
1352	Ga0373925_1045519	3300037068	Bacteria	672
1353	Ga0395899_0070283	3300037312	Bacteria	2562
1354	Ga0395899_0228326	3300037312	Bacteria	1286
1355	Ga0395899_0277752	3300037312	Bacteria	1140
1356	Ga0395899_0678151	3300037312	Bacteria	649
1357	Ga0395899_0969343	3300037312	Bacteria	514
1358	Ga0395900_0012719	3300037418	Bacteria	8601
1359	Ga0395900_0033262	3300037418	Bacteria	5307
1360	Ga0395900_0061044	3300037418	Bacteria	3877
1361	Ga0395900_0720736	3300037418	Unclassified	930
1362	Ga0395900_0875799	3300037418	Bacteria	822
1363	Ga0395898_0002941	3300037466	Bacteria	19375
1364	Ga0395898_0038755	3300037466	Bacteria	4721
1365	Ga0395898_0102792	3300037466	Bacteria	2742
1366	Ga0395898_0355254	3300037466	Bacteria	1397
1367	Ga0436364_0057880	3300037853	Bacteria	1862
1368	Ga0395901_0007692	3300038443	Bacteria	10871
1369	Ga0395901_0026093	3300038443	Bacteria	5999
1370	Ga0395901_0060283	3300038443	Bacteria	3948
1371	Ga0395901_0180452	3300038443	Bacteria	2214
1372	Ga0395901_0226604	3300038443	Bacteria	1952
1373	Ga0395901_0244988	3300038443	Bacteria	1868
1374	Ga0395901_0661800	3300038443	Bacteria	1046
1375	Ga0237819_03861	3300038705	Bacteria	2566
1376	Ga0237816_00234	3300039145	Bacteria	4638
1377	Ga0436365_1017425	3300039437	Bacteria	523
1378	Ga0436365_1087397	3300039437	Bacteria	2734
1379	Ga0436365_1344243	3300039437	Bacteria	754
1380	Ga0436365_1622187	3300039437	Bacteria	602
1381	Ga0436360_0042835	3300039438	Bacteria	750
1382	Ga0436360_0524417	3300039438	Bacteria	503
1383	Ga0436361_0560976	3300039447	Bacteria	504
1384	Ga0436361_1188776	3300039447	Bacteria	553
1385	Ga0436363_0157291	3300039450	Bacteria	568
1386	Ga0436363_0755022	3300039450	Bacteria	842
1387	Ga0436363_0969403	3300039450	Bacteria	2384
1388	Ga0436363_1396170	3300039450	Bacteria	2521
1389	Ga0436362_0745981	3300039453	Bacteria	3072
1390	Ga0439436_0028991	3300041404	Bacteria	1613
1391	Ga0439436_0078614	3300041404	Bacteria	918
1392	Ga0439438_001649	3300041405	Bacteria	9799
1393	Ga0439438_010778	3300041405	Bacteria	2876
1394	Ga0439447_000080	3300041407	Bacteria	34054
1395	Ga0439461_0002906	3300041410	Bacteria	2777
1396	Ga0439466_0011056	3300041411	Bacteria	3345
1397	Ga0439466_0086982	3300041411	Bacteria	982
1398	Ga0439465_0012506	3300041413	Bacteria	2652
1399	Ga0439465_0019673	3300041413	Bacteria	2111
1400	Ga0451787_145416	3300041441	Bacteria	540
1401	Ga0451789_0204476	3300041443	Bacteria	1038
1402	Ga0451789_0333893	3300041443	Bacteria	2553
1403	Ga0451791_0253301	3300041451	Bacteria	1666
1404	Ga0451791_0573374	3300041451	Bacteria	1096
1405	Ga0451791_1457090	3300041451	Bacteria	1003
1406	Ga0451791_1656641	3300041451	Bacteria	523
1407	Ga0451793_0592369	3300041452	Bacteria	1034
1408	Ga0451797_0511185	3300041453	Bacteria	676
1409	Ga0451797_0949176	3300041453	Bacteria	644
1410	Ga0451797_1031250	3300041453	Bacteria	701
1411	Ga0451795_1428379	3300041456	Bacteria	1726
1412	Ga0451798_0258464	3300041458	Bacteria	1096
1413	Ga0451800_0607376	3300041459	Bacteria	514
1414	Ga0451802_0133326	3300041460	Bacteria	1202
1415	Ga0451804_0146427	3300041463	Bacteria	683
1416	Ga0451804_0413304	3300041463	Bacteria	929
1417	Ga0451807_0517853	3300041486	Bacteria	1516
1418	Ga0451807_0962946	3300041486	Bacteria	1130
1419	Ga0451833_0845125	3300041491	Bacteria	1175
1420	Ga0451835_0177019	3300041492	Bacteria	779
1421	Ga0451837_0019255	3300041494	Bacteria	945
1422	Ga0451837_0497442	3300041494	Bacteria	828
1423	Ga0451837_1352619	3300041494	Bacteria	530
1424	Ga0451837_1594772	3300041494	Bacteria	677
1425	Ga0451839_0350986	3300041496	Bacteria	618
1426	Ga0451839_0438407	3300041496	Bacteria	632
1427	Ga0451839_1534640	3300041496	Bacteria	1490
1428	Ga0451841_0656054	3300041498	Bacteria	983
1429	Ga0451841_1239896	3300041498	Bacteria	541
1430	Ga0451849_0191803	3300041505	Bacteria	1120
1431	Ga0451849_0962937	3300041505	Bacteria	735
1432	Ga0451851_1366462	3300041507	Bacteria	758
1433	Ga0451843_0414088	3300041509	Bacteria	1277
1434	Ga0451843_1145372	3300041509	Bacteria	643
1435	Ga0451855_1830322	3300041511	Bacteria	580
1436	Ga0451853_0311127	3300041512	Bacteria	974
1437	Ga0451853_3959737	3300041512	Bacteria	883
1438	Ga0439431_0014208	3300041997	Bacteria	1844
1439	Ga0439431_0106224	3300041997	Bacteria	775
1440	Ga0439431_0273425	3300041997	Bacteria	505
1441	Ga0439433_0009792	3300041999	Bacteria	2092
1442	Ga0439433_0055349	3300041999	Bacteria	939
1443	Ga0439437_000764	3300042000	Bacteria	3274
1444	Ga0439437_007146	3300042000	Bacteria	1244
1445	Ga0439445_0006797	3300042004	Bacteria	2637
1446	Ga0439448_0016807	3300042005	Bacteria	2230
1447	Ga0439448_0025040	3300042005	Bacteria	1870
1448	Ga0439432_001476	3300042006	Bacteria	8822
1449	Ga0439432_002832	3300042006	Bacteria	6469
1450	Ga0439432_074147	3300042006	Bacteria	1035
1451	Ga0439432_181123	3300042006	Bacteria	613
1452	Ga0439449_0001500	3300042007	Bacteria	9144
1453	Ga0439449_0055190	3300042007	Bacteria	1467
1454	Ga0439452_087001	3300042010	Bacteria	677
1455	Ga0439455_0002810	3300042012	Bacteria	3232
1456	Ga0439455_0006481	3300042012	Bacteria	2434
1457	Ga0439455_0047608	3300042012	Bacteria	1113
1458	Ga0439455_0084591	3300042012	Bacteria	865
1459	Ga0439456_018734	3300042013	Bacteria	1454
1460	Ga0439457_042198	3300042014	Bacteria	1017
1461	Ga0439462_0075487	3300042015	Bacteria	917
1462	Ga0439463_031266	3300042016	Bacteria	1343
1463	Ga0450911_000020	3300042115	Bacteria	101786
1464	Ga0450917_002232	3300042120	Bacteria	1384
1465	Ga0450922_025752	3300042124	Bacteria	624
1466	Ga0450923_025409	3300042125	Bacteria	1180
1467	Ga0450898_036197	3300042134	Bacteria	921
1468	Ga0450900_014862	3300042136	Bacteria	1042
1469	Ga0450900_022512	3300042136	Bacteria	885
1470	Ga0450900_046619	3300042136	Bacteria	657
1471	Ga0450902_007074	3300042137	Bacteria	1731
1472	Ga0450903_028382	3300042138	Bacteria	849
1473	Ga0450904_000233	3300042139	Bacteria	12151
1474	Ga0450905_000342	3300042142	Bacteria	5567
1475	Ga0450905_039619	3300042142	Bacteria	746
1476	Ga0450905_041664	3300042142	Bacteria	731
1477	Ga0439446_0000118	3300042156	Bacteria	13752
1478	Ga0439446_0003755	3300042156	Bacteria	3794
1479	Ga0439446_0019960	3300042156	Bacteria	1885
1480	Ga0439446_0046696	3300042156	Bacteria	1287
1481	Ga0439458_0076749	3300042157	Bacteria	849
1482	Ga0450909_061194	3300042185	Bacteria	595
1483	Ga0439434_0006972	3300042435	Bacteria	3300
1484	Ga0439434_0031216	3300042435	Bacteria	1619
1485	Ga0439435_0101997	3300042436	Bacteria	883
1486	Ga0439459_0010045	3300042438	Bacteria	1643
1487	Ga0439464_0000275	3300042439	Bacteria	9622
1488	Ga0439464_0018609	3300042439	Bacteria	1890
1489	Ga0439464_0041334	3300042439	Bacteria	1314
1490	Ga0439464_0144497	3300042439	Bacteria	742
1491	Ga0439460_0055708	3300042461	Bacteria	1196
1492	Ga0450916_002042	3300042530	Bacteria	2090
1493	Ga0450916_042585	3300042530	Bacteria	695
1494	Ga0450893_0012291	3300042532	Bacteria	1421
1495	Ga0450901_000100	3300042533	Bacteria	9240
1496	Ga0451577_0117711	3300042876	Bacteria	2380
1497	Ga0451577_0200709	3300042876	Bacteria	1800
1498	Ga0451577_0533680	3300042876	Bacteria	1065
1499	Ga0451577_0763073	3300042876	Bacteria	874
1500	Ga0451577_0878608	3300042876	Bacteria	808
1501	Ga0451577_0912957	3300042876	Bacteria	790
1502	Ga0451577_1034944	3300042876	Bacteria	736
1503	Ga0451577_1054543	3300042876	Bacteria	729
1504	Ga0466972_0001279	3300044658	Bacteria	12140
1505	Ga0453683_0083753	3300044673	Bacteria	1998
1506	Ga0453683_0251084	3300044673	Bacteria	1127
1507	Ga0453683_0302539	3300044673	Bacteria	1023
1508	Ga0453683_1202240	3300044673	Bacteria	507
1509	Ga0466966_0198994	3300044684	Bacteria	1213
1510	Ga0466966_0279945	3300044684	Bacteria	1003
1511	Ga0466963_0529920	3300044694	Bacteria	832
1512	Ga0453684_0019189	3300044712	Bacteria	10425
1513	Ga0453684_0037230	3300044712	Bacteria	6681
1514	Ga0453684_0067698	3300044712	Bacteria	4539
1515	Ga0453684_0206907	3300044712	Bacteria	2283
1516	Ga0453684_0417443	3300044712	Bacteria	1499
1517	Ga0453684_0441206	3300044712	Bacteria	1451
1518	Ga0453684_0612469	3300044712	Bacteria	1192
1519	Ga0453684_0636089	3300044712	Bacteria	1165
1520	Ga0453684_1371042	3300044712	Unclassified	735
1521	Ga0453684_1441788	3300044712	Bacteria	712
1522	Ga0466971_0701605	3300044719	Bacteria	509
1523	Ga0466968_0191906	3300044735	Bacteria	954
1524	Ga0466970_0000079	3300044765	Bacteria	39743
1525	Ga0466957_0056122	3300044842	Bacteria	2408
1526	Ga0451576_0025850	3300045051	Bacteria	6324
1527	Ga0451576_0030205	3300045051	Bacteria	5795
1528	Ga0451576_0165424	3300045051	Bacteria	2308
1529	Ga0451576_0184058	3300045051	Bacteria	2181
1530	Ga0451576_0295987	3300045051	Bacteria	1692
1531	Ga0451576_0313419	3300045051	Bacteria	1641
1532	Ga0451576_0524477	3300045051	Bacteria	1244
1533	Ga0451576_0848869	3300045051	Bacteria	959
1534	Ga0451576_0953769	3300045051	Bacteria	899
1535	Ga0451576_2351851	3300045051	Bacteria	546
1536	Ga0466967_1550522	3300045976	Bacteria	660
1537	Ga0495617_148623	3300046452	Bacteria	746
1538	Ga0495627_020637	3300046453	Bacteria	2194
1539	Ga0495603_0188321	3300046455	Bacteria	1193
1540	Ga0495603_0387015	3300046455	Bacteria	802
1541	Ga0495590_0165785	3300046457	Bacteria	804
1542	Ga0495591_133101	3300046458	Bacteria	602
1543	Ga0495650_0000006	3300046471	Bacteria	721347
1544	Ga0495580_0012229	3300046472	Bacteria	6593
1545	Ga0495580_0029478	3300046472	Bacteria	3982
1546	Ga0495580_0033484	3300046472	Bacteria	3702
1547	Ga0495580_0275091	3300046472	Bacteria	1149
1548	Ga0495580_0540985	3300046472	Bacteria	774
1549	Ga0495605_0009205	3300046474	Bacteria	5552
1550	Ga0495662_0593400	3300046476	Bacteria	542
1551	Ga0495584_0069175	3300046491	Bacteria	1774
1552	Ga0495594_0058963	3300046499	Bacteria	2122
1553	Ga0495594_0485224	3300046499	Bacteria	702
1554	Ga0495596_0000086	3300046500	Bacteria	64736
1555	Ga0495607_0038124	3300046501	Bacteria	2881
1556	Ga0495607_0104372	3300046501	Bacteria	1512
1557	Ga0495606_0008800	3300046507	Bacteria	8666
1558	Ga0495608_0023264	3300046511	Eukaryota	4248
1559	Ga0495610_0000221	3300046512	Bacteria	61150
1560	Ga0495616_0000391	3300046513	Bacteria	34066
1561	Ga0495616_0073478	3300046513	Bacteria	1650
1562	Ga0495616_0075945	3300046513	Bacteria	1616
1563	Ga0495618_0658768	3300046514	Bacteria	619
1564	Ga0495620_0000013	3300046515	Bacteria	160349
1565	Ga0495630_0709453	3300046517	Unclassified	769
1566	Ga0495631_0287820	3300046518	Bacteria	699
1567	Ga0495632_0001757	3300046519	Bacteria	17531
1568	Ga0495632_0025642	3300046519	Bacteria	3115
1569	Ga0495637_0282366	3300046520	Bacteria	592
1570	Ga0495643_0000740	3300046522	Bacteria	37104
1571	Ga0495643_0013511	3300046522	Bacteria	4882
1572	Ga0495643_0013936	3300046522	Bacteria	4792
1573	Ga0495643_0041441	3300046522	Bacteria	2510
1574	Ga0495643_0351823	3300046522	Unclassified	660
1575	Ga0495648_0000885	3300046524	Bacteria	31452
1576	Ga0495648_0042107	3300046524	Bacteria	2876
1577	Ga0495663_0000254	3300046525	Bacteria	20648
1578	Ga0495666_0272614	3300046526	Bacteria	768
1579	Ga0495642_0084673	3300046528	Bacteria	1338
1580	Ga0495652_0008024	3300046529	Eukaryota	9680
1581	Ga0495654_0054660	3300046530	Bacteria	1936
1582	Ga0495654_0113430	3300046530	Bacteria	1234
1583	Ga0495654_0192511	3300046530	Bacteria	877
1584	Ga0495665_0630947	3300046531	Bacteria	534
1585	Ga0495665_0689904	3300046531	Bacteria	507
1586	Ga0495640_0460210	3300046533	Bacteria	776
1587	Ga0495586_0483193	3300046535	Bacteria	714
1588	Ga0495586_0614680	3300046535	Bacteria	628
1589	Ga0495586_0669037	3300046535	Bacteria	600
1590	Ga0495609_0000896	3300046538	Bacteria	21724
1591	Ga0495621_0324137	3300046539	Bacteria	642
1592	Ga0495597_0084514	3300046542	Bacteria	1353
1593	Ga0495633_0006586	3300046558	Bacteria	6860
1594	Ga0495633_0222571	3300046558	Bacteria	864
1595	Ga0495656_0009664	3300046615	Bacteria	3478
1596	Ga0495611_0016131	3300046648	Bacteria	3194
1597	Ga0495625_0305400	3300046660	Bacteria	1017
1598	Ga0495625_0489240	3300046660	Bacteria	754
1599	Ga0495625_0577896	3300046660	Bacteria	677
1600	Ga0495659_0141997	3300046664	Bacteria	959
1601	Ga0495661_0004133	3300046665	Bacteria	10567
1602	Ga0495588_0511360	3300046674	Bacteria	629
1603	Ga0495657_0018048	3300046675	Eukaryota	5115
1604	Ga0495599_0152776	3300046678	Bacteria	1429
1605	Ga0495647_0572268	3300046681	Bacteria	529
1606	Ga0495658_0432238	3300046683	Bacteria	840
1607	Ga0495658_0652225	3300046683	Bacteria	674
1608	Ga0495669_0044626	3300046684	Bacteria	1975
1609	Ga0495669_0080324	3300046684	Bacteria	1496
1610	Ga0495669_0626867	3300046684	Bacteria	523
1611	Ga0495670_0459126	3300046691	Bacteria	690
1612	Ga0495671_0000191	3300046692	Bacteria	53612
1613	Ga0495671_0008423	3300046692	Bacteria	5802
1614	Ga0495671_0012903	3300046692	Bacteria	4548
1615	Ga0495671_0294329	3300046692	Bacteria	781
1616	Ga0495649_0010707	3300046694	Bacteria	5400
1617	Ga0495649_0011102	3300046694	Bacteria	5303
1618	Ga0495660_0172759	3300046810	Bacteria	1051
1619	Ga0495660_0276286	3300046810	Bacteria	770
1620	Ga0495604_0412386	3300047317	Bacteria	888
1621	Ga0495636_0176503	3300047318	Bacteria	968
1622	Ga0495672_0023367	3300047320	Bacteria	4002
1623	Ga0495679_193326	3300047446	Bacteria	536
1624	Ga0495685_002516	3300047447	Bacteria	5752
1625	Ga0495673_0000702	3300047469	Bacteria	32531
1626	Ga0495681_0061754	3300047470	Bacteria	1725
1627	Ga0495681_0103313	3300047470	Bacteria	1243
1628	Ga0495684_0248518	3300047471	Bacteria	1295
1629	Ga0495686_0038495	3300047472	Bacteria	3058
1630	Ga0495686_0321979	3300047472	Bacteria	847
1631	Ga0495602_0050051	3300048088	Bacteria	3737
1632	Ga0496100_0024099	3300048903	Bacteria	3707
1633	Ga0496100_0279509	3300048903	Bacteria	1244
1634	Ga0496100_0417942	3300048903	Bacteria	1024
1635	Ga0496101_0051308	3300048904	Bacteria	2972
1636	Ga0496101_0209470	3300048904	Bacteria	1510
1637	Ga0496101_0559343	3300048904	Bacteria	904
1638	Ga0496102_0168238	3300048905	Bacteria	2063
1639	Ga0496102_0596605	3300048905	Bacteria	1027
1640	Ga0496102_1640207	3300048905	Bacteria	561
1641	Ga0496103_0156386	3300048906	Bacteria	1461
1642	Ga0496103_0182041	3300048906	Bacteria	1351
1643	Ga0496103_0200348	3300048906	Bacteria	1284
1644	Ga0496104_0056210	3300048907	Bacteria	3721
1645	Ga0496104_0933746	3300048907	Bacteria	772
1646	Ga0496105_0162904	3300048908	Bacteria	1830
1647	Ga0496105_0639978	3300048908	Bacteria	821
1648	Ga0496105_1286270	3300048908	Bacteria	535
1649	Ga0496106_0008998	3300048909	Bacteria	7380
1650	Ga0496106_0051113	3300048909	Bacteria	3116
1651	Ga0496107_0206331	3300048910	Bacteria	1461
1652	Ga0496107_0256608	3300048910	Bacteria	1301
1653	Ga0496107_1382409	3300048910	Bacteria	502
1654	Ga0496108_0000948	3300048911	Bacteria	22529
1655	Ga0496108_0062419	3300048911	Bacteria	3137
1656	Ga0496109_0000018	3300048912	Bacteria	191977
1657	Ga0496109_0544007	3300048912	Bacteria	1095
1658	Ga0496110_0000224	3300048913	Bacteria	36697
1659	Ga0496110_0015985	3300048913	Bacteria	6258
1660	Ga0496110_0030061	3300048913	Bacteria	4681
1661	Ga0496110_0179490	3300048913	Bacteria	1922
1662	Ga0496110_1112930	3300048913	Bacteria	698
1663	Ga0496110_1206871	3300048913	Bacteria	665
1664	Ga0496111_0013885	3300048914	Bacteria	5493
1665	Ga0496111_0061645	3300048914	Bacteria	2718
1666	Ga0496111_0422524	3300048914	Bacteria	985
1667	Ga0496112_0000058	3300048915	Bacteria	76327
1668	Ga0496112_0002596	3300048915	Bacteria	14583
1669	Ga0496113_0000103	3300048916	Bacteria	36181
1670	Ga0496113_0031805	3300048916	Bacteria	3832
1671	Ga0496113_0980480	3300048916	Bacteria	666
1672	Ga0496113_1591330	3300048916	Bacteria	503
1673	Ga0496114_0001100	3300048917	Bacteria	20414
1674	Ga0496114_0128293	3300048917	Bacteria	2188
1675	Ga0496114_0812150	3300048917	Bacteria	814
1676	Ga0496115_0143282	3300048918	Bacteria	1971
1677	Ga0496115_0206662	3300048918	Bacteria	1622
1678	Ga0496115_0675793	3300048918	Bacteria	814
1679	Ga0496116_0005326	3300048919	Bacteria	11986
1680	Ga0496116_0198709	3300048919	Bacteria	1052
1681	Ga0496116_0422870	3300048919	Bacteria	581
1682	Ga0496117_0001232	3300048920	Bacteria	38326
1683	Ga0496117_0001277	3300048920	Bacteria	37322
1684	Ga0496117_0058483	3300048920	Bacteria	2669
1685	Ga0496117_0081925	3300048920	Bacteria	2115
1686	Ga0496118_0002130	3300048921	Bacteria	27647
1687	Ga0496118_0013166	3300048921	Bacteria	7848
1688	Ga0496118_0061135	3300048921	Bacteria	2791
1689	Ga0496118_0636298	3300048921	Bacteria	504
1690	Ga0496119_0000112	3300048922	Bacteria	114767
1691	Ga0496120_0001230	3300048923	Bacteria	32387
1692	Ga0496121_0002075	3300048924	Bacteria	31672
1693	Ga0496121_0010419	3300048924	Bacteria	10488
1694	Ga0496121_0070443	3300048924	Bacteria	2816
1695	Ga0496121_0249380	3300048924	Bacteria	1232
1696	Ga0496122_0001211	3300048925	Bacteria	43805
1697	Ga0496122_0001943	3300048925	Bacteria	31037
1698	Ga0496122_0004262	3300048925	Bacteria	17939
1699	Ga0496122_0004606	3300048925	Bacteria	16975
1700	Ga0496122_0076603	3300048925	Bacteria	2353
1701	Ga0496122_0131783	3300048925	Bacteria	1586
1702	Ga0496122_0321254	3300048925	Bacteria	823
1703	Ga0496123_0000493	3300048926	Bacteria	68308
1704	Ga0496123_0001575	3300048926	Bacteria	31163
1705	Ga0496123_0001754	3300048926	Bacteria	28633
1706	Ga0496123_0003760	3300048926	Bacteria	16647
1707	Ga0496124_0000087	3300048927	Bacteria	200697
1708	Ga0496124_0011323	3300048927	Bacteria	8923
1709	Ga0496124_0016854	3300048927	Bacteria	6923
1710	Ga0496124_0180284	3300048927	Bacteria	1626
1711	Ga0496124_0229914	3300048927	Bacteria	1387
1712	Ga0496124_0239156	3300048927	Bacteria	1351
1713	Ga0496124_0533014	3300048927	Bacteria	779
1714	Ga0496125_0001176	3300048928	Bacteria	39651
1715	Ga0496125_0013981	3300048928	Bacteria	7848
1716	Ga0496125_0022391	3300048928	Bacteria	5868
1717	Ga0496125_0053662	3300048928	Bacteria	3302
1718	Ga0496125_0119080	3300048928	Bacteria	1889
1719	Ga0496126_0014937	3300048929	Bacteria	7829
1720	Ga0496126_0045256	3300048929	Bacteria	4046
1721	Ga0496126_0050252	3300048929	Bacteria	3801
1722	Ga0496126_0068356	3300048929	Bacteria	3172
1723	Ga0496126_0199515	3300048929	Bacteria	1690
1724	Ga0501307_091247	3300049162	Bacteria	509
1725	Ga0495678_042409	3300049459	Bacteria	1814
1726	Ga0501290_000034	3300049513	Bacteria	18287
1727	Ga0501296_087494	3300049519	Bacteria	500
1728	Ga0501031_0001510	3300049568	Bacteria	14503
1729	Ga0501031_0005274	3300049568	Bacteria	8423
1730	Ga0501031_0258145	3300049568	Bacteria	1132
1731	Ga0501031_0668954	3300049568	Bacteria	667
1732	Ga0501031_1016229	3300049568	Bacteria	530
1733	Ga0501032_0006681	3300049569	Bacteria	8466
1734	Ga0501032_0010584	3300049569	Bacteria	6648
1735	Ga0501032_0014794	3300049569	Bacteria	5522
1736	Ga0501032_0049531	3300049569	Bacteria	2834
1737	Ga0501032_0577171	3300049569	Bacteria	716
1738	Ga0501033_0010202	3300049570	Bacteria	7212
1739	Ga0501033_0065996	3300049570	Bacteria	2661
1740	Ga0501033_0195763	3300049570	Bacteria	1445
1741	Ga0501033_0324814	3300049570	Bacteria	1081
1742	Ga0501033_0443557	3300049570	Bacteria	902
1743	Ga0501033_0444340	3300049570	Bacteria	901
1744	Ga0501033_1067136	3300049570	Bacteria	538
1745	Ga0501034_0000020	3300049571	Bacteria	280294
1746	Ga0501034_0000083	3300049571	Bacteria	169656
1747	Ga0501034_0004573	3300049571	Bacteria	15325
1748	Ga0501034_0011636	3300049571	Bacteria	9109
1749	Ga0501034_0452978	3300049571	Bacteria	1201
1750	Ga0501036_0004970	3300049572	Bacteria	10750
1751	Ga0501036_0014330	3300049572	Bacteria	6599
1752	Ga0501036_0029960	3300049572	Bacteria	4599
1753	Ga0501036_0194875	3300049572	Bacteria	1705
1754	Ga0501037_0005081	3300049573	Bacteria	9572
1755	Ga0501037_0005974	3300049573	Bacteria	8894
1756	Ga0501037_0020850	3300049573	Bacteria	4839
1757	Ga0501037_0123608	3300049573	Bacteria	1859
1758	Ga0501037_0352383	3300049573	Bacteria	1015
1759	Ga0501038_0002806	3300049574	Bacteria	16225
1760	Ga0501038_0003719	3300049574	Bacteria	14212
1761	Ga0501038_0226934	3300049574	Bacteria	1488
1762	Ga0501038_0758615	3300049574	Bacteria	723
1763	Ga0501039_0000863	3300049575	Bacteria	21927
1764	Ga0501039_0016327	3300049575	Bacteria	5690
1765	Ga0501040_0000640	3300049576	Bacteria	21433
1766	Ga0501041_0000456	3300049577	Bacteria	20769
1767	Ga0501042_0001942	3300049578	Bacteria	12449
1768	Ga0501042_1111860	3300049578	Bacteria	576
1769	Ga0501043_0004158	3300049579	Bacteria	11829
1770	Ga0501043_0028820	3300049579	Bacteria	4359
1771	Ga0501043_0119349	3300049579	Bacteria	2068
1772	Ga0501043_0121324	3300049579	Bacteria	2050
1773	Ga0501043_0230140	3300049579	Bacteria	1432
1774	Ga0501046_0004084	3300049580	Bacteria	13308
1775	Ga0501046_0004283	3300049580	Bacteria	12983
1776	Ga0501046_0007697	3300049580	Bacteria	9445
1777	Ga0501047_0011899	3300049581	Bacteria	8234
1778	Ga0501047_0017446	3300049581	Bacteria	6875
1779	Ga0501047_0028668	3300049581	Bacteria	5369
1780	Ga0501047_0061562	3300049581	Bacteria	3621
1781	Ga0501047_0171219	3300049581	Bacteria	2040
1782	Ga0501047_1384550	3300049581	Bacteria	518
1783	Ga0501047_1447604	3300049581	Bacteria	503
1784	Ga0501048_0001202	3300049582	Bacteria	19590
1785	Ga0501048_0010523	3300049582	Bacteria	6904
1786	Ga0501067_0312577	3300049583	Bacteria	875
1787	Ga0501067_0536980	3300049583	Bacteria	655
1788	Ga0501068_0021385	3300049584	Bacteria	3777
1789	Ga0501068_0860828	3300049584	Bacteria	596
1790	Ga0501069_0017558	3300049585	Bacteria	3854
1791	Ga0501069_0027413	3300049585	Bacteria	3122
1792	Ga0501069_0055287	3300049585	Bacteria	2211
1793	Ga0501069_0083832	3300049585	Bacteria	1798
1794	Ga0501069_0109719	3300049585	Bacteria	1570
1795	Ga0501070_0000553	3300049586	Bacteria	34119
1796	Ga0501070_0001797	3300049586	Bacteria	18924
1797	Ga0501070_0002909	3300049586	Bacteria	14911
1798	Ga0501070_0005401	3300049586	Bacteria	10901
1799	Ga0501070_0010375	3300049586	Bacteria	7876
1800	Ga0501070_0012584	3300049586	Bacteria	7137
1801	Ga0501070_0051202	3300049586	Bacteria	3428
1802	Ga0501070_0193008	3300049586	Bacteria	1673
1803	Ga0501070_0305118	3300049586	Bacteria	1296
1804	Ga0501070_0392881	3300049586	Bacteria	1123
1805	Ga0501071_0000368	3300049587	Bacteria	22055
1806	Ga0501071_0037503	3300049587	Bacteria	3461
1807	Ga0501072_0000472	3300049588	Bacteria	28832
1808	Ga0501073_0009597	3300049589	Bacteria	7137
1809	Ga0501073_0014688	3300049589	Bacteria	5689
1810	Ga0501073_0088024	3300049589	Bacteria	2159
1811	Ga0501073_0128288	3300049589	Bacteria	1758
1812	Ga0501073_0540510	3300049589	Bacteria	805
1813	Ga0501074_0002205	3300049590	Bacteria	13503
1814	Ga0501074_0003935	3300049590	Bacteria	10588
1815	Ga0501074_0015643	3300049590	Bacteria	5515
1816	Ga0501074_0016023	3300049590	Bacteria	5447
1817	Ga0501074_0161821	3300049590	Bacteria	1598
1818	Ga0501075_0011973	3300049591	Bacteria	6155
1819	Ga0501076_0002163	3300049592	Bacteria	13475
1820	Ga0501076_0811948	3300049592	Bacteria	772
1821	Ga0501077_0001485	3300049593	Bacteria	14130
1822	Ga0501077_0005636	3300049593	Bacteria	7631
1823	Ga0501077_0042073	3300049593	Bacteria	2907
1824	Ga0501077_0435571	3300049593	Bacteria	839
1825	Ga0501225_0003923	3300049705	Bacteria	4454
1826	Ga0501079_0000804	3300049741	Bacteria	21398
1827	Ga0501079_0290567	3300049741	Bacteria	1278
1828	Ga0501080_0009482	3300049742	Bacteria	8879
1829	Ga0501080_0013296	3300049742	Bacteria	7563
1830	Ga0501080_0013343	3300049742	Bacteria	7553
1831	Ga0501080_0018066	3300049742	Bacteria	6528
1832	Ga0501080_0018996	3300049742	Bacteria	6365
1833	Ga0501080_0054883	3300049742	Bacteria	3710
1834	Ga0501080_0074332	3300049742	Bacteria	3161
1835	Ga0501081_0320292	3300049743	Bacteria	1139
1836	Ga0501083_0509508	3300049744	Bacteria	783
1837	Ga0501083_0902041	3300049744	Bacteria	575
1838	Ga0501269_054654	3300049766	Bacteria	555
1839	Ga0501275_000308	3300049772	Bacteria	5566
1840	Ga0501035_0003969	3300049822	Bacteria	14097
1841	Ga0501035_0006193	3300049822	Bacteria	11255
1842	Ga0501035_0023224	3300049822	Bacteria	5689
1843	Ga0501035_0060046	3300049822	Bacteria	3385
1844	Ga0501035_0223413	3300049822	Bacteria	1607
1845	Ga0501035_0291750	3300049822	Bacteria	1376
1846	Ga0501035_0319164	3300049822	Bacteria	1305
1847	Ga0501035_1122059	3300049822	Bacteria	613
1848	Ga0501044_0021569	3300049823	Bacteria	6868
1849	Ga0501044_0025694	3300049823	Bacteria	6243
1850	Ga0501044_0038658	3300049823	Bacteria	4983
1851	Ga0501044_0051890	3300049823	Bacteria	4228
1852	Ga0501044_0072537	3300049823	Bacteria	3500
1853	Ga0501044_0086512	3300049823	Bacteria	3166
1854	Ga0501044_0093528	3300049823	Bacteria	3031
1855	Ga0501044_0149271	3300049823	Bacteria	2321
1856	Ga0501044_0463352	3300049823	Bacteria	1172
1857	Ga0501045_0000517	3300049824	Bacteria	24006
1858	Ga0501204_046191	3300049850	Bacteria	654
1859	Ga0501226_000012	3300049853	Bacteria	175419
1860	nmdc:mga03683_71_c1	3300050489	Bacteria	38241
1861	nmdc:mga03n38_8273_c1	3300050490	Bacteria	3725
1862	nmdc:mga00v17_146867_c1	3300050491	Bacteria	1514
1863	nmdc:mga00v17_164658_c1	3300050491	Bacteria	1429
1864	nmdc:mga00v17_25528_c1	3300050491	Bacteria	3436
1865	nmdc:mga00v17_609626_c1	3300050491	Bacteria	704
1866	nmdc:mga00v17_71151_c1	3300050491	Bacteria	2156
1867	nmdc:mga00v17_75834_c1	3300050491	Bacteria	2091
1868	nmdc:mga0k408_30_c1	3300050493	Bacteria	89511
1869	nmdc:mga06z11_29030_c1	3300050494	Bacteria	2660
1870	nmdc:mga07m45_14_c1	3300050496	Bacteria	154035
1871	nmdc:mga05p37_1183814_c1	3300050507	Bacteria	791
1872	nmdc:mga05p37_1934487_c1	3300050507	Bacteria	561
1873	nmdc:mga05p37_89744_c1	3300050507	Bacteria	3788
1874	nmdc:mga05p37_92764_c1	3300050507	Bacteria	3721
1875	nmdc:mga08y16_492917_c1	3300050511	Bacteria	1246
1876	nmdc:mga08y16_606988_c1	3300050511	Bacteria	1102
1877	nmdc:mga0n895_17629_c1	3300050512	Bacteria	6587
1878	nmdc:mga0n895_18894_c1	3300050512	Bacteria	6391
1879	nmdc:mga0n895_22948_c1	3300050512	Bacteria	5856
1880	nmdc:mga0n895_24715_c1	3300050512	Bacteria	5665
1881	nmdc:mga0n895_600864_c1	3300050512	Bacteria	1102
1882	nmdc:mga0n895_758825_c1	3300050512	Bacteria	963
1883	nmdc:mga0rr50_10022_c1	3300050513	Bacteria	5995
1884	nmdc:mga0rr50_1675842_c1	3300050513	Bacteria	536
1885	nmdc:mga0rr50_1725711_c1	3300050513	Bacteria	527
1886	nmdc:mga0rr50_2876_c1	3300050513	Bacteria	9815
1887	nmdc:mga0rr50_499_c1	3300050513	Bacteria	20926
1888	nmdc:mga0rr50_511168_c1	3300050513	Bacteria	1022
1889	nmdc:mga0rr50_56270_c1	3300050513	Bacteria	2938
1890	nmdc:mga0rr50_609583_c1	3300050513	Bacteria	931
1891	nmdc:mga08x19_12843_c1	3300050514	Bacteria	5052
1892	nmdc:mga08x19_232393_c1	3300050514	Bacteria	1269
1893	nmdc:mga08x19_417_c1	3300050514	Bacteria	15212
1894	nmdc:mga08x19_4314_c1	3300050514	Bacteria	8421
1895	nmdc:mga08x19_7180_c1	3300050514	Bacteria	6617
1896	nmdc:mga0a205_272581_c1	3300050515	Bacteria	1569
1897	nmdc:mga0a205_39707_c1	3300050515	Bacteria	4529
1898	nmdc:mga0a205_4643_c1	3300050515	Bacteria	12319
1899	nmdc:mga0a205_558_c1	3300050515	Bacteria	29546
1900	nmdc:mga0sz30_1338_c2	3300050516	Bacteria	7010
1901	nmdc:mga0sz30_544929_c1	3300050516	Bacteria	523
1902	Ga0495601_0135582	3300053077	Bacteria	1605
1903	Ga0495655_0000315	3300053083	Bacteria	8593
1904	Ga0495619_0067033	3300053085	Bacteria	2396
1905	Ga0500643_026591	3300053087	Bacteria	1809
1906	Ga0500643_087738	3300053087	Bacteria	850
1907	Ga0500644_0026825	3300053088	Bacteria	1786
1908	Ga0500560_220476	3300053107	Bacteria	605
1909	Ga0500658_0168447	3300053134	Bacteria	994
1910	Ga0500659_0001360	3300053135	Bacteria	15531
1911	Ga0500659_0018561	3300053135	Bacteria	3787
1912	Ga0500590_236812	3300053148	Bacteria	738
1913	Ga0500622_0162530	3300053156	Bacteria	1046
1914	Ga0500634_0004864	3300053161	Bacteria	6292
1915	Ga0500609_012057	3300053731	Bacteria	1169
1916	Ga0501084_0000953	3300054114	Bacteria	22399
1917	Ga0590071_149219	3300059421	Bacteria	605
1918	Ga0587084_096685	3300059477	Bacteria	593
1919	Ga0587066_170060	3300059490	Bacteria	554
1920	Ga0587066_219331	3300059490	Bacteria	509
1921	Ga0587073_0251986	3300059492	Bacteria	554
1922	Ga0587077_201758	3300059493	Bacteria	551
1923	Ga0587080_004783	3300059503	Eukaryota	1783
1924	Ga0587080_046491	3300059503	Unclassified	807
1925	Ga0587088_142705	3300059508	Bacteria	573
1926	Ga0587092_155021	3300059512	Bacteria	514
1927	Ga0587106_029912	3300059605	Bacteria	868
1928	Ga0587106_143029	3300059605	Bacteria	526
1929	Ga0587128_048486	3300059630	Bacteria	768
1930	Ga0587128_154608	3300059630	Bacteria	525
1931	Ga0587067_197362	3300059640	Bacteria	533
1932	Ga0587078_086877	3300059646	Bacteria	508
1933	Ga0587079_252355	3300059647	Bacteria	503
1934	Ga0587107_041865	3300059652	Bacteria	744
1935	Ga0587118_25696	3300059657	Bacteria	503
1936	Ga0587120_032762	3300059659	Bacteria	536
1937	Ga0587060_026748	3300060243	Bacteria	573
1938	Ga0501082_0000226	3300060353	Bacteria	49180
1939	Ga0501082_1860808	3300060353	Bacteria	525
1940	Ga0530510_0001860	3300061734	Bacteria	14433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300059503	Ga0587080_046491	Ga0587080_046491_46_276	57
2	3300047447	Ga0495685_002516	Ga0495685_002516_2600_2785	60
3	3300005329	Ga0070683_100674300	Ga0070683_1006743001	65
4	3300005468	Ga0070707_101424900	Ga0070707_1014249001	65
5	3300044712	Ga0453684_0441206	Ga0453684_0441206_1185_1382	65
6	3300053077	Ga0495601_0135582	Ga0495601_0135582_114_314	65
7	3300053085	Ga0495619_0067033	Ga0495619_0067033_971_1171	65
8	iso_pu_bacteria	2510065053	2510283725	65
9	iso_pu_bacteria	2510065053	2510285354	65
10	iso_pu_bacteria	2510065055	2510292437	65
11	iso_pu_bacteria	2510065055	2510294770	65
12	iso_pu_bacteria	2510065058	2510311366	65
13	iso_pu_bacteria	2510065058	2510311539	65
14	iso_pu_bacteria	2511231004	2511256478	65
15	iso_pu_bacteria	2511231004	2511257059	65
16	iso_pu_bacteria	2511231006	2511264482	65
17	iso_pu_bacteria	2511231006	2511268239	65
18	iso_pu_bacteria	2511231007	2511270010	65
19	iso_pu_bacteria	2511231007	2511273563	65
20	iso_pu_bacteria	2511231008	2511279043	65
21	iso_pu_bacteria	2511231008	2511280945	65
22	iso_pu_bacteria	2511231010	2511287960	65
23	iso_pu_bacteria	2511231010	2511290175	65
24	iso_pu_bacteria	2511231011	2511294050	65
25	iso_pu_bacteria	2511231011	2511294143	65
26	iso_pu_bacteria	2511231012	2511300057	65
27	iso_pu_bacteria	2511231012	2511303272	65
28	iso_pu_bacteria	2511231014	2511311365	65
29	iso_pu_bacteria	2511231014	2511311689	65
30	iso_pu_bacteria	2511231015	2511318762	65
31	iso_pu_bacteria	2511231015	2511319584	65
32	iso_pu_bacteria	2511231016	2511323807	65
33	iso_pu_bacteria	2511231016	2511326602	65
34	iso_pu_bacteria	2511231017	2511330176	65
35	iso_pu_bacteria	2511231017	2511332956	65
36	iso_pu_bacteria	2511231018	2511337775	65
37	iso_pu_bacteria	2511231018	2511338889	65
38	iso_pu_bacteria	2511231019	2511343552	65
39	iso_pu_bacteria	2511231019	2511343908	65
40	iso_pu_bacteria	2511231020	2511348814	65
41	iso_pu_bacteria	2511231020	2511351757	65
42	iso_pu_bacteria	2511231021	2511353688	65
43	iso_pu_bacteria	2511231021	2511357251	65
44	iso_pu_bacteria	2511231022	2511363732	65
45	iso_pu_bacteria	2511231022	2511363811	65
46	iso_pu_bacteria	2511231023	2511370282	65
47	iso_pu_bacteria	2511231023	2511371580	65
48	iso_pu_bacteria	2511231024	2511375207	65
49	iso_pu_bacteria	2511231024	2511376401	65
50	iso_pu_bacteria	2511231031	2511415691	65
51	iso_pu_bacteria	2511231031	2511415962	65
52	iso_pu_bacteria	2511231156	2511823207	65
53	iso_pu_bacteria	2511231156	2511826589	65
54	iso_pu_bacteria	2512047018	2512326331	65
55	iso_pu_bacteria	2512047018	2512327453	65
56	iso_pu_bacteria	2524614729	2525557951	65
57	iso_pu_bacteria	2537561836	2538835041	65
58	iso_pu_bacteria	2547132130	2547501180	65
59	iso_pu_bacteria	2554235132	2554814056	65
60	iso_pu_bacteria	2554235231	2555246847	65
61	iso_pu_bacteria	2554235231	2555248026	65
62	iso_pu_bacteria	2554235341	2555668237	65
63	iso_pu_bacteria	2554235341	2555671663	65
64	iso_pu_bacteria	2582580891	2583790781	65
65	iso_pu_bacteria	2582580891	2583794140	65
66	iso_pu_bacteria	2597489887	2597856454	65
67	iso_pu_bacteria	2597489887	2597859732	65
68	iso_pu_bacteria	2597489888	2597862561	65
69	iso_pu_bacteria	2597489889	2597868406	65
70	iso_pu_bacteria	2597489889	2597871457	65
71	iso_pu_bacteria	2599185155	2599328201	65
72	iso_pu_bacteria	2599185155	2599330162	65
73	iso_pu_bacteria	2599185160	2599354183	65
74	iso_pu_bacteria	2599185160	2599355238	65
75	iso_pu_bacteria	2599185161	2599360140	65
76	iso_pu_bacteria	2599185161	2599360939	65
77	iso_pu_bacteria	2599185162	2599366462	65
78	iso_pu_bacteria	2599185162	2599367261	65
79	iso_pu_bacteria	2599185163	2599373252	65
80	iso_pu_bacteria	2599185163	2599374051	65
81	iso_pu_bacteria	2599185164	2599379291	65
82	iso_pu_bacteria	2599185164	2599380344	65
83	iso_pu_bacteria	2599185165	2599385731	65
84	iso_pu_bacteria	2599185165	2599386791	65
85	iso_pu_bacteria	2599185166	2599392111	65
86	iso_pu_bacteria	2599185166	2599392909	65
87	iso_pu_bacteria	2599185167	2599396671	65
88	iso_pu_bacteria	2599185167	2599396847	65
89	iso_pu_bacteria	2599185167	2599399978	65
90	iso_pu_bacteria	2599185168	2599403877	65
91	iso_pu_bacteria	2599185168	2599404676	65
92	iso_pu_bacteria	2599185179	2599448825	65
93	iso_pu_bacteria	2599185179	2599452798	65
94	iso_pu_bacteria	2599185179	2599453269	65
95	iso_pu_bacteria	2599185181	2599461017	65
96	iso_pu_bacteria	2599185181	2599462072	65
97	iso_pu_bacteria	2599185182	2599466885	65
98	iso_pu_bacteria	2599185182	2599469559	65
99	iso_pu_bacteria	2599185185	2599482561	65
100	iso_pu_bacteria	2599185185	2599483293	65
101	iso_pu_bacteria	2599185186	2599490037	65
102	iso_pu_bacteria	2599185186	2599490836	65
103	iso_pu_bacteria	2599185188	2599501325	65
104	iso_pu_bacteria	2599185189	2599507798	65
105	iso_pu_bacteria	2599185189	2599510118	65
106	iso_pu_bacteria	2599185190	2599511416	65
107	iso_pu_bacteria	2599185190	2599514432	65
108	iso_pu_bacteria	2599185190	2599514601	65
109	iso_pu_bacteria	2599185191	2599517468	65
110	iso_pu_bacteria	2599185191	2599517644	65
111	iso_pu_bacteria	2599185191	2599520675	65
112	iso_pu_bacteria	2599185212	2599613309	65
113	iso_pu_bacteria	2599185212	2599616861	65
114	iso_pu_bacteria	2599185248	2599770607	65
115	iso_pu_bacteria	2599185248	2599770980	65
116	iso_pu_bacteria	2599185257	2599803718	65
117	iso_pu_bacteria	2599185257	2599805193	65
118	iso_pu_bacteria	2599185288	2599879872	65
119	iso_pu_bacteria	2599185288	2599880045	65
120	iso_pu_bacteria	2599185288	2599882027	65
121	iso_pu_bacteria	2599185289	2599886128	65
122	iso_pu_bacteria	2599185289	2599886489	65
123	iso_pu_bacteria	2599185290	2599890790	65
124	iso_pu_bacteria	2599185290	2599893808	65
125	iso_pu_bacteria	2599185290	2599894134	65
126	iso_pu_bacteria	2599185291	2599896854	65
127	iso_pu_bacteria	2599185291	2599897843	65
128	iso_pu_bacteria	2599185300	2599931626	65
129	iso_pu_bacteria	2599185302	2599944760	65
130	iso_pu_bacteria	2599185302	2599945633	65
131	iso_pu_bacteria	2599185303	2599948380	65
132	iso_pu_bacteria	2599185303	2599948545	65
133	iso_pu_bacteria	2599185303	2599950077	65
134	iso_pu_bacteria	2599185304	2599956496	65
135	iso_pu_bacteria	2599185304	2599957386	65
136	iso_pu_bacteria	2599185305	2599959612	65
137	iso_pu_bacteria	2599185305	2599960157	65
138	iso_pu_bacteria	2599185306	2599966125	65
139	iso_pu_bacteria	2599185307	2599974990	65
140	iso_pu_bacteria	2599185307	2599975510	65
141	iso_pu_bacteria	2599185308	2599980760	65
142	iso_pu_bacteria	2599185309	2599983631	65
143	iso_pu_bacteria	2599185309	2599986554	65
144	iso_pu_bacteria	2599185310	2599987075	65
145	iso_pu_bacteria	2599185310	2599990038	65
146	iso_pu_bacteria	2599185311	2599995875	65
147	iso_pu_bacteria	2599185311	2599996402	65
148	iso_pu_bacteria	2599185312	2600000516	65
149	iso_pu_bacteria	2599185312	2600002633	65
150	iso_pu_bacteria	2599185313	2600005194	65
151	iso_pu_bacteria	2599185313	2600006458	65
152	iso_pu_bacteria	2599185314	2600014671	65
153	iso_pu_bacteria	2599185315	2600016806	65
154	iso_pu_bacteria	2599185315	2600017657	65
155	iso_pu_bacteria	2599185316	2600024159	65
156	iso_pu_bacteria	2599185316	2600025661	65
157	iso_pu_bacteria	2599185317	2600028701	65
158	iso_pu_bacteria	2599185317	2600031186	65
159	iso_pu_bacteria	2599185318	2600033638	65
160	iso_pu_bacteria	2599185318	2600035342	65
161	iso_pu_bacteria	2599185319	2600040070	65
162	iso_pu_bacteria	2599185319	2600042683	65
163	iso_pu_bacteria	2599185320	2600047653	65
164	iso_pu_bacteria	2599185320	2600050580	65
165	iso_pu_bacteria	2599185321	2600053613	65
166	iso_pu_bacteria	2599185321	2600053701	65
167	iso_pu_bacteria	2599185322	2600058295	65
168	iso_pu_bacteria	2599185322	2600059043	65
169	iso_pu_bacteria	2599185323	2600064030	65
170	iso_pu_bacteria	2599185323	2600064444	65
171	iso_pu_bacteria	2599185324	2600070272	65
172	iso_pu_bacteria	2599185324	2600074681	65
173	iso_pu_bacteria	2599185325	2600077117	65
174	iso_pu_bacteria	2599185325	2600078478	65
175	iso_pu_bacteria	2599185356	2600213631	65
176	iso_pu_bacteria	2599185356	2600214694	65
177	iso_pu_bacteria	2600254930	2600357869	65
178	iso_pu_bacteria	2600254930	2600360126	65
179	iso_pu_bacteria	2600254931	2600363901	65
180	iso_pu_bacteria	2600254931	2600365020	65
181	iso_pu_bacteria	2600254954	2600442517	65
182	iso_pu_bacteria	2600254954	2600443036	65
183	iso_pu_bacteria	2600255283	2601625669	65
184	iso_pu_bacteria	2600255283	2601625978	65
185	iso_pu_bacteria	2600255296	2601691149	65
186	iso_pu_bacteria	2600255313	2601773799	65
187	iso_pu_bacteria	2600255313	2601774601	65
188	iso_pu_bacteria	2600255318	2601796667	65
189	iso_pu_bacteria	2600255318	2601800280	65
190	iso_pu_bacteria	2600255389	2602009486	65
191	iso_pu_bacteria	2600255389	2602012461	65
192	iso_pu_bacteria	2603880185	2606073816	65
193	iso_pu_bacteria	2603880185	2606074454	65
194	iso_pu_bacteria	2603880199	2606126539	65
195	iso_pu_bacteria	2603880199	2606127317	65
196	iso_pu_bacteria	2606217733	2608384649	65
197	iso_pu_bacteria	2616644814	2616701242	65
198	iso_pu_bacteria	2619619299	2621301300	65
199	iso_pu_bacteria	2623620443	2624479032	65
200	iso_pu_bacteria	2623620443	2624482368	65
201	iso_pu_bacteria	2623620446	2624490596	65
202	iso_pu_bacteria	2623620446	2624493969	65
203	iso_pu_bacteria	2627854209	2630650082	65
204	iso_pu_bacteria	2643221562	2643828487	65
205	iso_pu_bacteria	2643221565	2643841382	65
206	iso_pu_bacteria	2643221565	2643845348	65
207	iso_pu_bacteria	2643221571	2643873219	65
208	iso_pu_bacteria	2643221571	2643873766	65
209	iso_pu_bacteria	2643221577	2643895963	65
210	iso_pu_bacteria	2643221579	2643907893	65
211	iso_pu_bacteria	2643221581	2643915896	65
212	iso_pu_bacteria	2643221589	2643952111	65
213	iso_pu_bacteria	2643221589	2643955167	65
214	iso_pu_bacteria	2643221602	2644023520	65
215	iso_pu_bacteria	2643221602	2644024130	65
216	iso_pu_bacteria	2643221633	2644184814	65
217	iso_pu_bacteria	2643221633	2644186357	65
218	iso_pu_bacteria	2643221650	2644282283	65
219	iso_pu_bacteria	2643221650	2644286987	65
220	iso_pu_bacteria	2643221685	2644478145	65
221	iso_pu_bacteria	2643221713	2644624242	65
222	iso_pu_bacteria	2651869719	2652544335	65
223	iso_pu_bacteria	2667528170	2671089936	65
224	iso_pu_bacteria	2667528170	2671092210	65
225	iso_pu_bacteria	2667528171	2671096763	65
226	iso_pu_bacteria	2667528171	2671097839	65
227	iso_pu_bacteria	2667528176	2671125425	65
228	iso_pu_bacteria	2667528176	2671127566	65
229	iso_pu_bacteria	2671180172	2671768072	65
230	iso_pu_bacteria	2671180172	2671770714	65
231	iso_pu_bacteria	2675903420	2677897709	65
232	iso_pu_bacteria	2675903420	2677897827	65
233	iso_pu_bacteria	2675903515	2678261746	65
234	iso_pu_bacteria	2675903515	2678264931	65
235	iso_pu_bacteria	2687453130	2687582537	65
236	iso_pu_bacteria	2713897148	2715750366	65
237	iso_pu_bacteria	2713897148	2715752940	65
238	iso_pu_bacteria	2713897149	2715755243	65
239	iso_pu_bacteria	2713897149	2715758753	65
240	iso_pu_bacteria	2718217725	2718632918	65
241	iso_pu_bacteria	2718217725	2718635547	65
242	iso_pu_bacteria	2721755607	2723247445	65
243	iso_pu_bacteria	2728369097	2729147217	65
244	iso_pu_bacteria	2728369097	2729147809	65
245	iso_pu_bacteria	2738541265	2738673930	65
246	iso_pu_bacteria	2738541271	2738689497	65
247	iso_pu_bacteria	2738541271	2738691488	65
248	iso_pu_bacteria	2738541282	2738752323	65
249	iso_pu_bacteria	2738541294	2738809335	65
250	iso_pu_bacteria	2738541294	2738809516	65
251	iso_pu_bacteria	2738541294	2738811657	65
252	iso_pu_bacteria	2738541303	2738861364	65
253	iso_pu_bacteria	2738541309	2738896695	65
254	iso_pu_bacteria	2738541309	2738896876	65
255	iso_pu_bacteria	2738541309	2738899017	65
256	iso_pu_bacteria	2738543004	2739196735	65
257	iso_pu_bacteria	2738543004	2739198567	65
258	iso_pu_bacteria	2738543015	2739256670	65
259	iso_pu_bacteria	2738543015	2739257710	65
260	iso_pu_bacteria	2738543016	2739265271	65
261	iso_pu_bacteria	2738543016	2739267263	65
262	iso_pu_bacteria	2738543020	2739286298	65
263	iso_pu_bacteria	2738543020	2739286715	65
264	iso_pu_bacteria	2738543021	2739291611	65
265	iso_pu_bacteria	2738543021	2739292028	65
266	iso_pu_bacteria	2738543025	2739312994	65
267	iso_pu_bacteria	2738543025	2739313425	65
268	iso_pu_bacteria	2740892503	2743735869	65
269	iso_pu_bacteria	2740892503	2743739283	65
270	iso_pu_bacteria	2744054620	2745005388	65
271	iso_pu_bacteria	2744054620	2745008095	65
272	iso_pu_bacteria	2747842428	2747948219	65
273	iso_pu_bacteria	2765235840	2765578712	65
274	iso_pu_bacteria	2765235841	2765582163	65
275	iso_pu_bacteria	2765235841	2765585634	65
276	iso_pu_bacteria	2773857670	2774121553	65
277	iso_pu_bacteria	2773857670	2774122283	65
278	iso_pu_bacteria	2773857672	2774128459	65
279	iso_pu_bacteria	2773857673	2774133249	65
280	iso_pu_bacteria	2773857673	2774136172	65
281	iso_pu_bacteria	2784132063	2784260248	65
282	iso_pu_bacteria	2784132063	2784262888	65
283	iso_pu_bacteria	2784132072	2784316121	65
284	iso_pu_bacteria	2791355520	2794594553	65
285	iso_pu_bacteria	2806310737	2807406983	65
286	iso_pu_bacteria	2806310737	2807409976	65
287	iso_pu_bacteria	2806310745	2807455315	65
288	iso_pu_bacteria	2806310745	2807458323	65
289	iso_pu_bacteria	2808606361	2808854631	65
290	iso_pu_bacteria	2808606361	2808856468	65
291	iso_pu_bacteria	2808606373	2808906858	65
292	iso_pu_bacteria	2808606376	2808921726	65
293	iso_pu_bacteria	2808606376	2808924554	65
294	iso_pu_bacteria	2808606377	2808929430	65
295	iso_pu_bacteria	2808606377	2808931360	65
296	iso_pu_bacteria	2808606378	2808934739	65
297	iso_pu_bacteria	2808606378	2808936384	65
298	iso_pu_bacteria	2808606379	2808941080	65
299	iso_pu_bacteria	2808606379	2808943469	65
300	iso_pu_bacteria	2808606380	2808943847	65
301	iso_pu_bacteria	2808606380	2808946613	65
302	iso_pu_bacteria	2808606381	2808951463	65
303	iso_pu_bacteria	2808606381	2808953482	65
304	iso_pu_bacteria	2808606382	2808958689	65
305	iso_pu_bacteria	2808606382	2808960332	65
306	iso_pu_bacteria	2808606383	2808963136	65
307	iso_pu_bacteria	2808606383	2808964805	65
308	iso_pu_bacteria	2808606385	2808975482	65
309	iso_pu_bacteria	2808606385	2808979626	65
310	iso_pu_bacteria	2808606388	2808990879	65
311	iso_pu_bacteria	2808606388	2808995105	65
312	iso_pu_bacteria	2808606389	2808998024	65
313	iso_pu_bacteria	2808606389	2808999697	65
314	iso_pu_bacteria	2808606445	2809216005	65
315	iso_pu_bacteria	2808606445	2809218245	65
316	iso_pu_bacteria	2811994881	2812370836	65
317	iso_pu_bacteria	2816332141	2816516786	65
318	iso_pu_bacteria	2816332141	2816517759	65
319	iso_pu_bacteria	2816332298	2817489336	65
320	iso_pu_bacteria	2818991456	2819656042	65
321	iso_pu_bacteria	2818991456	2819658583	65
322	iso_pu_bacteria	2818991457	2819662899	65
323	iso_pu_bacteria	2818991464	2819701856	65
324	iso_pu_bacteria	2818991464	2819702923	65
325	iso_pu_bacteria	2818991472	2819747243	65
326	iso_pu_bacteria	2823421272	2823422485	65
327	iso_pu_bacteria	2823421272	2823424661	65
328	iso_pu_bacteria	2825651385	2825653527	65
329	iso_pu_bacteria	2825651385	2825656171	65
330	iso_pu_bacteria	2826581358	2826585812	65
331	iso_pu_bacteria	2834028612	2834029238	65
332	iso_pu_bacteria	2834028612	2834031400	65
333	iso_pu_bacteria	2842391507	2842395022	65
334	iso_pu_bacteria	2842780639	2842783704	65
335	iso_pu_bacteria	2842805378	2842805534	65
336	iso_pu_bacteria	2842805378	2842809310	65
337	iso_pu_bacteria	2842815866	2842819489	65
338	iso_pu_bacteria	2842815866	2842820678	65
339	iso_pu_bacteria	2842826826	2842828941	65
340	iso_pu_bacteria	2842826826	2842832117	65
341	iso_pu_bacteria	2842832357	2842833136	65
342	iso_pu_bacteria	2842832357	2842837223	65
343	iso_pu_bacteria	2842837860	2842839852	65
344	iso_pu_bacteria	2842843487	2842845020	65
345	iso_pu_bacteria	2842843487	2842847248	65
346	iso_pu_bacteria	2842849001	2842853291	65
347	iso_pu_bacteria	2842854478	2842856573	65
348	iso_pu_bacteria	2842854478	2842857077	65
349	iso_pu_bacteria	2842918807	2842919831	65
350	iso_pu_bacteria	2844665904	2844668760	65
351	iso_pu_bacteria	2844665904	2844672187	65
352	iso_pu_bacteria	2852612431	2852612614	65
353	iso_pu_bacteria	2852612431	2852615283	65
354	iso_pu_bacteria	2852657418	2852658528	65
355	iso_pu_bacteria	2852657418	2852660892	65
356	iso_pu_bacteria	2852667396	2852669650	65
357	iso_pu_bacteria	2852667396	2852670251	65
358	iso_pu_bacteria	2857442823	2857445993	65
359	iso_pu_bacteria	2860339153	2860340458	65
360	iso_pu_bacteria	2860339153	2860341222	65
361	iso_pu_bacteria	2860867994	2860869293	65
362	iso_pu_bacteria	2860867994	2860872080	65
363	iso_pu_bacteria	2874220319	2874221339	65
364	iso_pu_bacteria	2878029506	2878030990	65
365	iso_pu_bacteria	2878029506	2878034292	65
366	iso_pu_bacteria	2880230671	2880231908	65
367	iso_pu_bacteria	2880230671	2880234920	65
368	iso_pu_bacteria	2894414249	2894416864	65
369	iso_pu_bacteria	2895395659	2895397871	65
370	iso_pu_bacteria	2895498888	2895500572	65
371	iso_pu_bacteria	2895511927	2895515693	65
372	iso_pu_bacteria	2895522137	2895523524	65
373	iso_pu_bacteria	2895525241	2895526311	65
374	iso_pu_bacteria	2904518522	2904520946	65
375	iso_pu_bacteria	2904518522	2904522229	65
376	iso_pu_bacteria	2904550169	2904551704	65
377	iso_pu_bacteria	2904550169	2904551799	65
378	iso_pu_bacteria	2908446538	2908448146	65
379	iso_pu_bacteria	2908446538	2908451582	65
380	iso_pu_bacteria	2912963787	2912964805	65
381	iso_pu_bacteria	2912963787	2912967882	65
382	iso_pu_bacteria	2913036834	2913038098	65
383	iso_pu_bacteria	2913036834	2913041533	65
384	iso_pu_bacteria	2917070673	2917072003	65
385	iso_pu_bacteria	2917070673	2917075534	65
386	iso_pu_bacteria	2917832318	2917834572	65
387	iso_pu_bacteria	2917832318	2917837092	65
388	iso_pu_bacteria	2919063839	2919064496	65
389	iso_pu_bacteria	2919063839	2919066646	65
390	iso_pu_bacteria	2919089067	2919091844	65
391	iso_pu_bacteria	2919125081	2919127029	65
392	iso_pu_bacteria	2919125081	2919127216	65
393	iso_pu_bacteria	2919130084	2919133649	65
394	iso_pu_bacteria	2919134579	2919138540	65
395	iso_pu_bacteria	2919134579	2919138758	65
396	iso_pu_bacteria	2919155634	2919157956	65
397	iso_pu_bacteria	2919155634	2919159332	65
398	iso_pu_bacteria	2919385768	2919386031	65
399	iso_pu_bacteria	2919385768	2919388368	65
400	iso_pu_bacteria	2919456309	2919458116	65
401	iso_pu_bacteria	2919456309	2919459315	65
402	iso_pu_bacteria	2919481497	2919483007	65
403	iso_pu_bacteria	2919481497	2919484465	65
404	iso_pu_bacteria	2919487758	2919490311	65
405	iso_pu_bacteria	2919487758	2919490824	65
406	iso_pu_bacteria	2919501602	2919504392	65
407	iso_pu_bacteria	2919501602	2919505108	65
408	iso_pu_bacteria	2919513703	2919516774	65
409	iso_pu_bacteria	2919675420	2919676534	65
410	iso_pu_bacteria	2919675420	2919676998	65
411	iso_pu_bacteria	2919675420	2919677016	65
412	iso_pu_bacteria	2919697872	2919700113	65
413	iso_pu_bacteria	2919697872	2919701791	65
414	iso_pu_bacteria	2923153595	2923154878	65
415	iso_pu_bacteria	2923153595	2923158367	65
416	iso_pu_bacteria	2923516293	2923518570	65
417	iso_pu_bacteria	2923519811	2923524941	65
418	iso_pu_bacteria	2923586266	2923590783	65
419	iso_pu_bacteria	2923586266	2923591348	65
420	iso_pu_bacteria	2926063275	2926065035	65
421	iso_pu_bacteria	2926063275	2926066785	65
422	iso_pu_bacteria	2928496128	2928496308	65
423	iso_pu_bacteria	2929144301	2929145538	65
424	iso_pu_bacteria	2929144301	2929148875	65
425	iso_pu_bacteria	2929189879	2929191264	65
426	iso_pu_bacteria	2929189879	2929194155	65
427	iso_pu_bacteria	2929195423	2929197296	65
428	iso_pu_bacteria	2931369376	2931371127	65
429	iso_pu_bacteria	2931369376	2931373706	65
430	iso_pu_bacteria	2931380184	2931381007	65
431	iso_pu_bacteria	2931390751	2931392254	65
432	iso_pu_bacteria	2931390751	2931392431	65
433	iso_pu_bacteria	2931396565	2931396957	65
434	iso_pu_bacteria	2931396565	2931399638	65
435	iso_pu_bacteria	2935353572	2935354175	65
436	iso_pu_bacteria	2935353572	2935356520	65
437	iso_pu_bacteria	2937610967	2937612161	65
438	iso_pu_bacteria	2939589442	2939590799	65
439	iso_pu_bacteria	2939611941	2939613716	65
440	iso_pu_bacteria	2939626828	2939629745	65
441	iso_pu_bacteria	2939636861	2939637199	65
442	iso_pu_bacteria	2939636861	2939637875	65
443	iso_pu_bacteria	2939651529	2939652306	65
444	iso_pu_bacteria	2939651529	2939656018	65
445	iso_pu_bacteria	2941489479	2941492096	65
446	iso_pu_bacteria	2945928738	2945929319	65
447	iso_pu_bacteria	2945928738	2945931858	65
448	iso_pu_bacteria	2945961074	2945961501	65
449	iso_pu_bacteria	2945961074	2945965570	65
450	iso_pu_bacteria	2946006987	2946007954	65
451	iso_pu_bacteria	2946006987	2946011592	65
452	iso_pu_bacteria	2946027586	2946029488	65
453	iso_pu_bacteria	2946027586	2946032670	65
454	iso_pu_bacteria	2947233263	2947233431	65
455	iso_pu_bacteria	2947233263	2947236077	65
456	iso_pu_bacteria	2953994433	2953995130	65
457	iso_pu_bacteria	2961047084	2961048105	65
458	iso_pu_bacteria	2961064222	2961065123	65
459	iso_pu_bacteria	2969304461	2969305817	65
460	iso_pu_bacteria	2969304461	2969309074	65
461	iso_pu_bacteria	2974289157	2974289558	65
462	iso_pu_bacteria	2974289157	2974292567	65
463	iso_pu_bacteria	2974298342	2974299391	65
464	iso_pu_bacteria	2974307012	2974309172	65
465	iso_pu_bacteria	2977247770	2977249890	65
466	iso_pu_bacteria	2984286254	2984287825	65
467	iso_pu_bacteria	2984286254	2984291153	65
468	iso_pu_bacteria	2984499530	2984501738	65
469	iso_pu_bacteria	2984504281	2984504777	65
470	iso_pu_bacteria	2984504281	2984506950	65
471	iso_pu_bacteria	2984514374	2984515620	65
472	iso_pu_bacteria	2987605356	2987607211	65
473	iso_pu_bacteria	2988728565	2988730449	65
474	iso_pu_bacteria	2988728565	2988733089	65
475	iso_pu_bacteria	2990196909	2990200402	65
476	iso_pu_bacteria	2990196909	2990200677	65
477	iso_pu_bacteria	2995948881	2995949429	65
478	iso_pu_bacteria	2998139840	2998141240	65
479	iso_pu_bacteria	2998139840	2998144358	65
480	iso_pu_bacteria	3007252601	3007253796	65
481	iso_pu_bacteria	3007252601	3007253850	65
482	iso_pu_bacteria	3007315729	3007317410	65
483	iso_pu_bacteria	3007315729	3007317464	65
484	iso_pu_bacteria	3007395558	3007397656	65
485	iso_pu_bacteria	3007395558	3007400398	65
486	iso_pu_bacteria	3007419365	3007420844	65
487	iso_pu_bacteria	3007419365	3007424840	65
488	iso_pu_bacteria	3007511990	3007512610	65
489	iso_pu_bacteria	3007511990	3007516139	65
490	iso_pu_bacteria	3007614139	3007615004	65
491	iso_pu_bacteria	3007614139	3007619211	65
492	iso_pu_bacteria	3007619802	3007620393	65
493	iso_pu_bacteria	3007619802	3007623082	65
494	iso_pu_bacteria	3007718800	3007720077	65
495	iso_pu_bacteria	3007718800	3007720974	65
496	iso_pu_bacteria	3007803356	3007805056	65
497	iso_pu_bacteria	3007803356	3007806086	65
498	iso_pu_bacteria	3007855910	3007858660	65
499	iso_pu_bacteria	3007855910	3007860333	65
500	iso_pu_bacteria	3007861166	3007863527	65
501	iso_pu_bacteria	3007861166	3007865312	65
502	iso_pu_bacteria	3007861166	3007865812	65
503	iso_pu_bacteria	3007866637	3007867784	65
504	iso_pu_bacteria	3007866637	3007871591	65
505	iso_pu_bacteria	3007872151	3007872737	65
506	iso_pu_bacteria	3007872151	3007874573	65
507	iso_pu_bacteria	637000220	637318600	65
508	iso_pu_bacteria	637000220	637321981	65
509	iso_pu_bacteria	640427133	640487220	65
510	iso_pu_bacteria	640427133	640488998	65
511	iso_pu_bacteria	651053060	651175164	65
512	iso_pu_bacteria	651053060	651177088	65
513	iso_pu_bacteria	8011350971	8011353867	65
514	iso_pu_bacteria	8015687852	8015689110	65
515	iso_pu_bacteria	8015687852	8015692443	65
516	iso_pu_bacteria	8016728285	8016730987	65
517	iso_pu_bacteria	8016728285	8016733406	65
518	iso_pu_bacteria	8019769354	8019770801	65
519	iso_pu_bacteria	8019769354	8019773885	65
520	iso_pu_bacteria	8019775933	8019776780	65
521	iso_pu_bacteria	8019775933	8019780687	65
522	iso_pu_bacteria	8029995093	8029996522	65
523	iso_pu_bacteria	8029995093	8029999507	65
524	iso_pu_bacteria	8034962539	8034962646	65
525	iso_pu_bacteria	8034962539	8034964228	65
526	iso_pu_bacteria	8052494512	8052498832	65
527	iso_pu_bacteria	8052494512	8052498947	65
528	iso_pu_bacteria	8054285046	8054285567	65
529	iso_pu_bacteria	8054285046	8054286690	65
530	iso_pu_bacteria	8054347763	8054348313	65
531	iso_pu_bacteria	8054347763	8054351274	65
532	iso_pu_bacteria	8054503363	8054504828	65
533	iso_pu_bacteria	8054503363	8054507973	65
534	iso_pu_bacteria	8054929484	8054933299	65
535	iso_pu_bacteria	8054929484	8054934451	65
536	iso_pu_bacteria	8055770955	8055772229	65
537	iso_pu_bacteria	8055770955	8055775662	65
538	iso_pu_bacteria	8055817908	8055819273	65
539	iso_pu_bacteria	8055817908	8055822941	65
540	iso_pu_bacteria	8055878733	8055883345	65
541	iso_pu_bacteria	8055878733	8055884130	65
542	iso_pu_bacteria	8056115690	8056117497	65
543	iso_pu_bacteria	8056120720	8056121832	65
544	iso_pu_bacteria	8056120720	8056124805	65
545	iso_pu_bacteria	8056125926	8056127290	65
546	iso_pu_bacteria	8056125926	8056130649	65
547	iso_pu_bacteria	8056131705	8056133192	65
548	iso_pu_bacteria	8056131705	8056136341	65
549	iso_pu_bacteria	8056137416	8056138638	65
550	iso_pu_bacteria	8056137416	8056141948	65
551	iso_pu_bacteria	8056143049	8056144527	65
552	iso_pu_bacteria	8056143049	8056147731	65
553	iso_pu_bacteria	8056148874	8056149439	65
554	iso_pu_bacteria	8056148874	8056153639	65
555	iso_pu_bacteria	8056155041	8056155340	65
556	iso_pu_bacteria	8056155041	8056159534	65
557	iso_pu_bacteria	8056161164	8056162599	65
558	iso_pu_bacteria	8056161164	8056164601	65
559	iso_pu_bacteria	8056166840	8056166905	65
560	iso_pu_bacteria	8056166840	8056169817	65
561	iso_pu_bacteria	8056172158	8056172890	65
562	iso_pu_bacteria	8056172158	8056175927	65
563	iso_pu_bacteria	8056177738	8056180370	65
564	iso_pu_bacteria	8056177738	8056183264	65
565	iso_pu_bacteria	8056569372	8056569900	65
566	iso_pu_bacteria	8056569372	8056572432	65
567	iso_pu_bacteria	8057798959	8057803553	65
568	iso_pu_bacteria	8057798959	8057804521	65
569	3300000546	LJNas_1000537	LJNas_10005374	66
570	3300001976	JGI24752J21851_1007937	JGI24752J21851_10079371	66
571	3300001977	JGI24746J21847_1047156	JGI24746J21847_10471561	66
572	3300001979	JGI24740J21852_10174118	JGI24740J21852_101741181	66
573	3300001989	JGI24739J22299_10223195	JGI24739J22299_102231951	66
574	3300001990	JGI24737J22298_10020425	JGI24737J22298_100204253	66
575	3300001991	JGI24743J22301_10001525	JGI24743J22301_100015256	66
576	3300002073	JGI24745J21846_1042922	JGI24745J21846_10429221	66
577	3300002074	JGI24748J21848_1005076	JGI24748J21848_10050762	66
578	3300002076	JGI24749J21850_1018066	JGI24749J21850_10180661	66
579	3300002126	JGI24035J26624_1030081	JGI24035J26624_10300811	66
580	3300002155	JGI24033J26618_1010641	JGI24033J26618_10106411	66
581	3300002239	JGI24034J26672_10057963	JGI24034J26672_100579631	66
582	3300002244	JGI24742J22300_10077282	JGI24742J22300_100772821	66
583	3300002459	JGI24751J29686_10042892	JGI24751J29686_100428922	66
584	3300003320	rootH2_10016961	rootH2_100169616	66
585	3300003323	rootH1_10015409	rootH1_100154093	66
586	3300003373	JGI25407J50210_10019913	JGI25407J50210_100199133	66
587	3300005289	Ga0065704_10575586	Ga0065704_105755862	66
588	3300005290	Ga0065712_10007051	Ga0065712_100070512	66
589	3300005293	Ga0065715_10262662	Ga0065715_102626622	66
590	3300005293	Ga0065715_10605238	Ga0065715_106052381	66
591	3300005293	Ga0065715_10627484	Ga0065715_106274842	66
592	3300005295	Ga0065707_10409039	Ga0065707_104090392	66
593	3300005327	Ga0070658_10023584	Ga0070658_100235844	66
594	3300005327	Ga0070658_10145769	Ga0070658_101457692	66
595	3300005328	Ga0070676_10008726	Ga0070676_100087264	66
596	3300005328	Ga0070676_10436134	Ga0070676_104361341	66
597	3300005328	Ga0070676_11009789	Ga0070676_110097891	66
598	3300005329	Ga0070683_100000480	Ga0070683_10000048013	66
599	3300005330	Ga0070690_100008224	Ga0070690_1000082246	66
600	3300005331	Ga0070670_100008310	Ga0070670_1000083107	66
601	3300005331	Ga0070670_100128916	Ga0070670_1001289163	66
602	3300005331	Ga0070670_100506044	Ga0070670_1005060441	66
603	3300005333	Ga0070677_10413671	Ga0070677_104136711	66
604	3300005334	Ga0068869_100060522	Ga0068869_1000605224	66
605	3300005334	Ga0068869_100120389	Ga0068869_1001203892	66
606	3300005334	Ga0068869_100227170	Ga0068869_1002271702	66
607	3300005335	Ga0070666_10020201	Ga0070666_100202013	66
608	3300005335	Ga0070666_10242647	Ga0070666_102426471	66
609	3300005335	Ga0070666_10435863	Ga0070666_104358632	66
610	3300005335	Ga0070666_10923064	Ga0070666_109230641	66
611	3300005336	Ga0070680_100295213	Ga0070680_1002952132	66
612	3300005337	Ga0070682_100002905	Ga0070682_1000029059	66
613	3300005337	Ga0070682_100038059	Ga0070682_1000380592	66
614	3300005338	Ga0068868_100009755	Ga0068868_1000097554	66
615	3300005338	Ga0068868_100011952	Ga0068868_1000119522	66
616	3300005338	Ga0068868_100046578	Ga0068868_1000465784	66
617	3300005338	Ga0068868_100051661	Ga0068868_1000516613	66
618	3300005338	Ga0068868_100714372	Ga0068868_1007143721	66
619	3300005339	Ga0070660_100005909	Ga0070660_1000059097	66
620	3300005339	Ga0070660_100575546	Ga0070660_1005755462	66
621	3300005340	Ga0070689_100045991	Ga0070689_1000459913	66
622	3300005343	Ga0070687_100004085	Ga0070687_1000040852	66
623	3300005343	Ga0070687_100316848	Ga0070687_1003168482	66
624	3300005343	Ga0070687_100558159	Ga0070687_1005581591	66
625	3300005344	Ga0070661_100005169	Ga0070661_1000051695	66
626	3300005344	Ga0070661_100753315	Ga0070661_1007533151	66
627	3300005345	Ga0070692_10122772	Ga0070692_101227723	66
628	3300005347	Ga0070668_100012646	Ga0070668_1000126467	66
629	3300005353	Ga0070669_100022083	Ga0070669_1000220832	66
630	3300005354	Ga0070675_100019633	Ga0070675_1000196337	66
631	3300005354	Ga0070675_100513237	Ga0070675_1005132371	66
632	3300005355	Ga0070671_100073774	Ga0070671_1000737742	66
633	3300005355	Ga0070671_100778124	Ga0070671_1007781241	66
634	3300005355	Ga0070671_101365293	Ga0070671_1013652931	66
635	3300005356	Ga0070674_100020531	Ga0070674_1000205315	66
636	3300005356	Ga0070674_100867680	Ga0070674_1008676802	66
637	3300005364	Ga0070673_100039122	Ga0070673_1000391225	66
638	3300005364	Ga0070673_100082713	Ga0070673_1000827132	66
639	3300005364	Ga0070673_100550278	Ga0070673_1005502781	66
640	3300005365	Ga0070688_100003220	Ga0070688_1000032207	66
641	3300005365	Ga0070688_100185632	Ga0070688_1001856322	66
642	3300005366	Ga0070659_100015947	Ga0070659_1000159476	66
643	3300005366	Ga0070659_100137352	Ga0070659_1001373522	66
644	3300005367	Ga0070667_100488077	Ga0070667_1004880772	66
645	3300005367	Ga0070667_100580919	Ga0070667_1005809191	66
646	3300005367	Ga0070667_101509777	Ga0070667_1015097772	66
647	3300005367	Ga0070667_101601643	Ga0070667_1016016432	66
648	3300005367	Ga0070667_101726034	Ga0070667_1017260341	66
649	3300005434	Ga0070709_10060875	Ga0070709_100608753	66
650	3300005434	Ga0070709_10073011	Ga0070709_100730112	66
651	3300005434	Ga0070709_10228977	Ga0070709_102289771	66
652	3300005434	Ga0070709_10816874	Ga0070709_108168742	66
653	3300005434	Ga0070709_10868952	Ga0070709_108689521	66
654	3300005434	Ga0070709_11174952	Ga0070709_111749522	66
655	3300005434	Ga0070709_11704193	Ga0070709_117041931	66
656	3300005435	Ga0070714_100040834	Ga0070714_1000408342	66
657	3300005435	Ga0070714_100283463	Ga0070714_1002834632	66
658	3300005435	Ga0070714_100474855	Ga0070714_1004748552	66
659	3300005435	Ga0070714_101389283	Ga0070714_1013892832	66
660	3300005435	Ga0070714_101433079	Ga0070714_1014330791	66
661	3300005435	Ga0070714_101656914	Ga0070714_1016569141	66
662	3300005435	Ga0070714_101740025	Ga0070714_1017400251	66
663	3300005436	Ga0070713_100069214	Ga0070713_1000692142	66
664	3300005436	Ga0070713_100085120	Ga0070713_1000851203	66
665	3300005436	Ga0070713_100141666	Ga0070713_1001416664	66
666	3300005436	Ga0070713_100250486	Ga0070713_1002504862	66
667	3300005436	Ga0070713_100320243	Ga0070713_1003202431	66
668	3300005436	Ga0070713_100519325	Ga0070713_1005193252	66
669	3300005437	Ga0070710_10001952	Ga0070710_100019528	66
670	3300005437	Ga0070710_10033126	Ga0070710_100331261	66
671	3300005437	Ga0070710_10225128	Ga0070710_102251282	66
672	3300005437	Ga0070710_10837659	Ga0070710_108376591	66
673	3300005438	Ga0070701_10016280	Ga0070701_100162805	66
674	3300005438	Ga0070701_10492970	Ga0070701_104929701	66
675	3300005439	Ga0070711_100031931	Ga0070711_1000319314	66
676	3300005439	Ga0070711_100046593	Ga0070711_1000465933	66
677	3300005439	Ga0070711_100505712	Ga0070711_1005057122	66
678	3300005439	Ga0070711_100701386	Ga0070711_1007013862	66
679	3300005439	Ga0070711_100758134	Ga0070711_1007581342	66
680	3300005439	Ga0070711_101043390	Ga0070711_1010433901	66
681	3300005440	Ga0070705_100170233	Ga0070705_1001702333	66
682	3300005440	Ga0070705_100858111	Ga0070705_1008581111	66
683	3300005445	Ga0070708_100001577	Ga0070708_1000015773	66
684	3300005445	Ga0070708_100020736	Ga0070708_1000207367	66
685	3300005445	Ga0070708_100039485	Ga0070708_1000394853	66
686	3300005445	Ga0070708_100092563	Ga0070708_1000925633	66
687	3300005445	Ga0070708_100098504	Ga0070708_1000985042	66
688	3300005445	Ga0070708_100119178	Ga0070708_1001191782	66
689	3300005445	Ga0070708_100448592	Ga0070708_1004485922	66
690	3300005445	Ga0070708_101194068	Ga0070708_1011940682	66
691	3300005445	Ga0070708_101335294	Ga0070708_1013352941	66
692	3300005455	Ga0070663_100010760	Ga0070663_1000107608	66
693	3300005455	Ga0070663_100450359	Ga0070663_1004503591	66
694	3300005455	Ga0070663_101015470	Ga0070663_1010154701	66
695	3300005456	Ga0070678_100010887	Ga0070678_1000108871	66
696	3300005456	Ga0070678_100206396	Ga0070678_1002063962	66
697	3300005456	Ga0070678_100827669	Ga0070678_1008276691	66
698	3300005456	Ga0070678_100985527	Ga0070678_1009855271	66
699	3300005457	Ga0070662_100079672	Ga0070662_1000796724	66
700	3300005457	Ga0070662_100246691	Ga0070662_1002466913	66
701	3300005458	Ga0070681_10085350	Ga0070681_100853505	66
702	3300005458	Ga0070681_10109738	Ga0070681_101097383	66
703	3300005458	Ga0070681_10154657	Ga0070681_101546573	66
704	3300005458	Ga0070681_10805194	Ga0070681_108051941	66
705	3300005458	Ga0070681_11252303	Ga0070681_112523031	66
706	3300005459	Ga0068867_100025261	Ga0068867_1000252612	66
707	3300005459	Ga0068867_100162280	Ga0068867_1001622803	66
708	3300005459	Ga0068867_100210574	Ga0068867_1002105742	66
709	3300005459	Ga0068867_101428719	Ga0068867_1014287191	66
710	3300005466	Ga0070685_10000888	Ga0070685_100008883	66
711	3300005466	Ga0070685_10481090	Ga0070685_104810901	66
712	3300005467	Ga0070706_100018240	Ga0070706_1000182403	66
713	3300005467	Ga0070706_100153563	Ga0070706_1001535632	66
714	3300005467	Ga0070706_100188489	Ga0070706_1001884893	66
715	3300005467	Ga0070706_100208226	Ga0070706_1002082262	66
716	3300005467	Ga0070706_100406358	Ga0070706_1004063582	66
717	3300005467	Ga0070706_100443662	Ga0070706_1004436621	66
718	3300005468	Ga0070707_100001982	Ga0070707_1000019822	66
719	3300005468	Ga0070707_100023559	Ga0070707_1000235595	66
720	3300005468	Ga0070707_100087462	Ga0070707_1000874623	66
721	3300005468	Ga0070707_100253013	Ga0070707_1002530133	66
722	3300005468	Ga0070707_100277923	Ga0070707_1002779231	66
723	3300005468	Ga0070707_100299122	Ga0070707_1002991222	66
724	3300005468	Ga0070707_100428713	Ga0070707_1004287131	66
725	3300005468	Ga0070707_100492567	Ga0070707_1004925672	66
726	3300005468	Ga0070707_100966192	Ga0070707_1009661921	66
727	3300005471	Ga0070698_100009342	Ga0070698_1000093426	66
728	3300005471	Ga0070698_100682487	Ga0070698_1006824872	66
729	3300005471	Ga0070698_101191523	Ga0070698_1011915232	66
730	3300005518	Ga0070699_100001432	Ga0070699_1000014323	66
731	3300005518	Ga0070699_100023314	Ga0070699_1000233142	66
732	3300005518	Ga0070699_100039521	Ga0070699_1000395212	66
733	3300005518	Ga0070699_100169639	Ga0070699_1001696392	66
734	3300005518	Ga0070699_101271930	Ga0070699_1012719302	66
735	3300005530	Ga0070679_100049320	Ga0070679_1000493205	66
736	3300005530	Ga0070679_100765336	Ga0070679_1007653362	66
737	3300005535	Ga0070684_100001628	Ga0070684_10000162810	66
738	3300005535	Ga0070684_101203207	Ga0070684_1012032071	66
739	3300005536	Ga0070697_100000488	Ga0070697_1000004885	66
740	3300005536	Ga0070697_100003392	Ga0070697_1000033923	66
741	3300005536	Ga0070697_100015789	Ga0070697_1000157893	66
742	3300005536	Ga0070697_101197833	Ga0070697_1011978332	66
743	3300005536	Ga0070697_102021976	Ga0070697_1020219762	66
744	3300005539	Ga0068853_100007273	Ga0068853_1000072731	66
745	3300005539	Ga0068853_100089372	Ga0068853_1000893722	66
746	3300005539	Ga0068853_100190260	Ga0068853_1001902603	66
747	3300005543	Ga0070672_100055330	Ga0070672_1000553304	66
748	3300005543	Ga0070672_100545034	Ga0070672_1005450341	66
749	3300005544	Ga0070686_100023280	Ga0070686_1000232805	66
750	3300005544	Ga0070686_101051439	Ga0070686_1010514392	66
751	3300005545	Ga0070695_100554437	Ga0070695_1005544372	66
752	3300005546	Ga0070696_100162955	Ga0070696_1001629554	66
753	3300005546	Ga0070696_100245167	Ga0070696_1002451672	66
754	3300005546	Ga0070696_100532364	Ga0070696_1005323642	66
755	3300005546	Ga0070696_100865012	Ga0070696_1008650121	66
756	3300005547	Ga0070693_100165052	Ga0070693_1001650521	66
757	3300005547	Ga0070693_100599378	Ga0070693_1005993782	66
758	3300005547	Ga0070693_100961424	Ga0070693_1009614241	66
759	3300005547	Ga0070693_101149555	Ga0070693_1011495551	66
760	3300005547	Ga0070693_101571402	Ga0070693_1015714021	66
761	3300005547	Ga0070693_101672055	Ga0070693_1016720551	66
762	3300005548	Ga0070665_100172334	Ga0070665_1001723343	66
763	3300005548	Ga0070665_100616924	Ga0070665_1006169241	66
764	3300005548	Ga0070665_102521952	Ga0070665_1025219521	66
765	3300005563	Ga0068855_100003012	Ga0068855_10000301216	66
766	3300005563	Ga0068855_100120157	Ga0068855_1001201575	66
767	3300005563	Ga0068855_100294872	Ga0068855_1002948723	66
768	3300005564	Ga0070664_100083674	Ga0070664_1000836741	66
769	3300005564	Ga0070664_100108355	Ga0070664_1001083554	66
770	3300005564	Ga0070664_100419789	Ga0070664_1004197893	66
771	3300005577	Ga0068857_100012083	Ga0068857_1000120837	66
772	3300005577	Ga0068857_100042098	Ga0068857_1000420985	66
773	3300005577	Ga0068857_100454655	Ga0068857_1004546551	66
774	3300005578	Ga0068854_100067943	Ga0068854_1000679432	66
775	3300005578	Ga0068854_100247011	Ga0068854_1002470111	66
776	3300005578	Ga0068854_100812164	Ga0068854_1008121642	66
777	3300005578	Ga0068854_101199204	Ga0068854_1011992042	66
778	3300005578	Ga0068854_101291595	Ga0068854_1012915951	66
779	3300005614	Ga0068856_100034566	Ga0068856_1000345667	66
780	3300005614	Ga0068856_100123164	Ga0068856_1001231643	66
781	3300005614	Ga0068856_100162769	Ga0068856_1001627692	66
782	3300005615	Ga0070702_100046821	Ga0070702_1000468213	66
783	3300005615	Ga0070702_100086814	Ga0070702_1000868141	66
784	3300005615	Ga0070702_100311785	Ga0070702_1003117852	66
785	3300005615	Ga0070702_101742694	Ga0070702_1017426941	66
786	3300005616	Ga0068852_100011379	Ga0068852_1000113797	66
787	3300005616	Ga0068852_100186991	Ga0068852_1001869912	66
788	3300005616	Ga0068852_100393962	Ga0068852_1003939623	66
789	3300005616	Ga0068852_102169115	Ga0068852_1021691152	66
790	3300005617	Ga0068859_100022541	Ga0068859_1000225413	66
791	3300005617	Ga0068859_102428329	Ga0068859_1024283292	66
792	3300005618	Ga0068864_100321461	Ga0068864_1003214611	66
793	3300005618	Ga0068864_100565326	Ga0068864_1005653262	66
794	3300005718	Ga0068866_10018617	Ga0068866_100186172	66
795	3300005718	Ga0068866_10109454	Ga0068866_101094543	66
796	3300005718	Ga0068866_10797920	Ga0068866_107979202	66
797	3300005719	Ga0068861_100063032	Ga0068861_1000630322	66
798	3300005834	Ga0068851_10009484	Ga0068851_100094846	66
799	3300005834	Ga0068851_10062567	Ga0068851_100625673	66
800	3300005834	Ga0068851_11043760	Ga0068851_110437601	66
801	3300005840	Ga0068870_10003565	Ga0068870_100035657	66
802	3300005841	Ga0068863_100043264	Ga0068863_1000432642	66
803	3300005841	Ga0068863_100046772	Ga0068863_1000467724	66
804	3300005841	Ga0068863_100630481	Ga0068863_1006304812	66
805	3300005841	Ga0068863_100796306	Ga0068863_1007963062	66
806	3300005842	Ga0068858_100000940	Ga0068858_10000094016	66
807	3300005842	Ga0068858_100032974	Ga0068858_1000329743	66
808	3300005842	Ga0068858_100117391	Ga0068858_1001173912	66
809	3300005843	Ga0068860_100080630	Ga0068860_1000806302	66
810	3300005843	Ga0068860_100204525	Ga0068860_1002045252	66
811	3300005843	Ga0068860_101860948	Ga0068860_1018609481	66
812	3300005843	Ga0068860_102162198	Ga0068860_1021621981	66
813	3300005844	Ga0068862_100002744	Ga0068862_10000274412	66
814	3300005844	Ga0068862_100101081	Ga0068862_1001010812	66
815	3300005937	Ga0081455_10147396	Ga0081455_101473962	66
816	3300005981	Ga0081538_10111050	Ga0081538_101110503	66
817	3300005983	Ga0081540_1063714	Ga0081540_10637144	66
818	3300005983	Ga0081540_1092912	Ga0081540_10929122	66
819	3300006028	Ga0070717_10003516	Ga0070717_100035167	66
820	3300006028	Ga0070717_10005479	Ga0070717_1000547911	66
821	3300006028	Ga0070717_10015655	Ga0070717_100156554	66
822	3300006028	Ga0070717_10018069	Ga0070717_100180694	66
823	3300006028	Ga0070717_10107944	Ga0070717_101079442	66
824	3300006028	Ga0070717_10291342	Ga0070717_102913421	66
825	3300006028	Ga0070717_10594655	Ga0070717_105946551	66
826	3300006028	Ga0070717_10664023	Ga0070717_106640232	66
827	3300006028	Ga0070717_10703078	Ga0070717_107030782	66
828	3300006028	Ga0070717_10871598	Ga0070717_108715982	66
829	3300006028	Ga0070717_11059338	Ga0070717_110593381	66
830	3300006048	Ga0075363_100000215	Ga0075363_1000002155	66
831	3300006051	Ga0075364_10185836	Ga0075364_101858363	66
832	3300006163	Ga0070715_10011304	Ga0070715_100113044	66
833	3300006163	Ga0070715_10199366	Ga0070715_101993662	66
834	3300006173	Ga0070716_100000590	Ga0070716_1000005908	66
835	3300006173	Ga0070716_100102464	Ga0070716_1001024643	66
836	3300006173	Ga0070716_100223086	Ga0070716_1002230862	66
837	3300006173	Ga0070716_100290110	Ga0070716_1002901102	66
838	3300006173	Ga0070716_100444398	Ga0070716_1004443981	66
839	3300006173	Ga0070716_101011782	Ga0070716_1010117821	66
840	3300006173	Ga0070716_101218460	Ga0070716_1012184601	66
841	3300006173	Ga0070716_101286332	Ga0070716_1012863321	66
842	3300006175	Ga0070712_100028140	Ga0070712_1000281403	66
843	3300006175	Ga0070712_100259079	Ga0070712_1002590792	66
844	3300006175	Ga0070712_100515802	Ga0070712_1005158022	66
845	3300006175	Ga0070712_101238096	Ga0070712_1012380963	66
846	3300006175	Ga0070712_101764739	Ga0070712_1017647392	66
847	3300006177	Ga0075362_10000026	Ga0075362_100000262	66
848	3300006178	Ga0075367_10279233	Ga0075367_102792332	66
849	3300006186	Ga0075369_10038429	Ga0075369_100384292	66
850	3300006195	Ga0075366_10000187	Ga0075366_100001875	66
851	3300006237	Ga0097621_100007053	Ga0097621_1000070533	66
852	3300006237	Ga0097621_100072360	Ga0097621_1000723602	66
853	3300006237	Ga0097621_100201409	Ga0097621_1002014092	66
854	3300006237	Ga0097621_100288371	Ga0097621_1002883712	66
855	3300006237	Ga0097621_100294772	Ga0097621_1002947722	66
856	3300006237	Ga0097621_100420048	Ga0097621_1004200482	66
857	3300006237	Ga0097621_101650386	Ga0097621_1016503862	66
858	3300006353	Ga0075370_10000035	Ga0075370_1000003516	66
859	3300006358	Ga0068871_100021461	Ga0068871_1000214613	66
860	3300006358	Ga0068871_100054783	Ga0068871_1000547832	66
861	3300006358	Ga0068871_100152956	Ga0068871_1001529561	66
862	3300006358	Ga0068871_100155816	Ga0068871_1001558164	66
863	3300006358	Ga0068871_100316501	Ga0068871_1003165012	66
864	3300006358	Ga0068871_100393403	Ga0068871_1003934032	66
865	3300006358	Ga0068871_100413934	Ga0068871_1004139342	66
866	3300006844	Ga0075428_100038819	Ga0075428_1000388194	66
867	3300006844	Ga0075428_101767397	Ga0075428_1017673972	66
868	3300006852	Ga0075433_10016225	Ga0075433_100162256	66
869	3300006852	Ga0075433_10018873	Ga0075433_100188731	66
870	3300006852	Ga0075433_10580980	Ga0075433_105809802	66
871	3300006871	Ga0075434_100000594	Ga0075434_10000059418	66
872	3300006871	Ga0075434_100000934	Ga0075434_10000093414	66
873	3300006871	Ga0075434_100003422	Ga0075434_10000342210	66
874	3300006871	Ga0075434_100014866	Ga0075434_1000148662	66
875	3300006871	Ga0075434_100401930	Ga0075434_1004019301	66
876	3300006871	Ga0075434_100653413	Ga0075434_1006534132	66
877	3300006871	Ga0075434_100829020	Ga0075434_1008290202	66
878	3300006881	Ga0068865_100011703	Ga0068865_1000117032	66
879	3300006881	Ga0068865_100286707	Ga0068865_1002867072	66
880	3300006881	Ga0068865_100821761	Ga0068865_1008217612	66
881	3300006914	Ga0075436_100001972	Ga0075436_10000197211	66
882	3300006914	Ga0075436_100007930	Ga0075436_1000079306	66
883	3300006914	Ga0075436_100024376	Ga0075436_1000243762	66
884	3300006914	Ga0075436_100025173	Ga0075436_1000251736	66
885	3300006914	Ga0075436_100332497	Ga0075436_1003324972	66
886	3300006914	Ga0075436_100610877	Ga0075436_1006108772	66
887	3300006931	Ga0097620_100022541	Ga0097620_1000225413	66
888	3300006931	Ga0097620_102428315	Ga0097620_1024283152	66
889	3300007076	Ga0075435_100000208	Ga0075435_10000020818	66
890	3300007076	Ga0075435_100006088	Ga0075435_1000060882	66
891	3300007076	Ga0075435_100211651	Ga0075435_1002116512	66
892	3300007076	Ga0075435_100423340	Ga0075435_1004233402	66
893	3300007076	Ga0075435_100525961	Ga0075435_1005259612	66
894	3300007265	Ga0099794_10752335	Ga0099794_107523351	66
895	3300007788	Ga0099795_10423035	Ga0099795_104230352	66
896	3300009011	Ga0105251_10050875	Ga0105251_100508751	66
897	3300009011	Ga0105251_10059144	Ga0105251_100591443	66
898	3300009036	Ga0105244_10458006	Ga0105244_104580061	66
899	3300009036	Ga0105244_10575492	Ga0105244_105754921	66
900	3300009092	Ga0105250_10048269	Ga0105250_100482692	66
901	3300009093	Ga0105240_10044964	Ga0105240_100449645	66
902	3300009093	Ga0105240_10117121	Ga0105240_101171212	66
903	3300009093	Ga0105240_10165320	Ga0105240_101653204	66
904	3300009093	Ga0105240_10870042	Ga0105240_108700422	66
905	3300009094	Ga0111539_10582226	Ga0111539_105822263	66
906	3300009094	Ga0111539_11487241	Ga0111539_114872411	66
907	3300009098	Ga0105245_10017626	Ga0105245_100176269	66
908	3300009098	Ga0105245_10114922	Ga0105245_101149222	66
909	3300009098	Ga0105245_10652730	Ga0105245_106527303	66
910	3300009098	Ga0105245_12399734	Ga0105245_123997341	66
911	3300009101	Ga0105247_10001626	Ga0105247_100016264	66
912	3300009101	Ga0105247_10174401	Ga0105247_101744011	66
913	3300009101	Ga0105247_10240891	Ga0105247_102408912	66
914	3300009147	Ga0114129_10028292	Ga0114129_1002829210	66
915	3300009147	Ga0114129_10171475	Ga0114129_101714753	66
916	3300009147	Ga0114129_10564879	Ga0114129_105648793	66
917	3300009147	Ga0114129_12796522	Ga0114129_127965221	66
918	3300009148	Ga0105243_12585106	Ga0105243_125851061	66
919	3300009174	Ga0105241_10015494	Ga0105241_100154943	66
920	3300009174	Ga0105241_10055910	Ga0105241_100559102	66
921	3300009174	Ga0105241_10093194	Ga0105241_100931942	66
922	3300009174	Ga0105241_12209041	Ga0105241_122090411	66
923	3300009176	Ga0105242_10037301	Ga0105242_100373014	66
924	3300009176	Ga0105242_10312989	Ga0105242_103129892	66
925	3300009177	Ga0105248_10074642	Ga0105248_100746422	66
926	3300009177	Ga0105248_10101151	Ga0105248_101011512	66
927	3300009177	Ga0105248_10116081	Ga0105248_101160812	66
928	3300009177	Ga0105248_10421360	Ga0105248_104213603	66
929	3300009177	Ga0105248_10447137	Ga0105248_104471373	66
930	3300009545	Ga0105237_10017049	Ga0105237_100170495	66
931	3300009545	Ga0105237_10079744	Ga0105237_100797444	66
932	3300009545	Ga0105237_10095020	Ga0105237_100950203	66
933	3300009545	Ga0105237_10276200	Ga0105237_102762001	66
934	3300009551	Ga0105238_10072059	Ga0105238_100720594	66
935	3300009551	Ga0105238_12184900	Ga0105238_121849001	66
936	3300009553	Ga0105249_10068709	Ga0105249_100687091	66
937	3300010159	Ga0099796_10427190	Ga0099796_104271901	66
938	3300010375	Ga0105239_10006319	Ga0105239_100063199	66
939	3300010375	Ga0105239_10028030	Ga0105239_100280307	66
940	3300010375	Ga0105239_10526194	Ga0105239_105261942	66
941	3300010375	Ga0105239_10879991	Ga0105239_108799912	66
942	3300010375	Ga0105239_11074504	Ga0105239_110745041	66
943	3300011119	Ga0105246_10025608	Ga0105246_100256082	66
944	3300011119	Ga0105246_10087205	Ga0105246_100872051	66
945	3300011119	Ga0105246_10487073	Ga0105246_104870732	66
946	3300012482	Ga0157318_1002084	Ga0157318_10020842	66
947	3300012502	Ga0157347_1034727	Ga0157347_10347271	66
948	3300012502	Ga0157347_1046081	Ga0157347_10460812	66
949	3300012513	Ga0157326_1028892	Ga0157326_10288922	66
950	3300013100	Ga0157373_10034513	Ga0157373_100345133	66
951	3300013100	Ga0157373_10052875	Ga0157373_100528751	66
952	3300013100	Ga0157373_10119374	Ga0157373_101193743	66
953	3300013100	Ga0157373_10124806	Ga0157373_101248062	66
954	3300013100	Ga0157373_10857757	Ga0157373_108577571	66
955	3300013102	Ga0157371_10019689	Ga0157371_100196892	66
956	3300013102	Ga0157371_10079057	Ga0157371_100790571	66
957	3300013104	Ga0157370_10292904	Ga0157370_102929042	66
958	3300013104	Ga0157370_10331043	Ga0157370_103310431	66
959	3300013104	Ga0157370_10334111	Ga0157370_103341112	66
960	3300013105	Ga0157369_10013112	Ga0157369_100131129	66
961	3300013105	Ga0157369_10031364	Ga0157369_100313646	66
962	3300013105	Ga0157369_10140359	Ga0157369_101403593	66
963	3300013105	Ga0157369_10187071	Ga0157369_101870713	66
964	3300013105	Ga0157369_10366896	Ga0157369_103668962	66
965	3300013105	Ga0157369_10497166	Ga0157369_104971662	66
966	3300013296	Ga0157374_10006067	Ga0157374_1000606710	66
967	3300013296	Ga0157374_10024568	Ga0157374_100245686	66
968	3300013296	Ga0157374_10053813	Ga0157374_100538132	66
969	3300013296	Ga0157374_10147251	Ga0157374_101472512	66
970	3300013296	Ga0157374_11986834	Ga0157374_119868341	66
971	3300013297	Ga0157378_10024794	Ga0157378_100247942	66
972	3300013297	Ga0157378_10082362	Ga0157378_100823622	66
973	3300013297	Ga0157378_10084730	Ga0157378_100847303	66
974	3300013297	Ga0157378_10796958	Ga0157378_107969582	66
975	3300013297	Ga0157378_11513120	Ga0157378_115131201	66
976	3300013297	Ga0157378_11586589	Ga0157378_115865892	66
977	3300013306	Ga0163162_10020829	Ga0163162_100208298	66
978	3300013306	Ga0163162_10075935	Ga0163162_100759351	66
979	3300013306	Ga0163162_10255111	Ga0163162_102551111	66
980	3300013307	Ga0157372_10043267	Ga0157372_100432673	66
981	3300013307	Ga0157372_10101166	Ga0157372_101011665	66
982	3300013307	Ga0157372_10218600	Ga0157372_102186003	66
983	3300013307	Ga0157372_12432383	Ga0157372_124323831	66
984	3300013308	Ga0157375_10285614	Ga0157375_102856142	66
985	3300014325	Ga0163163_10002860	Ga0163163_1000286012	66
986	3300014325	Ga0163163_10077542	Ga0163163_100775422	66
987	3300014325	Ga0163163_10114751	Ga0163163_101147515	66
988	3300014326	Ga0157380_10204262	Ga0157380_102042622	66
989	3300014497	Ga0182008_10008768	Ga0182008_100087686	66
990	3300014497	Ga0182008_10013055	Ga0182008_100130552	66
991	3300014745	Ga0157377_10002085	Ga0157377_100020852	66
992	3300014745	Ga0157377_10060887	Ga0157377_100608873	66
993	3300014968	Ga0157379_10296364	Ga0157379_102963642	66
994	3300014968	Ga0157379_10914777	Ga0157379_109147771	66
995	3300014968	Ga0157379_10960517	Ga0157379_109605172	66
996	3300014968	Ga0157379_12204602	Ga0157379_122046021	66
997	3300014969	Ga0157376_10055012	Ga0157376_100550125	66
998	3300014969	Ga0157376_10107521	Ga0157376_101075212	66
999	3300014969	Ga0157376_10155049	Ga0157376_101550493	66
1000	3300014969	Ga0157376_10409558	Ga0157376_104095583	66
1001	3300014969	Ga0157376_10468881	Ga0157376_104688811	66
1002	3300014969	Ga0157376_10584179	Ga0157376_105841792	66
1003	3300014969	Ga0157376_11800377	Ga0157376_118003772	66
1004	3300015262	Ga0182007_10004310	Ga0182007_100043102	66
1005	3300015262	Ga0182007_10157932	Ga0182007_101579321	66
1006	3300015265	Ga0182005_1014387	Ga0182005_10143874	66
1007	3300015265	Ga0182005_1290424	Ga0182005_12904242	66
1008	3300017792	Ga0163161_10023952	Ga0163161_100239523	66
1009	3300017792	Ga0163161_10379286	Ga0163161_103792863	66
1010	3300019176	Ga0184596_118748	Ga0184596_1187481	66
1011	3300020070	Ga0206356_11678499	Ga0206356_116784991	66
1012	3300020610	Ga0154015_1500108	Ga0154015_15001082	66
1013	3300021358	Ga0213873_10034439	Ga0213873_100344392	66
1014	3300021377	Ga0213874_10459831	Ga0213874_104598311	66
1015	3300021388	Ga0213875_10441551	Ga0213875_104415511	66
1016	3300022732	Ga0224569_100622	Ga0224569_1006222	66
1017	3300022732	Ga0224569_101242	Ga0224569_1012423	66
1018	3300022734	Ga0224571_105378	Ga0224571_1053781	66
1019	3300024225	Ga0224572_1009106	Ga0224572_10091062	66
1020	3300024225	Ga0224572_1061411	Ga0224572_10614112	66
1021	3300024225	Ga0224572_1109384	Ga0224572_11093841	66
1022	3300024227	Ga0228598_1001223	Ga0228598_10012232	66
1023	3300024227	Ga0228598_1002814	Ga0228598_10028142	66
1024	3300025290	Ga0207673_1007725	Ga0207673_10077252	66
1025	3300025315	Ga0207697_10065320	Ga0207697_100653201	66
1026	3300025315	Ga0207697_10072008	Ga0207697_100720082	66
1027	3300025321	Ga0207656_10030327	Ga0207656_100303272	66
1028	3300025321	Ga0207656_10161253	Ga0207656_101612531	66
1029	3300025711	Ga0207696_1067735	Ga0207696_10677351	66
1030	3300025735	Ga0207713_1043167	Ga0207713_10431672	66
1031	3300025735	Ga0207713_1105716	Ga0207713_11057163	66
1032	3300025898	Ga0207692_10005309	Ga0207692_100053094	66
1033	3300025898	Ga0207692_10143584	Ga0207692_101435842	66
1034	3300025898	Ga0207692_10379305	Ga0207692_103793051	66
1035	3300025898	Ga0207692_10547083	Ga0207692_105470831	66
1036	3300025899	Ga0207642_10021562	Ga0207642_100215624	66
1037	3300025899	Ga0207642_10381382	Ga0207642_103813822	66
1038	3300025900	Ga0207710_10066537	Ga0207710_100665371	66
1039	3300025900	Ga0207710_10306694	Ga0207710_103066941	66
1040	3300025901	Ga0207688_10024335	Ga0207688_100243355	66
1041	3300025901	Ga0207688_10196857	Ga0207688_101968572	66
1042	3300025903	Ga0207680_10005063	Ga0207680_100050637	66
1043	3300025903	Ga0207680_10072290	Ga0207680_100722903	66
1044	3300025903	Ga0207680_11361855	Ga0207680_113618551	66
1045	3300025904	Ga0207647_10001631	Ga0207647_1000163111	66
1046	3300025904	Ga0207647_10001634	Ga0207647_1000163411	66
1047	3300025904	Ga0207647_10799759	Ga0207647_107997592	66
1048	3300025905	Ga0207685_10003197	Ga0207685_100031971	66
1049	3300025905	Ga0207685_10244266	Ga0207685_102442662	66
1050	3300025905	Ga0207685_10821893	Ga0207685_108218931	66
1051	3300025906	Ga0207699_10019452	Ga0207699_100194522	66
1052	3300025906	Ga0207699_10023858	Ga0207699_100238583	66
1053	3300025906	Ga0207699_10191143	Ga0207699_101911432	66
1054	3300025906	Ga0207699_10506736	Ga0207699_105067362	66
1055	3300025907	Ga0207645_10000038	Ga0207645_1000003855	66
1056	3300025907	Ga0207645_11188000	Ga0207645_111880001	66
1057	3300025908	Ga0207643_10015886	Ga0207643_100158866	66
1058	3300025909	Ga0207705_10135171	Ga0207705_101351714	66
1059	3300025909	Ga0207705_11013084	Ga0207705_110130841	66
1060	3300025910	Ga0207684_10000641	Ga0207684_1000064137	66
1061	3300025910	Ga0207684_10000716	Ga0207684_1000071616	66
1062	3300025910	Ga0207684_10014829	Ga0207684_100148295	66
1063	3300025910	Ga0207684_10077034	Ga0207684_100770342	66
1064	3300025910	Ga0207684_10080207	Ga0207684_100802072	66
1065	3300025910	Ga0207684_10433818	Ga0207684_104338181	66
1066	3300025910	Ga0207684_10521845	Ga0207684_105218452	66
1067	3300025911	Ga0207654_10024569	Ga0207654_100245695	66
1068	3300025911	Ga0207654_10059248	Ga0207654_100592482	66
1069	3300025911	Ga0207654_10307108	Ga0207654_103071082	66
1070	3300025911	Ga0207654_10760011	Ga0207654_107600111	66
1071	3300025912	Ga0207707_10099756	Ga0207707_100997563	66
1072	3300025912	Ga0207707_11439576	Ga0207707_114395761	66
1073	3300025913	Ga0207695_10061610	Ga0207695_100616104	66
1074	3300025913	Ga0207695_10195489	Ga0207695_101954892	66
1075	3300025913	Ga0207695_11330652	Ga0207695_113306521	66
1076	3300025913	Ga0207695_11540309	Ga0207695_115403091	66
1077	3300025914	Ga0207671_10050237	Ga0207671_100502375	66
1078	3300025914	Ga0207671_10228873	Ga0207671_102288731	66
1079	3300025914	Ga0207671_10349891	Ga0207671_103498912	66
1080	3300025914	Ga0207671_10890401	Ga0207671_108904011	66
1081	3300025915	Ga0207693_10002686	Ga0207693_100026861	66
1082	3300025915	Ga0207693_10054800	Ga0207693_100548004	66
1083	3300025915	Ga0207693_11331860	Ga0207693_113318602	66
1084	3300025916	Ga0207663_10240896	Ga0207663_102408962	66
1085	3300025916	Ga0207663_10244537	Ga0207663_102445371	66
1086	3300025916	Ga0207663_10325555	Ga0207663_103255552	66
1087	3300025916	Ga0207663_10491766	Ga0207663_104917661	66
1088	3300025917	Ga0207660_10158367	Ga0207660_101583672	66
1089	3300025917	Ga0207660_10870328	Ga0207660_108703281	66
1090	3300025918	Ga0207662_10001578	Ga0207662_100015785	66
1091	3300025919	Ga0207657_10000363	Ga0207657_100003637	66
1092	3300025919	Ga0207657_10029481	Ga0207657_100294811	66
1093	3300025920	Ga0207649_10000270	Ga0207649_1000027014	66
1094	3300025920	Ga0207649_10333109	Ga0207649_103331092	66
1095	3300025921	Ga0207652_10351926	Ga0207652_103519262	66
1096	3300025922	Ga0207646_10000463	Ga0207646_1000046335	66
1097	3300025922	Ga0207646_10002779	Ga0207646_100027793	66
1098	3300025922	Ga0207646_10059849	Ga0207646_100598492	66
1099	3300025922	Ga0207646_10072177	Ga0207646_100721774	66
1100	3300025922	Ga0207646_10301202	Ga0207646_103012021	66
1101	3300025922	Ga0207646_10327773	Ga0207646_103277732	66
1102	3300025922	Ga0207646_10622998	Ga0207646_106229981	66
1103	3300025922	Ga0207646_10744890	Ga0207646_107448902	66
1104	3300025923	Ga0207681_10056945	Ga0207681_100569454	66
1105	3300025924	Ga0207694_11153904	Ga0207694_111539042	66
1106	3300025924	Ga0207694_11470911	Ga0207694_114709111	66
1107	3300025925	Ga0207650_10000122	Ga0207650_1000012288	66
1108	3300025925	Ga0207650_11585971	Ga0207650_115859711	66
1109	3300025926	Ga0207659_10068914	Ga0207659_100689142	66
1110	3300025926	Ga0207659_11264548	Ga0207659_112645481	66
1111	3300025926	Ga0207659_11539338	Ga0207659_115393381	66
1112	3300025927	Ga0207687_10048003	Ga0207687_100480032	66
1113	3300025927	Ga0207687_10092933	Ga0207687_100929332	66
1114	3300025927	Ga0207687_10493349	Ga0207687_104933493	66
1115	3300025928	Ga0207700_10014363	Ga0207700_100143634	66
1116	3300025928	Ga0207700_10562522	Ga0207700_105625222	66
1117	3300025928	Ga0207700_10739256	Ga0207700_107392562	66
1118	3300025929	Ga0207664_10274928	Ga0207664_102749282	66
1119	3300025929	Ga0207664_10292267	Ga0207664_102922673	66
1120	3300025929	Ga0207664_10856392	Ga0207664_108563921	66
1121	3300025929	Ga0207664_11032711	Ga0207664_110327112	66
1122	3300025929	Ga0207664_11222304	Ga0207664_112223041	66
1123	3300025931	Ga0207644_10007908	Ga0207644_100079082	66
1124	3300025931	Ga0207644_10194591	Ga0207644_101945912	66
1125	3300025932	Ga0207690_10015893	Ga0207690_100158933	66
1126	3300025932	Ga0207690_10634554	Ga0207690_106345541	66
1127	3300025933	Ga0207706_10002981	Ga0207706_1000298112	66
1128	3300025933	Ga0207706_10029250	Ga0207706_100292502	66
1129	3300025934	Ga0207686_10223477	Ga0207686_102234771	66
1130	3300025934	Ga0207686_10224301	Ga0207686_102243012	66
1131	3300025934	Ga0207686_10411394	Ga0207686_104113942	66
1132	3300025935	Ga0207709_11452816	Ga0207709_114528161	66
1133	3300025936	Ga0207670_10656502	Ga0207670_106565022	66
1134	3300025936	Ga0207670_11938490	Ga0207670_119384901	66
1135	3300025937	Ga0207669_10796952	Ga0207669_107969521	66
1136	3300025938	Ga0207704_10035346	Ga0207704_100353465	66
1137	3300025938	Ga0207704_10061288	Ga0207704_100612883	66
1138	3300025938	Ga0207704_10353225	Ga0207704_103532252	66
1139	3300025938	Ga0207704_10767736	Ga0207704_107677362	66
1140	3300025939	Ga0207665_10001443	Ga0207665_100014436	66
1141	3300025939	Ga0207665_10080379	Ga0207665_100803795	66
1142	3300025939	Ga0207665_10314033	Ga0207665_103140332	66
1143	3300025939	Ga0207665_10550220	Ga0207665_105502202	66
1144	3300025939	Ga0207665_10742699	Ga0207665_107426992	66
1145	3300025939	Ga0207665_10929675	Ga0207665_109296751	66
1146	3300025940	Ga0207691_10000912	Ga0207691_1000091218	66
1147	3300025940	Ga0207691_10348692	Ga0207691_103486922	66
1148	3300025941	Ga0207711_10012585	Ga0207711_100125857	66
1149	3300025941	Ga0207711_10079195	Ga0207711_100791952	66
1150	3300025941	Ga0207711_10688456	Ga0207711_106884561	66
1151	3300025941	Ga0207711_10997716	Ga0207711_109977161	66
1152	3300025942	Ga0207689_10000658	Ga0207689_1000065814	66
1153	3300025942	Ga0207689_10001175	Ga0207689_1000117511	66
1154	3300025942	Ga0207689_10967154	Ga0207689_109671541	66
1155	3300025944	Ga0207661_10011167	Ga0207661_100111677	66
1156	3300025944	Ga0207661_10584157	Ga0207661_105841572	66
1157	3300025945	Ga0207679_10000070	Ga0207679_1000007073	66
1158	3300025945	Ga0207679_10409545	Ga0207679_104095452	66
1159	3300025945	Ga0207679_11178500	Ga0207679_111785002	66
1160	3300025945	Ga0207679_11977257	Ga0207679_119772572	66
1161	3300025949	Ga0207667_10123847	Ga0207667_101238475	66
1162	3300025949	Ga0207667_10312291	Ga0207667_103122911	66
1163	3300025949	Ga0207667_10323404	Ga0207667_103234042	66
1164	3300025960	Ga0207651_10001089	Ga0207651_100010896	66
1165	3300025961	Ga0207712_10030606	Ga0207712_100306064	66
1166	3300025961	Ga0207712_10323871	Ga0207712_103238711	66
1167	3300025972	Ga0207668_10012963	Ga0207668_100129633	66
1168	3300025981	Ga0207640_10040634	Ga0207640_100406343	66
1169	3300025981	Ga0207640_10658653	Ga0207640_106586532	66
1170	3300025981	Ga0207640_10914140	Ga0207640_109141402	66
1171	3300025986	Ga0207658_10405141	Ga0207658_104051412	66
1172	3300025986	Ga0207658_12027426	Ga0207658_120274261	66
1173	3300025986	Ga0207658_12137941	Ga0207658_121379411	66
1174	3300026023	Ga0207677_10014901	Ga0207677_100149013	66
1175	3300026023	Ga0207677_10018066	Ga0207677_100180662	66
1176	3300026023	Ga0207677_10127426	Ga0207677_101274263	66
1177	3300026023	Ga0207677_10128209	Ga0207677_101282092	66
1178	3300026023	Ga0207677_10843215	Ga0207677_108432152	66
1179	3300026035	Ga0207703_10019404	Ga0207703_100194045	66
1180	3300026035	Ga0207703_10028743	Ga0207703_100287434	66
1181	3300026035	Ga0207703_10123245	Ga0207703_101232451	66
1182	3300026035	Ga0207703_10207359	Ga0207703_102073592	66
1183	3300026035	Ga0207703_10787602	Ga0207703_107876021	66
1184	3300026041	Ga0207639_10046943	Ga0207639_100469431	66
1185	3300026041	Ga0207639_10468702	Ga0207639_104687022	66
1186	3300026067	Ga0207678_10001701	Ga0207678_1000170111	66
1187	3300026067	Ga0207678_10055030	Ga0207678_100550307	66
1188	3300026075	Ga0207708_10082840	Ga0207708_100828401	66
1189	3300026078	Ga0207702_10011667	Ga0207702_100116679	66
1190	3300026078	Ga0207702_10499491	Ga0207702_104994911	66
1191	3300026078	Ga0207702_11036184	Ga0207702_110361842	66
1192	3300026088	Ga0207641_10000020	Ga0207641_10000020115	66
1193	3300026088	Ga0207641_10025048	Ga0207641_100250483	66
1194	3300026088	Ga0207641_10027048	Ga0207641_100270484	66
1195	3300026088	Ga0207641_10214449	Ga0207641_102144492	66
1196	3300026089	Ga0207648_10000218	Ga0207648_1000021826	66
1197	3300026089	Ga0207648_10229313	Ga0207648_102293132	66
1198	3300026089	Ga0207648_11616301	Ga0207648_116163011	66
1199	3300026095	Ga0207676_10000101	Ga0207676_1000010170	66
1200	3300026095	Ga0207676_10046660	Ga0207676_100466602	66
1201	3300026095	Ga0207676_10576460	Ga0207676_105764602	66
1202	3300026116	Ga0207674_10001686	Ga0207674_100016864	66
1203	3300026116	Ga0207674_10188503	Ga0207674_101885033	66
1204	3300026118	Ga0207675_100008729	Ga0207675_1000087296	66
1205	3300026121	Ga0207683_10000780	Ga0207683_1000078014	66
1206	3300026121	Ga0207683_10257681	Ga0207683_102576812	66
1207	3300026121	Ga0207683_10975252	Ga0207683_109752521	66
1208	3300026121	Ga0207683_11100010	Ga0207683_111000102	66
1209	3300026121	Ga0207683_11434771	Ga0207683_114347711	66
1210	3300026121	Ga0207683_12038267	Ga0207683_120382671	66
1211	3300026142	Ga0207698_10128843	Ga0207698_101288434	66
1212	3300027424	Ga0209984_1046072	Ga0209984_10460721	66
1213	3300027512	Ga0209179_1052730	Ga0209179_10527302	66
1214	3300027666	Ga0209282_1000019	Ga0209282_100001925	66
1215	3300027907	Ga0207428_10064990	Ga0207428_100649901	66
1216	3300028010	Ga0265358_105405	Ga0265358_1054051	66
1217	3300028016	Ga0265354_1015073	Ga0265354_10150731	66
1218	3300028016	Ga0265354_1018884	Ga0265354_10188841	66
1219	3300028017	Ga0265356_1013424	Ga0265356_10134242	66
1220	3300028017	Ga0265356_1035582	Ga0265356_10355821	66
1221	3300028379	Ga0268266_10000911	Ga0268266_1000091114	66
1222	3300028379	Ga0268266_10514397	Ga0268266_105143973	66
1223	3300028380	Ga0268265_10056737	Ga0268265_100567372	66
1224	3300028380	Ga0268265_10119813	Ga0268265_101198133	66
1225	3300028381	Ga0268264_10012909	Ga0268264_100129094	66
1226	3300028381	Ga0268264_10039140	Ga0268264_100391406	66
1227	3300030760	Ga0265762_1001568	Ga0265762_10015683	66
1228	3300030760	Ga0265762_1002940	Ga0265762_10029402	66
1229	3300030878	Ga0265770_1006276	Ga0265770_10062763	66
1230	3300031018	Ga0265773_1040221	Ga0265773_10402212	66
1231	3300031090	Ga0265760_10003135	Ga0265760_100031352	66
1232	3300031090	Ga0265760_10010197	Ga0265760_100101973	66
1233	3300031090	Ga0265760_10014986	Ga0265760_100149863	66
1234	3300031344	Ga0265316_10851911	Ga0265316_108519111	66
1235	3300031548	Ga0307408_100027381	Ga0307408_1000273812	66
1236	3300031548	Ga0307408_101924856	Ga0307408_1019248561	66
1237	3300031727	Ga0316576_10000432	Ga0316576_1000043214	66
1238	3300031728	Ga0316578_10156724	Ga0316578_101567242	66
1239	3300031731	Ga0307405_10000608	Ga0307405_100006086	66
1240	3300031731	Ga0307405_10845591	Ga0307405_108455911	66
1241	3300031824	Ga0307413_10001775	Ga0307413_100017757	66
1242	3300031824	Ga0307413_10713780	Ga0307413_107137802	66
1243	3300031901	Ga0307406_10015544	Ga0307406_100155442	66
1244	3300031901	Ga0307406_10166102	Ga0307406_101661022	66
1245	3300031903	Ga0307407_10005070	Ga0307407_100050705	66
1246	3300031911	Ga0307412_10043455	Ga0307412_100434555	66
1247	3300031995	Ga0307409_100004715	Ga0307409_1000047156	66
1248	3300031995	Ga0307409_102166198	Ga0307409_1021661981	66
1249	3300031995	Ga0307409_102603903	Ga0307409_1026039032	66
1250	3300032002	Ga0307416_100015583	Ga0307416_1000155835	66
1251	3300032002	Ga0307416_100351188	Ga0307416_1003511881	66
1252	3300032002	Ga0307416_100415552	Ga0307416_1004155522	66
1253	3300032004	Ga0307414_10209377	Ga0307414_102093771	66
1254	3300032005	Ga0307411_10111593	Ga0307411_101115931	66
1255	3300032126	Ga0307415_100009006	Ga0307415_1000090065	66
1256	3300032126	Ga0307415_100011120	Ga0307415_1000111202	66
1257	3300032126	Ga0307415_100188192	Ga0307415_1001881922	66
1258	3300033545	Ga0316214_1047746	Ga0316214_10477461	66
1259	3300033547	Ga0316212_1036713	Ga0316212_10367131	66
1260	3300034819	Ga0373958_0154960	Ga0373958_0154960_129_329	66
1261	3300035084	Ga0373928_0051687	Ga0373928_0051687_438_638	66
1262	3300035084	Ga0373928_0102208	Ga0373928_0102208_495_695	66
1263	3300035085	Ga0373929_0052905	Ga0373929_0052905_705_905	66
1264	3300035085	Ga0373929_0169344	Ga0373929_0169344_273_473	66
1265	3300035091	Ga0373951_0196191	Ga0373951_0196191_337_537	66
1266	3300035112	Ga0373932_0172006	Ga0373932_0172006_15_215	66
1267	3300035114	Ga0373939_0298962	Ga0373939_0298962_239_445	66
1268	3300035170	Ga0373943_0694169	Ga0373943_0694169_59_259	66
1269	3300035170	Ga0373943_0831448	Ga0373943_0831448_24_224	66
1270	3300035207	Ga0373942_0065665	Ga0373942_0065665_27_227	66
1271	3300035242	Ga0373962_0079096	Ga0373962_0079096_715_921	66
1272	3300035242	Ga0373962_0363351	Ga0373962_0363351_194_394	66
1273	3300035691	Ga0373931_0074889	Ga0373931_0074889_1555_1755	66
1274	3300035691	Ga0373931_0212852	Ga0373931_0212852_944_1150	66
1275	3300035691	Ga0373931_1014878	Ga0373931_1014878_275_475	66
1276	3300035692	Ga0373935_0113161	Ga0373935_0113161_1551_1751	66
1277	3300035692	Ga0373935_0324419	Ga0373935_0324419_435_635	66
1278	3300035695	Ga0373927_0263585	Ga0373927_0263585_27_227	66
1279	3300035695	Ga0373927_0672051	Ga0373927_0672051_28_228	66
1280	3300035724	Ga0373933_0042979	Ga0373933_0042979_66_266	66
1281	3300035725	Ga0373947_0165340	Ga0373947_0165340_77_277	66
1282	3300035725	Ga0373947_0382927	Ga0373947_0382927_194_394	66
1283	3300035725	Ga0373947_1041201	Ga0373947_1041201_263_463	66
1284	3300036401	Ga0373937_0168438	Ga0373937_0168438_31_231	66
1285	3300036401	Ga0373937_0606962	Ga0373937_0606962_50_250	66
1286	3300036401	Ga0373937_0693070	Ga0373937_0693070_443_643	66
1287	3300037068	Ga0373925_0549044	Ga0373925_0549044_718_918	66
1288	3300037068	Ga0373925_1045519	Ga0373925_1045519_220_420	66
1289	3300037418	Ga0395900_0720736	Ga0395900_0720736_17_217	66
1290	3300037853	Ga0436364_0057880	Ga0436364_0057880_1232_1432	66
1291	3300038443	Ga0395901_0226604	Ga0395901_0226604_522_728	66
1292	3300039437	Ga0436365_1017425	Ga0436365_1017425_133_333	66
1293	3300039437	Ga0436365_1087397	Ga0436365_1087397_1903_2103	66
1294	3300039437	Ga0436365_1344243	Ga0436365_1344243_197_397	66
1295	3300039437	Ga0436365_1622187	Ga0436365_1622187_236_436	66
1296	3300039438	Ga0436360_0042835	Ga0436360_0042835_466_666	66
1297	3300039438	Ga0436360_0524417	Ga0436360_0524417_288_488	66
1298	3300039447	Ga0436361_0560976	Ga0436361_0560976_223_423	66
1299	3300039447	Ga0436361_1188776	Ga0436361_1188776_289_489	66
1300	3300039450	Ga0436363_0157291	Ga0436363_0157291_285_485	66
1301	3300039450	Ga0436363_0755022	Ga0436363_0755022_295_495	66
1302	3300039450	Ga0436363_0969403	Ga0436363_0969403_569_769	66
1303	3300039450	Ga0436363_1396170	Ga0436363_1396170_1879_2079	66
1304	3300039453	Ga0436362_0745981	Ga0436362_0745981_989_1189	66
1305	3300042005	Ga0439448_0016807	Ga0439448_0016807_521_730	66
1306	3300042012	Ga0439455_0047608	Ga0439455_0047608_22_231	66
1307	3300042016	Ga0439463_031266	Ga0439463_031266_543_752	66
1308	3300042124	Ga0450922_025752	Ga0450922_025752_351_560	66
1309	3300042142	Ga0450905_041664	Ga0450905_041664_347_556	66
1310	3300042439	Ga0439464_0018609	Ga0439464_0018609_911_1120	66
1311	3300042461	Ga0439460_0055708	Ga0439460_0055708_178_387	66
1312	3300042530	Ga0450916_042585	Ga0450916_042585_406_615	66
1313	3300042876	Ga0451577_0117711	Ga0451577_0117711_513_713	66
1314	3300042876	Ga0451577_0200709	Ga0451577_0200709_1305_1505	66
1315	3300042876	Ga0451577_0533680	Ga0451577_0533680_435_635	66
1316	3300042876	Ga0451577_0763073	Ga0451577_0763073_557_757	66
1317	3300042876	Ga0451577_0878608	Ga0451577_0878608_164_364	66
1318	3300042876	Ga0451577_0912957	Ga0451577_0912957_363_563	66
1319	3300042876	Ga0451577_1034944	Ga0451577_1034944_417_617	66
1320	3300042876	Ga0451577_1054543	Ga0451577_1054543_395_595	66
1321	3300044673	Ga0453683_0083753	Ga0453683_0083753_1681_1881	66
1322	3300044673	Ga0453683_0251084	Ga0453683_0251084_621_821	66
1323	3300044673	Ga0453683_0302539	Ga0453683_0302539_36_236	66
1324	3300044673	Ga0453683_1202240	Ga0453683_1202240_116_316	66
1325	3300044684	Ga0466966_0198994	Ga0466966_0198994_592_792	66
1326	3300044684	Ga0466966_0279945	Ga0466966_0279945_529_729	66
1327	3300044712	Ga0453684_0019189	Ga0453684_0019189_6204_6404	66
1328	3300044712	Ga0453684_0037230	Ga0453684_0037230_4895_5095	66
1329	3300044712	Ga0453684_0067698	Ga0453684_0067698_312_512	66
1330	3300044712	Ga0453684_0206907	Ga0453684_0206907_1662_1862	66
1331	3300044712	Ga0453684_0417443	Ga0453684_0417443_576_776	66
1332	3300044712	Ga0453684_0612469	Ga0453684_0612469_488_688	66
1333	3300044712	Ga0453684_0636089	Ga0453684_0636089_385_585	66
1334	3300044712	Ga0453684_1371042	Ga0453684_1371042_274_474	66
1335	3300044712	Ga0453684_1441788	Ga0453684_1441788_320_520	66
1336	3300044719	Ga0466971_0701605	Ga0466971_0701605_290_490	66
1337	3300044735	Ga0466968_0191906	Ga0466968_0191906_675_875	66
1338	3300045051	Ga0451576_0025850	Ga0451576_0025850_2438_2638	66
1339	3300045051	Ga0451576_0030205	Ga0451576_0030205_3566_3766	66
1340	3300045051	Ga0451576_0165424	Ga0451576_0165424_772_972	66
1341	3300045051	Ga0451576_0184058	Ga0451576_0184058_591_791	66
1342	3300045051	Ga0451576_0295987	Ga0451576_0295987_992_1192	66
1343	3300045051	Ga0451576_0313419	Ga0451576_0313419_181_381	66
1344	3300045051	Ga0451576_0524477	Ga0451576_0524477_173_373	66
1345	3300045051	Ga0451576_0953769	Ga0451576_0953769_520_720	66
1346	3300045051	Ga0451576_2351851	Ga0451576_2351851_250_450	66
1347	3300046455	Ga0495603_0188321	Ga0495603_0188321_542_742	66
1348	3300046455	Ga0495603_0387015	Ga0495603_0387015_254_454	66
1349	3300046457	Ga0495590_0165785	Ga0495590_0165785_572_772	66
1350	3300046471	Ga0495650_0000006	Ga0495650_0000006_230478_230678	66
1351	3300046472	Ga0495580_0012229	Ga0495580_0012229_4993_5193	66
1352	3300046472	Ga0495580_0029478	Ga0495580_0029478_3626_3826	66
1353	3300046472	Ga0495580_0033484	Ga0495580_0033484_2243_2443	66
1354	3300046472	Ga0495580_0275091	Ga0495580_0275091_903_1103	66
1355	3300046472	Ga0495580_0540985	Ga0495580_0540985_126_326	66
1356	3300046474	Ga0495605_0009205	Ga0495605_0009205_921_1124	66
1357	3300046491	Ga0495584_0069175	Ga0495584_0069175_270_473	66
1358	3300046499	Ga0495594_0058963	Ga0495594_0058963_1121_1321	66
1359	3300046499	Ga0495594_0485224	Ga0495594_0485224_344_544	66
1360	3300046500	Ga0495596_0000086	Ga0495596_0000086_2978_3181	66
1361	3300046501	Ga0495607_0038124	Ga0495607_0038124_389_592	66
1362	3300046512	Ga0495610_0000221	Ga0495610_0000221_48567_48770	66
1363	3300046513	Ga0495616_0000391	Ga0495616_0000391_4325_4528	66
1364	3300046517	Ga0495630_0709453	Ga0495630_0709453_535_735	66
1365	3300046518	Ga0495631_0287820	Ga0495631_0287820_265_468	66
1366	3300046522	Ga0495643_0041441	Ga0495643_0041441_1337_1540	66
1367	3300046522	Ga0495643_0351823	Ga0495643_0351823_245_445	66
1368	3300046524	Ga0495648_0042107	Ga0495648_0042107_81_284	66
1369	3300046526	Ga0495666_0272614	Ga0495666_0272614_33_233	66
1370	3300046528	Ga0495642_0084673	Ga0495642_0084673_817_1020	66
1371	3300046531	Ga0495665_0630947	Ga0495665_0630947_186_386	66
1372	3300046531	Ga0495665_0689904	Ga0495665_0689904_251_451	66
1373	3300046533	Ga0495640_0460210	Ga0495640_0460210_505_705	66
1374	3300046535	Ga0495586_0483193	Ga0495586_0483193_432_632	66
1375	3300046535	Ga0495586_0669037	Ga0495586_0669037_366_566	66
1376	3300046538	Ga0495609_0000896	Ga0495609_0000896_12399_12602	66
1377	3300046542	Ga0495597_0084514	Ga0495597_0084514_815_1018	66
1378	3300046615	Ga0495656_0009664	Ga0495656_0009664_54_254	66
1379	3300046648	Ga0495611_0016131	Ga0495611_0016131_2569_2772	66
1380	3300046660	Ga0495625_0305400	Ga0495625_0305400_600_803	66
1381	3300046664	Ga0495659_0141997	Ga0495659_0141997_37_237	66
1382	3300046665	Ga0495661_0004133	Ga0495661_0004133_3885_4088	66
1383	3300046683	Ga0495658_0652225	Ga0495658_0652225_305_505	66
1384	3300046684	Ga0495669_0044626	Ga0495669_0044626_945_1148	66
1385	3300046684	Ga0495669_0080324	Ga0495669_0080324_298_498	66
1386	3300046684	Ga0495669_0626867	Ga0495669_0626867_273_473	66
1387	3300046691	Ga0495670_0459126	Ga0495670_0459126_411_611	66
1388	3300046692	Ga0495671_0000191	Ga0495671_0000191_41377_41580	66
1389	3300046694	Ga0495649_0011102	Ga0495649_0011102_1972_2175	66
1390	3300047318	Ga0495636_0176503	Ga0495636_0176503_595_795	66
1391	3300047472	Ga0495686_0038495	Ga0495686_0038495_1259_1465	66
1392	3300048903	Ga0496100_0024099	Ga0496100_0024099_1932_2132	66
1393	3300048903	Ga0496100_0279509	Ga0496100_0279509_861_1061	66
1394	3300048904	Ga0496101_0051308	Ga0496101_0051308_1238_1438	66
1395	3300048904	Ga0496101_0559343	Ga0496101_0559343_501_701	66
1396	3300048905	Ga0496102_0168238	Ga0496102_0168238_860_1060	66
1397	3300048905	Ga0496102_0596605	Ga0496102_0596605_642_842	66
1398	3300048906	Ga0496103_0156386	Ga0496103_0156386_104_304	66
1399	3300048906	Ga0496103_0182041	Ga0496103_0182041_874_1074	66
1400	3300048906	Ga0496103_0200348	Ga0496103_0200348_895_1095	66
1401	3300048907	Ga0496104_0056210	Ga0496104_0056210_208_408	66
1402	3300048907	Ga0496104_0933746	Ga0496104_0933746_303_503	66
1403	3300048908	Ga0496105_0162904	Ga0496105_0162904_1027_1227	66
1404	3300048908	Ga0496105_0639978	Ga0496105_0639978_476_676	66
1405	3300048908	Ga0496105_1286270	Ga0496105_1286270_241_441	66
1406	3300048909	Ga0496106_0008998	Ga0496106_0008998_848_1048	66
1407	3300048909	Ga0496106_0051113	Ga0496106_0051113_1618_1818	66
1408	3300048910	Ga0496107_0206331	Ga0496107_0206331_728_928	66
1409	3300048910	Ga0496107_0256608	Ga0496107_0256608_775_975	66
1410	3300048911	Ga0496108_0000948	Ga0496108_0000948_19221_19421	66
1411	3300048911	Ga0496108_0062419	Ga0496108_0062419_72_272	66
1412	3300048912	Ga0496109_0000018	Ga0496109_0000018_112577_112777	66
1413	3300048912	Ga0496109_0544007	Ga0496109_0544007_228_428	66
1414	3300048913	Ga0496110_0000224	Ga0496110_0000224_3656_3856	66
1415	3300048913	Ga0496110_0179490	Ga0496110_0179490_1346_1546	66
1416	3300048913	Ga0496110_1112930	Ga0496110_1112930_118_318	66
1417	3300048914	Ga0496111_0013885	Ga0496111_0013885_4653_4853	66
1418	3300048914	Ga0496111_0061645	Ga0496111_0061645_2324_2524	66
1419	3300048915	Ga0496112_0000058	Ga0496112_0000058_2224_2424	66
1420	3300048915	Ga0496112_0002596	Ga0496112_0002596_11457_11657	66
1421	3300048916	Ga0496113_0000103	Ga0496113_0000103_8953_9153	66
1422	3300048916	Ga0496113_0031805	Ga0496113_0031805_997_1197	66
1423	3300048917	Ga0496114_0812150	Ga0496114_0812150_488_688	66
1424	3300048918	Ga0496115_0143282	Ga0496115_0143282_1438_1638	66
1425	3300048918	Ga0496115_0675793	Ga0496115_0675793_34_234	66
1426	3300048919	Ga0496116_0005326	Ga0496116_0005326_335_538	66
1427	3300048924	Ga0496121_0002075	Ga0496121_0002075_6835_7038	66
1428	3300048925	Ga0496122_0001211	Ga0496122_0001211_31383_31586	66
1429	3300048926	Ga0496123_0000493	Ga0496123_0000493_63641_63844	66
1430	3300048927	Ga0496124_0533014	Ga0496124_0533014_384_590	66
1431	3300048928	Ga0496125_0119080	Ga0496125_0119080_243_449	66
1432	3300049519	Ga0501296_087494	Ga0501296_087494_208_408	66
1433	3300049568	Ga0501031_0005274	Ga0501031_0005274_7474_7683	66
1434	3300049569	Ga0501032_0049531	Ga0501032_0049531_1438_1647	66
1435	3300049570	Ga0501033_0010202	Ga0501033_0010202_1205_1414	66
1436	3300049572	Ga0501036_0004970	Ga0501036_0004970_3458_3667	66
1437	3300049573	Ga0501037_0020850	Ga0501037_0020850_1039_1248	66
1438	3300049574	Ga0501038_0003719	Ga0501038_0003719_2661_2870	66
1439	3300049575	Ga0501039_0000863	Ga0501039_0000863_18371_18580	66
1440	3300049576	Ga0501040_0000640	Ga0501040_0000640_3593_3802	66
1441	3300049577	Ga0501041_0000456	Ga0501041_0000456_16965_17174	66
1442	3300049578	Ga0501042_0001942	Ga0501042_0001942_1565_1774	66
1443	3300049579	Ga0501043_0028820	Ga0501043_0028820_1867_2076	66
1444	3300049580	Ga0501046_0007697	Ga0501046_0007697_3623_3832	66
1445	3300049581	Ga0501047_1447604	Ga0501047_1447604_48_257	66
1446	3300049582	Ga0501048_0001202	Ga0501048_0001202_15672_15881	66
1447	3300049584	Ga0501068_0021385	Ga0501068_0021385_2530_2739	66
1448	3300049585	Ga0501069_0017558	Ga0501069_0017558_1220_1429	66
1449	3300049586	Ga0501070_0305118	Ga0501070_0305118_670_879	66
1450	3300049587	Ga0501071_0000368	Ga0501071_0000368_3686_3895	66
1451	3300049588	Ga0501072_0000472	Ga0501072_0000472_25044_25253	66
1452	3300049589	Ga0501073_0128288	Ga0501073_0128288_814_1023	66
1453	3300049590	Ga0501074_0015643	Ga0501074_0015643_3609_3818	66
1454	3300049591	Ga0501075_0011973	Ga0501075_0011973_3459_3668	66
1455	3300049592	Ga0501076_0002163	Ga0501076_0002163_9666_9875	66
1456	3300049593	Ga0501077_0001485	Ga0501077_0001485_10337_10546	66
1457	3300049741	Ga0501079_0000804	Ga0501079_0000804_3609_3818	66
1458	3300049742	Ga0501080_0074332	Ga0501080_0074332_2330_2539	66
1459	3300049743	Ga0501081_0320292	Ga0501081_0320292_95_304	66
1460	3300049744	Ga0501083_0509508	Ga0501083_0509508_479_679	66
1461	3300049823	Ga0501044_0149271	Ga0501044_0149271_171_380	66
1462	3300049824	Ga0501045_0000517	Ga0501045_0000517_3603_3812	66
1463	3300050489	nmdc:mga03683_71_c1	nmdc:mga03683_71_c1_28425_28631	66
1464	3300050490	nmdc:mga03n38_8273_c1	nmdc:mga03n38_8273_c1_2446_2652	66
1465	3300050491	nmdc:mga00v17_75834_c1	nmdc:mga00v17_75834_c1_1286_1492	66
1466	3300050493	nmdc:mga0k408_30_c1	nmdc:mga0k408_30_c1_33775_33981	66
1467	3300050494	nmdc:mga06z11_29030_c1	nmdc:mga06z11_29030_c1_876_1082	66
1468	3300050496	nmdc:mga07m45_14_c1	nmdc:mga07m45_14_c1_94519_94725	66
1469	3300050507	nmdc:mga05p37_1934487_c1	nmdc:mga05p37_1934487_c1_293_493	66
1470	3300050507	nmdc:mga05p37_89744_c1	nmdc:mga05p37_89744_c1_2299_2508	66
1471	3300050507	nmdc:mga05p37_92764_c1	nmdc:mga05p37_92764_c1_2318_2518	66
1472	3300050511	nmdc:mga08y16_492917_c1	nmdc:mga08y16_492917_c1_770_976	66
1473	3300050511	nmdc:mga08y16_606988_c1	nmdc:mga08y16_606988_c1_238_438	66
1474	3300050512	nmdc:mga0n895_17629_c1	nmdc:mga0n895_17629_c1_3221_3421	66
1475	3300050512	nmdc:mga0n895_18894_c1	nmdc:mga0n895_18894_c1_4909_5109	66
1476	3300050512	nmdc:mga0n895_22948_c1	nmdc:mga0n895_22948_c1_2734_2934	66
1477	3300050512	nmdc:mga0n895_24715_c1	nmdc:mga0n895_24715_c1_4179_4379	66
1478	3300050512	nmdc:mga0n895_600864_c1	nmdc:mga0n895_600864_c1_79_279	66
1479	3300050512	nmdc:mga0n895_758825_c1	nmdc:mga0n895_758825_c1_342_542	66
1480	3300050513	nmdc:mga0rr50_1675842_c1	nmdc:mga0rr50_1675842_c1_212_412	66
1481	3300050513	nmdc:mga0rr50_1725711_c1	nmdc:mga0rr50_1725711_c1_256_456	66
1482	3300050513	nmdc:mga0rr50_2876_c1	nmdc:mga0rr50_2876_c1_2796_2996	66
1483	3300050513	nmdc:mga0rr50_499_c1	nmdc:mga0rr50_499_c1_3836_4036	66
1484	3300050513	nmdc:mga0rr50_511168_c1	nmdc:mga0rr50_511168_c1_455_655	66
1485	3300050513	nmdc:mga0rr50_609583_c1	nmdc:mga0rr50_609583_c1_17_217	66
1486	3300050514	nmdc:mga08x19_12843_c1	nmdc:mga08x19_12843_c1_1668_1868	66
1487	3300050514	nmdc:mga08x19_232393_c1	nmdc:mga08x19_232393_c1_958_1158	66
1488	3300050514	nmdc:mga08x19_4314_c1	nmdc:mga08x19_4314_c1_7733_7933	66
1489	3300050514	nmdc:mga08x19_7180_c1	nmdc:mga08x19_7180_c1_6064_6264	66
1490	3300050515	nmdc:mga0a205_272581_c1	nmdc:mga0a205_272581_c1_609_809	66
1491	3300050515	nmdc:mga0a205_39707_c1	nmdc:mga0a205_39707_c1_1310_1510	66
1492	3300050515	nmdc:mga0a205_4643_c1	nmdc:mga0a205_4643_c1_1684_1884	66
1493	3300050515	nmdc:mga0a205_558_c1	nmdc:mga0a205_558_c1_21277_21477	66
1494	3300050516	nmdc:mga0sz30_1338_c2	nmdc:mga0sz30_1338_c2_1039_1245	66
1495	3300053087	Ga0500643_026591	Ga0500643_026591_1360_1560	66
1496	3300053148	Ga0500590_236812	Ga0500590_236812_465_665	66
1497	3300054114	Ga0501084_0000953	Ga0501084_0000953_1423_1632	66
1498	3300059421	Ga0590071_149219	Ga0590071_149219_234_443	66
1499	3300059477	Ga0587084_096685	Ga0587084_096685_96_296	66
1500	3300059490	Ga0587066_170060	Ga0587066_170060_18_218	66
1501	3300059490	Ga0587066_219331	Ga0587066_219331_109_315	66
1502	3300059492	Ga0587073_0251986	Ga0587073_0251986_249_449	66
1503	3300059493	Ga0587077_201758	Ga0587077_201758_326_526	66
1504	3300059503	Ga0587080_004783	Ga0587080_004783_1487_1687	66
1505	3300059508	Ga0587088_142705	Ga0587088_142705_264_473	66
1506	3300059512	Ga0587092_155021	Ga0587092_155021_103_303	66
1507	3300059605	Ga0587106_029912	Ga0587106_029912_460_660	66
1508	3300059605	Ga0587106_143029	Ga0587106_143029_195_395	66
1509	3300059630	Ga0587128_048486	Ga0587128_048486_19_225	66
1510	3300059630	Ga0587128_154608	Ga0587128_154608_104_313	66
1511	3300059640	Ga0587067_197362	Ga0587067_197362_221_421	66
1512	3300059647	Ga0587079_252355	Ga0587079_252355_12_212	66
1513	3300059657	Ga0587118_25696	Ga0587118_25696_12_212	66
1514	3300059659	Ga0587120_032762	Ga0587120_032762_234_434	66
1515	3300060243	Ga0587060_026748	Ga0587060_026748_355_555	66
1516	3300060353	Ga0501082_0000226	Ga0501082_0000226_7361_7570	66
1517	3300061734	Ga0530510_0001860	Ga0530510_0001860_10627_10836	66
1518	iso_pu_bacteria	2619619299	2621297871	66
1519	iso_pu_bacteria	2643221593	2643977350	66
1520	iso_pu_bacteria	2738541265	2738670776	66
1521	iso_pu_bacteria	2738541282	2738749170	66
1522	iso_pu_bacteria	2738541303	2738858211	66
1523	iso_pu_bacteria	2816332298	2817492994	66
1524	3300005293	Ga0065715_10118967	Ga0065715_101189673	67
1525	3300005334	Ga0068869_100976809	Ga0068869_1009768091	67
1526	3300005343	Ga0070687_101104910	Ga0070687_1011049101	67
1527	3300005434	Ga0070709_11716077	Ga0070709_117160771	67
1528	3300005436	Ga0070713_100009415	Ga0070713_1000094152	67
1529	3300005437	Ga0070710_10670391	Ga0070710_106703912	67
1530	3300005471	Ga0070698_100292476	Ga0070698_1002924762	67
1531	3300005518	Ga0070699_100400464	Ga0070699_1004004643	67
1532	3300005615	Ga0070702_101565190	Ga0070702_1015651902	67
1533	3300006028	Ga0070717_10000047	Ga0070717_1000004792	67
1534	3300006173	Ga0070716_100379707	Ga0070716_1003797073	67
1535	3300006844	Ga0075428_100035125	Ga0075428_1000351255	67
1536	3300007076	Ga0075435_100113151	Ga0075435_1001131512	67
1537	3300009176	Ga0105242_12241925	Ga0105242_122419252	67
1538	3300010375	Ga0105239_10125770	Ga0105239_101257702	67
1539	3300013306	Ga0163162_10321584	Ga0163162_103215842	67
1540	3300025898	Ga0207692_10639874	Ga0207692_106398742	67
1541	3300025928	Ga0207700_10009203	Ga0207700_100092035	67
1542	3300025939	Ga0207665_10165237	Ga0207665_101652372	67
1543	3300025942	Ga0207689_11090928	Ga0207689_110909282	67
1544	3300032126	Ga0307415_101937265	Ga0307415_1019372651	67
1545	3300045051	Ga0451576_0848869	Ga0451576_0848869_114_317	67
1546	3300049589	Ga0501073_0014688	Ga0501073_0014688_3838_4041	67
1547	3300049742	Ga0501080_0018066	Ga0501080_0018066_5113_5316	67
1548	3300049744	Ga0501083_0902041	Ga0501083_0902041_324_527	67
1549	3300050507	nmdc:mga05p37_1183814_c1	nmdc:mga05p37_1183814_c1_417_620	67
1550	3300050513	nmdc:mga0rr50_10022_c1	nmdc:mga0rr50_10022_c1_1273_1476	67
1551	3300050513	nmdc:mga0rr50_56270_c1	nmdc:mga0rr50_56270_c1_193_396	67
1552	3300050514	nmdc:mga08x19_417_c1	nmdc:mga08x19_417_c1_6558_6761	67
1553	3300053083	Ga0495655_0000315	Ga0495655_0000315_4369_4572	67
1554	iso_pu_bacteria	2747842501	2748015998	67
1555	2124908027	MRS2a_Contig_1297	MRS2a_00196160	69
1556	2124908027	MRS2a_Contig_720	MRS2a_00577230	69
1557	2124908027	MRS2a_Contig_9080	MRS2a_00656820	69
1558	2162886007	SwRhRL2b_contig_655993	SwRhRL2b_0541.00001310	69
1559	3300001915	JGI24741J21665_1002221	JGI24741J21665_10022213	69
1560	3300001915	JGI24741J21665_1005274	JGI24741J21665_10052747	69
1561	3300001915	JGI24741J21665_1017159	JGI24741J21665_10171591	69
1562	3300001979	JGI24740J21852_10000088	JGI24740J21852_1000008821	69
1563	3300001979	JGI24740J21852_10000088	JGI24740J21852_1000008831	69
1564	3300001979	JGI24740J21852_10113317	JGI24740J21852_101133172	69
1565	3300002067	JGI24735J21928_10152024	JGI24735J21928_101520243	69
1566	3300002704	JGI25155J39150_1002347	JGI25155J39150_10023472	69
1567	3300002705	JGI25156J39149_1043045	JGI25156J39149_10430451	69
1568	3300002705	JGI25156J39149_1044979	JGI25156J39149_10449791	69
1569	3300002738	JGI25154J39366_1002279	JGI25154J39366_10022796	69
1570	3300002741	JGI25157J39369_1000282	JGI25157J39369_100028224	69
1571	3300003322	rootL2_10119882	rootL2_101198822	69
1572	3300003323	rootH1_10069979	rootH1_100699796	69
1573	3300003371	JGI26145J50221_1022212	JGI26145J50221_10222122	69
1574	3300003391	JGI26135J50243_103023	JGI26135J50243_1030231	69
1575	3300003405	JGI26132J50249_104563	JGI26132J50249_1045631	69
1576	3300003502	JGI26143J51219_1004854	JGI26143J51219_10048541	69
1577	3300003751	Ga0055538_1000096	Ga0055538_100009613	69
1578	3300003752	Ga0055539_1000142	Ga0055539_100014213	69
1579	3300003756	Ga0055533_1000146	Ga0055533_100014613	69
1580	3300003756	Ga0055533_1012986	Ga0055533_10129861	69
1581	3300003758	Ga0055532_1000132	Ga0055532_100013213	69
1582	3300003761	Ga0055535_1004683	Ga0055535_10046835	69
1583	3300003781	Ga0055536_1000946	Ga0055536_10009467	69
1584	3300003781	Ga0055536_1016807	Ga0055536_10168075	69
1585	3300003781	Ga0055536_1055772	Ga0055536_10557722	69
1586	3300003791	Ga0055530_10000296	Ga0055530_100002967	69
1587	3300003791	Ga0055530_10098704	Ga0055530_100987042	69
1588	3300003792	Ga0055540_1108355	Ga0055540_11083552	69
1589	3300003794	Ga0055531_10001697	Ga0055531_100016975	69
1590	3300003794	Ga0055531_10008331	Ga0055531_100083314	69
1591	3300003794	Ga0055531_10011186	Ga0055531_100111864	69
1592	3300003841	Ga0055541_1000096	Ga0055541_100009654	69
1593	3300003856	Ga0058692_1000002	Ga0058692_100000227	69
1594	3300003856	Ga0058692_1026528	Ga0058692_10265282	69
1595	3300004800	Ga0058861_10053130	Ga0058861_100531302	69
1596	3300005288	Ga0065714_10000562	Ga0065714_100005622	69
1597	3300005288	Ga0065714_10071126	Ga0065714_100711262	69
1598	3300005289	Ga0065704_10000467	Ga0065704_100004672	69
1599	3300005289	Ga0065704_10002481	Ga0065704_100024818	69
1600	3300005289	Ga0065704_10012125	Ga0065704_100121252	69
1601	3300005289	Ga0065704_10250254	Ga0065704_102502541	69
1602	3300005289	Ga0065704_10353766	Ga0065704_103537662	69
1603	3300005290	Ga0065712_10067808	Ga0065712_1006780831	69
1604	3300005293	Ga0065715_10134922	Ga0065715_101349222	69
1605	3300005293	Ga0065715_10951252	Ga0065715_109512522	69
1606	3300005327	Ga0070658_10122767	Ga0070658_101227676	69
1607	3300005327	Ga0070658_11036834	Ga0070658_110368341	69
1608	3300005327	Ga0070658_11067144	Ga0070658_110671441	69
1609	3300005328	Ga0070676_10435238	Ga0070676_104352381	69
1610	3300005330	Ga0070690_101674413	Ga0070690_1016744132	69
1611	3300005331	Ga0070670_100242687	Ga0070670_1002426872	69
1612	3300005333	Ga0070677_10910416	Ga0070677_109104161	69
1613	3300005336	Ga0070680_100000138	Ga0070680_10000013844	69
1614	3300005336	Ga0070680_100010092	Ga0070680_1000100927	69
1615	3300005336	Ga0070680_100325524	Ga0070680_1003255243	69
1616	3300005336	Ga0070680_100739311	Ga0070680_1007393112	69
1617	3300005336	Ga0070680_101378275	Ga0070680_1013782752	69
1618	3300005337	Ga0070682_100138584	Ga0070682_1001385843	69
1619	3300005337	Ga0070682_100173330	Ga0070682_1001733303	69
1620	3300005337	Ga0070682_100332422	Ga0070682_1003324222	69
1621	3300005337	Ga0070682_100966569	Ga0070682_1009665692	69
1622	3300005337	Ga0070682_102053318	Ga0070682_1020533181	69
1623	3300005339	Ga0070660_100058361	Ga0070660_1000583611	69
1624	3300005339	Ga0070660_100219665	Ga0070660_1002196651	69
1625	3300005339	Ga0070660_100895698	Ga0070660_1008956981	69
1626	3300005339	Ga0070660_101181235	Ga0070660_1011812352	69
1627	3300005339	Ga0070660_101594353	Ga0070660_1015943531	69
1628	3300005340	Ga0070689_100403475	Ga0070689_1004034751	69
1629	3300005341	Ga0070691_10693743	Ga0070691_106937432	69
1630	3300005344	Ga0070661_100000306	Ga0070661_10000030614	69
1631	3300005344	Ga0070661_100014683	Ga0070661_1000146832	69
1632	3300005344	Ga0070661_100215629	Ga0070661_1002156291	69
1633	3300005344	Ga0070661_100234058	Ga0070661_1002340583	69
1634	3300005344	Ga0070661_100274436	Ga0070661_1002744364	69
1635	3300005345	Ga0070692_10000478	Ga0070692_100004782	69
1636	3300005345	Ga0070692_10034906	Ga0070692_100349064	69
1637	3300005345	Ga0070692_10056636	Ga0070692_100566364	69
1638	3300005345	Ga0070692_10204302	Ga0070692_102043021	69
1639	3300005345	Ga0070692_10656179	Ga0070692_106561791	69
1640	3300005347	Ga0070668_100135989	Ga0070668_1001359893	69
1641	3300005347	Ga0070668_101094190	Ga0070668_1010941901	69
1642	3300005347	Ga0070668_101937483	Ga0070668_1019374831	69
1643	3300005353	Ga0070669_100176976	Ga0070669_1001769762	69
1644	3300005356	Ga0070674_100416299	Ga0070674_1004162992	69
1645	3300005364	Ga0070673_100843268	Ga0070673_1008432681	69
1646	3300005366	Ga0070659_100016511	Ga0070659_1000165116	69
1647	3300005366	Ga0070659_100336883	Ga0070659_1003368832	69
1648	3300005366	Ga0070659_100670095	Ga0070659_1006700952	69
1649	3300005367	Ga0070667_101834516	Ga0070667_1018345161	69
1650	3300005435	Ga0070714_100690735	Ga0070714_1006907352	69
1651	3300005436	Ga0070713_100003934	Ga0070713_1000039348	69
1652	3300005437	Ga0070710_10042274	Ga0070710_100422742	69
1653	3300005439	Ga0070711_100286601	Ga0070711_1002866012	69
1654	3300005439	Ga0070711_101339017	Ga0070711_1013390171	69
1655	3300005444	Ga0070694_101873168	Ga0070694_1018731681	69
1656	3300005455	Ga0070663_100188372	Ga0070663_1001883722	69
1657	3300005455	Ga0070663_100300629	Ga0070663_1003006291	69
1658	3300005455	Ga0070663_100381217	Ga0070663_1003812171	69
1659	3300005455	Ga0070663_100929881	Ga0070663_1009298812	69
1660	3300005456	Ga0070678_101625787	Ga0070678_1016257871	69
1661	3300005457	Ga0070662_100011657	Ga0070662_1000116577	69
1662	3300005457	Ga0070662_100104237	Ga0070662_1001042373	69
1663	3300005457	Ga0070662_100208377	Ga0070662_1002083772	69
1664	3300005457	Ga0070662_100655735	Ga0070662_1006557352	69
1665	3300005458	Ga0070681_10011966	Ga0070681_100119662	69
1666	3300005458	Ga0070681_10026572	Ga0070681_100265722	69
1667	3300005458	Ga0070681_10048022	Ga0070681_100480227	69
1668	3300005458	Ga0070681_10115453	Ga0070681_101154532	69
1669	3300005466	Ga0070685_10103747	Ga0070685_101037472	69
1670	3300005518	Ga0070699_102101584	Ga0070699_1021015841	69
1671	3300005530	Ga0070679_100047747	Ga0070679_1000477471	69
1672	3300005530	Ga0070679_100055346	Ga0070679_1000553462	69
1673	3300005530	Ga0070679_100165244	Ga0070679_1001652442	69
1674	3300005530	Ga0070679_100903627	Ga0070679_1009036271	69
1675	3300005535	Ga0070684_100012803	Ga0070684_1000128039	69
1676	3300005535	Ga0070684_100548743	Ga0070684_1005487432	69
1677	3300005535	Ga0070684_100687464	Ga0070684_1006874641	69
1678	3300005535	Ga0070684_101361340	Ga0070684_1013613401	69
1679	3300005539	Ga0068853_100001671	Ga0068853_10000167112	69
1680	3300005539	Ga0068853_100012022	Ga0068853_1000120226	69
1681	3300005539	Ga0068853_100030193	Ga0068853_1000301934	69
1682	3300005539	Ga0068853_100126388	Ga0068853_1001263881	69
1683	3300005539	Ga0068853_100146115	Ga0068853_1001461154	69
1684	3300005539	Ga0068853_101232703	Ga0068853_1012327031	69
1685	3300005544	Ga0070686_100149817	Ga0070686_1001498174	69
1686	3300005545	Ga0070695_101137920	Ga0070695_1011379201	69
1687	3300005546	Ga0070696_100001623	Ga0070696_10000162310	69
1688	3300005546	Ga0070696_100298788	Ga0070696_1002987882	69
1689	3300005546	Ga0070696_101574876	Ga0070696_1015748761	69
1690	3300005547	Ga0070693_100002601	Ga0070693_1000026018	69
1691	3300005547	Ga0070693_100003579	Ga0070693_1000035793	69
1692	3300005547	Ga0070693_100046828	Ga0070693_1000468283	69
1693	3300005547	Ga0070693_100210534	Ga0070693_1002105342	69
1694	3300005548	Ga0070665_100234379	Ga0070665_1002343792	69
1695	3300005548	Ga0070665_100367397	Ga0070665_1003673972	69
1696	3300005549	Ga0070704_101592649	Ga0070704_1015926491	69
1697	3300005563	Ga0068855_100228767	Ga0068855_1002287672	69
1698	3300005563	Ga0068855_101673535	Ga0068855_1016735352	69
1699	3300005564	Ga0070664_100000741	Ga0070664_1000007411	69
1700	3300005564	Ga0070664_100096146	Ga0070664_1000961464	69
1701	3300005564	Ga0070664_100166660	Ga0070664_1001666603	69
1702	3300005564	Ga0070664_101001138	Ga0070664_1010011382	69
1703	3300005577	Ga0068857_100081431	Ga0068857_1000814313	69
1704	3300005577	Ga0068857_100093128	Ga0068857_1000931282	69
1705	3300005577	Ga0068857_100169594	Ga0068857_1001695942	69
1706	3300005577	Ga0068857_100362383	Ga0068857_1003623832	69
1707	3300005578	Ga0068854_100028524	Ga0068854_1000285243	69
1708	3300005578	Ga0068854_100070528	Ga0068854_1000705286	69
1709	3300005578	Ga0068854_100333610	Ga0068854_1003336103	69
1710	3300005578	Ga0068854_100360395	Ga0068854_1003603952	69
1711	3300005614	Ga0068856_100031611	Ga0068856_1000316116	69
1712	3300005614	Ga0068856_100316992	Ga0068856_1003169922	69
1713	3300005615	Ga0070702_100360434	Ga0070702_1003604341	69
1714	3300005616	Ga0068852_100058742	Ga0068852_1000587423	69
1715	3300005616	Ga0068852_100116964	Ga0068852_1001169641	69
1716	3300005616	Ga0068852_100437521	Ga0068852_1004375214	69
1717	3300005617	Ga0068859_100707626	Ga0068859_1007076262	69
1718	3300005834	Ga0068851_10000019	Ga0068851_1000001939	69
1719	3300005834	Ga0068851_10002065	Ga0068851_100020653	69
1720	3300005834	Ga0068851_10043938	Ga0068851_100439384	69
1721	3300005844	Ga0068862_100013496	Ga0068862_1000134964	69
1722	3300005985	Ga0081539_10184640	Ga0081539_101846401	69
1723	3300006038	Ga0075365_11014601	Ga0075365_110146011	69
1724	3300006038	Ga0075365_11067217	Ga0075365_110672173	69
1725	3300006048	Ga0075363_100429621	Ga0075363_1004296212	69
1726	3300006051	Ga0075364_10084588	Ga0075364_100845883	69
1727	3300006051	Ga0075364_10902665	Ga0075364_109026653	69
1728	3300006051	Ga0075364_10969202	Ga0075364_109692021	69
1729	3300006058	Ga0075432_10170318	Ga0075432_101703182	69
1730	3300006175	Ga0070712_101196930	Ga0070712_1011969302	69
1731	3300006175	Ga0070712_101288617	Ga0070712_1012886172	69
1732	3300006177	Ga0075362_10689157	Ga0075362_106891572	69
1733	3300006178	Ga0075367_10730605	Ga0075367_107306051	69
1734	3300006186	Ga0075369_10475403	Ga0075369_104754032	69
1735	3300006194	Ga0075427_10034136	Ga0075427_100341362	69
1736	3300006195	Ga0075366_10326262	Ga0075366_103262621	69
1737	3300006195	Ga0075366_10699793	Ga0075366_106997931	69
1738	3300006237	Ga0097621_100071743	Ga0097621_1000717434	69
1739	3300006353	Ga0075370_11015545	Ga0075370_110155451	69
1740	3300006358	Ga0068871_100018101	Ga0068871_1000181012	69
1741	3300006880	Ga0075429_101709394	Ga0075429_1017093942	69
1742	3300006914	Ga0075436_101312767	Ga0075436_1013127672	69
1743	3300006931	Ga0097620_100707504	Ga0097620_1007075042	69
1744	3300006944	Ga0099823_1000376	Ga0099823_100037612	69
1745	3300006944	Ga0099823_1008670	Ga0099823_100867011	69
1746	3300006948	Ga0099826_10000372	Ga0099826_100003725	69
1747	3300009011	Ga0105251_10000123	Ga0105251_100001239	69
1748	3300009011	Ga0105251_10043744	Ga0105251_100437441	69
1749	3300009036	Ga0105244_10010350	Ga0105244_100103504	69
1750	3300009036	Ga0105244_10015391	Ga0105244_100153912	69
1751	3300009036	Ga0105244_10015842	Ga0105244_100158423	69
1752	3300009036	Ga0105244_10051025	Ga0105244_100510251	69
1753	3300009036	Ga0105244_10077459	Ga0105244_100774592	69
1754	3300009036	Ga0105244_10095751	Ga0105244_100957512	69
1755	3300009036	Ga0105244_10217361	Ga0105244_102173612	69
1756	3300009092	Ga0105250_10000254	Ga0105250_100002548	69
1757	3300009092	Ga0105250_10029806	Ga0105250_100298063	69
1758	3300009093	Ga0105240_10336613	Ga0105240_103366133	69
1759	3300009093	Ga0105240_10875669	Ga0105240_108756692	69
1760	3300009093	Ga0105240_10879893	Ga0105240_108798931	69
1761	3300009094	Ga0111539_12193973	Ga0111539_121939731	69
1762	3300009098	Ga0105245_12729068	Ga0105245_127290682	69
1763	3300009101	Ga0105247_11357661	Ga0105247_113576611	69
1764	3300009148	Ga0105243_10012630	Ga0105243_100126305	69
1765	3300009148	Ga0105243_10027778	Ga0105243_100277782	69
1766	3300009148	Ga0105243_10059887	Ga0105243_100598873	69
1767	3300009148	Ga0105243_10162156	Ga0105243_101621562	69
1768	3300009148	Ga0105243_10347269	Ga0105243_103472692	69
1769	3300009148	Ga0105243_12602966	Ga0105243_126029662	69
1770	3300009174	Ga0105241_10068216	Ga0105241_100682165	69
1771	3300009174	Ga0105241_10153877	Ga0105241_101538772	69
1772	3300009174	Ga0105241_10267538	Ga0105241_102675382	69
1773	3300009174	Ga0105241_10312244	Ga0105241_103122441	69
1774	3300009174	Ga0105241_10454941	Ga0105241_104549412	69
1775	3300009174	Ga0105241_10589555	Ga0105241_105895552	69
1776	3300009174	Ga0105241_11536059	Ga0105241_115360592	69
1777	3300009176	Ga0105242_10001061	Ga0105242_1000106110	69
1778	3300009176	Ga0105242_10917073	Ga0105242_109170731	69
1779	3300009177	Ga0105248_11311776	Ga0105248_113117761	69
1780	3300009177	Ga0105248_11773730	Ga0105248_117737301	69
1781	3300009545	Ga0105237_10002041	Ga0105237_1000204113	69
1782	3300009545	Ga0105237_10045048	Ga0105237_100450486	69
1783	3300009545	Ga0105237_10568256	Ga0105237_105682561	69
1784	3300009545	Ga0105237_10572067	Ga0105237_105720672	69
1785	3300009551	Ga0105238_10009103	Ga0105238_100091038	69
1786	3300009551	Ga0105238_10012750	Ga0105238_100127508	69
1787	3300009551	Ga0105238_10516092	Ga0105238_105160922	69
1788	3300009551	Ga0105238_11599198	Ga0105238_115991982	69
1789	3300009553	Ga0105249_10983299	Ga0105249_109832992	69
1790	3300009553	Ga0105249_11685673	Ga0105249_116856731	69
1791	3300009553	Ga0105249_13351060	Ga0105249_133510601	69
1792	3300009993	Ga0105028_105122	Ga0105028_1051221	69
1793	3300010375	Ga0105239_10007373	Ga0105239_1000737314	69
1794	3300010375	Ga0105239_10014032	Ga0105239_100140322	69
1795	3300010375	Ga0105239_11003877	Ga0105239_110038772	69
1796	3300012482	Ga0157318_1034626	Ga0157318_10346261	69
1797	3300012494	Ga0157341_1009120	Ga0157341_10091202	69
1798	3300013100	Ga0157373_10047843	Ga0157373_100478432	69
1799	3300013100	Ga0157373_10074378	Ga0157373_100743783	69
1800	3300013100	Ga0157373_10197231	Ga0157373_101972312	69
1801	3300013100	Ga0157373_10269288	Ga0157373_102692883	69
1802	3300013100	Ga0157373_10788707	Ga0157373_107887072	69
1803	3300013100	Ga0157373_10991395	Ga0157373_109913951	69
1804	3300013102	Ga0157371_10000311	Ga0157371_1000031127	69
1805	3300013102	Ga0157371_10028700	Ga0157371_100287004	69
1806	3300013102	Ga0157371_10061733	Ga0157371_100617332	69
1807	3300013102	Ga0157371_10156471	Ga0157371_101564712	69
1808	3300013102	Ga0157371_10206585	Ga0157371_102065852	69
1809	3300013102	Ga0157371_10423407	Ga0157371_104234071	69
1810	3300013102	Ga0157371_10468856	Ga0157371_104688561	69
1811	3300013104	Ga0157370_10009913	Ga0157370_100099131	69
1812	3300013104	Ga0157370_10058147	Ga0157370_100581471	69
1813	3300013104	Ga0157370_10156026	Ga0157370_101560263	69
1814	3300013104	Ga0157370_10283606	Ga0157370_102836062	69
1815	3300013104	Ga0157370_10587039	Ga0157370_105870392	69
1816	3300013104	Ga0157370_11818812	Ga0157370_118188122	69
1817	3300013105	Ga0157369_10119332	Ga0157369_101193322	69
1818	3300013105	Ga0157369_10165135	Ga0157369_101651352	69
1819	3300013105	Ga0157369_10883319	Ga0157369_108833193	69
1820	3300013105	Ga0157369_11367670	Ga0157369_113676703	69
1821	3300013105	Ga0157369_12432511	Ga0157369_124325111	69
1822	3300013296	Ga0157374_12126751	Ga0157374_121267511	69
1823	3300013306	Ga0163162_12901263	Ga0163162_129012632	69
1824	3300013307	Ga0157372_10000274	Ga0157372_1000027417	69
1825	3300013307	Ga0157372_10000640	Ga0157372_100006404	69
1826	3300013307	Ga0157372_10239647	Ga0157372_102396474	69
1827	3300013307	Ga0157372_10250519	Ga0157372_102505192	69
1828	3300013307	Ga0157372_10333179	Ga0157372_103331794	69
1829	3300013307	Ga0157372_10506829	Ga0157372_105068294	69
1830	3300013307	Ga0157372_10678275	Ga0157372_106782752	69
1831	3300014325	Ga0163163_11544294	Ga0163163_115442941	69
1832	3300014969	Ga0157376_11629200	Ga0157376_116292002	69
1833	3300015261	Ga0182006_1000514	Ga0182006_100051428	69
1834	3300015261	Ga0182006_1003926	Ga0182006_10039266	69
1835	3300015261	Ga0182006_1013796	Ga0182006_10137963	69
1836	3300015685	Ga0183369_1009	Ga0183369_1009125	69
1837	3300017792	Ga0163161_10005387	Ga0163161_100053872	69
1838	3300017792	Ga0163161_10025004	Ga0163161_100250047	69
1839	3300017792	Ga0163161_10104934	Ga0163161_101049342	69
1840	3300020069	Ga0197907_10236480	Ga0197907_102364802	69
1841	3300020069	Ga0197907_10672939	Ga0197907_106729391	69
1842	3300020070	Ga0206356_11039573	Ga0206356_110395737	69
1843	3300020075	Ga0206349_1698478	Ga0206349_16984781	69
1844	3300020077	Ga0206351_10324362	Ga0206351_103243622	69
1845	3300020080	Ga0206350_10000740	Ga0206350_100007401	69
1846	3300020082	Ga0206353_10292816	Ga0206353_102928161	69
1847	3300020082	Ga0206353_11578131	Ga0206353_115781312	69
1848	3300020610	Ga0154015_1305770	Ga0154015_13057705	69
1849	3300023309	Ga0256744_118603	Ga0256744_1186031	69
1850	3300025206	Ga0209435_100393	Ga0209435_1003932	69
1851	3300025207	Ga0209760_100099	Ga0209760_1000999	69
1852	3300025207	Ga0209760_100111	Ga0209760_10011150	69
1853	3300025224	Ga0209784_100015	Ga0209784_100015188	69
1854	3300025225	Ga0209566_100012	Ga0209566_100012188	69
1855	3300025226	Ga0209674_100027	Ga0209674_100027188	69
1856	3300025226	Ga0209674_100519	Ga0209674_1005198	69
1857	3300025229	Ga0209147_100019	Ga0209147_100019188	69
1858	3300025230	Ga0209563_100031	Ga0209563_100031188	69
1859	3300025231	Ga0207427_100001	Ga0207427_100001428	69
1860	3300025231	Ga0207427_100029	Ga0207427_100029257	69
1861	3300025231	Ga0207427_100119	Ga0207427_10011920	69
1862	3300025231	Ga0207427_100141	Ga0207427_10014119	69
1863	3300025233	Ga0209437_100003	Ga0209437_100003944	69
1864	3300025233	Ga0209437_100005	Ga0209437_10000570	69
1865	3300025233	Ga0209437_100009	Ga0209437_100009512	69
1866	3300025233	Ga0209437_100253	Ga0209437_10025351	69
1867	3300025242	Ga0209258_100824	Ga0209258_10082414	69
1868	3300025242	Ga0209258_108474	Ga0209258_1084742	69
1869	3300025246	Ga0209646_1000220	Ga0209646_100022038	69
1870	3300025250	Ga0209026_1000113	Ga0209026_100011346	69
1871	3300025253	Ga0209677_100016	Ga0209677_100016188	69
1872	3300025256	Ga0209759_1005930	Ga0209759_10059302	69
1873	3300025256	Ga0209759_1007370	Ga0209759_10073703	69
1874	3300025256	Ga0209759_1029468	Ga0209759_10294682	69
1875	3300025261	Ga0209233_1000007	Ga0209233_1000007428	69
1876	3300025261	Ga0209233_1000011	Ga0209233_1000011870	69
1877	3300025261	Ga0209233_1000032	Ga0209233_1000032512	69
1878	3300025261	Ga0209233_1000046	Ga0209233_1000046322	69
1879	3300025292	Ga0209676_1000016	Ga0209676_1000016155	69
1880	3300025292	Ga0209676_1000080	Ga0209676_1000080219	69
1881	3300025292	Ga0209676_1000086	Ga0209676_100008668	69
1882	3300025292	Ga0209676_1000231	Ga0209676_100023155	69
1883	3300025292	Ga0209676_1002984	Ga0209676_10029841	69
1884	3300025297	Ga0209758_1031630	Ga0209758_10316303	69
1885	3300025298	Ga0209050_1000117	Ga0209050_1000117173	69
1886	3300025298	Ga0209050_1001895	Ga0209050_100189517	69
1887	3300025298	Ga0209050_1036452	Ga0209050_10364523	69
1888	3300025303	Ga0209051_1000077	Ga0209051_1000077173	69
1889	3300025303	Ga0209051_1030544	Ga0209051_10305444	69
1890	3300025304	Ga0209257_1000251	Ga0209257_100025122	69
1891	3300025304	Ga0209257_1000342	Ga0209257_10003421	69
1892	3300025304	Ga0209257_1000704	Ga0209257_100070440	69
1893	3300025321	Ga0207656_10000042	Ga0207656_1000004217	69
1894	3300025321	Ga0207656_10054038	Ga0207656_100540384	69
1895	3300025321	Ga0207656_10147183	Ga0207656_101471831	69
1896	3300025321	Ga0207656_10383706	Ga0207656_103837061	69
1897	3300025711	Ga0207696_1000018	Ga0207696_1000018266	69
1898	3300025711	Ga0207696_1000022	Ga0207696_100002227	69
1899	3300025711	Ga0207696_1000044	Ga0207696_1000044283	69
1900	3300025711	Ga0207696_1000063	Ga0207696_1000063141	69
1901	3300025711	Ga0207696_1006387	Ga0207696_10063873	69
1902	3300025728	Ga0207655_1000021	Ga0207655_1000021347	69
1903	3300025728	Ga0207655_1000399	Ga0207655_100039958	69
1904	3300025728	Ga0207655_1002739	Ga0207655_10027391	69
1905	3300025728	Ga0207655_1002946	Ga0207655_100294611	69
1906	3300025728	Ga0207655_1003971	Ga0207655_100397112	69
1907	3300025728	Ga0207655_1004743	Ga0207655_10047438	69
1908	3300025728	Ga0207655_1010619	Ga0207655_10106198	69
1909	3300025728	Ga0207655_1021881	Ga0207655_10218813	69
1910	3300025728	Ga0207655_1035804	Ga0207655_10358042	69
1911	3300025728	Ga0207655_1037962	Ga0207655_10379622	69
1912	3300025728	Ga0207655_1049084	Ga0207655_10490842	69
1913	3300025728	Ga0207655_1054381	Ga0207655_10543812	69
1914	3300025728	Ga0207655_1064963	Ga0207655_10649632	69
1915	3300025735	Ga0207713_1000085	Ga0207713_1000085148	69
1916	3300025735	Ga0207713_1000230	Ga0207713_100023053	69
1917	3300025735	Ga0207713_1000338	Ga0207713_100033820	69
1918	3300025735	Ga0207713_1000697	Ga0207713_100069711	69
1919	3300025735	Ga0207713_1002966	Ga0207713_100296610	69
1920	3300025735	Ga0207713_1011272	Ga0207713_10112724	69
1921	3300025735	Ga0207713_1016774	Ga0207713_10167741	69
1922	3300025735	Ga0207713_1077233	Ga0207713_10772332	69
1923	3300025735	Ga0207713_1122472	Ga0207713_11224721	69
1924	3300025893	Ga0207682_10513034	Ga0207682_105130341	69
1925	3300025898	Ga0207692_10031714	Ga0207692_100317142	69
1926	3300025898	Ga0207692_11215276	Ga0207692_112152761	69
1927	3300025904	Ga0207647_10011761	Ga0207647_100117617	69
1928	3300025904	Ga0207647_10267584	Ga0207647_102675842	69
1929	3300025904	Ga0207647_10332931	Ga0207647_103329311	69
1930	3300025907	Ga0207645_10378031	Ga0207645_103780312	69
1931	3300025909	Ga0207705_10000146	Ga0207705_1000014618	69
1932	3300025909	Ga0207705_10000373	Ga0207705_1000037311	69
1933	3300025909	Ga0207705_10000373	Ga0207705_100003731	69
1934	3300025909	Ga0207705_10000900	Ga0207705_1000090016	69
1935	3300025909	Ga0207705_10007781	Ga0207705_100077815	69
1936	3300025909	Ga0207705_10031894	Ga0207705_100318944	69
1937	3300025909	Ga0207705_10038764	Ga0207705_100387645	69
1938	3300025911	Ga0207654_10442756	Ga0207654_104427561	69
1939	3300025911	Ga0207654_10568096	Ga0207654_105680961	69
1940	3300025911	Ga0207654_10916707	Ga0207654_109167071	69
1941	3300025911	Ga0207654_11064550	Ga0207654_110645502	69
1942	3300025911	Ga0207654_11118415	Ga0207654_111184151	69
1943	3300025912	Ga0207707_10000215	Ga0207707_1000021554	69
1944	3300025912	Ga0207707_10000725	Ga0207707_1000072534	69
1945	3300025912	Ga0207707_10000844	Ga0207707_1000084417	69
1946	3300025912	Ga0207707_10000844	Ga0207707_100008446	69
1947	3300025912	Ga0207707_10001158	Ga0207707_1000115814	69
1948	3300025912	Ga0207707_10001158	Ga0207707_100011584	69
1949	3300025912	Ga0207707_10001457	Ga0207707_1000145710	69
1950	3300025912	Ga0207707_10017431	Ga0207707_100174316	69
1951	3300025912	Ga0207707_10026497	Ga0207707_100264972	69
1952	3300025912	Ga0207707_10032018	Ga0207707_100320183	69
1953	3300025912	Ga0207707_10037788	Ga0207707_100377882	69
1954	3300025912	Ga0207707_10728454	Ga0207707_107284542	69
1955	3300025913	Ga0207695_10006716	Ga0207695_1000671618	69
1956	3300025913	Ga0207695_10008344	Ga0207695_100083447	69
1957	3300025913	Ga0207695_10062723	Ga0207695_100627234	69
1958	3300025913	Ga0207695_11429238	Ga0207695_114292382	69
1959	3300025914	Ga0207671_10000420	Ga0207671_1000042050	69
1960	3300025914	Ga0207671_10231114	Ga0207671_102311142	69
1961	3300025914	Ga0207671_10574978	Ga0207671_105749781	69
1962	3300025914	Ga0207671_11242464	Ga0207671_112424642	69
1963	3300025915	Ga0207693_10417497	Ga0207693_104174971	69
1964	3300025915	Ga0207693_11000275	Ga0207693_110002752	69
1965	3300025916	Ga0207663_10101704	Ga0207663_101017042	69
1966	3300025916	Ga0207663_11059641	Ga0207663_110596411	69
1967	3300025917	Ga0207660_10001193	Ga0207660_1000119318	69
1968	3300025917	Ga0207660_10002237	Ga0207660_100022374	69
1969	3300025917	Ga0207660_10003750	Ga0207660_100037508	69
1970	3300025917	Ga0207660_10012254	Ga0207660_100122544	69
1971	3300025917	Ga0207660_10022199	Ga0207660_100221991	69
1972	3300025917	Ga0207660_10061422	Ga0207660_100614223	69
1973	3300025917	Ga0207660_10231189	Ga0207660_102311893	69
1974	3300025917	Ga0207660_10386727	Ga0207660_103867272	69
1975	3300025918	Ga0207662_10171220	Ga0207662_101712202	69
1976	3300025919	Ga0207657_10006033	Ga0207657_100060337	69
1977	3300025919	Ga0207657_10058734	Ga0207657_100587342	69
1978	3300025919	Ga0207657_10091708	Ga0207657_100917084	69
1979	3300025920	Ga0207649_10000002	Ga0207649_10000002361	69
1980	3300025920	Ga0207649_10002626	Ga0207649_100026264	69
1981	3300025920	Ga0207649_10016518	Ga0207649_100165186	69
1982	3300025920	Ga0207649_10061227	Ga0207649_100612271	69
1983	3300025920	Ga0207649_10063223	Ga0207649_100632234	69
1984	3300025920	Ga0207649_10153798	Ga0207649_101537982	69
1985	3300025921	Ga0207652_10000409	Ga0207652_1000040942	69
1986	3300025921	Ga0207652_10001049	Ga0207652_1000104911	69
1987	3300025921	Ga0207652_10002979	Ga0207652_1000297912	69
1988	3300025921	Ga0207652_10003256	Ga0207652_100032566	69
1989	3300025921	Ga0207652_10003709	Ga0207652_1000370911	69
1990	3300025921	Ga0207652_10018777	Ga0207652_100187777	69
1991	3300025921	Ga0207652_10040309	Ga0207652_100403092	69
1992	3300025921	Ga0207652_10214193	Ga0207652_102141932	69
1993	3300025921	Ga0207652_10811616	Ga0207652_108116162	69
1994	3300025923	Ga0207681_10000815	Ga0207681_1000081518	69
1995	3300025923	Ga0207681_10672713	Ga0207681_106727132	69
1996	3300025924	Ga0207694_10014106	Ga0207694_100141062	69
1997	3300025924	Ga0207694_10014405	Ga0207694_100144056	69
1998	3300025924	Ga0207694_10020487	Ga0207694_100204871	69
1999	3300025924	Ga0207694_10061900	Ga0207694_100619002	69
2000	3300025924	Ga0207694_10112418	Ga0207694_101124183	69
2001	3300025925	Ga0207650_10000606	Ga0207650_1000060612	69
2002	3300025928	Ga0207700_10003011	Ga0207700_100030112	69
2003	3300025929	Ga0207664_10000173	Ga0207664_100001735	69
2004	3300025929	Ga0207664_10000797	Ga0207664_1000079721	69
2005	3300025929	Ga0207664_10879986	Ga0207664_108799861	69
2006	3300025932	Ga0207690_10006035	Ga0207690_100060356	69
2007	3300025932	Ga0207690_10006042	Ga0207690_100060427	69
2008	3300025932	Ga0207690_10009879	Ga0207690_100098794	69
2009	3300025932	Ga0207690_10010804	Ga0207690_100108043	69
2010	3300025932	Ga0207690_10045459	Ga0207690_100454596	69
2011	3300025932	Ga0207690_10099409	Ga0207690_100994096	69
2012	3300025932	Ga0207690_10592675	Ga0207690_105926752	69
2013	3300025932	Ga0207690_10996475	Ga0207690_109964753	69
2014	3300025932	Ga0207690_11623266	Ga0207690_116232661	69
2015	3300025933	Ga0207706_10004930	Ga0207706_100049309	69
2016	3300025933	Ga0207706_10020025	Ga0207706_100200253	69
2017	3300025933	Ga0207706_10130605	Ga0207706_101306053	69
2018	3300025933	Ga0207706_11245368	Ga0207706_112453682	69
2019	3300025934	Ga0207686_10022071	Ga0207686_100220715	69
2020	3300025934	Ga0207686_10868519	Ga0207686_108685191	69
2021	3300025935	Ga0207709_10000036	Ga0207709_100000368	69
2022	3300025935	Ga0207709_10011641	Ga0207709_100116413	69
2023	3300025935	Ga0207709_10048403	Ga0207709_100484033	69
2024	3300025935	Ga0207709_11125073	Ga0207709_111250732	69
2025	3300025936	Ga0207670_10285787	Ga0207670_102857872	69
2026	3300025937	Ga0207669_10187106	Ga0207669_101871062	69
2027	3300025941	Ga0207711_11413950	Ga0207711_114139501	69
2028	3300025944	Ga0207661_10009672	Ga0207661_1000967210	69
2029	3300025944	Ga0207661_10013654	Ga0207661_100136547	69
2030	3300025944	Ga0207661_10028633	Ga0207661_100286332	69
2031	3300025944	Ga0207661_10031283	Ga0207661_100312834	69
2032	3300025944	Ga0207661_10040881	Ga0207661_100408811	69
2033	3300025945	Ga0207679_10000006	Ga0207679_10000006130	69
2034	3300025945	Ga0207679_10004131	Ga0207679_100041319	69
2035	3300025945	Ga0207679_10022509	Ga0207679_100225096	69
2036	3300025945	Ga0207679_10089598	Ga0207679_100895983	69
2037	3300025945	Ga0207679_10142002	Ga0207679_101420021	69
2038	3300025945	Ga0207679_10321412	Ga0207679_103214121	69
2039	3300025949	Ga0207667_10000493	Ga0207667_1000049310	69
2040	3300025949	Ga0207667_10005511	Ga0207667_100055117	69
2041	3300025949	Ga0207667_10006956	Ga0207667_1000695611	69
2042	3300025949	Ga0207667_10007043	Ga0207667_1000704316	69
2043	3300025949	Ga0207667_10008317	Ga0207667_100083175	69
2044	3300025949	Ga0207667_10015711	Ga0207667_100157116	69
2045	3300025949	Ga0207667_10021898	Ga0207667_100218988	69
2046	3300025949	Ga0207667_10111418	Ga0207667_101114182	69
2047	3300025949	Ga0207667_10121817	Ga0207667_101218175	69
2048	3300025961	Ga0207712_10230467	Ga0207712_102304672	69
2049	3300025972	Ga0207668_10165032	Ga0207668_101650321	69
2050	3300025972	Ga0207668_10303565	Ga0207668_103035651	69
2051	3300025972	Ga0207668_11603863	Ga0207668_116038631	69
2052	3300025972	Ga0207668_12154892	Ga0207668_121548921	69
2053	3300025981	Ga0207640_10003046	Ga0207640_100030466	69
2054	3300025981	Ga0207640_10003757	Ga0207640_100037575	69
2055	3300025981	Ga0207640_10008281	Ga0207640_100082814	69
2056	3300025981	Ga0207640_10009762	Ga0207640_100097625	69
2057	3300025981	Ga0207640_10014268	Ga0207640_100142684	69
2058	3300025981	Ga0207640_10044363	Ga0207640_100443633	69
2059	3300025981	Ga0207640_10094860	Ga0207640_100948602	69
2060	3300025981	Ga0207640_10366254	Ga0207640_103662541	69
2061	3300025986	Ga0207658_10677748	Ga0207658_106777482	69
2062	3300026041	Ga0207639_10001583	Ga0207639_1000158319	69
2063	3300026041	Ga0207639_10001932	Ga0207639_1000193213	69
2064	3300026041	Ga0207639_10003948	Ga0207639_1000394810	69
2065	3300026041	Ga0207639_10004691	Ga0207639_1000469112	69
2066	3300026041	Ga0207639_10015209	Ga0207639_100152094	69
2067	3300026041	Ga0207639_10018104	Ga0207639_100181041	69
2068	3300026041	Ga0207639_10069591	Ga0207639_100695912	69
2069	3300026041	Ga0207639_10293595	Ga0207639_102935952	69
2070	3300026041	Ga0207639_10590552	Ga0207639_105905522	69
2071	3300026041	Ga0207639_12214693	Ga0207639_122146931	69
2072	3300026067	Ga0207678_10004731	Ga0207678_100047317	69
2073	3300026067	Ga0207678_10081598	Ga0207678_100815982	69
2074	3300026067	Ga0207678_10101985	Ga0207678_101019854	69
2075	3300026067	Ga0207678_10155046	Ga0207678_101550462	69
2076	3300026078	Ga0207702_10002317	Ga0207702_100023175	69
2077	3300026078	Ga0207702_10040184	Ga0207702_100401845	69
2078	3300026078	Ga0207702_10144775	Ga0207702_101447755	69
2079	3300026078	Ga0207702_10195354	Ga0207702_101953544	69
2080	3300026078	Ga0207702_10573853	Ga0207702_105738531	69
2081	3300026078	Ga0207702_10666016	Ga0207702_106660161	69
2082	3300026078	Ga0207702_11706449	Ga0207702_117064491	69
2083	3300026078	Ga0207702_11754447	Ga0207702_117544472	69
2084	3300026116	Ga0207674_10006525	Ga0207674_100065256	69
2085	3300026116	Ga0207674_10006658	Ga0207674_100066584	69
2086	3300026116	Ga0207674_10036090	Ga0207674_100360905	69
2087	3300026116	Ga0207674_10594294	Ga0207674_105942941	69
2088	3300026116	Ga0207674_10646587	Ga0207674_106465872	69
2089	3300026118	Ga0207675_101378297	Ga0207675_1013782972	69
2090	3300026121	Ga0207683_10584390	Ga0207683_105843901	69
2091	3300026142	Ga0207698_10000753	Ga0207698_1000075314	69
2092	3300026142	Ga0207698_10006967	Ga0207698_100069675	69
2093	3300026142	Ga0207698_10008224	Ga0207698_100082242	69
2094	3300026142	Ga0207698_10065940	Ga0207698_100659404	69
2095	3300026142	Ga0207698_10398152	Ga0207698_103981522	69
2096	3300027111	Ga0209281_1000013	Ga0209281_1000013443	69
2097	3300027111	Ga0209281_1010348	Ga0209281_10103484	69
2098	3300027252	Ga0209973_1019543	Ga0209973_10195432	69
2099	3300027296	Ga0209389_1000005	Ga0209389_1000005105	69
2100	3300027296	Ga0209389_1000131	Ga0209389_100013153	69
2101	3300027312	Ga0209371_1000004	Ga0209371_1000004235	69
2102	3300027312	Ga0209371_1000135	Ga0209371_100013539	69
2103	3300027312	Ga0209371_1003230	Ga0209371_10032305	69
2104	3300027312	Ga0209371_1027105	Ga0209371_10271051	69
2105	3300027364	Ga0209967_1061365	Ga0209967_10613651	69
2106	3300027378	Ga0209981_1022200	Ga0209981_10222002	69
2107	3300027395	Ga0209996_1014148	Ga0209996_10141482	69
2108	3300027395	Ga0209996_1051888	Ga0209996_10518881	69
2109	3300027395	Ga0209996_1074632	Ga0209996_10746321	69
2110	3300027424	Ga0209984_1003970	Ga0209984_10039702	69
2111	3300027462	Ga0210000_1007911	Ga0210000_10079112	69
2112	3300027471	Ga0209995_1005333	Ga0209995_10053334	69
2113	3300027526	Ga0209968_1030014	Ga0209968_10300142	69
2114	3300027543	Ga0209999_1007661	Ga0209999_10076613	69
2115	3300027543	Ga0209999_1049265	Ga0209999_10492651	69
2116	3300027552	Ga0209982_1009739	Ga0209982_10097392	69
2117	3300027552	Ga0209982_1058158	Ga0209982_10581582	69
2118	3300027614	Ga0209970_1015584	Ga0209970_10155842	69
2119	3300027617	Ga0210002_1037747	Ga0210002_10377472	69
2120	3300027665	Ga0209983_1001258	Ga0209983_10012582	69
2121	3300027665	Ga0209983_1017501	Ga0209983_10175013	69
2122	3300027666	Ga0209282_1027977	Ga0209282_10279775	69
2123	3300027682	Ga0209971_1001741	Ga0209971_10017417	69
2124	3300027876	Ga0209974_10002695	Ga0209974_100026953	69
2125	3300027876	Ga0209974_10023431	Ga0209974_100234311	69
2126	3300028379	Ga0268266_10010436	Ga0268266_100104367	69
2127	3300028379	Ga0268266_10302564	Ga0268266_103025643	69
2128	3300028379	Ga0268266_10336447	Ga0268266_103364473	69
2129	3300028380	Ga0268265_10009799	Ga0268265_100097993	69
2130	3300028381	Ga0268264_10264875	Ga0268264_102648752	69
2131	3300028794	Ga0307515_10217506	Ga0307515_102175064	69
2132	3300030500	Ga0268256_1000005	Ga0268256_1000005810	69
2133	3300030500	Ga0268256_1000148	Ga0268256_100014839	69
2134	3300030500	Ga0268256_1002928	Ga0268256_10029286	69
2135	3300030500	Ga0268256_1030829	Ga0268256_10308292	69
2136	3300030731	Ga0316177_1107574	Ga0316177_11075743	69
2137	3300030731	Ga0316177_1132906	Ga0316177_11329062	69
2138	3300030732	Ga0316176_1211692	Ga0316176_12116922	69
2139	3300030733	Ga0314311_1069660	Ga0314311_10696602	69
2140	3300030734	Ga0316179_1120852	Ga0316179_11208521	69
2141	3300030735	Ga0316178_1003918	Ga0316178_10039185	69
2142	3300030736	Ga0316180_1173768	Ga0316180_11737682	69
2143	3300030744	Ga0316181_1039458	Ga0316181_10394581	69
2144	3300030744	Ga0316181_1255556	Ga0316181_12555564	69
2145	3300030763	Ga0265763_1050400	Ga0265763_10504002	69
2146	3300031238	Ga0265332_10034898	Ga0265332_100348982	69
2147	3300031456	Ga0307513_10072433	Ga0307513_100724335	69
2148	3300031548	Ga0307408_100000081	Ga0307408_10000008176	69
2149	3300031548	Ga0307408_100119597	Ga0307408_1001195972	69
2150	3300031548	Ga0307408_101232820	Ga0307408_1012328202	69
2151	3300031727	Ga0316576_10907709	Ga0316576_109077091	69
2152	3300031731	Ga0307405_10000116	Ga0307405_100001167	69
2153	3300031824	Ga0307413_10040711	Ga0307413_100407113	69
2154	3300031824	Ga0307413_10085648	Ga0307413_100856481	69
2155	3300031901	Ga0307406_11187013	Ga0307406_111870131	69
2156	3300031911	Ga0307412_10567876	Ga0307412_105678763	69
2157	3300032002	Ga0307416_100079472	Ga0307416_1000794723	69
2158	3300032002	Ga0307416_100420817	Ga0307416_1004208172	69
2159	3300032004	Ga0307414_10001089	Ga0307414_1000108915	69
2160	3300032004	Ga0307414_10045617	Ga0307414_100456171	69
2161	3300032004	Ga0307414_10100632	Ga0307414_101006323	69
2162	3300032004	Ga0307414_10765441	Ga0307414_107654412	69
2163	3300032004	Ga0307414_10849304	Ga0307414_108493041	69
2164	3300032005	Ga0307411_11323788	Ga0307411_113237881	69
2165	3300035171	Ga0373946_0361847	Ga0373946_0361847_420_629	69
2166	3300035398	Ga0316574_0037212	Ga0316574_0037212_1932_2141	69
2167	3300035398	Ga0316574_0067131	Ga0316574_0067131_219_428	69
2168	3300037312	Ga0395899_0070283	Ga0395899_0070283_881_1090	69
2169	3300037312	Ga0395899_0228326	Ga0395899_0228326_1067_1276	69
2170	3300037312	Ga0395899_0277752	Ga0395899_0277752_707_916	69
2171	3300037312	Ga0395899_0678151	Ga0395899_0678151_354_563	69
2172	3300037312	Ga0395899_0969343	Ga0395899_0969343_119_328	69
2173	3300037418	Ga0395900_0012719	Ga0395900_0012719_8237_8446	69
2174	3300037418	Ga0395900_0033262	Ga0395900_0033262_4625_4834	69
2175	3300037418	Ga0395900_0061044	Ga0395900_0061044_2683_2892	69
2176	3300037418	Ga0395900_0875799	Ga0395900_0875799_12_221	69
2177	3300037466	Ga0395898_0002941	Ga0395898_0002941_12053_12262	69
2178	3300037466	Ga0395898_0038755	Ga0395898_0038755_3001_3210	69
2179	3300037466	Ga0395898_0102792	Ga0395898_0102792_1498_1707	69
2180	3300037466	Ga0395898_0355254	Ga0395898_0355254_650_859	69
2181	3300038443	Ga0395901_0007692	Ga0395901_0007692_1624_1833	69
2182	3300038443	Ga0395901_0026093	Ga0395901_0026093_4340_4549	69
2183	3300038443	Ga0395901_0060283	Ga0395901_0060283_1936_2145	69
2184	3300038443	Ga0395901_0180452	Ga0395901_0180452_1233_1442	69
2185	3300038443	Ga0395901_0244988	Ga0395901_0244988_1636_1845	69
2186	3300038443	Ga0395901_0661800	Ga0395901_0661800_472_681	69
2187	3300038705	Ga0237819_03861	Ga0237819_03861_938_1147	69
2188	3300039145	Ga0237816_00234	Ga0237816_00234_3318_3527	69
2189	3300041404	Ga0439436_0028991	Ga0439436_0028991_1255_1464	69
2190	3300041404	Ga0439436_0078614	Ga0439436_0078614_428_637	69
2191	3300041405	Ga0439438_001649	Ga0439438_001649_6328_6537	69
2192	3300041405	Ga0439438_010778	Ga0439438_010778_1951_2160	69
2193	3300041407	Ga0439447_000080	Ga0439447_000080_24721_24930	69
2194	3300041410	Ga0439461_0002906	Ga0439461_0002906_1465_1674	69
2195	3300041411	Ga0439466_0011056	Ga0439466_0011056_2707_2916	69
2196	3300041411	Ga0439466_0086982	Ga0439466_0086982_362_571	69
2197	3300041413	Ga0439465_0012506	Ga0439465_0012506_1398_1607	69
2198	3300041413	Ga0439465_0019673	Ga0439465_0019673_481_690	69
2199	3300041441	Ga0451787_145416	Ga0451787_145416_168_377	69
2200	3300041443	Ga0451789_0204476	Ga0451789_0204476_653_862	69
2201	3300041443	Ga0451789_0333893	Ga0451789_0333893_893_1102	69
2202	3300041451	Ga0451791_0253301	Ga0451791_0253301_918_1127	69
2203	3300041451	Ga0451791_0573374	Ga0451791_0573374_649_858	69
2204	3300041451	Ga0451791_1457090	Ga0451791_1457090_521_730	69
2205	3300041451	Ga0451791_1656641	Ga0451791_1656641_213_422	69
2206	3300041452	Ga0451793_0592369	Ga0451793_0592369_481_690	69
2207	3300041453	Ga0451797_0511185	Ga0451797_0511185_177_386	69
2208	3300041453	Ga0451797_0949176	Ga0451797_0949176_101_310	69
2209	3300041453	Ga0451797_1031250	Ga0451797_1031250_132_341	69
2210	3300041456	Ga0451795_1428379	Ga0451795_1428379_281_490	69
2211	3300041458	Ga0451798_0258464	Ga0451798_0258464_495_704	69
2212	3300041459	Ga0451800_0607376	Ga0451800_0607376_112_321	69
2213	3300041460	Ga0451802_0133326	Ga0451802_0133326_499_708	69
2214	3300041463	Ga0451804_0146427	Ga0451804_0146427_341_550	69
2215	3300041463	Ga0451804_0413304	Ga0451804_0413304_227_436	69
2216	3300041486	Ga0451807_0517853	Ga0451807_0517853_420_629	69
2217	3300041486	Ga0451807_0962946	Ga0451807_0962946_889_1098	69
2218	3300041491	Ga0451833_0845125	Ga0451833_0845125_397_606	69
2219	3300041492	Ga0451835_0177019	Ga0451835_0177019_278_487	69
2220	3300041494	Ga0451837_0019255	Ga0451837_0019255_254_463	69
2221	3300041494	Ga0451837_0497442	Ga0451837_0497442_49_258	69
2222	3300041494	Ga0451837_1352619	Ga0451837_1352619_277_486	69
2223	3300041494	Ga0451837_1594772	Ga0451837_1594772_190_399	69
2224	3300041496	Ga0451839_0350986	Ga0451839_0350986_156_365	69
2225	3300041496	Ga0451839_0438407	Ga0451839_0438407_199_408	69
2226	3300041496	Ga0451839_1534640	Ga0451839_1534640_1080_1289	69
2227	3300041498	Ga0451841_0656054	Ga0451841_0656054_653_862	69
2228	3300041498	Ga0451841_1239896	Ga0451841_1239896_78_290	69
2229	3300041505	Ga0451849_0191803	Ga0451849_0191803_581_790	69
2230	3300041505	Ga0451849_0962937	Ga0451849_0962937_469_678	69
2231	3300041507	Ga0451851_1366462	Ga0451851_1366462_194_403	69
2232	3300041509	Ga0451843_0414088	Ga0451843_0414088_647_856	69
2233	3300041509	Ga0451843_1145372	Ga0451843_1145372_323_532	69
2234	3300041511	Ga0451855_1830322	Ga0451855_1830322_76_285	69
2235	3300041512	Ga0451853_0311127	Ga0451853_0311127_163_372	69
2236	3300041512	Ga0451853_3959737	Ga0451853_3959737_503_712	69
2237	3300041997	Ga0439431_0014208	Ga0439431_0014208_1382_1591	69
2238	3300041997	Ga0439431_0106224	Ga0439431_0106224_67_279	69
2239	3300041997	Ga0439431_0273425	Ga0439431_0273425_242_451	69
2240	3300041999	Ga0439433_0009792	Ga0439433_0009792_139_348	69
2241	3300041999	Ga0439433_0055349	Ga0439433_0055349_499_708	69
2242	3300042000	Ga0439437_000764	Ga0439437_000764_394_603	69
2243	3300042000	Ga0439437_007146	Ga0439437_007146_602_814	69
2244	3300042004	Ga0439445_0006797	Ga0439445_0006797_2399_2608	69
2245	3300042005	Ga0439448_0025040	Ga0439448_0025040_1577_1786	69
2246	3300042006	Ga0439432_001476	Ga0439432_001476_3086_3295	69
2247	3300042006	Ga0439432_002832	Ga0439432_002832_222_431	69
2248	3300042006	Ga0439432_074147	Ga0439432_074147_206_415	69
2249	3300042006	Ga0439432_181123	Ga0439432_181123_243_452	69
2250	3300042007	Ga0439449_0001500	Ga0439449_0001500_8640_8849	69
2251	3300042007	Ga0439449_0055190	Ga0439449_0055190_351_560	69
2252	3300042010	Ga0439452_087001	Ga0439452_087001_293_502	69
2253	3300042012	Ga0439455_0002810	Ga0439455_0002810_897_1109	69
2254	3300042012	Ga0439455_0006481	Ga0439455_0006481_1897_2106	69
2255	3300042012	Ga0439455_0084591	Ga0439455_0084591_46_255	69
2256	3300042013	Ga0439456_018734	Ga0439456_018734_551_763	69
2257	3300042014	Ga0439457_042198	Ga0439457_042198_355_564	69
2258	3300042015	Ga0439462_0075487	Ga0439462_0075487_470_679	69
2259	3300042115	Ga0450911_000020	Ga0450911_000020_37585_37797	69
2260	3300042120	Ga0450917_002232	Ga0450917_002232_361_573	69
2261	3300042125	Ga0450923_025409	Ga0450923_025409_664_873	69
2262	3300042134	Ga0450898_036197	Ga0450898_036197_630_839	69
2263	3300042136	Ga0450900_014862	Ga0450900_014862_792_1001	69
2264	3300042136	Ga0450900_022512	Ga0450900_022512_210_419	69
2265	3300042136	Ga0450900_046619	Ga0450900_046619_376_588	69
2266	3300042137	Ga0450902_007074	Ga0450902_007074_1046_1255	69
2267	3300042138	Ga0450903_028382	Ga0450903_028382_256_468	69
2268	3300042139	Ga0450904_000233	Ga0450904_000233_10943_11155	69
2269	3300042142	Ga0450905_000342	Ga0450905_000342_1641_1850	69
2270	3300042142	Ga0450905_039619	Ga0450905_039619_214_426	69
2271	3300042156	Ga0439446_0000118	Ga0439446_0000118_8079_8288	69
2272	3300042156	Ga0439446_0003755	Ga0439446_0003755_2705_2917	69
2273	3300042156	Ga0439446_0019960	Ga0439446_0019960_555_764	69
2274	3300042156	Ga0439446_0046696	Ga0439446_0046696_439_648	69
2275	3300042157	Ga0439458_0076749	Ga0439458_0076749_177_386	69
2276	3300042185	Ga0450909_061194	Ga0450909_061194_299_508	69
2277	3300042435	Ga0439434_0006972	Ga0439434_0006972_2796_3005	69
2278	3300042435	Ga0439434_0031216	Ga0439434_0031216_1180_1389	69
2279	3300042436	Ga0439435_0101997	Ga0439435_0101997_130_339	69
2280	3300042438	Ga0439459_0010045	Ga0439459_0010045_604_816	69
2281	3300042439	Ga0439464_0000275	Ga0439464_0000275_43_252	69
2282	3300042439	Ga0439464_0041334	Ga0439464_0041334_665_874	69
2283	3300042439	Ga0439464_0144497	Ga0439464_0144497_499_708	69
2284	3300042530	Ga0450916_002042	Ga0450916_002042_1146_1358	69
2285	3300042532	Ga0450893_0012291	Ga0450893_0012291_869_1081	69
2286	3300042533	Ga0450901_000100	Ga0450901_000100_8479_8688	69
2287	3300044658	Ga0466972_0001279	Ga0466972_0001279_1818_2027	69
2288	3300044694	Ga0466963_0529920	Ga0466963_0529920_62_271	69
2289	3300044765	Ga0466970_0000079	Ga0466970_0000079_29450_29659	69
2290	3300044842	Ga0466957_0056122	Ga0466957_0056122_603_812	69
2291	3300045976	Ga0466967_1550522	Ga0466967_1550522_408_617	69
2292	3300046452	Ga0495617_148623	Ga0495617_148623_63_272	69
2293	3300046453	Ga0495627_020637	Ga0495627_020637_1669_1878	69
2294	3300046458	Ga0495591_133101	Ga0495591_133101_248_457	69
2295	3300046476	Ga0495662_0593400	Ga0495662_0593400_199_414	69
2296	3300046501	Ga0495607_0104372	Ga0495607_0104372_1022_1231	69
2297	3300046507	Ga0495606_0008800	Ga0495606_0008800_7936_8145	69
2298	3300046511	Ga0495608_0023264	Ga0495608_0023264_863_1078	69
2299	3300046513	Ga0495616_0073478	Ga0495616_0073478_505_714	69
2300	3300046513	Ga0495616_0075945	Ga0495616_0075945_1297_1506	69
2301	3300046514	Ga0495618_0658768	Ga0495618_0658768_183_398	69
2302	3300046515	Ga0495620_0000013	Ga0495620_0000013_29468_29677	69
2303	3300046519	Ga0495632_0001757	Ga0495632_0001757_2167_2376	69
2304	3300046519	Ga0495632_0025642	Ga0495632_0025642_1420_1629	69
2305	3300046520	Ga0495637_0282366	Ga0495637_0282366_312_524	69
2306	3300046522	Ga0495643_0000740	Ga0495643_0000740_147_356	69
2307	3300046522	Ga0495643_0013511	Ga0495643_0013511_3671_3880	69
2308	3300046522	Ga0495643_0013936	Ga0495643_0013936_20_232	69
2309	3300046524	Ga0495648_0000885	Ga0495648_0000885_2161_2370	69
2310	3300046525	Ga0495663_0000254	Ga0495663_0000254_11620_11829	69
2311	3300046529	Ga0495652_0008024	Ga0495652_0008024_7953_8168	69
2312	3300046530	Ga0495654_0054660	Ga0495654_0054660_1648_1860	69
2313	3300046530	Ga0495654_0113430	Ga0495654_0113430_116_328	69
2314	3300046530	Ga0495654_0192511	Ga0495654_0192511_649_858	69
2315	3300046535	Ga0495586_0614680	Ga0495586_0614680_182_391	69
2316	3300046539	Ga0495621_0324137	Ga0495621_0324137_135_344	69
2317	3300046558	Ga0495633_0006586	Ga0495633_0006586_5269_5478	69
2318	3300046558	Ga0495633_0222571	Ga0495633_0222571_353_565	69
2319	3300046660	Ga0495625_0489240	Ga0495625_0489240_158_367	69
2320	3300046660	Ga0495625_0577896	Ga0495625_0577896_413_625	69
2321	3300046674	Ga0495588_0511360	Ga0495588_0511360_152_361	69
2322	3300046675	Ga0495657_0018048	Ga0495657_0018048_3133_3348	69
2323	3300046678	Ga0495599_0152776	Ga0495599_0152776_372_584	69
2324	3300046681	Ga0495647_0572268	Ga0495647_0572268_189_398	69
2325	3300046683	Ga0495658_0432238	Ga0495658_0432238_315_524	69
2326	3300046692	Ga0495671_0008423	Ga0495671_0008423_3466_3675	69
2327	3300046692	Ga0495671_0012903	Ga0495671_0012903_3559_3771	69
2328	3300046692	Ga0495671_0294329	Ga0495671_0294329_120_329	69
2329	3300046694	Ga0495649_0010707	Ga0495649_0010707_4043_4255	69
2330	3300046810	Ga0495660_0172759	Ga0495660_0172759_111_323	69
2331	3300046810	Ga0495660_0276286	Ga0495660_0276286_439_648	69
2332	3300047317	Ga0495604_0412386	Ga0495604_0412386_84_299	69
2333	3300047320	Ga0495672_0023367	Ga0495672_0023367_2850_3062	69
2334	3300047446	Ga0495679_193326	Ga0495679_193326_216_428	69
2335	3300047469	Ga0495673_0000702	Ga0495673_0000702_1525_1737	69
2336	3300047470	Ga0495681_0061754	Ga0495681_0061754_77_289	69
2337	3300047470	Ga0495681_0103313	Ga0495681_0103313_464_673	69
2338	3300047471	Ga0495684_0248518	Ga0495684_0248518_401_616	69
2339	3300047472	Ga0495686_0321979	Ga0495686_0321979_487_699	69
2340	3300048088	Ga0495602_0050051	Ga0495602_0050051_2183_2398	69
2341	3300048903	Ga0496100_0417942	Ga0496100_0417942_298_507	69
2342	3300048904	Ga0496101_0209470	Ga0496101_0209470_933_1142	69
2343	3300048905	Ga0496102_1640207	Ga0496102_1640207_293_502	69
2344	3300048910	Ga0496107_1382409	Ga0496107_1382409_32_241	69
2345	3300048913	Ga0496110_0015985	Ga0496110_0015985_522_731	69
2346	3300048913	Ga0496110_0030061	Ga0496110_0030061_138_347	69
2347	3300048913	Ga0496110_1206871	Ga0496110_1206871_34_243	69
2348	3300048914	Ga0496111_0422524	Ga0496111_0422524_292_501	69
2349	3300048916	Ga0496113_0980480	Ga0496113_0980480_263_472	69
2350	3300048916	Ga0496113_1591330	Ga0496113_1591330_266_475	69
2351	3300048917	Ga0496114_0001100	Ga0496114_0001100_5498_5707	69
2352	3300048917	Ga0496114_0128293	Ga0496114_0128293_1242_1451	69
2353	3300048918	Ga0496115_0206662	Ga0496115_0206662_130_339	69
2354	3300048919	Ga0496116_0198709	Ga0496116_0198709_198_407	69
2355	3300048919	Ga0496116_0422870	Ga0496116_0422870_39_248	69
2356	3300048920	Ga0496117_0001232	Ga0496117_0001232_29256_29465	69
2357	3300048920	Ga0496117_0001277	Ga0496117_0001277_35231_35440	69
2358	3300048920	Ga0496117_0058483	Ga0496117_0058483_1918_2127	69
2359	3300048920	Ga0496117_0081925	Ga0496117_0081925_1412_1621	69
2360	3300048921	Ga0496118_0002130	Ga0496118_0002130_1752_1961	69
2361	3300048921	Ga0496118_0013166	Ga0496118_0013166_160_372	69
2362	3300048921	Ga0496118_0061135	Ga0496118_0061135_2044_2253	69
2363	3300048921	Ga0496118_0636298	Ga0496118_0636298_246_455	69
2364	3300048922	Ga0496119_0000112	Ga0496119_0000112_43570_43779	69
2365	3300048923	Ga0496120_0001230	Ga0496120_0001230_7069_7278	69
2366	3300048924	Ga0496121_0010419	Ga0496121_0010419_2422_2631	69
2367	3300048924	Ga0496121_0070443	Ga0496121_0070443_1030_1242	69
2368	3300048924	Ga0496121_0249380	Ga0496121_0249380_728_937	69
2369	3300048925	Ga0496122_0001943	Ga0496122_0001943_9235_9444	69
2370	3300048925	Ga0496122_0004262	Ga0496122_0004262_2124_2333	69
2371	3300048925	Ga0496122_0004606	Ga0496122_0004606_9294_9503	69
2372	3300048925	Ga0496122_0076603	Ga0496122_0076603_10_219	69
2373	3300048925	Ga0496122_0131783	Ga0496122_0131783_630_842	69
2374	3300048925	Ga0496122_0321254	Ga0496122_0321254_19_228	69
2375	3300048926	Ga0496123_0001575	Ga0496123_0001575_21576_21785	69
2376	3300048926	Ga0496123_0001754	Ga0496123_0001754_20952_21161	69
2377	3300048926	Ga0496123_0003760	Ga0496123_0003760_13149_13358	69
2378	3300048927	Ga0496124_0000087	Ga0496124_0000087_131160_131369	69
2379	3300048927	Ga0496124_0011323	Ga0496124_0011323_5698_5907	69
2380	3300048927	Ga0496124_0016854	Ga0496124_0016854_44_253	69
2381	3300048927	Ga0496124_0180284	Ga0496124_0180284_921_1130	69
2382	3300048927	Ga0496124_0229914	Ga0496124_0229914_740_949	69
2383	3300048927	Ga0496124_0239156	Ga0496124_0239156_862_1071	69
2384	3300048928	Ga0496125_0001176	Ga0496125_0001176_9576_9785	69
2385	3300048928	Ga0496125_0013981	Ga0496125_0013981_7477_7689	69
2386	3300048928	Ga0496125_0022391	Ga0496125_0022391_3775_3984	69
2387	3300048928	Ga0496125_0053662	Ga0496125_0053662_589_798	69
2388	3300048929	Ga0496126_0014937	Ga0496126_0014937_4244_4453	69
2389	3300048929	Ga0496126_0045256	Ga0496126_0045256_57_266	69
2390	3300048929	Ga0496126_0050252	Ga0496126_0050252_3518_3727	69
2391	3300048929	Ga0496126_0068356	Ga0496126_0068356_1319_1528	69
2392	3300048929	Ga0496126_0199515	Ga0496126_0199515_1250_1459	69
2393	3300049162	Ga0501307_091247	Ga0501307_091247_14_226	69
2394	3300049459	Ga0495678_042409	Ga0495678_042409_718_930	69
2395	3300049513	Ga0501290_000034	Ga0501290_000034_3846_4055	69
2396	3300049568	Ga0501031_0001510	Ga0501031_0001510_6529_6738	69
2397	3300049568	Ga0501031_0258145	Ga0501031_0258145_16_225	69
2398	3300049568	Ga0501031_0668954	Ga0501031_0668954_242_451	69
2399	3300049568	Ga0501031_1016229	Ga0501031_1016229_59_268	69
2400	3300049569	Ga0501032_0006681	Ga0501032_0006681_6402_6611	69
2401	3300049569	Ga0501032_0010584	Ga0501032_0010584_4032_4241	69
2402	3300049569	Ga0501032_0014794	Ga0501032_0014794_3029_3241	69
2403	3300049569	Ga0501032_0577171	Ga0501032_0577171_37_246	69
2404	3300049570	Ga0501033_0065996	Ga0501033_0065996_1638_1847	69
2405	3300049570	Ga0501033_0195763	Ga0501033_0195763_362_571	69
2406	3300049570	Ga0501033_0324814	Ga0501033_0324814_481_690	69
2407	3300049570	Ga0501033_0443557	Ga0501033_0443557_274_483	69
2408	3300049570	Ga0501033_0444340	Ga0501033_0444340_461_670	69
2409	3300049570	Ga0501033_1067136	Ga0501033_1067136_68_277	69
2410	3300049571	Ga0501034_0000020	Ga0501034_0000020_116016_116225	69
2411	3300049571	Ga0501034_0000020	Ga0501034_0000020_249484_249693	69
2412	3300049571	Ga0501034_0000083	Ga0501034_0000083_124739_124948	69
2413	3300049571	Ga0501034_0004573	Ga0501034_0004573_6502_6711	69
2414	3300049571	Ga0501034_0011636	Ga0501034_0011636_4418_4627	69
2415	3300049571	Ga0501034_0452978	Ga0501034_0452978_395_604	69
2416	3300049572	Ga0501036_0014330	Ga0501036_0014330_2946_3155	69
2417	3300049572	Ga0501036_0029960	Ga0501036_0029960_1381_1590	69
2418	3300049572	Ga0501036_0194875	Ga0501036_0194875_15_224	69
2419	3300049573	Ga0501037_0005081	Ga0501037_0005081_6545_6754	69
2420	3300049573	Ga0501037_0005974	Ga0501037_0005974_6599_6808	69
2421	3300049573	Ga0501037_0123608	Ga0501037_0123608_48_257	69
2422	3300049573	Ga0501037_0352383	Ga0501037_0352383_121_330	69
2423	3300049574	Ga0501038_0002806	Ga0501038_0002806_9475_9684	69
2424	3300049574	Ga0501038_0226934	Ga0501038_0226934_216_425	69
2425	3300049574	Ga0501038_0758615	Ga0501038_0758615_74_283	69
2426	3300049575	Ga0501039_0016327	Ga0501039_0016327_3984_4193	69
2427	3300049578	Ga0501042_1111860	Ga0501042_1111860_261_470	69
2428	3300049579	Ga0501043_0004158	Ga0501043_0004158_6458_6667	69
2429	3300049579	Ga0501043_0119349	Ga0501043_0119349_636_845	69
2430	3300049579	Ga0501043_0121324	Ga0501043_0121324_603_812	69
2431	3300049579	Ga0501043_0230140	Ga0501043_0230140_872_1081	69
2432	3300049580	Ga0501046_0004084	Ga0501046_0004084_3717_3926	69
2433	3300049580	Ga0501046_0004283	Ga0501046_0004283_9349_9558	69
2434	3300049581	Ga0501047_0011899	Ga0501047_0011899_4430_4639	69
2435	3300049581	Ga0501047_0017446	Ga0501047_0017446_2682_2891	69
2436	3300049581	Ga0501047_0028668	Ga0501047_0028668_423_632	69
2437	3300049581	Ga0501047_0061562	Ga0501047_0061562_1721_1930	69
2438	3300049581	Ga0501047_0171219	Ga0501047_0171219_301_510	69
2439	3300049581	Ga0501047_1384550	Ga0501047_1384550_278_487	69
2440	3300049582	Ga0501048_0010523	Ga0501048_0010523_3384_3593	69
2441	3300049583	Ga0501067_0312577	Ga0501067_0312577_32_241	69
2442	3300049583	Ga0501067_0536980	Ga0501067_0536980_101_310	69
2443	3300049584	Ga0501068_0860828	Ga0501068_0860828_47_256	69
2444	3300049585	Ga0501069_0027413	Ga0501069_0027413_2626_2835	69
2445	3300049585	Ga0501069_0055287	Ga0501069_0055287_1710_1919	69
2446	3300049585	Ga0501069_0083832	Ga0501069_0083832_1570_1779	69
2447	3300049585	Ga0501069_0109719	Ga0501069_0109719_33_242	69
2448	3300049586	Ga0501070_0000553	Ga0501070_0000553_32603_32812	69
2449	3300049586	Ga0501070_0001797	Ga0501070_0001797_8786_8995	69
2450	3300049586	Ga0501070_0002909	Ga0501070_0002909_749_958	69
2451	3300049586	Ga0501070_0005401	Ga0501070_0005401_9492_9701	69
2452	3300049586	Ga0501070_0010375	Ga0501070_0010375_5821_6030	69
2453	3300049586	Ga0501070_0012584	Ga0501070_0012584_6621_6830	69
2454	3300049586	Ga0501070_0051202	Ga0501070_0051202_1845_2054	69
2455	3300049586	Ga0501070_0193008	Ga0501070_0193008_130_339	69
2456	3300049586	Ga0501070_0392881	Ga0501070_0392881_228_437	69
2457	3300049587	Ga0501071_0037503	Ga0501071_0037503_2190_2399	69
2458	3300049589	Ga0501073_0009597	Ga0501073_0009597_61_270	69
2459	3300049589	Ga0501073_0088024	Ga0501073_0088024_749_958	69
2460	3300049589	Ga0501073_0540510	Ga0501073_0540510_31_240	69
2461	3300049590	Ga0501074_0002205	Ga0501074_0002205_8985_9194	69
2462	3300049590	Ga0501074_0003935	Ga0501074_0003935_943_1152	69
2463	3300049590	Ga0501074_0016023	Ga0501074_0016023_3430_3639	69
2464	3300049590	Ga0501074_0161821	Ga0501074_0161821_1201_1410	69
2465	3300049592	Ga0501076_0811948	Ga0501076_0811948_426_635	69
2466	3300049593	Ga0501077_0005636	Ga0501077_0005636_6026_6235	69
2467	3300049593	Ga0501077_0042073	Ga0501077_0042073_91_300	69
2468	3300049593	Ga0501077_0435571	Ga0501077_0435571_247_456	69
2469	3300049705	Ga0501225_0003923	Ga0501225_0003923_2634_2843	69
2470	3300049741	Ga0501079_0290567	Ga0501079_0290567_863_1072	69
2471	3300049742	Ga0501080_0009482	Ga0501080_0009482_6815_7024	69
2472	3300049742	Ga0501080_0013296	Ga0501080_0013296_1909_2118	69
2473	3300049742	Ga0501080_0013343	Ga0501080_0013343_5716_5925	69
2474	3300049742	Ga0501080_0018996	Ga0501080_0018996_4431_4640	69
2475	3300049742	Ga0501080_0054883	Ga0501080_0054883_521_730	69
2476	3300049766	Ga0501269_054654	Ga0501269_054654_109_318	69
2477	3300049772	Ga0501275_000308	Ga0501275_000308_1194_1403	69
2478	3300049822	Ga0501035_0003969	Ga0501035_0003969_1270_1479	69
2479	3300049822	Ga0501035_0006193	Ga0501035_0006193_8871_9080	69
2480	3300049822	Ga0501035_0023224	Ga0501035_0023224_1434_1643	69
2481	3300049822	Ga0501035_0060046	Ga0501035_0060046_245_454	69
2482	3300049822	Ga0501035_0223413	Ga0501035_0223413_1266_1475	69
2483	3300049822	Ga0501035_0291750	Ga0501035_0291750_590_799	69
2484	3300049822	Ga0501035_0319164	Ga0501035_0319164_342_551	69
2485	3300049822	Ga0501035_1122059	Ga0501035_1122059_102_311	69
2486	3300049823	Ga0501044_0021569	Ga0501044_0021569_2272_2481	69
2487	3300049823	Ga0501044_0025694	Ga0501044_0025694_3406_3615	69
2488	3300049823	Ga0501044_0038658	Ga0501044_0038658_1447_1656	69
2489	3300049823	Ga0501044_0051890	Ga0501044_0051890_1335_1544	69
2490	3300049823	Ga0501044_0072537	Ga0501044_0072537_1643_1852	69
2491	3300049823	Ga0501044_0086512	Ga0501044_0086512_2605_2814	69
2492	3300049823	Ga0501044_0093528	Ga0501044_0093528_696_905	69
2493	3300049823	Ga0501044_0463352	Ga0501044_0463352_12_221	69
2494	3300049850	Ga0501204_046191	Ga0501204_046191_364_576	69
2495	3300049853	Ga0501226_000012	Ga0501226_000012_141301_141513	69
2496	3300050491	nmdc:mga00v17_146867_c1	nmdc:mga00v17_146867_c1_1149_1358	69
2497	3300050491	nmdc:mga00v17_164658_c1	nmdc:mga00v17_164658_c1_772_981	69
2498	3300050491	nmdc:mga00v17_25528_c1	nmdc:mga00v17_25528_c1_1118_1327	69
2499	3300050491	nmdc:mga00v17_609626_c1	nmdc:mga00v17_609626_c1_384_593	69
2500	3300050491	nmdc:mga00v17_71151_c1	nmdc:mga00v17_71151_c1_1388_1597	69
2501	3300050516	nmdc:mga0sz30_544929_c1	nmdc:mga0sz30_544929_c1_275_484	69
2502	3300053087	Ga0500643_087738	Ga0500643_087738_222_431	69
2503	3300053088	Ga0500644_0026825	Ga0500644_0026825_1324_1533	69
2504	3300053107	Ga0500560_220476	Ga0500560_220476_359_568	69
2505	3300053134	Ga0500658_0168447	Ga0500658_0168447_371_580	69
2506	3300053135	Ga0500659_0001360	Ga0500659_0001360_1007_1216	69
2507	3300053135	Ga0500659_0018561	Ga0500659_0018561_898_1107	69
2508	3300053156	Ga0500622_0162530	Ga0500622_0162530_107_316	69
2509	3300053161	Ga0500634_0004864	Ga0500634_0004864_2135_2344	69
2510	3300053731	Ga0500609_012057	Ga0500609_012057_391_600	69
2511	3300059646	Ga0587078_086877	Ga0587078_086877_83_292	69
2512	3300059652	Ga0587107_041865	Ga0587107_041865_147_356	69
2513	3300060353	Ga0501082_1860808	Ga0501082_1860808_15_224	69
2514	iso_pu_bacteria	8056137416	8056141014	69

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

5

70

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1mjc-assembly1.cif.gz_A	crystal structure of cspa, the major cold shock protein of escherichia coli	0.9774	2	69
3i2z-assembly2.cif.gz_B	structure of cold shock protein e from salmonella typhimurium	0.9746	5	69
1hza-assembly1.cif.gz_B	bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability	0.9724	5	69
8h1i-assembly1.cif.gz_B	crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c	0.9701	4	69
1c9o-assembly1.cif.gz_B	crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp	0.9671	5	69

ID	Description	Score	Start	End	Superfamily
af_P92186_48_133_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9672	4	66	2.40.50.140
af_P91306_55_138_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9603	4	66	2.40.50.140
af_Q9VRN5_36_116_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9497	4	69	2.40.50.140
af_Q4DCA9_18_92_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9475	6	66	2.40.50.140
af_P91398_61_146_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9453	4	66	2.40.50.140

ID	Description	Score	Start	End	GO Terms
AF-A1CFX7-F1-model_v4	Cold shock NA binding domain protein	1.009	4	69	GO:0003676
AF-A0A1B2N683-F1-model_v4	deleted	1.007	4	69
AF-A0A0B7KLS5-F1-model_v4	CSD domain-containing protein	1.004	4	69	GO:0003676
AF-A0A2W0BM59-F1-model_v4	Cold-shock protein	1.004	5	69	GO:0003676 GO:0005737
AF-A0A1G1L1P4-F1-model_v4	Cold-shock protein	1.003	5	69	GO:0003676 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
93.93	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496873

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00313

CSD

'Cold-shock' DNA-binding domain

5

70

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map