F496764

General Info

Members Datasets Scaffolds Average Seq Length
2386 1157 1840 293

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10024874|JGI24739J22299_100248742
Length 324
Sequence MDKTINQKAWFLVLPVFLVVAFSAVLPLMTVVNYSMQDTFGNNQFFWNGVGWFKELLDPSTDLGGRFLASLGRNLFFSMVILAIEVPLGIVVALSMPRQGWTVAACLVILALPLLIPWNVVGTIWQIFGRPDIGLLGYVLNHIGLDYNYVSNDIDAWVTVIVMDVWHWTSLVALLCYAGLKSIPEAYYQAAQIDGASRWAVFKAXQLPKMNRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNSTTFVSIELVKIALGQFDLGKAAALSLVYNLIILIVCWIFYTVMTNAGVERKVQAESEPAVEPKASAALKPVPALKPKEGVA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
5 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
6 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
7 2508501050 Microvirga lupini Lut6 Isolate Nodule
8 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
9 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231004 Pseudomonas sp. GM102 Isolate Nodule
13 2511231006 Pseudomonas sp. GM17 Isolate Nodule
14 2511231007 Pseudomonas sp. GM18 Isolate Nodule
15 2511231008 Pseudomonas sp. GM21 Isolate Nodule
16 2511231010 Pseudomonas sp. GM25 Isolate Nodule
17 2511231011 Pseudomonas sp. GM30 Isolate Nodule
18 2511231012 Pseudomonas sp. GM33 Isolate Nodule
19 2511231014 Pseudomonas sp. GM48 Isolate Nodule
20 2511231015 Pseudomonas sp. GM49 Isolate Nodule
21 2511231016 Pseudomonas sp. GM50 Isolate Nodule
22 2511231017 Pseudomonas sp. GM55 Isolate Nodule
23 2511231018 Pseudomonas sp. GM60 Isolate Nodule
24 2511231019 Pseudomonas sp. GM67 Isolate Nodule
25 2511231020 Pseudomonas sp. GM74 Isolate Nodule
26 2511231021 Pseudomonas sp. GM78 Isolate Nodule
27 2511231022 Pseudomonas sp. GM79 Isolate Nodule
28 2511231023 Pseudomonas sp. GM80 Isolate Nodule
29 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
30 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
31 2511231031 Pseudomonas sp. GM16 Isolate Nodule
32 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
33 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
34 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
35 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
36 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
37 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
38 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
39 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
40 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
41 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
42 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
43 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
44 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
45 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
46 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
47 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
48 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
49 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
50 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
51 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
52 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
53 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
54 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
55 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
56 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
57 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
58 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
59 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
60 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
61 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
62 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
63 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
64 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
65 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
66 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
67 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
68 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
69 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
70 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
71 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
72 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
73 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
74 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
75 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
76 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
77 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
78 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
79 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
80 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
81 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
82 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
83 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
84 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
85 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
86 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
87 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
88 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
89 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
90 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
91 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
92 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
93 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
94 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
95 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
96 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
97 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
98 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
99 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
100 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
101 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
102 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
103 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
104 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
105 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
106 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
107 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
108 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
109 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
110 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
111 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
112 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
113 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
114 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
115 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
116 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
117 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
118 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
119 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
120 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
121 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
122 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
123 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
124 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
125 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
126 2643221568 Rhizobium sp. Root564 Isolate Unclassified
127 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
128 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
129 2643221599 Rhizobium sp. Root708 Isolate Unclassified
130 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
131 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
132 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
133 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
134 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
135 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
136 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
137 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
138 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
139 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
140 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
141 2643221651 Afipia sp. Root123D2 Isolate Unclassified
142 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
143 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
144 2643221683 Variovorax sp. Root473 Isolate Unclassified
145 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
146 2643221718 Rhizobium sp. Root268 Isolate Unclassified
147 2643221719 Rhizobium sp. Root274 Isolate Unclassified
148 2643221733 Bosea sp. Root381 Isolate Unclassified
149 2643221736 Bosea sp. Root483D1 Isolate Unclassified
150 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
151 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
152 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
153 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
154 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
155 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
156 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
157 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
158 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
159 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
160 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
161 2721755523 Delftia sp. HK171 Isolate Unclassified
162 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
163 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
164 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
165 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
166 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
167 2738541293 Rhizobium sp. GV031 Isolate Unclassified
168 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
169 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
170 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
171 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
172 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
173 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
174 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
175 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
176 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
177 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
178 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
179 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
180 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
181 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
182 2773857670 Pseudomonas sp. 478 Isolate Unclassified
183 2773857673 Pseudomonas sp. 443 Isolate Unclassified
184 2773857925 Microvirga vignae BR3299 Isolate Unclassified
185 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
186 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
187 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
188 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
189 2784132063 Pseudomonas sp. 424 Isolate Unclassified
190 2784132072 Pseudomonas sp. 460 Isolate Unclassified
191 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
192 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
193 2791355199
194 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
195 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
196 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
197 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
198 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
199 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
200 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
201 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
202 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
203 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
204 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
205 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
206 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
207 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
208 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
209 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
210 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
211 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
212 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
213 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
214 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
215 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
216 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
217 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
218 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
219 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
220 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
221 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
222 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
223 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
224 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
225 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
226 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
227 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
228 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
229 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
230 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
231 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
232 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
233 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
234 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
235 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
236 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
237 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
238 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
239 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
240 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
241 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
242 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
243 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
244 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
245 2841760612 Bosea sp. Tri-49 Isolate Nodule
246 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
247 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
248 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
249 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
250 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
251 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
252 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
253 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
254 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
255 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
256 2842677519 Variovorax sp. R-72495 Isolate Unclassified
257 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
258 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
259 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
260 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
261 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
262 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
263 2844104063 Bosea sp. Tri-39 Isolate Nodule
264 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
265 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
266 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
267 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
268 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
269 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
270 2851182111 Bosea sp. Tri-44 Isolate Nodule
271 2851246043 Bosea sp. Tri-54 Isolate Nodule
272 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
273 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
274 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
275 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
276 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
277 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
278 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
279 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
280 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
281 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
282 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
283 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
284 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
285 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
286 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
287 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
288 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
289 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
290 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
291 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
292 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
293 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
294 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
295 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
296 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
297 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
298 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
299 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
300 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
301 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
302 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
303 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
304 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
305 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
306 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
307 2885198086 Variovorax sp. 679 Isolate Unclassified
308 2885211737 Variovorax sp. 553 Isolate Unclassified
309 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
310 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
311 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
312 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
313 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
314 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
315 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
316 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
317 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
318 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
319 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
320 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
321 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
322 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
323 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
324 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
325 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
326 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
327 2904456579 Variovorax sp. 2002 Isolate Unclassified
328 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
329 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
330 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
331 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
332 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
333 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
334 2904699407
335 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
336 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
337 2906610324
338 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
339 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
340 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
341 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
342 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
343 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
344 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
345 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
346 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
347 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
348 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
349 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
350 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
351 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
352 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
353 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
354 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
355 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
356 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
357 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
358 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
359 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
360 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
361 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
362 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
363 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
364 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
365 2922368715
366 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
367 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
368 2922425934
369 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
370 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
371 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
372 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
373 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
374 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
375 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
376 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
377 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
378 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
379 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
380 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
381 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
382 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
383 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
384 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
385 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
386 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
387 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
388 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
389 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
390 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
391 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
392 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
393 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
394 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
395 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
396 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
397 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
398 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
399 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
400 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
401 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
402 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
403 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
404 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
405 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
406 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
407 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
408 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
409 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
410 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
411 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
412 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
413 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
414 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
415 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
416 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
417 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
418 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
419 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
420 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
421 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
422 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
423 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
424 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
425 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
426 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
427 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
428 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
429 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
430 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
431 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
432 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
433 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
434 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
435 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
436 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
437 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
438 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
439 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
440 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
441 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
442 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
443 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
444 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
445 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
446 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
447 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
448 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
449 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
450 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
451 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
452 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
453 2952252522 Salinicola sp. DM10 Isolate Unclassified
454 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
455 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
456 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
457 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
458 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
459 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
460 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
461 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
462 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
463 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
464 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
465 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
466 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
467 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
468 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
469 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
470 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
471 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
472 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
473 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
474 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
475 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
476 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
477 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
478 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
479 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
480 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
481 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
482 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
483 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
484 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
485 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
486 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
487 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
488 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
489 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
490 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
491 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
492 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
493 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
494 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
495 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
496 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
497 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
498 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
499 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
500 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
501 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
502 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
503 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
504 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
505 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
506 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
507 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
508 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
509 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
510 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
511 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
512 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
513 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
514 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
515 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
516 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
517 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
518 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
519 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
520 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
521 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
522 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
523 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
524 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
525 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
526 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
527 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
528 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
529 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
530 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
531 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
532 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
533 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
534 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
535 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
536 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
537 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
538 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
539 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
540 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
541 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
542 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
543 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
544 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
545 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
546 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
547 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
548 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
549 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
550 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
551 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
552 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
553 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
554 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
555 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
556 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
557 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
558 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
559 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
560 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
561 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
562 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
563 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
564 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
565 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
566 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
567 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
568 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
569 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
570 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
571 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
572 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
573 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
574 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
575 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
576 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
577 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
578 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
579 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
580 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
581 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
582 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
583 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
584 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
585 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
586 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
587 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
588 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
589 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
590 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
591 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
592 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
593 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
594 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
595 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
596 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
597 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
598 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
599 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
600 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
601 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
602 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
603 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
604 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
605 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
606 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
607 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
608 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
609 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
610 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
611 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
612 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
613 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
614 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
615 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
616 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
617 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
618 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
619 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
620 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
621 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
622 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
623 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
624 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
625 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
626 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
627 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
628 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
629 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
630 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
631 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
632 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
633 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
634 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
635 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
636 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
637 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
638 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
639 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
640 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
641 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
642 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
643 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
644 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
645 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
646 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
647 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
648 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
649 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
650 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
651 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
652 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
653 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
654 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
655 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
656 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
657 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
658 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
659 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
660 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
661 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
662 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
663 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
664 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
665 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
666 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
669 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
675 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
676 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
698 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
700 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
702 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
703 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
704 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
705 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
706 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
707 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
708 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
709 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
710 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
711 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
713 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
714 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
716 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
717 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
718 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
719 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
720 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
721 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
722 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
723 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
724 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
725 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
726 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
727 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
728 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
729 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
730 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
731 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
732 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
733 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
734 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
735 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
736 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
737 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
738 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
739 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
740 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
741 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
742 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
743 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
744 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
745 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
746 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
747 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
748 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
749 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
750 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
751 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
752 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
753 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
754 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
755 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
756 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
757 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
758 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
759 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
760 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
761 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
762 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
763 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
764 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
765 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
766 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
767 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
768 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
769 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
770 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
771 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
772 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
773 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
774 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
775 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
776 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
777 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
778 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
779 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
780 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
781 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
782 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
783 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
784 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
785 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
786 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
787 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
788 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
789 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
790 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
791 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
792 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
793 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
794 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
795 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
796 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
797 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
798 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
799 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
800 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
801 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
802 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
803 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
804 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
805 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
806 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
807 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
808 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
809 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
810 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
811 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
812 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
813 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
814 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
815 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
816 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
817 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
818 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
819 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
820 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
821 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
822 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
823 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
824 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
825 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
826 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
827 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
828 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
829 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
830 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
831 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
832 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
833 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
834 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
835 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
836 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
837 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
838 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
839 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
840 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
841 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
842 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
843 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
844 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
845 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
846 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
847 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
848 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
849 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
850 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
851 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
852 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
853 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
854 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
855 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
856 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
857 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
858 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
859 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
860 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
861 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
862 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
863 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
864 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
865 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
866 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
867 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
868 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
869 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
870 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
871 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
872 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
873 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
874 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
875 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
876 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
877 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
878 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
879 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
880 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
881 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
882 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
883 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
884 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
885 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
886 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
887 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
888 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
889 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
890 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
891 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
892 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
893 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
894 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
895 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
896 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
897 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
898 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
899 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
900 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
901 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
902 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
903 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
904 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
905 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
906 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
907 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
908 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
909 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
910 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
911 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
912 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
913 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
914 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
915 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
916 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
917 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
918 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
919 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
920 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
921 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
922 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
923 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
924 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
925 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
926 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
927 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
928 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
929 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
930 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
931 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
932 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
933 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
934 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
935 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
936 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
937 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
938 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
939 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
940 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
941 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
942 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
943 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
944 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
945 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
946 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
947 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
948 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
949 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
950 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
951 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
952 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
953 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
954 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
955 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
956 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
957 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
958 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
959 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
960 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
961 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
962 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
963 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
964 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
965 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
966 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
967 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
968 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
969 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
970 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
971 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
972 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
973 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
974 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
975 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
976 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
977 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
978 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
979 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
980 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
981 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
982 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
983 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
984 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
985 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
986 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
987 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
988 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
989 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
990 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
991 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
992 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
993 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
994 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
995 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
996 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
997 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
998 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
999 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1000 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1001 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1002 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1003 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1004 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1005 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
1006 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
1007 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
1008 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
1009 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
1010 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
1011 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
1012 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
1013 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
1014 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
1015 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1016 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1017 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1018 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
1019 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
1020 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1021 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1022 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1023 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1024 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1025 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1026 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1027 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1028 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1029 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1030 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1031 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1032 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1033 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1034 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1035 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1036 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1037 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1038 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1039 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1040 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1041 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1042 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1043 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1044 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
1045 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1046 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1047 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1048 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1049 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1050 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1051 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1052 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1053 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1054 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1055 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1056 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1057 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1058 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1059 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1060 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1061 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1062 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1063 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1064 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1065 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1066 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1067 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1068 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1069 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1070 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1071 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1072 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1073 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
1074 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1075 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1076 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1077 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1078 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1079 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1080 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1081 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1082 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1083 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1084 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1085 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1086 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1087 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1088 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1089 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1090 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1091 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1092 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1093 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1094 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1095 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1096 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1097 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1098 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1099 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1100 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1101 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1102 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
1103 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1104 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1105 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1106 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1107 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1108 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1109 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1110 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1111 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1112 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1113 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1114 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1115 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1116 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1117 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1118 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1119 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1120 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1121 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1122 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1123 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1124 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1125 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1126 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1127 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1128 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1129 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1130 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1131 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1132 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1133 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
1134 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1135 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1136 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1137 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1138 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1139 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1140 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1141 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1142 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1143 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1144 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1145 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1146 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1147 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1148 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1149 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1150 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1151 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1152 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1153 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1154 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1155 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1156 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1157 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.11
Metatranscriptomes 0.17
Isolates 22.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.51
Nodule 9.51
Rhizoplane 4.65
Rhizosphere 56.12
Stem 0
Stem Tuber 0
Unclassified 14.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C7977 2010549000 Bacteria 2394
2 MRS2a_Contig_49 2124908027 Bacteria 14994
3 SwRhRL2b_contig_2985449 2162886007 Bacteria 1769
4 JGI24739J22299_10024874 3300001989 Bacteria 2109
5 JGI24739J22299_10047227 3300001989 Bacteria 1406
6 JGI24744J21845_10026991 3300002077 Bacteria 1112
7 JGI25155J39150_1000064 3300002704 Bacteria 69949
8 JGI25156J39149_1000085 3300002705 Bacteria 69953
9 JGI25156J39149_1006718 3300002705 Bacteria 3105
10 JGI25154J39366_1000112 3300002738 Bacteria 69961
11 JGI25157J39369_1000109 3300002741 Bacteria 69961
12 JGI25164J39214_1004164 3300002772 Bacteria 1700
13 JGI25152J39213_1003372 3300002773 Bacteria 5481
14 JGI25152J39213_1015154 3300002773 Bacteria 1529
15 JGI25150J39212_1000123 3300002774 Bacteria 43588
16 JGI25150J39212_1003044 3300002774 Bacteria 4020
17 JGI25150J39212_1016369 3300002774 Bacteria 1217
18 JGI25159J45721_1004965 3300002987 Bacteria 4263
19 JGI25159J45721_1009814 3300002987 Bacteria 2494
20 JGI25159J45721_1014117 3300002987 Bacteria 1817
21 JGI25151J46595_10000083 3300003187 Bacteria 130658
22 JGI25151J46595_10005526 3300003187 Bacteria 6512
23 JGI25151J46595_10010917 3300003187 Bacteria 4199
24 JGI25151J46595_10017014 3300003187 Bacteria 3166
25 JGI25151J46595_10028541 3300003187 Bacteria 2221
26 JGI25151J46595_10046217 3300003187 Bacteria 1527
27 JGI25406J46586_10000042 3300003203 Bacteria 56211
28 JGI25406J46586_10023074 3300003203 Bacteria 2465
29 JGI25153J46596_10000024 3300003215 Bacteria 238285
30 JGI25153J46596_10000210 3300003215 Bacteria 52714
31 JGI25153J46596_10002003 3300003215 Bacteria 12033
32 JGI25153J46596_10002706 3300003215 Bacteria 10105
33 JGI25153J46596_10004494 3300003215 Bacteria 7510
34 JGI25153J46596_10008716 3300003215 Bacteria 4809
35 JGI25160J50197_1002743 3300003354 Bacteria 8080
36 JGI25161J50226_1000036 3300003374 Bacteria 133407
37 JGI25404J52841_10024437 3300003659 Bacteria 1302
38 Ga0055539_1000243 3300003752 Bacteria 35448
39 Ga0055533_1000011 3300003756 Bacteria 467893
40 Ga0055533_1000238 3300003756 Bacteria 35448
41 Ga0055532_1000259 3300003758 Bacteria 35444
42 Ga0055525_1000332 3300003759 Bacteria 35448
43 Ga0055525_1000644 3300003759 Bacteria 13803
44 Ga0055535_1005325 3300003761 Bacteria 2853
45 Ga0055526_1003106 3300003771 Bacteria 10770
46 Ga0055526_1008436 3300003771 Bacteria 5142
47 Ga0055526_1019348 3300003771 Bacteria 2485
48 Ga0055537_1000224 3300003773 Bacteria 41826
49 Ga0055524_1000098 3300003775 Bacteria 108095
50 Ga0055524_1000382 3300003775 Bacteria 38462
51 Ga0055524_1026803 3300003775 Bacteria 1769
52 Ga0055536_1000082 3300003781 Bacteria 81873
53 Ga0055536_1000185 3300003781 Bacteria 51529
54 Ga0055536_1013682 3300003781 Bacteria 2904
55 Ga0055536_1013856 3300003781 Bacteria 2873
56 Ga0055534_1000273 3300003784 Bacteria 35227
57 Ga0055534_1000902 3300003784 Bacteria 13393
58 Ga0055534_1004252 3300003784 Bacteria 4213
59 Ga0055528_1001031 3300003790 Bacteria 18417
60 Ga0055528_1005251 3300003790 Bacteria 6078
61 Ga0055530_10000094 3300003791 Bacteria 76102
62 Ga0055530_10001399 3300003791 Bacteria 17849
63 Ga0055530_10002109 3300003791 Bacteria 13253
64 Ga0055530_10002119 3300003791 Bacteria 13196
65 Ga0055530_10003201 3300003791 Bacteria 9596
66 Ga0055530_10006660 3300003791 Bacteria 5093
67 Ga0055540_1000007 3300003792 Bacteria 318178
68 Ga0055540_1000130 3300003792 Bacteria 76102
69 Ga0055540_1000137 3300003792 Bacteria 73229
70 Ga0055540_1000222 3300003792 Bacteria 53630
71 Ga0055540_1001438 3300003792 Bacteria 14188
72 Ga0055540_1012394 3300003792 Bacteria 2679
73 Ga0055540_1026244 3300003792 Bacteria 1412
74 Ga0055531_10000215 3300003794 Bacteria 63490
75 Ga0055531_10000322 3300003794 Bacteria 47122
76 Ga0055531_10001985 3300003794 Bacteria 14214
77 Ga0055531_10006835 3300003794 Bacteria 6365
78 Ga0055531_10010330 3300003794 Bacteria 4651
79 Ga0055531_10041864 3300003794 Bacteria 1319
80 Ga0055541_1000146 3300003841 Bacteria 35448
81 Ga0055543_1000157 3300004625 Bacteria 57172
82 Ga0055543_1004514 3300004625 Bacteria 3769
83 Ga0055543_1010096 3300004625 Bacteria 1996
84 Ga0065165_1000086 3300005262 Bacteria 154235
85 Ga0065165_1000132 3300005262 Bacteria 128732
86 Ga0065165_1000235 3300005262 Bacteria 96698
87 Ga0065165_1002164 3300005262 Bacteria 17774
88 Ga0065165_1003449 3300005262 Bacteria 11100
89 Ga0065165_1005901 3300005262 Bacteria 6648
90 Ga0065165_1015276 3300005262 Bacteria 2935
91 Ga0065165_1018020 3300005262 Bacteria 2576
92 Ga0065165_1021516 3300005262 Bacteria 2238
93 Ga0065714_10006377 3300005288 Bacteria 5429
94 Ga0065714_10010702 3300005288 Bacteria 4792
95 Ga0065714_10064795 3300005288 Bacteria 18680
96 Ga0065714_10068142 3300005288 Bacteria 4933
97 Ga0065704_10070946 3300005289 Bacteria 14338
98 Ga0065704_10089375 3300005289 Bacteria 2864
99 Ga0065704_10157222 3300005289 Bacteria 1382
100 Ga0065704_10164190 3300005289 Bacteria 1333
101 Ga0065704_10206522 3300005289 Bacteria 1124
102 Ga0065712_10081086 3300005290 Bacteria 3039
103 Ga0065712_10118723 3300005290 Bacteria 1702
104 Ga0065715_10141072 3300005293 Bacteria 1853
105 Ga0070658_10023280 3300005327 Bacteria 4972
106 Ga0070658_10139932 3300005327 Bacteria 2021
107 Ga0070658_10318478 3300005327 Bacteria 1328
108 Ga0070676_10050547 3300005328 Bacteria 2437
109 Ga0070683_100003964 3300005329 Bacteria 12115
110 Ga0070683_100017977 3300005329 Bacteria 6252
111 Ga0070683_100046754 3300005329 Bacteria 3999
112 Ga0070683_100127041 3300005329 Bacteria 2410
113 Ga0070683_100179321 3300005329 Bacteria 2011
114 Ga0070670_100000372 3300005331 Bacteria 37330
115 Ga0070670_100000760 3300005331 Bacteria 25035
116 Ga0070670_100082747 3300005331 Bacteria 2758
117 Ga0070670_100114378 3300005331 Bacteria 2326
118 Ga0070680_100011764 3300005336 Bacteria 6786
119 Ga0070680_100209735 3300005336 Bacteria 1643
120 Ga0070682_100128666 3300005337 Bacteria 1711
121 Ga0068868_100077236 3300005338 Bacteria 2664
122 Ga0070660_100071105 3300005339 Bacteria 2716
123 Ga0070660_100497834 3300005339 Bacteria 1014
124 Ga0070689_100054745 3300005340 Bacteria 3089
125 Ga0070661_100000140 3300005344 Bacteria 60039
126 Ga0070661_100106571 3300005344 Bacteria 2090
127 Ga0070661_100229694 3300005344 Bacteria 1426
128 Ga0070661_100245311 3300005344 Bacteria 1381
129 Ga0070669_100001983 3300005353 Bacteria 14798
130 Ga0070669_100036727 3300005353 Bacteria 3551
131 Ga0070675_100042193 3300005354 Bacteria 3727
132 Ga0070675_100068234 3300005354 Bacteria 2944
133 Ga0070671_100044769 3300005355 Bacteria 3678
134 Ga0070671_100048581 3300005355 Bacteria 3529
135 Ga0070671_100111737 3300005355 Bacteria 2295
136 Ga0070674_100007372 3300005356 Bacteria 6487
137 Ga0070674_100026172 3300005356 Bacteria 3807
138 Ga0070674_100027773 3300005356 Bacteria 3711
139 Ga0070674_100067175 3300005356 Bacteria 2521
140 Ga0070674_100142579 3300005356 Bacteria 1800
141 Ga0070673_100139498 3300005364 Bacteria 2043
142 Ga0070673_100223048 3300005364 Bacteria 1632
143 Ga0070688_100060348 3300005365 Bacteria 2395
144 Ga0070667_100000219 3300005367 Bacteria 66264
145 Ga0070667_100078809 3300005367 Bacteria 2815
146 Ga0070667_100292277 3300005367 Bacteria 1466
147 Ga0070667_100311231 3300005367 Bacteria 1419
148 Ga0070709_10000380 3300005434 Bacteria 27434
149 Ga0070709_10042930 3300005434 Bacteria 2794
150 Ga0070714_100072863 3300005435 Bacteria 2975
151 Ga0070714_100187876 3300005435 Bacteria 1884
152 Ga0070713_100025776 3300005436 Bacteria 4603
153 Ga0070713_100031324 3300005436 Bacteria 4235
154 Ga0070713_100107242 3300005436 Bacteria 2430
155 Ga0070713_100262520 3300005436 Bacteria 1579
156 Ga0070710_10001211 3300005437 Bacteria 12205
157 Ga0070711_100023898 3300005439 Bacteria 3981
158 Ga0070700_100031574 3300005441 Bacteria 3175
159 Ga0070663_100119438 3300005455 Bacteria 1989
160 Ga0070663_100199811 3300005455 Bacteria 1560
161 Ga0070678_100055642 3300005456 Bacteria 2889
162 Ga0070678_100194209 3300005456 Bacteria 1671
163 Ga0070662_100003380 3300005457 Bacteria 9944
164 Ga0070681_10002996 3300005458 Bacteria 15672
165 Ga0070681_10047095 3300005458 Bacteria 4309
166 Ga0070681_10110577 3300005458 Bacteria 2687
167 Ga0070681_10139649 3300005458 Bacteria 2353
168 Ga0070681_10334927 3300005458 Bacteria 1423
169 Ga0068867_100006086 3300005459 Bacteria 8545
170 Ga0068867_100061387 3300005459 Bacteria 2791
171 Ga0068867_100323987 3300005459 Bacteria 1277
172 Ga0070706_100060692 3300005467 Bacteria 3490
173 Ga0070707_100037612 3300005468 Bacteria 4620
174 Ga0070679_100006191 3300005530 Bacteria 11141
175 Ga0070679_100009801 3300005530 Bacteria 9063
176 Ga0070679_100065635 3300005530 Bacteria 3617
177 Ga0070679_100222470 3300005530 Bacteria 1848
178 Ga0070684_100083145 3300005535 Bacteria 2836
179 Ga0070684_100142382 3300005535 Bacteria 2169
180 Ga0070684_100174262 3300005535 Bacteria 1954
181 Ga0070684_100515146 3300005535 Bacteria 1108
182 Ga0070697_100009974 3300005536 Bacteria 7412
183 Ga0070697_100340685 3300005536 Bacteria 1294
184 Ga0068853_100101373 3300005539 Bacteria 2546
185 Ga0068853_100143634 3300005539 Bacteria 2143
186 Ga0070672_100006495 3300005543 Bacteria 7859
187 Ga0070672_100058504 3300005543 Bacteria 3030
188 Ga0070672_100173029 3300005543 Bacteria 1796
189 Ga0070686_100118488 3300005544 Bacteria 1814
190 Ga0070696_100162798 3300005546 Bacteria 1645
191 Ga0070693_100123400 3300005547 Bacteria 1609
192 Ga0070693_100182553 3300005547 Bacteria 1352
193 Ga0070693_100219439 3300005547 Bacteria 1245
194 Ga0070665_100029739 3300005548 Bacteria 5497
195 Ga0070665_100062998 3300005548 Bacteria 3718
196 Ga0070665_100166107 3300005548 Bacteria 2209
197 Ga0070665_100429001 3300005548 Bacteria 1331
198 Ga0070665_100501116 3300005548 Bacteria 1225
199 Ga0068855_100030522 3300005563 Bacteria 6446
200 Ga0068855_100054492 3300005563 Bacteria 4700
201 Ga0068855_100159363 3300005563 Bacteria 2562
202 Ga0068855_100287265 3300005563 Bacteria 1824
203 Ga0068855_100356384 3300005563 Bacteria 1610
204 Ga0068855_100609552 3300005563 Bacteria 1176
205 Ga0070664_100000201 3300005564 Bacteria 42562
206 Ga0070664_100042664 3300005564 Bacteria 3828
207 Ga0070664_100688573 3300005564 Bacteria 952
208 Ga0068857_100012293 3300005577 Bacteria 7448
209 Ga0068857_100206295 3300005577 Bacteria 1793
210 Ga0068857_100226182 3300005577 Bacteria 1710
211 Ga0068857_100312291 3300005577 Bacteria 1450
212 Ga0068857_100458514 3300005577 Bacteria 1192
213 Ga0068857_100570279 3300005577 Bacteria 1068
214 Ga0068854_100031155 3300005578 Bacteria 3704
215 Ga0068856_100000217 3300005614 Bacteria 61831
216 Ga0068856_100059874 3300005614 Bacteria 3762
217 Ga0068856_100107856 3300005614 Bacteria 2781
218 Ga0068856_100143863 3300005614 Bacteria 2392
219 Ga0068856_100180902 3300005614 Bacteria 2121
220 Ga0068852_100001671 3300005616 Bacteria 15117
221 Ga0068852_100091688 3300005616 Bacteria 2720
222 Ga0068852_100136573 3300005616 Bacteria 2264
223 Ga0068852_100153236 3300005616 Bacteria 2145
224 Ga0068864_100115854 3300005618 Bacteria 2391
225 Ga0068858_100180417 3300005842 Bacteria 1994
226 Ga0068858_100346459 3300005842 Bacteria 1422
227 Ga0068860_100000280 3300005843 Bacteria 72849
228 Ga0068862_100033882 3300005844 Bacteria 4320
229 Ga0068862_100599364 3300005844 Bacteria 1057
230 Ga0081455_10000751 3300005937 Bacteria 42140
231 Ga0081455_10007868 3300005937 Bacteria 11160
232 Ga0081455_10013127 3300005937 Bacteria 8211
233 Ga0081455_10015126 3300005937 Bacteria 7510
234 Ga0081455_10057044 3300005937 Bacteria 3312
235 Ga0081538_10045792 3300005981 Bacteria 2707
236 Ga0081540_1002153 3300005983 Bacteria 16368
237 Ga0081540_1002523 3300005983 Bacteria 14863
238 Ga0081540_1005561 3300005983 Bacteria 9385
239 Ga0081540_1008122 3300005983 Bacteria 7368
240 Ga0081540_1008798 3300005983 Bacteria 7015
241 Ga0081540_1013750 3300005983 Bacteria 5244
242 Ga0081540_1028343 3300005983 Bacteria 3147
243 Ga0081540_1089062 3300005983 Bacteria 1363
244 Ga0081540_1111796 3300005983 Bacteria 1153
245 Ga0081539_10000099 3300005985 Bacteria 201018
246 Ga0081539_10001660 3300005985 Bacteria 36067
247 Ga0081539_10007918 3300005985 Bacteria 9466
248 Ga0081539_10018502 3300005985 Bacteria 4830
249 Ga0081539_10062720 3300005985 Bacteria 2030
250 Ga0070717_10001256 3300006028 Bacteria 17303
251 Ga0070717_10008632 3300006028 Bacteria 7619
252 Ga0075365_10020604 3300006038 Bacteria 4092
253 Ga0075365_10162934 3300006038 Bacteria 1554
254 Ga0075365_10224057 3300006038 Bacteria 1319
255 Ga0075365_10339516 3300006038 Bacteria 1058
256 Ga0075368_10020284 3300006042 Bacteria 2516
257 Ga0075368_10034251 3300006042 Bacteria 1978
258 Ga0075364_10034399 3300006051 Bacteria 3269
259 Ga0075364_10043500 3300006051 Bacteria 2920
260 Ga0075364_10046426 3300006051 Bacteria 2828
261 Ga0075364_10102857 3300006051 Bacteria 1902
262 Ga0075364_10121122 3300006051 Bacteria 1751
263 Ga0075432_10030334 3300006058 Bacteria 1868
264 Ga0075432_10035898 3300006058 Bacteria 1722
265 Ga0070715_10088518 3300006163 Bacteria 1419
266 Ga0070716_100048945 3300006173 Bacteria 2392
267 Ga0070716_100119113 3300006173 Bacteria 1650
268 Ga0070712_100005932 3300006175 Bacteria 7558
269 Ga0070712_100008776 3300006175 Bacteria 6363
270 Ga0075362_10021558 3300006177 Bacteria 2706
271 Ga0075362_10038254 3300006177 Bacteria 2107
272 Ga0075362_10062461 3300006177 Bacteria 1687
273 Ga0075362_10063030 3300006177 Bacteria 1681
274 Ga0075362_10114043 3300006177 Bacteria 1275
275 Ga0075362_10148813 3300006177 Bacteria 1122
276 Ga0075367_10144208 3300006178 Bacteria 1476
277 Ga0075367_10177198 3300006178 Bacteria 1329
278 Ga0075367_10215987 3300006178 Bacteria 1200
279 Ga0075369_10000180 3300006186 Bacteria 18073
280 Ga0075369_10004583 3300006186 Bacteria 5124
281 Ga0075369_10038880 3300006186 Bacteria 2031
282 Ga0075369_10072627 3300006186 Bacteria 1516
283 Ga0075369_10108966 3300006186 Bacteria 1247
284 Ga0075366_10010769 3300006195 Bacteria 5141
285 Ga0075366_10052148 3300006195 Bacteria 2431
286 Ga0075366_10147616 3300006195 Bacteria 1423
287 Ga0075366_10198852 3300006195 Bacteria 1218
288 Ga0075366_10229611 3300006195 Bacteria 1131
289 Ga0097621_100209497 3300006237 Bacteria 1695
290 Ga0075370_10024822 3300006353 Bacteria 3314
291 Ga0075370_10034259 3300006353 Bacteria 2847
292 Ga0075370_10036798 3300006353 Bacteria 2750
293 Ga0075370_10039025 3300006353 Bacteria 2674
294 Ga0075370_10177243 3300006353 Bacteria 1254
295 Ga0075370_10228650 3300006353 Bacteria 1100
296 Ga0075428_100321704 3300006844 Bacteria 1662
297 Ga0075433_10253205 3300006852 Bacteria 1562
298 Ga0075434_100063130 3300006871 Bacteria 3687
299 Ga0075436_100100690 3300006914 Bacteria 2012
300 Ga0099824_1002075 3300006942 Bacteria 29088
301 Ga0099822_1008450 3300006943 Bacteria 13161
302 Ga0079104_1000009 3300006946 Bacteria 367015
303 Ga0079104_1000208 3300006946 Bacteria 82037
304 Ga0079104_1000239 3300006946 Bacteria 73048
305 Ga0079104_1000325 3300006946 Bacteria 58566
306 Ga0099826_10000135 3300006948 Bacteria 31697
307 Ga0099826_10044464 3300006948 Bacteria 3047
308 Ga0099826_10072630 3300006948 Bacteria 2177
309 Ga0075435_100016626 3300007076 Bacteria 5548
310 Ga0075435_100108433 3300007076 Bacteria 2307
311 Ga0099794_10019124 3300007265 Bacteria 3081
312 Ga0099794_10027843 3300007265 Bacteria 2623
313 Ga0099794_10042728 3300007265 Bacteria 2162
314 Ga0105251_10001079 3300009011 Bacteria 23858
315 Ga0105251_10006867 3300009011 Bacteria 7154
316 Ga0105251_10013774 3300009011 Bacteria 4505
317 Ga0105251_10043277 3300009011 Bacteria 2182
318 Ga0105251_10065110 3300009011 Bacteria 1706
319 Ga0105244_10000823 3300009036 Bacteria 26208
320 Ga0105244_10019773 3300009036 Bacteria 3750
321 Ga0105244_10026694 3300009036 Bacteria 3122
322 Ga0105244_10053196 3300009036 Bacteria 2059
323 Ga0105250_10000154 3300009092 Bacteria 59676
324 Ga0105250_10000523 3300009092 Bacteria 26747
325 Ga0105250_10001345 3300009092 Bacteria 13406
326 Ga0105250_10060706 3300009092 Bacteria 1519
327 Ga0105240_10003939 3300009093 Bacteria 22940
328 Ga0105240_10009735 3300009093 Bacteria 13572
329 Ga0105240_10208115 3300009093 Bacteria 2288
330 Ga0105240_10405279 3300009093 Bacteria 1535
331 Ga0111539_10413804 3300009094 Bacteria 1570
332 Ga0105247_10045403 3300009101 Bacteria 2695
333 Ga0105247_10083369 3300009101 Bacteria 2019
334 Ga0105247_10093409 3300009101 Bacteria 1912
335 Ga0114129_10030308 3300009147 Bacteria 7657
336 Ga0114129_10595650 3300009147 Bacteria 1433
337 Ga0105243_10000587 3300009148 Bacteria 36543
338 Ga0105243_10003470 3300009148 Bacteria 12726
339 Ga0105243_10178838 3300009148 Bacteria 1843
340 Ga0105243_10181233 3300009148 Bacteria 1832
341 Ga0105243_10437963 3300009148 Bacteria 1223
342 Ga0105241_10041364 3300009174 Bacteria 3482
343 Ga0105241_10100281 3300009174 Bacteria 2301
344 Ga0105241_10200563 3300009174 Bacteria 1666
345 Ga0105242_10003491 3300009176 Bacteria 12216
346 Ga0105242_10008807 3300009176 Bacteria 7743
347 Ga0105242_10314456 3300009176 Bacteria 1434
348 Ga0105242_10551563 3300009176 Bacteria 1105
349 Ga0105248_10309392 3300009177 Bacteria 1779
350 Ga0105237_10000413 3300009545 Bacteria 60829
351 Ga0105237_10000711 3300009545 Bacteria 46033
352 Ga0105237_10005231 3300009545 Bacteria 14681
353 Ga0105237_10116995 3300009545 Bacteria 2659
354 Ga0105237_10140221 3300009545 Bacteria 2412
355 Ga0105237_10175131 3300009545 Bacteria 2146
356 Ga0105237_10221020 3300009545 Bacteria 1894
357 Ga0105237_10240156 3300009545 Bacteria 1813
358 Ga0105238_10013593 3300009551 Bacteria 8221
359 Ga0105238_10015307 3300009551 Bacteria 7769
360 Ga0105238_10207894 3300009551 Bacteria 1933
361 Ga0105238_10248302 3300009551 Bacteria 1757
362 Ga0105238_10342465 3300009551 Bacteria 1483
363 Ga0105238_10411438 3300009551 Bacteria 1346
364 Ga0105238_10459237 3300009551 Bacteria 1271
365 Ga0099796_10071740 3300010159 Bacteria 1252
366 Ga0105239_10002359 3300010375 Bacteria 24075
367 Ga0105239_10047224 3300010375 Bacteria 4719
368 Ga0105239_10086633 3300010375 Bacteria 3452
369 Ga0105239_10093907 3300010375 Bacteria 3313
370 Ga0105239_10221947 3300010375 Bacteria 2119
371 Ga0105239_10473805 3300010375 Bacteria 1422
372 Ga0105246_10000239 3300011119 Bacteria 28228
373 Ga0105246_10057480 3300011119 Bacteria 2691
374 Ga0105246_10059504 3300011119 Bacteria 2650
375 Ga0105246_10171290 3300011119 Bacteria 1663
376 Ga0105246_10195093 3300011119 Bacteria 1570
377 Ga0157345_1000190 3300012498 Bacteria 9610
378 Ga0157326_1004788 3300012513 Bacteria 1425
379 Ga0157373_10000780 3300013100 Bacteria 24491
380 Ga0157373_10008065 3300013100 Bacteria 7827
381 Ga0157373_10072584 3300013100 Bacteria 2429
382 Ga0157371_10000189 3300013102 Bacteria 91155
383 Ga0157371_10003317 3300013102 Bacteria 14714
384 Ga0157371_10007676 3300013102 Bacteria 8684
385 Ga0157371_10043122 3300013102 Bacteria 3214
386 Ga0157370_10088442 3300013104 Bacteria 2909
387 Ga0157370_10091634 3300013104 Bacteria 2853
388 Ga0157370_10184755 3300013104 Bacteria 1936
389 Ga0157370_10324402 3300013104 Bacteria 1420
390 Ga0157370_10485708 3300013104 Bacteria 1135
391 Ga0157370_10508829 3300013104 Bacteria 1106
392 Ga0157369_10004800 3300013105 Bacteria 15885
393 Ga0157369_10007499 3300013105 Bacteria 12554
394 Ga0157369_10027452 3300013105 Bacteria 6311
395 Ga0157369_10037352 3300013105 Bacteria 5317
396 Ga0157369_10043154 3300013105 Bacteria 4916
397 Ga0157369_10068644 3300013105 Bacteria 3809
398 Ga0157369_10075613 3300013105 Bacteria 3610
399 Ga0157369_10093152 3300013105 Bacteria 3216
400 Ga0157369_10186668 3300013105 Bacteria 2180
401 Ga0171462_1016 3300013250 Bacteria 164601
402 Ga0157374_10079053 3300013296 Bacteria 3116
403 Ga0163162_10009532 3300013306 Bacteria 9444
404 Ga0157372_10030764 3300013307 Bacteria 5874
405 Ga0157372_10220737 3300013307 Bacteria 2197
406 Ga0157372_10283284 3300013307 Bacteria 1927
407 Ga0157375_10119307 3300013308 Bacteria 2745
408 Ga0157375_10123645 3300013308 Bacteria 2700
409 Ga0157375_10412970 3300013308 Bacteria 1516
410 Ga0157375_10458113 3300013308 Bacteria 1441
411 Ga0163163_10129728 3300014325 Bacteria 2561
412 Ga0163163_10388765 3300014325 Bacteria 1453
413 Ga0163163_10519134 3300014325 Bacteria 1253
414 Ga0182008_10018498 3300014497 Bacteria 3607
415 Ga0182008_10026815 3300014497 Bacteria 2921
416 Ga0182008_10040959 3300014497 Bacteria 2311
417 Ga0157376_10163548 3300014969 Bacteria 2020
418 Ga0157376_10483021 3300014969 Bacteria 1214
419 Ga0182006_1000002 3300015261 Bacteria 887990
420 Ga0182006_1001489 3300015261 Bacteria 14067
421 Ga0182006_1078660 3300015261 Bacteria 1207
422 Ga0182007_10000085 3300015262 Bacteria 70105
423 Ga0182007_10049056 3300015262 Bacteria 1395
424 Ga0182005_1000002 3300015265 Bacteria 908499
425 Ga0182005_1002866 3300015265 Bacteria 6003
426 Ga0183362_10003 3300015683 Bacteria 977584
427 Ga0163161_10015229 3300017792 Bacteria 5358
428 Ga0163161_10048777 3300017792 Bacteria 3058
429 Ga0163161_10288296 3300017792 Bacteria 1290
430 Ga0214544_1000136 3300021320 Bacteria 107814
431 Ga0214542_1000127 3300021321 Bacteria 107829
432 Ga0214545_1000063 3300021324 Bacteria 107829
433 Ga0214543_1018162 3300021327 Bacteria 6572
434 Ga0213872_10022991 3300021361 Bacteria 2869
435 Ga0213875_10044085 3300021388 Bacteria 2095
436 Ga0209435_100002 3300025206 Bacteria 794178
437 Ga0209435_100397 3300025206 Bacteria 9379
438 Ga0209436_108835 3300025208 Bacteria 1968
439 Ga0209784_100241 3300025224 Bacteria 35519
440 Ga0209566_100390 3300025225 Bacteria 35519
441 Ga0209674_100003 3300025226 Bacteria 2196646
442 Ga0209674_100293 3300025226 Bacteria 35519
443 Ga0209147_100332 3300025229 Bacteria 35519
444 Ga0209563_100010 3300025230 Bacteria 1337457
445 Ga0209563_100188 3300025230 Bacteria 35519
446 Ga0209563_100826 3300025230 Bacteria 9245
447 Ga0207427_100729 3300025231 Bacteria 15297
448 Ga0209258_100508 3300025242 Bacteria 37664
449 Ga0209258_100773 3300025242 Bacteria 19494
450 Ga0207425_1000024 3300025245 Bacteria 328978
451 Ga0207425_1000789 3300025245 Bacteria 16158
452 Ga0207425_1005788 3300025245 Bacteria 3478
453 Ga0207425_1007872 3300025245 Bacteria 2775
454 Ga0207425_1008495 3300025245 Bacteria 2622
455 Ga0207425_1032518 3300025245 Bacteria 1032
456 Ga0209646_1000001 3300025246 Bacteria 3092932
457 Ga0209026_1000121 3300025250 Bacteria 126801
458 Ga0209677_100266 3300025253 Bacteria 35519
459 Ga0209677_101929 3300025253 Bacteria 8294
460 Ga0209677_102242 3300025253 Bacteria 7490
461 Ga0209677_102733 3300025253 Bacteria 6327
462 Ga0209148_1000879 3300025254 Bacteria 20675
463 Ga0209148_1002254 3300025254 Bacteria 6983
464 Ga0209759_1000001 3300025256 Bacteria 2799452
465 Ga0209759_1001305 3300025256 Bacteria 14725
466 Ga0209759_1030804 3300025256 Bacteria 1054
467 Ga0209129_1000146 3300025258 Bacteria 115180
468 Ga0209129_1000212 3300025258 Bacteria 67061
469 Ga0209129_1007872 3300025258 Bacteria 3072
470 Ga0209233_1000753 3300025261 Bacteria 14662
471 Ga0209233_1001523 3300025261 Bacteria 9085
472 Ga0209233_1002406 3300025261 Bacteria 6910
473 Ga0209565_1000026 3300025263 Bacteria 365910
474 Ga0209565_1000083 3300025263 Bacteria 154007
475 Ga0209565_1001447 3300025263 Bacteria 10465
476 Ga0209565_1009765 3300025263 Bacteria 2412
477 Ga0209455_1002084 3300025272 Bacteria 8009
478 Ga0209455_1005287 3300025272 Bacteria 4025
479 Ga0209673_1000009 3300025273 Bacteria 620735
480 Ga0209673_1000534 3300025273 Bacteria 62274
481 Ga0209673_1025459 3300025273 Bacteria 1966
482 Ga0209673_1028549 3300025273 Bacteria 1793
483 Ga0209673_1037216 3300025273 Bacteria 1433
484 Ga0209130_1000109 3300025284 Bacteria 133520
485 Ga0209130_1000208 3300025284 Bacteria 78707
486 Ga0209130_1002387 3300025284 Bacteria 9506
487 Ga0209130_1004260 3300025284 Bacteria 5542
488 Ga0209675_1000081 3300025291 Bacteria 154007
489 Ga0209675_1000246 3300025291 Bacteria 53700
490 Ga0209675_1004057 3300025291 Bacteria 6669
491 Ga0209676_1000002 3300025292 Bacteria 1732948
492 Ga0209676_1000013 3300025292 Bacteria 816080
493 Ga0209676_1000017 3300025292 Bacteria 643409
494 Ga0209676_1000065 3300025292 Bacteria 318605
495 Ga0209676_1000441 3300025292 Bacteria 70795
496 Ga0209676_1001087 3300025292 Bacteria 30566
497 Ga0209676_1006060 3300025292 Bacteria 6087
498 Ga0209676_1006968 3300025292 Bacteria 5440
499 Ga0209676_1009189 3300025292 Bacteria 4299
500 Ga0209025_1000050 3300025294 Bacteria 331531
501 Ga0209025_1000245 3300025294 Bacteria 127801
502 Ga0209025_1000925 3300025294 Bacteria 44920
503 Ga0209025_1001886 3300025294 Bacteria 24515
504 Ga0209025_1002291 3300025294 Bacteria 20787
505 Ga0209025_1007137 3300025294 Bacteria 8441
506 Ga0209025_1009400 3300025294 Bacteria 6817
507 Ga0209025_1010298 3300025294 Bacteria 6352
508 Ga0209025_1082996 3300025294 Bacteria 1080
509 Ga0209564_1000024 3300025295 Bacteria 535041
510 Ga0209564_1000243 3300025295 Bacteria 118066
511 Ga0209564_1000366 3300025295 Bacteria 83994
512 Ga0209564_1000602 3300025295 Bacteria 56176
513 Ga0209564_1003071 3300025295 Bacteria 11841
514 Ga0209564_1003205 3300025295 Bacteria 11491
515 Ga0209564_1009126 3300025295 Bacteria 4772
516 Ga0209564_1010517 3300025295 Bacteria 4250
517 Ga0209564_1011345 3300025295 Bacteria 4004
518 Ga0209564_1027094 3300025295 Bacteria 1871
519 Ga0209758_1000011 3300025297 Bacteria 1049685
520 Ga0209758_1000026 3300025297 Bacteria 582706
521 Ga0209758_1000083 3300025297 Bacteria 257283
522 Ga0209758_1000213 3300025297 Bacteria 126745
523 Ga0209758_1000455 3300025297 Bacteria 68279
524 Ga0209758_1000558 3300025297 Bacteria 58712
525 Ga0209758_1000792 3300025297 Bacteria 45045
526 Ga0209758_1001083 3300025297 Bacteria 35356
527 Ga0209758_1011163 3300025297 Bacteria 5244
528 Ga0209758_1012836 3300025297 Bacteria 4640
529 Ga0209758_1013115 3300025297 Bacteria 4554
530 Ga0209758_1027818 3300025297 Bacteria 2407
531 Ga0209050_1000008 3300025298 Bacteria 1144179
532 Ga0209050_1000079 3300025298 Bacteria 277803
533 Ga0209050_1000242 3300025298 Bacteria 118006
534 Ga0209050_1000371 3300025298 Bacteria 85791
535 Ga0209050_1001174 3300025298 Bacteria 30903
536 Ga0209050_1002504 3300025298 Bacteria 15481
537 Ga0209050_1005060 3300025298 Bacteria 8522
538 Ga0209050_1006629 3300025298 Bacteria 6785
539 Ga0209050_1009571 3300025298 Bacteria 4936
540 Ga0209050_1018568 3300025298 Bacteria 2694
541 Ga0209050_1023748 3300025298 Bacteria 2145
542 Ga0209256_1000003 3300025299 Bacteria 1661127
543 Ga0209256_1000019 3300025299 Bacteria 558627
544 Ga0209256_1000934 3300025299 Bacteria 35520
545 Ga0209256_1002958 3300025299 Bacteria 12732
546 Ga0209256_1018955 3300025299 Bacteria 2212
547 Ga0207426_1001071 3300025302 Bacteria 25720
548 Ga0207426_1007923 3300025302 Bacteria 4378
549 Ga0207426_1015005 3300025302 Bacteria 2826
550 Ga0209051_1000001 3300025303 Bacteria 1732974
551 Ga0209051_1000004 3300025303 Bacteria 1155596
552 Ga0209051_1000005 3300025303 Bacteria 1142353
553 Ga0209051_1000054 3300025303 Bacteria 280804
554 Ga0209051_1000234 3300025303 Bacteria 92914
555 Ga0209051_1000244 3300025303 Bacteria 91505
556 Ga0209051_1006304 3300025303 Bacteria 6718
557 Ga0209051_1008812 3300025303 Bacteria 5288
558 Ga0209051_1011409 3300025303 Bacteria 4389
559 Ga0209257_1000038 3300025304 Bacteria 609032
560 Ga0209257_1000044 3300025304 Bacteria 486709
561 Ga0209257_1000048 3300025304 Bacteria 455536
562 Ga0209257_1000144 3300025304 Bacteria 197078
563 Ga0209257_1000167 3300025304 Bacteria 171342
564 Ga0209257_1000239 3300025304 Bacteria 128383
565 Ga0209257_1000365 3300025304 Bacteria 91586
566 Ga0209257_1003906 3300025304 Bacteria 12134
567 Ga0209257_1008157 3300025304 Bacteria 6068
568 Ga0209257_1023089 3300025304 Bacteria 2198
569 Ga0209257_1046541 3300025304 Bacteria 1252
570 Ga0207696_1000045 3300025711 Bacteria 296484
571 Ga0207696_1000090 3300025711 Bacteria 188474
572 Ga0207696_1000147 3300025711 Bacteria 120603
573 Ga0207696_1000388 3300025711 Bacteria 42044
574 Ga0207696_1006368 3300025711 Bacteria 4764
575 Ga0207696_1012353 3300025711 Bacteria 3023
576 Ga0207655_1000140 3300025728 Bacteria 139110
577 Ga0207655_1000333 3300025728 Bacteria 68997
578 Ga0207655_1004959 3300025728 Bacteria 9224
579 Ga0207655_1010972 3300025728 Bacteria 5442
580 Ga0207655_1015837 3300025728 Bacteria 4163
581 Ga0207655_1017861 3300025728 Bacteria 3803
582 Ga0207655_1026928 3300025728 Bacteria 2751
583 Ga0207713_1001032 3300025735 Bacteria 24214
584 Ga0207713_1001617 3300025735 Bacteria 17558
585 Ga0207713_1002467 3300025735 Bacteria 13449
586 Ga0207713_1002698 3300025735 Bacteria 12677
587 Ga0207713_1004082 3300025735 Bacteria 9622
588 Ga0207713_1004181 3300025735 Bacteria 9468
589 Ga0207713_1024073 3300025735 Bacteria 2848
590 Ga0207713_1045495 3300025735 Bacteria 1792
591 Ga0207682_10006388 3300025893 Bacteria 4752
592 Ga0207642_10018244 3300025899 Bacteria 2688
593 Ga0207688_10010905 3300025901 Bacteria 4944
594 Ga0207688_10016380 3300025901 Bacteria 4020
595 Ga0207688_10077308 3300025901 Bacteria 1896
596 Ga0207647_10021071 3300025904 Bacteria 4357
597 Ga0207647_10103671 3300025904 Bacteria 1686
598 Ga0207647_10193410 3300025904 Bacteria 1178
599 Ga0207699_10037385 3300025906 Bacteria 2775
600 Ga0207699_10094522 3300025906 Bacteria 1883
601 Ga0207699_10245439 3300025906 Bacteria 1232
602 Ga0207645_10023628 3300025907 Bacteria 3991
603 Ga0207643_10043732 3300025908 Bacteria 2528
604 Ga0207705_10037246 3300025909 Bacteria 3480
605 Ga0207705_10125185 3300025909 Bacteria 1909
606 Ga0207684_10015383 3300025910 Bacteria 6586
607 Ga0207684_10230764 3300025910 Bacteria 1597
608 Ga0207654_10110007 3300025911 Bacteria 1713
609 Ga0207707_10000183 3300025912 Bacteria 65793
610 Ga0207707_10005958 3300025912 Bacteria 10662
611 Ga0207707_10010268 3300025912 Bacteria 8126
612 Ga0207707_10272681 3300025912 Bacteria 1466
613 Ga0207695_10000157 3300025913 Bacteria 204140
614 Ga0207695_10012974 3300025913 Bacteria 9958
615 Ga0207695_10024944 3300025913 Bacteria 6710
616 Ga0207695_10175139 3300025913 Bacteria 2068
617 Ga0207695_10455151 3300025913 Bacteria 1163
618 Ga0207671_10003125 3300025914 Bacteria 16823
619 Ga0207671_10007248 3300025914 Bacteria 9659
620 Ga0207671_10024412 3300025914 Bacteria 4546
621 Ga0207671_10025871 3300025914 Bacteria 4403
622 Ga0207671_10083206 3300025914 Bacteria 2402
623 Ga0207671_10099213 3300025914 Bacteria 2204
624 Ga0207671_10101625 3300025914 Bacteria 2178
625 Ga0207671_10135615 3300025914 Bacteria 1892
626 Ga0207671_10341359 3300025914 Bacteria 1187
627 Ga0207693_10007368 3300025915 Bacteria 9045
628 Ga0207693_10018506 3300025915 Bacteria 5547
629 Ga0207693_10044139 3300025915 Bacteria 3503
630 Ga0207693_10199453 3300025915 Bacteria 1574
631 Ga0207693_10230843 3300025915 Bacteria 1453
632 Ga0207663_10041718 3300025916 Bacteria 2798
633 Ga0207663_10096789 3300025916 Bacteria 1972
634 Ga0207657_10001840 3300025919 Bacteria 22916
635 Ga0207657_10146645 3300025919 Bacteria 1924
636 Ga0207649_10000156 3300025920 Bacteria 55743
637 Ga0207649_10028131 3300025920 Bacteria 3308
638 Ga0207649_10064178 3300025920 Bacteria 2321
639 Ga0207652_10023004 3300025921 Bacteria 5163
640 Ga0207652_10131156 3300025921 Bacteria 2236
641 Ga0207652_10261848 3300025921 Bacteria 1560
642 Ga0207646_10205293 3300025922 Bacteria 1780
643 Ga0207681_10003803 3300025923 Bacteria 9365
644 Ga0207681_10029523 3300025923 Bacteria 3563
645 Ga0207681_10509215 3300025923 Bacteria 986
646 Ga0207694_10022641 3300025924 Bacteria 4767
647 Ga0207694_10036365 3300025924 Bacteria 3779
648 Ga0207694_10078687 3300025924 Bacteria 2585
649 Ga0207694_10290708 3300025924 Bacteria 1344
650 Ga0207650_10000266 3300025925 Bacteria 55293
651 Ga0207650_10000955 3300025925 Bacteria 21744
652 Ga0207650_10003617 3300025925 Bacteria 10596
653 Ga0207650_10027888 3300025925 Bacteria 4044
654 Ga0207650_10033574 3300025925 Bacteria 3717
655 Ga0207659_10004256 3300025926 Bacteria 8651
656 Ga0207659_10037749 3300025926 Bacteria 3356
657 Ga0207687_10184232 3300025927 Bacteria 1620
658 Ga0207700_10026499 3300025928 Bacteria 4042
659 Ga0207700_10111812 3300025928 Bacteria 2199
660 Ga0207700_10202496 3300025928 Bacteria 1674
661 Ga0207700_10229719 3300025928 Bacteria 1577
662 Ga0207664_10041985 3300025929 Bacteria 3567
663 Ga0207664_10283126 3300025929 Bacteria 1455
664 Ga0207644_10143631 3300025931 Bacteria 1840
665 Ga0207706_10001399 3300025933 Bacteria 24113
666 Ga0207706_10093287 3300025933 Bacteria 2647
667 Ga0207706_10510774 3300025933 Bacteria 1037
668 Ga0207686_10032635 3300025934 Bacteria 3100
669 Ga0207686_10128424 3300025934 Bacteria 1735
670 Ga0207686_10154091 3300025934 Bacteria 1603
671 Ga0207709_10000014 3300025935 Bacteria 526302
672 Ga0207709_10000745 3300025935 Bacteria 25844
673 Ga0207709_10000862 3300025935 Bacteria 23149
674 Ga0207709_10064266 3300025935 Bacteria 2303
675 Ga0207709_10152522 3300025935 Bacteria 1602
676 Ga0207670_10008860 3300025936 Bacteria 5702
677 Ga0207670_10247359 3300025936 Bacteria 1376
678 Ga0207669_10003348 3300025937 Bacteria 6939
679 Ga0207669_10062805 3300025937 Bacteria 2289
680 Ga0207669_10093092 3300025937 Bacteria 1968
681 Ga0207665_10034568 3300025939 Bacteria 3354
682 Ga0207665_10047803 3300025939 Bacteria 2870
683 Ga0207691_10015888 3300025940 Bacteria 7152
684 Ga0207711_10532840 3300025941 Bacteria 1095
685 Ga0207661_10005577 3300025944 Bacteria 8874
686 Ga0207661_10009220 3300025944 Bacteria 7071
687 Ga0207661_10248092 3300025944 Bacteria 1581
688 Ga0207679_10000016 3300025945 Bacteria 253494
689 Ga0207679_10400716 3300025945 Bacteria 1207
690 Ga0207667_10025206 3300025949 Bacteria 6514
691 Ga0207667_10042544 3300025949 Bacteria 4827
692 Ga0207667_10370428 3300025949 Bacteria 1460
693 Ga0207651_10040199 3300025960 Bacteria 3091
694 Ga0207712_10353700 3300025961 Bacteria 1222
695 Ga0207668_10192054 3300025972 Bacteria 1619
696 Ga0207640_10065278 3300025981 Bacteria 2428
697 Ga0207640_10164788 3300025981 Bacteria 1644
698 Ga0207658_10108932 3300025986 Bacteria 2186
699 Ga0207658_10143977 3300025986 Bacteria 1933
700 Ga0207677_10009064 3300026023 Bacteria 5584
701 Ga0207677_10156526 3300026023 Bacteria 1765
702 Ga0207703_10207747 3300026035 Bacteria 1744
703 Ga0207639_10057826 3300026041 Bacteria 2980
704 Ga0207639_10079348 3300026041 Bacteria 2594
705 Ga0207639_10267734 3300026041 Bacteria 1497
706 Ga0207678_10028237 3300026067 Bacteria 4899
707 Ga0207678_10056271 3300026067 Bacteria 3386
708 Ga0207702_10001581 3300026078 Bacteria 22550
709 Ga0207702_10037097 3300026078 Bacteria 4078
710 Ga0207702_10131075 3300026078 Bacteria 2256
711 Ga0207702_10411970 3300026078 Bacteria 1305
712 Ga0207641_10033406 3300026088 Bacteria 4274
713 Ga0207648_10013832 3300026089 Bacteria 7485
714 Ga0207648_10034250 3300026089 Bacteria 4477
715 Ga0207648_10101244 3300026089 Bacteria 2525
716 Ga0207676_10175434 3300026095 Bacteria 1871
717 Ga0207674_10036358 3300026116 Bacteria 5133
718 Ga0207674_10076492 3300026116 Bacteria 3354
719 Ga0207674_10100560 3300026116 Bacteria 2873
720 Ga0207674_10182305 3300026116 Bacteria 2051
721 Ga0207674_10205855 3300026116 Bacteria 1917
722 Ga0207674_10220597 3300026116 Bacteria 1844
723 Ga0207683_10045311 3300026121 Bacteria 3846
724 Ga0207683_10205221 3300026121 Bacteria 1792
725 Ga0207698_10006676 3300026142 Bacteria 7210
726 Ga0209281_1000002 3300027111 Bacteria 1924012
727 Ga0209281_1000018 3300027111 Bacteria 579091
728 Ga0209281_1000023 3300027111 Bacteria 519955
729 Ga0209281_1000061 3300027111 Bacteria 293814
730 Ga0209281_1000368 3300027111 Bacteria 73062
731 Ga0209389_1034967 3300027296 Bacteria 4091
732 Ga0209589_1000002 3300027357 Bacteria 708598
733 Ga0209589_1004535 3300027357 Bacteria 23952
734 Ga0209489_100002 3300027361 Bacteria 708609
735 Ga0209489_100050 3300027361 Bacteria 154669
736 Ga0209489_104795 3300027361 Bacteria 24473
737 Ga0209700_100002 3300027363 Bacteria 708598
738 Ga0209700_100016 3300027363 Bacteria 252567
739 Ga0209995_1000788 3300027471 Bacteria 4862
740 Ga0209179_1003151 3300027512 Bacteria 2337
741 Ga0209968_1019181 3300027526 Bacteria 1100
742 Ga0209970_1000107 3300027614 Bacteria 11851
743 Ga0210002_1016632 3300027617 Bacteria 1165
744 Ga0209983_1000442 3300027665 Bacteria 8967
745 Ga0209282_1001739 3300027666 Bacteria 12179
746 Ga0209282_1013266 3300027666 Bacteria 5249
747 Ga0209588_1020699 3300027671 Bacteria 2061
748 Ga0209588_1060223 3300027671 Bacteria 1227
749 Ga0209971_1001513 3300027682 Bacteria 5755
750 Ga0209971_1001548 3300027682 Bacteria 5688
751 Ga0209813_10003068 3300027866 Bacteria 3884
752 Ga0209813_10048661 3300027866 Bacteria 1317
753 Ga0209974_10007739 3300027876 Bacteria 3694
754 Ga0209974_10011930 3300027876 Bacteria 2912
755 Ga0207428_10022614 3300027907 Bacteria 5303
756 Ga0207428_10044673 3300027907 Bacteria 3573
757 Ga0207428_10083579 3300027907 Bacteria 2490
758 Ga0207428_10199749 3300027907 Bacteria 1505
759 Ga0207428_10255836 3300027907 Bacteria 1305
760 Ga0268266_10003203 3300028379 Bacteria 16557
761 Ga0268266_10012481 3300028379 Bacteria 7342
762 Ga0268266_10039076 3300028379 Bacteria 4041
763 Ga0268266_10078930 3300028379 Bacteria 2865
764 Ga0268266_10085845 3300028379 Bacteria 2751
765 Ga0268264_10000038 3300028381 Bacteria 383623
766 Ga0265337_1005916 3300028556 Bacteria 4789
767 Ga0265326_10003140 3300028558 Bacteria 5466
768 Ga0265319_1002854 3300028563 Bacteria 9237
769 Ga0265334_10001590 3300028573 Bacteria 10915
770 Ga0265318_10005470 3300028577 Bacteria 5963
771 Ga0265323_10000744 3300028653 Bacteria 17485
772 Ga0265322_10026828 3300028654 Bacteria 1646
773 Ga0265336_10000008 3300028666 Bacteria 336082
774 Ga0265336_10000228 3300028666 Bacteria 39886
775 Ga0307517_10000512 3300028786 Bacteria 66501
776 Ga0307515_10002738 3300028794 Bacteria 37712
777 Ga0307515_10007488 3300028794 Bacteria 21572
778 Ga0307515_10153679 3300028794 Bacteria 2389
779 Ga0265338_10000116 3300028800 Bacteria 146839
780 Ga0265324_10001429 3300029957 Bacteria 13685
781 Ga0265324_10003977 3300029957 Bacteria 6822
782 Ga0307511_10109527 3300030521 Bacteria 1765
783 Ga0316176_1097126 3300030732 Bacteria 1928
784 Ga0316178_1063861 3300030735 Bacteria 18113
785 Ga0265330_10000012 3300031235 Bacteria 180837
786 Ga0265330_10020866 3300031235 Bacteria 2993
787 Ga0265330_10039637 3300031235 Bacteria 2093
788 Ga0265332_10117983 3300031238 Bacteria 1115
789 Ga0265325_10020132 3300031241 Bacteria 3681
790 Ga0265340_10002528 3300031247 Bacteria 10391
791 Ga0265339_10001476 3300031249 Bacteria 17368
792 Ga0265339_10059648 3300031249 Bacteria 2057
793 Ga0265331_10023285 3300031250 Bacteria 3148
794 Ga0265327_10025625 3300031251 Bacteria 3434
795 Ga0265316_10182322 3300031344 Bacteria 1563
796 Ga0307513_10000028 3300031456 Bacteria 193264
797 Ga0307513_10000206 3300031456 Bacteria 85338
798 Ga0307513_10037114 3300031456 Bacteria 5426
799 Ga0307513_10266951 3300031456 Bacteria 1497
800 Ga0307513_10315343 3300031456 Bacteria 1324
801 Ga0307513_10346460 3300031456 Bacteria 1235
802 Ga0307509_10005567 3300031507 Bacteria 17451
803 Ga0307509_10084915 3300031507 Bacteria 3259
804 Ga0307509_10098912 3300031507 Bacteria 2960
805 Ga0307509_10120213 3300031507 Bacteria 2606
806 Ga0307509_10379167 3300031507 Bacteria 1127
807 Ga0307408_100000004 3300031548 Bacteria 572889
808 Ga0307408_100010250 3300031548 Bacteria 6181
809 Ga0307408_100027214 3300031548 Bacteria 3938
810 Ga0307408_100040046 3300031548 Bacteria 3316
811 Ga0307408_100091004 3300031548 Bacteria 2303
812 Ga0307408_100096358 3300031548 Bacteria 2244
813 Ga0307408_100155007 3300031548 Bacteria 1813
814 Ga0307408_100195868 3300031548 Bacteria 1631
815 Ga0307508_10000008 3300031616 Bacteria 265023
816 Ga0307508_10000053 3300031616 Bacteria 128020
817 Ga0307508_10000273 3300031616 Bacteria 63550
818 Ga0307508_10032796 3300031616 Bacteria 4690
819 Ga0307508_10040908 3300031616 Bacteria 4161
820 Ga0307508_10055166 3300031616 Bacteria 3521
821 Ga0307514_10000722 3300031649 Bacteria 57107
822 Ga0265314_10006545 3300031711 Bacteria 10278
823 Ga0265314_10015462 3300031711 Bacteria 6055
824 Ga0265314_10024921 3300031711 Bacteria 4524
825 Ga0316576_10017056 3300031727 Bacteria 4925
826 Ga0307516_10000064 3300031730 Bacteria 115074
827 Ga0307516_10001494 3300031730 Bacteria 32199
828 Ga0307516_10001622 3300031730 Bacteria 30969
829 Ga0307516_10024119 3300031730 Bacteria 6217
830 Ga0307516_10140243 3300031730 Bacteria 2188
831 Ga0307405_10007622 3300031731 Bacteria 5430
832 Ga0307405_10010736 3300031731 Bacteria 4761
833 Ga0307413_10232830 3300031824 Bacteria 1354
834 Ga0307410_10026075 3300031852 Bacteria 3674
835 Ga0307406_10003755 3300031901 Bacteria 8259
836 Ga0307406_10013191 3300031901 Bacteria 4729
837 Ga0307406_10018898 3300031901 Bacteria 4036
838 Ga0307406_10029649 3300031901 Bacteria 3315
839 Ga0307407_10027945 3300031903 Bacteria 3009
840 Ga0307407_10088687 3300031903 Bacteria 1890
841 Ga0307412_10002786 3300031911 Bacteria 9713
842 Ga0307412_10026597 3300031911 Bacteria 3598
843 Ga0307412_10097399 3300031911 Bacteria 2072
844 Ga0307409_100002839 3300031995 Bacteria 9162
845 Ga0307409_100139382 3300031995 Bacteria 2087
846 Ga0307416_100047679 3300032002 Bacteria 3393
847 Ga0307416_100049968 3300032002 Bacteria 3329
848 Ga0307416_100234891 3300032002 Bacteria 1771
849 Ga0307416_100279148 3300032002 Bacteria 1646
850 Ga0307414_10040421 3300032004 Bacteria 3150
851 Ga0307414_10057596 3300032004 Bacteria 2732
852 Ga0307414_10132567 3300032004 Bacteria 1937
853 Ga0307414_10193040 3300032004 Bacteria 1649
854 Ga0307414_10278168 3300032004 Bacteria 1405
855 Ga0307414_10326757 3300032004 Bacteria 1308
856 Ga0307414_10335077 3300032004 Bacteria 1293
857 Ga0307414_10428999 3300032004 Bacteria 1154
858 Ga0307411_10000039 3300032005 Bacteria 40183
859 Ga0307411_10016890 3300032005 Bacteria 4141
860 Ga0307411_10134858 3300032005 Bacteria 1810
861 Ga0307411_10256903 3300032005 Bacteria 1377
862 Ga0307411_10418826 3300032005 Bacteria 1112
863 Ga0307415_100008136 3300032126 Bacteria 5795
864 Ga0307415_100023443 3300032126 Bacteria 3831
865 Ga0307507_10071426 3300033179 Bacteria 3139
866 Ga0307510_10000088 3300033180 Bacteria 69071
867 Ga0307510_10002929 3300033180 Bacteria 19628
868 Ga0307510_10021544 3300033180 Bacteria 7509
869 Ga0307510_10068402 3300033180 Bacteria 3564
870 Ga0307510_10098920 3300033180 Bacteria 2718
871 Ga0315911_1000004 3300033442 Bacteria 472637
872 Ga0373926_0011772 3300035083 Bacteria 2951
873 Ga0373929_0011017 3300035085 Bacteria 1698
874 Ga0373934_0001948 3300035086 Bacteria 7568
875 Ga0373934_0012326 3300035086 Bacteria 3227
876 Ga0373932_0035200 3300035112 Bacteria 1415
877 Ga0373936_0007174 3300035113 Bacteria 4195
878 Ga0373945_0008905 3300035116 Bacteria 3279
879 Ga0373945_0020462 3300035116 Bacteria 2265
880 Ga0373953_0094460 3300035117 Bacteria 1253
881 Ga0373954_0001852 3300035118 Bacteria 8731
882 Ga0373954_0010696 3300035118 Bacteria 4055
883 Ga0373956_0003558 3300035119 Bacteria 6278
884 Ga0373956_0137522 3300035119 Bacteria 1146
885 Ga0373957_0010697 3300035120 Bacteria 3041
886 Ga0373943_0010932 3300035170 Bacteria 4079
887 Ga0373943_0215764 3300035170 Bacteria 1067
888 Ga0373946_0013875 3300035171 Bacteria 3033
889 Ga0373955_0039970 3300035172 Bacteria 2506
890 Ga0373955_0051885 3300035172 Bacteria 2235
891 Ga0373962_0060997 3300035242 Bacteria 1108
892 Ga0373924_0003246 3300035410 Bacteria 5563
893 Ga0373931_0001380 3300035691 Bacteria 10387
894 Ga0373935_0000493 3300035692 Bacteria 20439
895 Ga0373935_0058231 3300035692 Bacteria 2467
896 Ga0373927_0000331 3300035695 Bacteria 37139
897 Ga0373927_0007766 3300035695 Bacteria 7255
898 Ga0373927_0012238 3300035695 Bacteria 5708
899 Ga0373927_0075732 3300035695 Bacteria 2179
900 Ga0373927_0205124 3300035695 Bacteria 1294
901 Ga0373933_0004248 3300035724 Bacteria 7890
902 Ga0373933_0047155 3300035724 Bacteria 2561
903 Ga0373933_0369114 3300035724 Bacteria 934
904 Ga0373947_0004776 3300035725 Bacteria 7937
905 Ga0373947_0014044 3300035725 Bacteria 4591
906 Ga0373947_0055623 3300035725 Bacteria 2390
907 Ga0373947_0143620 3300035725 Bacteria 1533
908 Ga0373937_0009958 3300036401 Bacteria 8289
909 Ga0373937_0136963 3300036401 Bacteria 2289
910 Ga0373937_0140600 3300036401 Bacteria 2258
911 Ga0373937_0188612 3300036401 Bacteria 1937
912 Ga0316584_0161063 3300036712 Bacteria 1667
913 Ga0373925_0029402 3300037068 Bacteria 4032
914 Ga0373925_0053723 3300037068 Bacteria 3012
915 Ga0373925_0089848 3300037068 Bacteria 2347
916 Ga0373925_0094066 3300037068 Bacteria 2294
917 Ga0373925_0174547 3300037068 Bacteria 1698
918 Ga0373925_0499995 3300037068 Bacteria 998
919 Ga0395899_0001797 3300037312 Bacteria 17769
920 Ga0395899_0027157 3300037312 Bacteria 4318
921 Ga0395900_0000134 3300037418 Bacteria 124444
922 Ga0395900_0023837 3300037418 Bacteria 6261
923 Ga0395898_0029740 3300037466 Bacteria 5467
924 Ga0395898_0051921 3300037466 Bacteria 4007
925 Ga0395898_0411805 3300037466 Bacteria 1289
926 Ga0395905_0009931 3300037471 Bacteria 9272
927 Ga0395905_0155934 3300037471 Bacteria 2148
928 Ga0395905_0193383 3300037471 Bacteria 1908
929 Ga0395905_0193507 3300037471 Bacteria 1907
930 Ga0395901_0010231 3300038443 Bacteria 9503
931 Ga0395901_0011149 3300038443 Bacteria 9108
932 Ga0395901_0042456 3300038443 Bacteria 4714
933 Ga0395901_0084013 3300038443 Bacteria 3328
934 Ga0395901_0091348 3300038443 Bacteria 3187
935 Ga0395901_0176077 3300038443 Bacteria 2244
936 Ga0395901_0303025 3300038443 Bacteria 1656
937 Ga0237819_01625 3300038705 Bacteria 5565
938 Ga0436365_0622105 3300039437 Bacteria 10561
939 Ga0436365_0851563 3300039437 Bacteria 1441
940 Ga0436360_0042397 3300039438 Bacteria 10982
941 Ga0436360_0742143 3300039438 Bacteria 1447
942 Ga0436360_0766994 3300039438 Bacteria 2327
943 Ga0436360_0975226 3300039438 Bacteria 1622
944 Ga0436361_0054229 3300039447 Bacteria 4060
945 Ga0436363_0016840 3300039450 Bacteria 1060
946 Ga0436363_1029339 3300039450 Bacteria 1723
947 Ga0436362_0974760 3300039453 Bacteria 2641
948 Ga0439438_003472 3300041405 Bacteria 6366
949 Ga0439438_035300 3300041405 Bacteria 1314
950 Ga0439439_0029169 3300041406 Bacteria 1400
951 Ga0439447_005892 3300041407 Bacteria 4027
952 Ga0439466_0005482 3300041411 Bacteria 4845
953 Ga0439466_0012874 3300041411 Bacteria 3069
954 Ga0439466_0021425 3300041411 Bacteria 2290
955 Ga0439466_0022547 3300041411 Bacteria 2221
956 Ga0439466_0040918 3300041411 Bacteria 1548
957 Ga0439466_0044835 3300041411 Bacteria 1464
958 Ga0439466_0063208 3300041411 Bacteria 1188
959 Ga0451793_0212439 3300041452 Bacteria 1879
960 Ga0451795_0009169 3300041456 Bacteria 2183
961 Ga0451798_0710666 3300041458 Bacteria 1025
962 Ga0451807_0979801 3300041486 Bacteria 1396
963 Ga0439432_015833 3300042006 Bacteria 2541
964 Ga0439432_030932 3300042006 Bacteria 1733
965 Ga0439449_0004936 3300042007 Bacteria 5136
966 Ga0439449_0041706 3300042007 Bacteria 1706
967 Ga0439451_010177 3300042009 Bacteria 1897
968 Ga0439451_014540 3300042009 Bacteria 1588
969 Ga0439452_000836 3300042010 Bacteria 14300
970 Ga0439452_002288 3300042010 Bacteria 7154
971 Ga0439452_009502 3300042010 Bacteria 2861
972 Ga0439452_033175 3300042010 Bacteria 1255
973 Ga0439456_000087 3300042013 Bacteria 31983
974 Ga0439456_000624 3300042013 Bacteria 7398
975 Ga0439456_017042 3300042013 Bacteria 1521
976 Ga0439463_002248 3300042016 Bacteria 4954
977 Ga0450911_003188 3300042115 Bacteria 2956
978 Ga0450920_033559 3300042122 Bacteria 1015
979 Ga0450906_005074 3300042145 Bacteria 2730
980 Ga0450906_010567 3300042145 Bacteria 1744
981 Ga0450907_000564 3300042146 Bacteria 10035
982 Ga0450907_010491 3300042146 Bacteria 1537
983 Ga0450907_011127 3300042146 Bacteria 1494
984 Ga0450910_002768 3300042147 Bacteria 2306
985 Ga0450908_018115 3300042184 Bacteria 1247
986 Ga0450909_004159 3300042185 Bacteria 2064
987 Ga0439460_0007129 3300042461 Bacteria 2788
988 Ga0439460_0014220 3300042461 Bacteria 2090
989 Ga0450918_001867 3300042531 Bacteria 4090
990 Ga0450918_004434 3300042531 Bacteria 2555
991 Ga0439440_0010703 3300042993 Bacteria 1922
992 Ga0466972_0009712 3300044658 Bacteria 4828
993 Ga0453683_0003423 3300044673 Bacteria 11701
994 Ga0466965_0030147 3300044683 Bacteria 2642
995 Ga0466966_0001490 3300044684 Bacteria 15014
996 Ga0466966_0007913 3300044684 Bacteria 7038
997 Ga0466966_0049842 3300044684 Bacteria 2665
998 Ga0466961_0000122 3300044693 Bacteria 52002
999 Ga0466963_0004299 3300044694 Bacteria 8266
1000 Ga0466963_0027077 3300044694 Bacteria 3668
1001 Ga0453684_0000590 3300044712 Bacteria 134718
1002 Ga0466971_0017005 3300044719 Bacteria 3215
1003 Ga0466968_0010019 3300044735 Bacteria 3661
1004 Ga0466968_0030833 3300044735 Bacteria 2223
1005 Ga0466970_0050312 3300044765 Bacteria 2222
1006 Ga0466957_0039832 3300044842 Bacteria 2836
1007 Ga0466957_0093125 3300044842 Bacteria 1891
1008 Ga0466960_0014481 3300044901 Bacteria 3377
1009 Ga0466959_0077781 3300045049 Bacteria 2393
1010 Ga0466959_0149223 3300045049 Bacteria 1649
1011 Ga0451576_0004219 3300045051 Bacteria 18885
1012 Ga0451576_0019992 3300045051 Bacteria 7299
1013 Ga0451576_0029404 3300045051 Bacteria 5881
1014 Ga0451576_0141235 3300045051 Bacteria 2511
1015 Ga0466958_0036023 3300045836 Bacteria 2959
1016 Ga0466967_0080214 3300045976 Bacteria 2944
1017 Ga0466967_0081717 3300045976 Bacteria 2919
1018 Ga0495617_010946 3300046452 Bacteria 3101
1019 Ga0495617_012205 3300046452 Bacteria 2926
1020 Ga0495617_026539 3300046452 Bacteria 1950
1021 Ga0495627_002600 3300046453 Bacteria 8516
1022 Ga0495627_009802 3300046453 Bacteria 3509
1023 Ga0495627_013398 3300046453 Bacteria 2884
1024 Ga0495627_019154 3300046453 Bacteria 2299
1025 Ga0495627_019308 3300046453 Bacteria 2287
1026 Ga0495592_0014473 3300046454 Bacteria 5987
1027 Ga0495592_0017918 3300046454 Bacteria 5382
1028 Ga0495592_0023531 3300046454 Bacteria 4685
1029 Ga0495592_0034500 3300046454 Bacteria 3814
1030 Ga0495603_0003417 3300046455 Bacteria 9451
1031 Ga0495603_0029842 3300046455 Bacteria 3286
1032 Ga0495603_0031407 3300046455 Bacteria 3197
1033 Ga0495603_0043613 3300046455 Bacteria 2677
1034 Ga0495590_0011066 3300046457 Bacteria 3381
1035 Ga0495590_0018511 3300046457 Bacteria 2493
1036 Ga0495591_005068 3300046458 Bacteria 6187
1037 Ga0495591_017468 3300046458 Bacteria 2462
1038 Ga0495591_017558 3300046458 Bacteria 2453
1039 Ga0495591_025491 3300046458 Bacteria 1854
1040 Ga0495629_0001243 3300046459 Bacteria 20022
1041 Ga0495629_0002500 3300046459 Bacteria 14110
1042 Ga0495629_0046459 3300046459 Bacteria 3045
1043 Ga0495629_0190955 3300046459 Bacteria 1418
1044 Ga0495638_0017604 3300046460 Bacteria 4759
1045 Ga0495638_0033980 3300046460 Bacteria 3258
1046 Ga0495638_0036612 3300046460 Bacteria 3125
1047 Ga0495638_0071985 3300046460 Bacteria 2113
1048 Ga0495638_0073735 3300046460 Bacteria 2082
1049 Ga0495638_0115550 3300046460 Bacteria 1590
1050 Ga0495638_0148590 3300046460 Bacteria 1361
1051 Ga0495638_0173274 3300046460 Bacteria 1236
1052 Ga0495641_0006961 3300046461 Bacteria 7194
1053 Ga0495651_0036982 3300046462 Bacteria 3801
1054 Ga0495651_0058034 3300046462 Bacteria 2970
1055 Ga0495653_0000821 3300046463 Bacteria 23881
1056 Ga0495653_0077120 3300046463 Bacteria 2475
1057 Ga0495653_0079074 3300046463 Bacteria 2436
1058 Ga0495653_0084672 3300046463 Bacteria 2335
1059 Ga0495653_0128795 3300046463 Bacteria 1794
1060 Ga0495653_0128814 3300046463 Bacteria 1794
1061 Ga0495650_0006054 3300046471 Bacteria 7641
1062 Ga0495650_0029859 3300046471 Bacteria 2478
1063 Ga0495650_0043880 3300046471 Bacteria 1893
1064 Ga0495650_0053415 3300046471 Bacteria 1654
1065 Ga0495580_0001284 3300046472 Bacteria 22130
1066 Ga0495580_0006315 3300046472 Bacteria 9680
1067 Ga0495580_0148851 3300046472 Bacteria 1622
1068 Ga0495582_0000166 3300046473 Bacteria 35616
1069 Ga0495582_0003905 3300046473 Bacteria 8370
1070 Ga0495605_0000045 3300046474 Bacteria 176155
1071 Ga0495605_0035699 3300046474 Bacteria 2511
1072 Ga0495605_0042631 3300046474 Bacteria 2254
1073 Ga0495639_0001515 3300046475 Bacteria 10358
1074 Ga0495639_0003011 3300046475 Bacteria 7338
1075 Ga0495639_0004799 3300046475 Bacteria 5814
1076 Ga0495639_0082730 3300046475 Bacteria 1497
1077 Ga0495662_0090495 3300046476 Bacteria 1492
1078 Ga0495664_0002707 3300046477 Bacteria 9527
1079 Ga0495664_0002890 3300046477 Bacteria 9261
1080 Ga0495664_0134418 3300046477 Bacteria 1498
1081 Ga0495584_0006050 3300046491 Bacteria 6373
1082 Ga0495584_0006946 3300046491 Bacteria 5913
1083 Ga0495584_0014142 3300046491 Bacteria 4067
1084 Ga0495584_0023996 3300046491 Bacteria 3091
1085 Ga0495584_0037158 3300046491 Bacteria 2460
1086 Ga0495584_0037455 3300046491 Bacteria 2451
1087 Ga0495584_0041671 3300046491 Bacteria 2317
1088 Ga0495584_0056978 3300046491 Bacteria 1966
1089 Ga0495585_0028915 3300046492 Bacteria 3158
1090 Ga0495585_0037233 3300046492 Bacteria 2740
1091 Ga0495585_0069557 3300046492 Bacteria 1921
1092 Ga0495594_0004296 3300046499 Bacteria 7321
1093 Ga0495594_0043177 3300046499 Bacteria 2470
1094 Ga0495594_0086106 3300046499 Bacteria 1758
1095 Ga0495596_0003925 3300046500 Bacteria 7371
1096 Ga0495596_0052050 3300046500 Bacteria 1603
1097 Ga0495607_0007008 3300046501 Bacteria 7844
1098 Ga0495607_0018591 3300046501 Bacteria 4428
1099 Ga0495607_0038180 3300046501 Bacteria 2879
1100 Ga0495607_0078457 3300046501 Bacteria 1822
1101 Ga0495607_0142386 3300046501 Bacteria 1235
1102 Ga0495583_0002109 3300046506 Bacteria 17877
1103 Ga0495583_0002827 3300046506 Bacteria 14170
1104 Ga0495583_0009758 3300046506 Bacteria 5698
1105 Ga0495583_0035369 3300046506 Bacteria 2384
1106 Ga0495583_0037575 3300046506 Bacteria 2294
1107 Ga0495583_0038926 3300046506 Bacteria 2243
1108 Ga0495606_0000297 3300046507 Bacteria 85779
1109 Ga0495606_0001165 3300046507 Bacteria 37175
1110 Ga0495606_0001557 3300046507 Bacteria 30137
1111 Ga0495606_0002202 3300046507 Bacteria 23347
1112 Ga0495606_0004299 3300046507 Bacteria 14339
1113 Ga0495606_0011916 3300046507 Bacteria 7033
1114 Ga0495606_0012904 3300046507 Bacteria 6649
1115 Ga0495606_0049659 3300046507 Bacteria 2749
1116 Ga0495606_0058668 3300046507 Bacteria 2472
1117 Ga0495606_0060956 3300046507 Bacteria 2414
1118 Ga0495606_0078390 3300046507 Bacteria 2060
1119 Ga0495606_0080355 3300046507 Bacteria 2029
1120 Ga0495606_0098874 3300046507 Bacteria 1779
1121 Ga0495608_0002366 3300046511 Bacteria 13571
1122 Ga0495608_0170921 3300046511 Bacteria 1378
1123 Ga0495610_0017381 3300046512 Bacteria 4103
1124 Ga0495610_0018339 3300046512 Bacteria 3958
1125 Ga0495610_0037307 3300046512 Bacteria 2475
1126 Ga0495610_0043864 3300046512 Bacteria 2224
1127 Ga0495610_0048765 3300046512 Bacteria 2077
1128 Ga0495610_0075000 3300046512 Bacteria 1567
1129 Ga0495616_0016127 3300046513 Bacteria 4140
1130 Ga0495616_0033659 3300046513 Bacteria 2667
1131 Ga0495616_0038723 3300046513 Bacteria 2446
1132 Ga0495616_0041034 3300046513 Bacteria 2362
1133 Ga0495616_0042438 3300046513 Bacteria 2315
1134 Ga0495616_0051275 3300046513 Bacteria 2059
1135 Ga0495620_0000001 3300046515 Bacteria 386508
1136 Ga0495620_0009249 3300046515 Bacteria 5247
1137 Ga0495620_0023343 3300046515 Bacteria 2959
1138 Ga0495620_0062506 3300046515 Bacteria 1546
1139 Ga0495620_0076795 3300046515 Bacteria 1357
1140 Ga0495628_0020530 3300046516 Bacteria 5446
1141 Ga0495628_0033373 3300046516 Bacteria 4149
1142 Ga0495628_0083981 3300046516 Bacteria 2471
1143 Ga0495630_0006088 3300046517 Bacteria 8550
1144 Ga0495630_0017695 3300046517 Bacteria 5225
1145 Ga0495630_0167346 3300046517 Bacteria 1674
1146 Ga0495630_0321663 3300046517 Bacteria 1183
1147 Ga0495631_0019634 3300046518 Bacteria 3167
1148 Ga0495631_0026377 3300046518 Bacteria 2669
1149 Ga0495632_0002643 3300046519 Bacteria 13474
1150 Ga0495632_0005088 3300046519 Bacteria 8796
1151 Ga0495632_0020004 3300046519 Bacteria 3635
1152 Ga0495632_0021622 3300046519 Bacteria 3463
1153 Ga0495632_0047465 3300046519 Bacteria 2129
1154 Ga0495632_0068709 3300046519 Bacteria 1706
1155 Ga0495637_0001790 3300046520 Bacteria 12300
1156 Ga0495637_0014025 3300046520 Bacteria 3791
1157 Ga0495637_0015776 3300046520 Bacteria 3540
1158 Ga0495637_0018058 3300046520 Bacteria 3275
1159 Ga0495637_0026474 3300046520 Bacteria 2602
1160 Ga0495637_0056900 3300046520 Bacteria 1617
1161 Ga0495637_0069799 3300046520 Bacteria 1420
1162 Ga0495643_0003239 3300046522 Bacteria 12058
1163 Ga0495643_0018119 3300046522 Bacteria 4100
1164 Ga0495643_0027832 3300046522 Bacteria 3172
1165 Ga0495643_0115583 3300046522 Bacteria 1360
1166 Ga0495644_0016310 3300046523 Bacteria 2843
1167 Ga0495644_0020430 3300046523 Bacteria 2527
1168 Ga0495644_0022569 3300046523 Bacteria 2398
1169 Ga0495644_0159890 3300046523 Bacteria 863
1170 Ga0495648_0000832 3300046524 Bacteria 32621
1171 Ga0495648_0001607 3300046524 Bacteria 21994
1172 Ga0495648_0001740 3300046524 Bacteria 21030
1173 Ga0495648_0005382 3300046524 Bacteria 10643
1174 Ga0495648_0010306 3300046524 Bacteria 7130
1175 Ga0495648_0018275 3300046524 Bacteria 4972
1176 Ga0495648_0039513 3300046524 Bacteria 3002
1177 Ga0495648_0049120 3300046524 Bacteria 2589
1178 Ga0495648_0055774 3300046524 Bacteria 2380
1179 Ga0495648_0096164 3300046524 Bacteria 1646
1180 Ga0495648_0147540 3300046524 Bacteria 1230
1181 Ga0495666_0044498 3300046526 Bacteria 2143
1182 Ga0495642_0001494 3300046528 Bacteria 10440
1183 Ga0495642_0002271 3300046528 Bacteria 7848
1184 Ga0495642_0003355 3300046528 Bacteria 6328
1185 Ga0495652_0026794 3300046529 Bacteria 5086
1186 Ga0495652_0032433 3300046529 Bacteria 4568
1187 Ga0495652_0088960 3300046529 Bacteria 2529
1188 Ga0495652_0113108 3300046529 Bacteria 2179
1189 Ga0495654_0000207 3300046530 Bacteria 55932
1190 Ga0495654_0000407 3300046530 Bacteria 36796
1191 Ga0495654_0005186 3300046530 Bacteria 7599
1192 Ga0495654_0028531 3300046530 Bacteria 2853
1193 Ga0495654_0035572 3300046530 Bacteria 2506
1194 Ga0495654_0083190 3300046530 Bacteria 1496
1195 Ga0495654_0098157 3300046530 Bacteria 1351
1196 Ga0495665_0000104 3300046531 Bacteria 39624
1197 Ga0495640_0004822 3300046533 Bacteria 10741
1198 Ga0495640_0009631 3300046533 Bacteria 7514
1199 Ga0495640_0018706 3300046533 Bacteria 5128
1200 Ga0495640_0039260 3300046533 Bacteria 3323
1201 Ga0495586_0022737 3300046535 Bacteria 3346
1202 Ga0495587_0066179 3300046536 Bacteria 2108
1203 Ga0495587_0092871 3300046536 Bacteria 1742
1204 Ga0495609_0000012 3300046538 Bacteria 333994
1205 Ga0495609_0003344 3300046538 Bacteria 9246
1206 Ga0495609_0003527 3300046538 Bacteria 8914
1207 Ga0495609_0008316 3300046538 Bacteria 5086
1208 Ga0495597_0016953 3300046542 Bacteria 3435
1209 Ga0495597_0017788 3300046542 Bacteria 3340
1210 Ga0495597_0040151 3300046542 Bacteria 2092
1211 Ga0495597_0067733 3300046542 Bacteria 1543
1212 Ga0495597_0097453 3300046542 Bacteria 1242
1213 Ga0495645_0003878 3300046543 Bacteria 10187
1214 Ga0495645_0007622 3300046543 Bacteria 7533
1215 Ga0495645_0024803 3300046543 Bacteria 4350
1216 Ga0495645_0049530 3300046543 Bacteria 3059
1217 Ga0495622_0005470 3300046557 Bacteria 5890
1218 Ga0495622_0016696 3300046557 Bacteria 3418
1219 Ga0495622_0031473 3300046557 Bacteria 2478
1220 Ga0495622_0035224 3300046557 Bacteria 2335
1221 Ga0495622_0076376 3300046557 Bacteria 1543
1222 Ga0495622_0123527 3300046557 Bacteria 1181
1223 Ga0495633_0000034 3300046558 Bacteria 185552
1224 Ga0495633_0004906 3300046558 Bacteria 8354
1225 Ga0495633_0017329 3300046558 Bacteria 3686
1226 Ga0495667_0032161 3300046559 Bacteria 3518
1227 Ga0495667_0297173 3300046559 Bacteria 1023
1228 Ga0495656_0002963 3300046615 Bacteria 5698
1229 Ga0495656_0054834 3300046615 Bacteria 1716
1230 Ga0495668_0022598 3300046616 Bacteria 3594
1231 Ga0495668_0179737 3300046616 Bacteria 1159
1232 Ga0495634_0017597 3300046642 Bacteria 5097
1233 Ga0495634_0032726 3300046642 Bacteria 3574
1234 Ga0495634_0039721 3300046642 Bacteria 3203
1235 Ga0495634_0041737 3300046642 Bacteria 3115
1236 Ga0495611_0000087 3300046648 Bacteria 66051
1237 Ga0495611_0019217 3300046648 Bacteria 2934
1238 Ga0495611_0060183 3300046648 Bacteria 1725
1239 Ga0495625_0000637 3300046660 Bacteria 50416
1240 Ga0495625_0012781 3300046660 Bacteria 6789
1241 Ga0495625_0013758 3300046660 Bacteria 6487
1242 Ga0495625_0014739 3300046660 Bacteria 6223
1243 Ga0495625_0049192 3300046660 Bacteria 3031
1244 Ga0495625_0056382 3300046660 Bacteria 2797
1245 Ga0495625_0059637 3300046660 Bacteria 2706
1246 Ga0495625_0063090 3300046660 Bacteria 2617
1247 Ga0495625_0183625 3300046660 Bacteria 1389
1248 Ga0495625_0207763 3300046660 Bacteria 1288
1249 Ga0495635_0000965 3300046663 Bacteria 18965
1250 Ga0495635_0022910 3300046663 Bacteria 4353
1251 Ga0495635_0043323 3300046663 Bacteria 3106
1252 Ga0495659_0033826 3300046664 Bacteria 1795
1253 Ga0495661_0000004 3300046665 Bacteria 555340
1254 Ga0495661_0000028 3300046665 Bacteria 182191
1255 Ga0495661_0029104 3300046665 Bacteria 3528
1256 Ga0495661_0033680 3300046665 Bacteria 3229
1257 Ga0495661_0035431 3300046665 Bacteria 3131
1258 Ga0495661_0078549 3300046665 Bacteria 1909
1259 Ga0495661_0135855 3300046665 Bacteria 1342
1260 Ga0495588_0013704 3300046674 Bacteria 3866
1261 Ga0495657_0003762 3300046675 Bacteria 12281
1262 Ga0495657_0009942 3300046675 Bacteria 7179
1263 Ga0495657_0033182 3300046675 Bacteria 3596
1264 Ga0495657_0056668 3300046675 Bacteria 2608
1265 Ga0495599_0000673 3300046678 Bacteria 19348
1266 Ga0495599_0054348 3300046678 Bacteria 2509
1267 Ga0495646_0001365 3300046680 Bacteria 14447
1268 Ga0495646_0011555 3300046680 Bacteria 5607
1269 Ga0495646_0030382 3300046680 Bacteria 3374
1270 Ga0495646_0060500 3300046680 Bacteria 2258
1271 Ga0495647_0034877 3300046681 Bacteria 1887
1272 Ga0495658_0005346 3300046683 Bacteria 6313
1273 Ga0495658_0044779 3300046683 Bacteria 2480
1274 Ga0495658_0072881 3300046683 Bacteria 1998
1275 Ga0495669_0005702 3300046684 Bacteria 5193
1276 Ga0495613_0012606 3300046689 Bacteria 6286
1277 Ga0495613_0089766 3300046689 Bacteria 2226
1278 Ga0495613_0156210 3300046689 Bacteria 1625
1279 Ga0495624_0003391 3300046690 Bacteria 11822
1280 Ga0495624_0004989 3300046690 Bacteria 9615
1281 Ga0495624_0039559 3300046690 Bacteria 3022
1282 Ga0495624_0052583 3300046690 Bacteria 2573
1283 Ga0495670_0006645 3300046691 Bacteria 5687
1284 Ga0495670_0010648 3300046691 Bacteria 4519
1285 Ga0495670_0023440 3300046691 Bacteria 3046
1286 Ga0495670_0034406 3300046691 Bacteria 2523
1287 Ga0495670_0038914 3300046691 Bacteria 2371
1288 Ga0495671_0001003 3300046692 Bacteria 19655
1289 Ga0495671_0005757 3300046692 Bacteria 7226
1290 Ga0495671_0005823 3300046692 Bacteria 7178
1291 Ga0495671_0006451 3300046692 Bacteria 6774
1292 Ga0495671_0012528 3300046692 Bacteria 4627
1293 Ga0495671_0027502 3300046692 Bacteria 2937
1294 Ga0495671_0030431 3300046692 Bacteria 2764
1295 Ga0495671_0038771 3300046692 Bacteria 2407
1296 Ga0495671_0046929 3300046692 Bacteria 2159
1297 Ga0495671_0070167 3300046692 Bacteria 1721
1298 Ga0495649_0004978 3300046694 Bacteria 8550
1299 Ga0495649_0013633 3300046694 Bacteria 4684
1300 Ga0495649_0017670 3300046694 Bacteria 4022
1301 Ga0495649_0031447 3300046694 Bacteria 2926
1302 Ga0495649_0058833 3300046694 Bacteria 2070
1303 Ga0495649_0074345 3300046694 Bacteria 1820
1304 Ga0495649_0077622 3300046694 Bacteria 1777
1305 Ga0495649_0089796 3300046694 Bacteria 1638
1306 Ga0495649_0099289 3300046694 Bacteria 1548
1307 Ga0495589_0004519 3300046794 Bacteria 7392
1308 Ga0495589_0009874 3300046794 Bacteria 4957
1309 Ga0495589_0025524 3300046794 Bacteria 2998
1310 Ga0495600_0002097 3300046809 Bacteria 11264
1311 Ga0495600_0017523 3300046809 Bacteria 4557
1312 Ga0495600_0118175 3300046809 Bacteria 1725
1313 Ga0495660_0004735 3300046810 Bacteria 8214
1314 Ga0495660_0005085 3300046810 Bacteria 7901
1315 Ga0495660_0008278 3300046810 Bacteria 6091
1316 Ga0495660_0048407 3300046810 Bacteria 2324
1317 Ga0495660_0067759 3300046810 Bacteria 1900
1318 Ga0495660_0085531 3300046810 Bacteria 1647
1319 Ga0495581_0000391 3300047315 Bacteria 22000
1320 Ga0495581_0066443 3300047315 Bacteria 2085
1321 Ga0495604_0016096 3300047317 Bacteria 5973
1322 Ga0495604_0021599 3300047317 Bacteria 5139
1323 Ga0495636_0006933 3300047318 Bacteria 4455
1324 Ga0495674_0001108 3300047319 Bacteria 25886
1325 Ga0495674_0012073 3300047319 Bacteria 8141
1326 Ga0495674_0033082 3300047319 Bacteria 4686
1327 Ga0495674_0137732 3300047319 Bacteria 2053
1328 Ga0495674_0274794 3300047319 Bacteria 1381
1329 Ga0495672_0007313 3300047320 Bacteria 8329
1330 Ga0495672_0034531 3300047320 Bacteria 3123
1331 Ga0495672_0047729 3300047320 Bacteria 2544
1332 Ga0495672_0050453 3300047320 Bacteria 2455
1333 Ga0495672_0052406 3300047320 Bacteria 2397
1334 Ga0495672_0058151 3300047320 Bacteria 2242
1335 Ga0495676_0021883 3300047321 Bacteria 5573
1336 Ga0495676_0088536 3300047321 Bacteria 2321
1337 Ga0495676_0105399 3300047321 Bacteria 2079
1338 Ga0495676_0238373 3300047321 Bacteria 1246
1339 Ga0495680_0006581 3300047322 Bacteria 10780
1340 Ga0495680_0052297 3300047322 Bacteria 3184
1341 Ga0495683_0000059 3300047323 Bacteria 116530
1342 Ga0495683_0000445 3300047323 Bacteria 32636
1343 Ga0495683_0004382 3300047323 Bacteria 8028
1344 Ga0495683_0013480 3300047323 Bacteria 4274
1345 Ga0495683_0060049 3300047323 Bacteria 1885
1346 Ga0495687_000664 3300047443 Bacteria 39326
1347 Ga0495687_019958 3300047443 Bacteria 3275
1348 Ga0495687_022811 3300047443 Bacteria 2999
1349 Ga0495687_034916 3300047443 Bacteria 2266
1350 Ga0495687_043519 3300047443 Bacteria 1955
1351 Ga0495687_052157 3300047443 Bacteria 1731
1352 Ga0495675_0001627 3300047444 Bacteria 13504
1353 Ga0495675_0031987 3300047444 Bacteria 3359
1354 Ga0495675_0049885 3300047444 Bacteria 2659
1355 Ga0495679_004065 3300047446 Bacteria 6855
1356 Ga0495679_031872 3300047446 Bacteria 1696
1357 Ga0495685_024708 3300047447 Bacteria 2068
1358 Ga0495673_0003388 3300047469 Bacteria 10528
1359 Ga0495673_0006116 3300047469 Bacteria 7146
1360 Ga0495673_0006812 3300047469 Bacteria 6671
1361 Ga0495673_0019115 3300047469 Bacteria 3439
1362 Ga0495673_0024606 3300047469 Bacteria 2905
1363 Ga0495673_0029142 3300047469 Bacteria 2608
1364 Ga0495673_0032426 3300047469 Bacteria 2436
1365 Ga0495673_0049795 3300047469 Bacteria 1842
1366 Ga0495673_0061554 3300047469 Bacteria 1606
1367 Ga0495681_0015785 3300047470 Bacteria 4263
1368 Ga0495681_0022519 3300047470 Bacteria 3368
1369 Ga0495681_0032114 3300047470 Bacteria 2646
1370 Ga0495681_0038614 3300047470 Bacteria 2338
1371 Ga0495681_0055559 3300047470 Bacteria 1845
1372 Ga0495684_0001891 3300047471 Bacteria 16776
1373 Ga0495684_0006492 3300047471 Bacteria 9076
1374 Ga0495684_0020313 3300047471 Bacteria 5117
1375 Ga0495686_0016837 3300047472 Bacteria 4943
1376 Ga0495686_0030481 3300047472 Bacteria 3503
1377 Ga0495686_0037920 3300047472 Bacteria 3085
1378 Ga0495686_0062452 3300047472 Bacteria 2310
1379 Ga0495686_0096606 3300047472 Bacteria 1788
1380 Ga0495686_0131884 3300047472 Bacteria 1481
1381 Ga0495593_0000180 3300047673 Bacteria 32786
1382 Ga0495602_0029325 3300048088 Bacteria 5242
1383 Ga0495602_0061892 3300048088 Bacteria 3250
1384 Ga0495602_0112382 3300048088 Bacteria 2210
1385 Ga0495602_0266693 3300048088 Bacteria 1267
1386 Ga0495614_0009204 3300048089 Bacteria 4375
1387 Ga0495626_0001466 3300048091 Bacteria 18636
1388 Ga0495626_0003622 3300048091 Bacteria 9826
1389 Ga0495626_0003788 3300048091 Bacteria 9512
1390 Ga0495626_0017420 3300048091 Bacteria 3627
1391 Ga0495626_0036982 3300048091 Bacteria 2322
1392 Ga0495626_0047188 3300048091 Bacteria 2003
1393 Ga0495626_0053732 3300048091 Bacteria 1852
1394 Ga0495626_0083251 3300048091 Bacteria 1417
1395 Ga0496100_0343340 3300048903 Bacteria 1126
1396 Ga0496101_0054418 3300048904 Bacteria 2889
1397 Ga0496102_0001878 3300048905 Bacteria 18100
1398 Ga0496102_0027736 3300048905 Bacteria 5057
1399 Ga0496102_0035155 3300048905 Bacteria 4508
1400 Ga0496102_0149984 3300048905 Bacteria 2190
1401 Ga0496102_0268468 3300048905 Bacteria 1608
1402 Ga0496103_0004910 3300048906 Bacteria 8073
1403 Ga0496104_0152143 3300048907 Bacteria 2220
1404 Ga0496104_0157091 3300048907 Bacteria 2182
1405 Ga0496104_0173710 3300048907 Bacteria 2065
1406 Ga0496104_0274899 3300048907 Bacteria 1597
1407 Ga0496104_0408223 3300048907 Bacteria 1270
1408 Ga0496104_0505852 3300048907 Bacteria 1119
1409 Ga0496105_0008027 3300048908 Bacteria 8200
1410 Ga0496105_0068092 3300048908 Bacteria 2940
1411 Ga0496105_0068327 3300048908 Bacteria 2935
1412 Ga0496105_0090420 3300048908 Bacteria 2528
1413 Ga0496105_0313031 3300048908 Bacteria 1260
1414 Ga0496106_0000201 3300048909 Bacteria 41935
1415 Ga0496106_0013233 3300048909 Bacteria 6090
1416 Ga0496107_0043614 3300048910 Bacteria 3223
1417 Ga0496107_0133265 3300048910 Bacteria 1835
1418 Ga0496108_0030667 3300048911 Bacteria 4456
1419 Ga0496108_0074813 3300048911 Bacteria 2860
1420 Ga0496108_0106391 3300048911 Bacteria 2395
1421 Ga0496108_0210665 3300048911 Bacteria 1687
1422 Ga0496108_0288637 3300048911 Bacteria 1428
1423 Ga0496109_0024725 3300048912 Bacteria 5343
1424 Ga0496109_0036488 3300048912 Bacteria 4437
1425 Ga0496109_0252270 3300048912 Bacteria 1662
1426 Ga0496109_0291169 3300048912 Bacteria 1539
1427 Ga0496110_0035946 3300048913 Bacteria 4301
1428 Ga0496110_0088041 3300048913 Bacteria 2773
1429 Ga0496111_0024140 3300048914 Bacteria 4278
1430 Ga0496111_0038246 3300048914 Bacteria 3437
1431 Ga0496111_0045011 3300048914 Bacteria 3174
1432 Ga0496111_0104793 3300048914 Bacteria 2080
1433 Ga0496112_0000092 3300048915 Bacteria 58800
1434 Ga0496112_0022945 3300048915 Bacteria 5955
1435 Ga0496112_0179532 3300048915 Bacteria 2081
1436 Ga0496112_0181055 3300048915 Bacteria 2071
1437 Ga0496112_0566202 3300048915 Bacteria 1069
1438 Ga0496113_0049855 3300048916 Bacteria 3119
1439 Ga0496113_0274579 3300048916 Bacteria 1347
1440 Ga0496114_0013948 3300048917 Bacteria 6444
1441 Ga0496114_0041941 3300048917 Bacteria 3792
1442 Ga0496114_0156892 3300048917 Bacteria 1976
1443 Ga0496114_0162639 3300048917 Bacteria 1942
1444 Ga0496115_0002825 3300048918 Bacteria 12488
1445 Ga0496115_0022795 3300048918 Bacteria 4855
1446 Ga0496116_0000061 3300048919 Bacteria 271860
1447 Ga0496116_0002679 3300048919 Bacteria 18404
1448 Ga0496116_0004501 3300048919 Bacteria 13269
1449 Ga0496116_0004648 3300048919 Bacteria 13000
1450 Ga0496116_0005694 3300048919 Bacteria 11461
1451 Ga0496116_0032753 3300048919 Bacteria 3699
1452 Ga0496116_0036352 3300048919 Bacteria 3448
1453 Ga0496116_0072541 3300048919 Bacteria 2175
1454 Ga0496116_0089587 3300048919 Bacteria 1876
1455 Ga0496117_0000001 3300048920 Bacteria 2526244
1456 Ga0496117_0005527 3300048920 Bacteria 13235
1457 Ga0496117_0044016 3300048920 Bacteria 3237
1458 Ga0496117_0083816 3300048920 Bacteria 2082
1459 Ga0496117_0108516 3300048920 Bacteria 1736
1460 Ga0496117_0112417 3300048920 Bacteria 1693
1461 Ga0496117_0166454 3300048920 Bacteria 1285
1462 Ga0496118_0000002 3300048921 Bacteria 1690764
1463 Ga0496118_0009532 3300048921 Bacteria 9782
1464 Ga0496118_0056794 3300048921 Bacteria 2939
1465 Ga0496118_0057074 3300048921 Bacteria 2930
1466 Ga0496118_0061408 3300048921 Bacteria 2783
1467 Ga0496118_0095589 3300048921 Bacteria 2027
1468 Ga0496118_0143524 3300048921 Bacteria 1508
1469 Ga0496119_0000721 3300048922 Bacteria 44515
1470 Ga0496119_0001636 3300048922 Bacteria 26397
1471 Ga0496119_0033824 3300048922 Bacteria 3381
1472 Ga0496119_0190741 3300048922 Bacteria 1068
1473 Ga0496119_0204069 3300048922 Bacteria 1021
1474 Ga0496120_0090088 3300048923 Bacteria 1641
1475 Ga0496121_0000099 3300048924 Bacteria 200160
1476 Ga0496121_0000684 3300048924 Bacteria 63147
1477 Ga0496121_0002376 3300048924 Bacteria 28938
1478 Ga0496121_0002933 3300048924 Bacteria 24956
1479 Ga0496121_0006287 3300048924 Bacteria 14847
1480 Ga0496121_0012784 3300048924 Bacteria 9091
1481 Ga0496121_0023966 3300048924 Bacteria 5852
1482 Ga0496121_0028225 3300048924 Bacteria 5229
1483 Ga0496121_0032833 3300048924 Bacteria 4709
1484 Ga0496121_0053578 3300048924 Bacteria 3378
1485 Ga0496121_0063399 3300048924 Bacteria 3020
1486 Ga0496121_0067626 3300048924 Bacteria 2894
1487 Ga0496121_0087453 3300048924 Bacteria 2446
1488 Ga0496121_0120511 3300048924 Bacteria 1982
1489 Ga0496121_0168484 3300048924 Bacteria 1594
1490 Ga0496121_0197206 3300048924 Bacteria 1438
1491 Ga0496121_0231043 3300048924 Bacteria 1295
1492 Ga0496122_0001180 3300048925 Bacteria 44683
1493 Ga0496122_0005417 3300048925 Bacteria 15218
1494 Ga0496122_0055712 3300048925 Bacteria 2954
1495 Ga0496122_0057615 3300048925 Bacteria 2883
1496 Ga0496122_0086385 3300048925 Bacteria 2159
1497 Ga0496122_0093078 3300048925 Bacteria 2046
1498 Ga0496122_0099831 3300048925 Bacteria 1944
1499 Ga0496122_0101137 3300048925 Bacteria 1927
1500 Ga0496123_0000519 3300048926 Bacteria 66923
1501 Ga0496123_0002949 3300048926 Bacteria 19872
1502 Ga0496123_0010850 3300048926 Bacteria 7984
1503 Ga0496123_0018674 3300048926 Bacteria 5498
1504 Ga0496123_0046294 3300048926 Bacteria 2951
1505 Ga0496123_0051185 3300048926 Bacteria 2752
1506 Ga0496123_0060534 3300048926 Bacteria 2440
1507 Ga0496123_0093223 3300048926 Bacteria 1779
1508 Ga0496123_0108089 3300048926 Bacteria 1598
1509 Ga0496124_0000788 3300048927 Bacteria 51794
1510 Ga0496124_0026389 3300048927 Bacteria 5239
1511 Ga0496124_0047109 3300048927 Bacteria 3689
1512 Ga0496124_0055451 3300048927 Bacteria 3349
1513 Ga0496124_0058194 3300048927 Bacteria 3252
1514 Ga0496124_0059142 3300048927 Bacteria 3220
1515 Ga0496124_0081171 3300048927 Bacteria 2666
1516 Ga0496124_0406155 3300048927 Bacteria 944
1517 Ga0496125_0000715 3300048928 Bacteria 54933
1518 Ga0496125_0000790 3300048928 Bacteria 51640
1519 Ga0496125_0003799 3300048928 Bacteria 17957
1520 Ga0496125_0013289 3300048928 Bacteria 8100
1521 Ga0496125_0014724 3300048928 Bacteria 7601
1522 Ga0496125_0023769 3300048928 Bacteria 5650
1523 Ga0496125_0040985 3300048928 Bacteria 3964
1524 Ga0496125_0045842 3300048928 Bacteria 3674
1525 Ga0496125_0056254 3300048928 Bacteria 3196
1526 Ga0496125_0086597 3300048928 Bacteria 2369
1527 Ga0496125_0118562 3300048928 Bacteria 1895
1528 Ga0496125_0140249 3300048928 Bacteria 1682
1529 Ga0496125_0154525 3300048928 Bacteria 1570
1530 Ga0496125_0207685 3300048928 Bacteria 1275
1531 Ga0496126_0000397 3300048929 Bacteria 89305
1532 Ga0496126_0000466 3300048929 Bacteria 80395
1533 Ga0496126_0006480 3300048929 Bacteria 13035
1534 Ga0496126_0009052 3300048929 Bacteria 10644
1535 Ga0496126_0014179 3300048929 Bacteria 8067
1536 Ga0496126_0016190 3300048929 Bacteria 7468
1537 Ga0496126_0017014 3300048929 Bacteria 7255
1538 Ga0496126_0037699 3300048929 Bacteria 4507
1539 Ga0496126_0041380 3300048929 Bacteria 4265
1540 Ga0496126_0048610 3300048929 Bacteria 3875
1541 Ga0496126_0062027 3300048929 Bacteria 3355
1542 Ga0496126_0065008 3300048929 Bacteria 3265
1543 Ga0496126_0081582 3300048929 Bacteria 2859
1544 Ga0496126_0091239 3300048929 Bacteria 2679
1545 Ga0496126_0104723 3300048929 Bacteria 2471
1546 Ga0496126_0112527 3300048929 Bacteria 2370
1547 Ga0496126_0121887 3300048929 Bacteria 2260
1548 Ga0496126_0138887 3300048929 Bacteria 2093
1549 Ga0496126_0188274 3300048929 Bacteria 1749
1550 Ga0496126_0197132 3300048929 Bacteria 1702
1551 Ga0496126_0218447 3300048929 Bacteria 1602
1552 Ga0496126_0270528 3300048929 Bacteria 1410
1553 Ga0496126_0333399 3300048929 Bacteria 1244
1554 Ga0496126_0421289 3300048929 Bacteria 1079
1555 Ga0495678_000036 3300049459 Bacteria 198018
1556 Ga0495678_006946 3300049459 Bacteria 5940
1557 Ga0495678_008167 3300049459 Bacteria 5320
1558 Ga0495678_025219 3300049459 Bacteria 2556
1559 Ga0495678_026220 3300049459 Bacteria 2491
1560 Ga0495678_059471 3300049459 Bacteria 1440
1561 Ga0495682_0010828 3300049460 Bacteria 3516
1562 Ga0495682_0020359 3300049460 Bacteria 2490
1563 Ga0495682_0059803 3300049460 Bacteria 1376
1564 Ga0501296_005724 3300049519 Bacteria 1394
1565 Ga0501300_000849 3300049523 Bacteria 4654
1566 Ga0501031_0006330 3300049568 Bacteria 7718
1567 Ga0501031_0029630 3300049568 Bacteria 3570
1568 Ga0501031_0051048 3300049568 Bacteria 2694
1569 Ga0501032_0000088 3300049569 Bacteria 79913
1570 Ga0501032_0004273 3300049569 Bacteria 10788
1571 Ga0501032_0023586 3300049569 Bacteria 4247
1572 Ga0501032_0029214 3300049569 Bacteria 3786
1573 Ga0501032_0048350 3300049569 Bacteria 2872
1574 Ga0501032_0049366 3300049569 Bacteria 2838
1575 Ga0501033_0000724 3300049570 Bacteria 30292
1576 Ga0501033_0004494 3300049570 Bacteria 11160
1577 Ga0501033_0004740 3300049570 Bacteria 10881
1578 Ga0501033_0038006 3300049570 Bacteria 3601
1579 Ga0501033_0060004 3300049570 Bacteria 2807
1580 Ga0501033_0090768 3300049570 Bacteria 2235
1581 Ga0501033_0091683 3300049570 Bacteria 2223
1582 Ga0501033_0259434 3300049570 Bacteria 1230
1583 Ga0501033_0265378 3300049570 Bacteria 1214
1584 Ga0501034_0000332 3300049571 Bacteria 82900
1585 Ga0501034_0000413 3300049571 Bacteria 71861
1586 Ga0501034_0046250 3300049571 Bacteria 4398
1587 Ga0501034_0087844 3300049571 Bacteria 3108
1588 Ga0501034_0133323 3300049571 Bacteria 2466
1589 Ga0501034_0140445 3300049571 Bacteria 2395
1590 Ga0501034_0163752 3300049571 Bacteria 2193
1591 Ga0501034_0184492 3300049571 Bacteria 2050
1592 Ga0501034_0291310 3300049571 Bacteria 1570
1593 Ga0501034_0294452 3300049571 Bacteria 1560
1594 Ga0501034_0409243 3300049571 Bacteria 1278
1595 Ga0501036_0000233 3300049572 Bacteria 37220
1596 Ga0501036_0019618 3300049572 Bacteria 5676
1597 Ga0501036_0056239 3300049572 Bacteria 3333
1598 Ga0501037_0000242 3300049573 Bacteria 46822
1599 Ga0501037_0000421 3300049573 Bacteria 35090
1600 Ga0501037_0001825 3300049573 Bacteria 15467
1601 Ga0501037_0144712 3300049573 Bacteria 1700
1602 Ga0501037_0180980 3300049573 Bacteria 1495
1603 Ga0501038_0000049 3300049574 Bacteria 100279
1604 Ga0501038_0006856 3300049574 Bacteria 10523
1605 Ga0501038_0097772 3300049574 Bacteria 2448
1606 Ga0501038_0152963 3300049574 Bacteria 1880
1607 Ga0501039_0002402 3300049575 Bacteria 13924
1608 Ga0501039_0142671 3300049575 Bacteria 1881
1609 Ga0501043_0000101 3300049579 Bacteria 78983
1610 Ga0501043_0000440 3300049579 Bacteria 37461
1611 Ga0501043_0000740 3300049579 Bacteria 28916
1612 Ga0501043_0013981 3300049579 Bacteria 6281
1613 Ga0501043_0044868 3300049579 Bacteria 3476
1614 Ga0501043_0115632 3300049579 Bacteria 2105
1615 Ga0501043_0186067 3300049579 Bacteria 1617
1616 Ga0501043_0227759 3300049579 Bacteria 1440
1617 Ga0501046_0000135 3300049580 Bacteria 79084
1618 Ga0501046_0006266 3300049580 Bacteria 10552
1619 Ga0501046_0008083 3300049580 Bacteria 9194
1620 Ga0501046_0022355 3300049580 Bacteria 5209
1621 Ga0501047_0000173 3300049581 Bacteria 79071
1622 Ga0501047_0000875 3300049581 Bacteria 30740
1623 Ga0501047_0005968 3300049581 Bacteria 11448
1624 Ga0501047_0009133 3300049581 Bacteria 9361
1625 Ga0501047_0031398 3300049581 Bacteria 5123
1626 Ga0501047_0160289 3300049581 Bacteria 2121
1627 Ga0501047_0431125 3300049581 Bacteria 1149
1628 Ga0501047_0491545 3300049581 Bacteria 1054
1629 Ga0501048_0005053 3300049582 Bacteria 10056
1630 Ga0501048_0020879 3300049582 Bacteria 4797
1631 Ga0501048_0208119 3300049582 Bacteria 1387
1632 Ga0501068_0029721 3300049584 Bacteria 3238
1633 Ga0501069_0000017 3300049585 Bacteria 141492
1634 Ga0501069_0021804 3300049585 Bacteria 3479
1635 Ga0501069_0086231 3300049585 Bacteria 1772
1636 Ga0501070_0007767 3300049586 Bacteria 9093
1637 Ga0501070_0010286 3300049586 Bacteria 7911
1638 Ga0501070_0025357 3300049586 Bacteria 4973
1639 Ga0501070_0027733 3300049586 Bacteria 4751
1640 Ga0501070_0040998 3300049586 Bacteria 3857
1641 Ga0501070_0127996 3300049586 Bacteria 2098
1642 Ga0501070_0235240 3300049586 Bacteria 1500
1643 Ga0501071_0031427 3300049587 Bacteria 3763
1644 Ga0501072_0054390 3300049588 Bacteria 3153
1645 Ga0501072_0197180 3300049588 Bacteria 1605
1646 Ga0501073_0000112 3300049589 Bacteria 52280
1647 Ga0501073_0117617 3300049589 Bacteria 1842
1648 Ga0501074_0000610 3300049590 Bacteria 22218
1649 Ga0501074_0006273 3300049590 Bacteria 8584
1650 Ga0501074_0120179 3300049590 Bacteria 1879
1651 Ga0501206_009003 3300049653 Bacteria 1324
1652 Ga0501211_005232 3300049658 Bacteria 1303
1653 Ga0501227_036024 3300049665 Bacteria 1207
1654 Ga0501235_004940 3300049669 Bacteria 2890
1655 Ga0501249_010268 3300049679 Bacteria 1956
1656 Ga0501253_004339 3300049683 Bacteria 1783
1657 Ga0501257_023167 3300049686 Bacteria 1472
1658 Ga0501221_006153 3300049704 Bacteria 2023
1659 Ga0501225_0017431 3300049705 Bacteria 1993
1660 Ga0501229_005095 3300049706 Bacteria 1605
1661 Ga0501079_0003748 3300049741 Bacteria 11218
1662 Ga0501080_0000343 3300049742 Bacteria 35792
1663 Ga0501080_0006075 3300049742 Bacteria 10826
1664 Ga0501080_0177732 3300049742 Bacteria 1960
1665 Ga0501083_0000724 3300049744 Bacteria 21483
1666 Ga0501083_0003168 3300049744 Bacteria 11450
1667 Ga0501262_000189 3300049759 Bacteria 7646
1668 Ga0501265_002613 3300049762 Bacteria 2041
1669 Ga0501280_000460 3300049776 Bacteria 9712
1670 Ga0501035_0000101 3300049822 Bacteria 106949
1671 Ga0501035_0001854 3300049822 Bacteria 21280
1672 Ga0501035_0003169 3300049822 Bacteria 15796
1673 Ga0501035_0018035 3300049822 Bacteria 6504
1674 Ga0501035_0296486 3300049822 Bacteria 1363
1675 Ga0501035_0343325 3300049822 Bacteria 1250
1676 Ga0501044_0000010 3300049823 Bacteria 260121
1677 Ga0501044_0000182 3300049823 Bacteria 78052
1678 Ga0501044_0000916 3300049823 Bacteria 35511
1679 Ga0501044_0020484 3300049823 Bacteria 7062
1680 Ga0501044_0025590 3300049823 Bacteria 6256
1681 Ga0501044_0063871 3300049823 Bacteria 3759
1682 Ga0501044_0096823 3300049823 Bacteria 2972
1683 Ga0501044_0115924 3300049823 Bacteria 2684
1684 Ga0501044_0133026 3300049823 Bacteria 2480
1685 Ga0501044_0321189 3300049823 Bacteria 1472
1686 Ga0501045_0086916 3300049824 Bacteria 2308
1687 Ga0501045_0131924 3300049824 Bacteria 1857
1688 Ga0501045_0230577 3300049824 Bacteria 1378
1689 nmdc:mga03683_33107_c1 3300050489 Bacteria 2082
1690 nmdc:mga03683_41928_c2 3300050489 Bacteria 1348
1691 nmdc:mga03683_64361_c1 3300050489 Bacteria 1556
1692 nmdc:mga00v17_104836_c1 3300050491 Bacteria 1788
1693 nmdc:mga00v17_115762_c1 3300050491 Bacteria 1704
1694 nmdc:mga00v17_50950_c1 3300050491 Bacteria 2517
1695 nmdc:mga0yw44_3131_c1 3300050492 Bacteria 7259
1696 nmdc:mga0yw44_34788_c1 3300050492 Bacteria 2955
1697 nmdc:mga0yw44_4219_c1 3300050492 Bacteria 6543
1698 nmdc:mga0yw44_43205_c1 3300050492 Bacteria 2690
1699 nmdc:mga0k408_13536_c2 3300050493 Bacteria 2967
1700 nmdc:mga0k408_214466_c1 3300050493 Bacteria 1149
1701 nmdc:mga0k408_223182_c1 3300050493 Bacteria 1125
1702 nmdc:mga0k408_47167_c1 3300050493 Bacteria 2490
1703 nmdc:mga0k408_61822_c1 3300050493 Bacteria 2177
1704 nmdc:mga0k408_65660_c2 3300050493 Bacteria 1531
1705 nmdc:mga0k408_6933_c1 3300050493 Bacteria 6042
1706 nmdc:mga06z11_77649_c1 3300050494 Bacteria 1773
1707 nmdc:mga04h51_2456_c1 3300050495 Bacteria 4404
1708 nmdc:mga04h51_26269_c1 3300050495 Bacteria 1799
1709 nmdc:mga07m45_127312_c1 3300050496 Bacteria 1473
1710 nmdc:mga07m45_146317_c1 3300050496 Bacteria 1370
1711 nmdc:mga07m45_148252_c1 3300050496 Bacteria 1360
1712 nmdc:mga07m45_21735_c1 3300050496 Bacteria 3497
1713 nmdc:mga07m45_2857_c1 3300050496 Bacteria 8178
1714 nmdc:mga07m45_32439_c1 3300050496 Bacteria 2897
1715 nmdc:mga07m45_700_c1 3300050496 Bacteria 14224
1716 nmdc:mga07m45_72475_c1 3300050496 Bacteria 1961
1717 nmdc:mga05p37_510010_c1 3300050507 Bacteria 1378
1718 nmdc:mga08y16_713892_c1 3300050511 Bacteria 1001
1719 nmdc:mga0n895_2560_c1 3300050512 Bacteria 14260
1720 nmdc:mga0rr50_4914_c1 3300050513 Bacteria 7910
1721 nmdc:mga0a205_269570_c1 3300050515 Bacteria 1579
1722 nmdc:mga0sz30_13236_c1 3300050516 Bacteria 3227
1723 nmdc:mga0sz30_1854_c1 3300050516 Bacteria 7525
1724 nmdc:mga0sz30_20265_c1 3300050516 Bacteria 2442
1725 Ga0495601_0100329 3300053077 Bacteria 1869
1726 Ga0495601_0137133 3300053077 Bacteria 1595
1727 Ga0495601_0225575 3300053077 Bacteria 1224
1728 Ga0495612_0024087 3300053078 Bacteria 2444
1729 Ga0500635_0000003 3300053080 Bacteria 216927
1730 Ga0500635_0005930 3300053080 Bacteria 3241
1731 Ga0495595_0000394 3300053084 Bacteria 16586
1732 Ga0495595_0043698 3300053084 Bacteria 2056
1733 Ga0495619_0001260 3300053085 Bacteria 16606
1734 Ga0495619_0075414 3300053085 Bacteria 2263
1735 Ga0500578_0000064 3300053086 Bacteria 117170
1736 Ga0500578_0077167 3300053086 Bacteria 2121
1737 Ga0500578_0088708 3300053086 Bacteria 1964
1738 Ga0500643_000042 3300053087 Bacteria 158933
1739 Ga0500581_016873 3300053089 Bacteria 3661
1740 Ga0500646_0003505 3300053090 Bacteria 4024
1741 Ga0500583_0041114 3300053092 Bacteria 2098
1742 Ga0500651_0000751 3300053093 Bacteria 15835
1743 Ga0500651_0030895 3300053093 Bacteria 3372
1744 Ga0500651_0039450 3300053093 Bacteria 2974
1745 Ga0500566_0000621 3300053094 Bacteria 19875
1746 Ga0500566_0002553 3300053094 Bacteria 10831
1747 Ga0500566_0005911 3300053094 Bacteria 7277
1748 Ga0500566_0005990 3300053094 Bacteria 7226
1749 Ga0500566_0007233 3300053094 Bacteria 6576
1750 Ga0500554_024840 3300053102 Bacteria 1702
1751 Ga0500555_007469 3300053103 Bacteria 3105
1752 Ga0500556_0000012 3300053104 Bacteria 250391
1753 Ga0500556_0000747 3300053104 Bacteria 19402
1754 Ga0500556_0001028 3300053104 Bacteria 14579
1755 Ga0500557_000006 3300053105 Bacteria 141252
1756 Ga0500562_010400 3300053108 Bacteria 2358
1757 Ga0500562_015423 3300053108 Bacteria 1959
1758 Ga0500569_016776 3300053109 Bacteria 1861
1759 Ga0500569_064462 3300053109 Bacteria 1139
1760 Ga0500572_000226 3300053111 Bacteria 19903
1761 Ga0500572_006955 3300053111 Bacteria 2605
1762 Ga0500572_010015 3300053111 Bacteria 2255
1763 Ga0500592_000296 3300053116 Bacteria 8664
1764 Ga0500595_009264 3300053119 Bacteria 3980
1765 Ga0500595_013051 3300053119 Bacteria 3191
1766 Ga0500595_026070 3300053119 Bacteria 2018
1767 Ga0500608_003307 3300053122 Bacteria 6019
1768 Ga0500608_046152 3300053122 Bacteria 2093
1769 Ga0500608_048783 3300053122 Bacteria 2035
1770 Ga0500618_000025 3300053125 Bacteria 150583
1771 Ga0500618_007682 3300053125 Bacteria 3056
1772 Ga0500642_0000110 3300053130 Bacteria 38826
1773 Ga0500642_0000686 3300053130 Bacteria 10021
1774 Ga0500642_0003964 3300053130 Bacteria 4565
1775 Ga0500642_0064108 3300053130 Bacteria 1658
1776 Ga0500652_013163 3300053131 Bacteria 2922
1777 Ga0500652_136860 3300053131 Bacteria 1020
1778 Ga0500652_154497 3300053131 Bacteria 951
1779 Ga0500658_0036906 3300053134 Bacteria 1941
1780 Ga0500559_0000198 3300053136 Bacteria 47902
1781 Ga0500559_0005770 3300053136 Bacteria 5646
1782 Ga0500559_0009515 3300053136 Bacteria 4199
1783 Ga0500559_0052706 3300053136 Bacteria 1799
1784 Ga0500559_0068411 3300053136 Bacteria 1595
1785 Ga0500559_0073163 3300053136 Bacteria 1546
1786 Ga0500568_0000262 3300053139 Bacteria 44734
1787 Ga0500568_0001410 3300053139 Bacteria 15597
1788 Ga0500568_0009265 3300053139 Bacteria 4691
1789 Ga0500568_0090095 3300053139 Bacteria 1157
1790 Ga0500568_0104083 3300053139 Bacteria 1064
1791 Ga0500573_0062473 3300053140 Bacteria 2132
1792 Ga0500586_001269 3300053145 Bacteria 5291
1793 Ga0500590_054917 3300053148 Bacteria 2016
1794 Ga0500590_127444 3300053148 Bacteria 1183
1795 Ga0500603_001570 3300053150 Bacteria 5163
1796 Ga0500604_0009060 3300053151 Bacteria 2647
1797 Ga0500616_0000035 3300053153 Bacteria 394242
1798 Ga0500616_0082183 3300053153 Bacteria 1616
1799 Ga0500622_0000390 3300053156 Bacteria 42468
1800 Ga0500622_0000647 3300053156 Bacteria 31120
1801 Ga0500622_0001402 3300053156 Bacteria 19418
1802 Ga0500622_0006944 3300053156 Bacteria 6481
1803 Ga0500622_0011016 3300053156 Bacteria 4934
1804 Ga0500622_0020165 3300053156 Bacteria 3540
1805 Ga0500627_0123460 3300053158 Bacteria 1168
1806 Ga0500630_002647 3300053159 Bacteria 8611
1807 Ga0500634_0103553 3300053161 Bacteria 1419
1808 Ga0500638_046459 3300053162 Bacteria 2104
1809 Ga0500639_000029 3300053163 Bacteria 76014
1810 Ga0500636_0000009 3300053177 Bacteria 155504
1811 Ga0500636_0000711 3300053177 Bacteria 17869
1812 Ga0500636_0100958 3300053177 Bacteria 1640
1813 Ga0500636_0130136 3300053177 Bacteria 1402
1814 Ga0500637_0000707 3300053178 Bacteria 13299
1815 Ga0500637_0078591 3300053178 Bacteria 1904
1816 Ga0500637_0084706 3300053178 Bacteria 1833
1817 Ga0500637_0129457 3300053178 Bacteria 1464
1818 Ga0500625_000351 3300053729 Bacteria 11670
1819 Ga0500645_001142 3300053730 Bacteria 14384
1820 Ga0500645_012656 3300053730 Bacteria 2724
1821 Ga0500645_022107 3300053730 Bacteria 1959
1822 Ga0500645_039130 3300053730 Bacteria 1406
1823 Ga0500609_002203 3300053731 Bacteria 2784
1824 Ga0500609_006122 3300053731 Bacteria 1640
1825 Ga0500596_005177 3300053735 Bacteria 2321
1826 Ga0500601_001469 3300053737 Bacteria 2585
1827 Ga0501084_0041419 3300054114 Bacteria 3854
1828 Ga0500661_009777 3300055283 Bacteria 1751
1829 Ga0590074_025951 3300059423 Bacteria 1023
1830 Ga0590077_031064 3300059426 Bacteria 1166
1831 Ga0587084_002539 3300059477 Bacteria 1905
1832 Ga0587077_000359 3300059493 Bacteria 3671
1833 Ga0587077_003655 3300059493 Bacteria 1954
1834 Ga0587076_010795 3300059645 Bacteria 1328
1835 Ga0501082_0002561 3300060353 Bacteria 15915
1836 Ga0501082_0233918 3300060353 Bacteria 1599
1837 Ga0501082_0253642 3300060353 Bacteria 1531
1838 Ga0501082_0477300 3300060353 Bacteria 1090
1839 Ga0466962_0005798 3300061719 Bacteria 5932
1840 Ga0466962_0027799 3300061719 Bacteria 2712

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_0009169 Ga0451795_0009169_10_819 234
2 3300041458 Ga0451798_0710666 Ga0451798_0710666_10_819 234
3 3300047443 Ga0495687_000664 Ga0495687_000664_1582_2463 251
4 iso_pu_bacteria 8019586578 8019592847 251
5 3300005338 Ga0068868_100077236 Ga0068868_1000772362 252
6 3300005327 Ga0070658_10139932 Ga0070658_101399322 253
7 3300005328 Ga0070676_10050547 Ga0070676_100505471 253
8 3300005337 Ga0070682_100128666 Ga0070682_1001286662 253
9 3300005367 Ga0070667_100311231 Ga0070667_1003112312 253
10 3300005547 Ga0070693_100123400 Ga0070693_1001234002 253
11 3300005577 Ga0068857_100570279 Ga0068857_1005702791 253
12 3300005616 Ga0068852_100153236 Ga0068852_1001532362 253
13 3300006237 Ga0097621_100209497 Ga0097621_1002094972 253
14 3300006353 Ga0075370_10228650 Ga0075370_102286501 253
15 3300009176 Ga0105242_10551563 Ga0105242_105515631 253
16 3300009545 Ga0105237_10005231 Ga0105237_100052315 253
17 3300010375 Ga0105239_10093907 Ga0105239_100939073 253
18 3300013105 Ga0157369_10093152 Ga0157369_100931522 253
19 3300025908 Ga0207643_10043732 Ga0207643_100437322 253
20 3300025914 Ga0207671_10025871 Ga0207671_100258712 253
21 3300026116 Ga0207674_10076492 Ga0207674_100764925 253
22 3300037068 Ga0373925_0499995 Ga0373925_0499995_11_808 253
23 3300046460 Ga0495638_0173274 Ga0495638_0173274_428_1225 253
24 3300046523 Ga0495644_0159890 Ga0495644_0159890_53_850 253
25 3300046542 Ga0495597_0097453 Ga0495597_0097453_15_884 253
26 3300046660 Ga0495625_0012781 Ga0495625_0012781_3883_4764 253
27 3300046694 Ga0495649_0058833 Ga0495649_0058833_55_936 253
28 3300047443 Ga0495687_022811 Ga0495687_022811_1532_2413 253
29 3300047443 Ga0495687_043519 Ga0495687_043519_587_1468 253
30 3300048907 Ga0496104_0408223 Ga0496104_0408223_10_807 253
31 3300048922 Ga0496119_0204069 Ga0496119_0204069_13_882 253
32 3300050493 nmdc:mga0k408_47167_c1 nmdc:mga0k408_47167_c1_575_1456 253
33 3300050496 nmdc:mga07m45_146317_c1 nmdc:mga07m45_146317_c1_302_1183 253
34 3300050496 nmdc:mga07m45_72475_c1 nmdc:mga07m45_72475_c1_567_1448 253
35 3300053148 Ga0500590_127444 Ga0500590_127444_15_812 253
36 3300053158 Ga0500627_0123460 Ga0500627_0123460_361_1158 253
37 3300036401 Ga0373937_0188612 Ga0373937_0188612_632_1516 255
38 3300053730 Ga0500645_022107 Ga0500645_022107_578_1468 255
39 3300005467 Ga0070706_100060692 Ga0070706_1000606923 256
40 3300005468 Ga0070707_100037612 Ga0070707_1000376124 256
41 3300006038 Ga0075365_10224057 Ga0075365_102240572 256
42 3300006195 Ga0075366_10147616 Ga0075366_101476161 256
43 3300006353 Ga0075370_10036798 Ga0075370_100367983 256
44 3300025910 Ga0207684_10015383 Ga0207684_100153834 256
45 3300025922 Ga0207646_10205293 Ga0207646_102052932 256
46 3300050496 nmdc:mga07m45_21735_c1 nmdc:mga07m45_21735_c1_2463_3344 256
47 3300005331 Ga0070670_100114378 Ga0070670_1001143782 257
48 3300014325 Ga0163163_10519134 Ga0163163_105191342 257
49 3300025925 Ga0207650_10027888 Ga0207650_100278884 257
50 3300046455 Ga0495603_0029842 Ga0495603_0029842_2469_3254 258
51 3300046530 Ga0495654_0000407 Ga0495654_0000407_16329_17114 258
52 3300002773 JGI25152J39213_1003372 JGI25152J39213_10033722 260
53 3300002774 JGI25150J39212_1016369 JGI25150J39212_10163692 260
54 3300003215 JGI25153J46596_10004494 JGI25153J46596_100044946 260
55 3300003771 Ga0055526_1008436 Ga0055526_10084364 260
56 3300003791 Ga0055530_10006660 Ga0055530_100066605 260
57 3300005262 Ga0065165_1002164 Ga0065165_10021647 260
58 3300025245 Ga0207425_1000789 Ga0207425_100078912 260
59 3300025258 Ga0209129_1000212 Ga0209129_100021227 260
60 3300025273 Ga0209673_1028549 Ga0209673_10285492 260
61 3300025295 Ga0209564_1000024 Ga0209564_1000024169 260
62 3300025297 Ga0209758_1000558 Ga0209758_100055859 260
63 3300025298 Ga0209050_1002504 Ga0209050_10025047 260
64 3300025960 Ga0207651_10040199 Ga0207651_100401994 260
65 3300028794 Ga0307515_10002738 Ga0307515_100027382 260
66 3300035724 Ga0373933_0369114 Ga0373933_0369114_122_910 260
67 3300048921 Ga0496118_0143524 Ga0496118_0143524_12_902 260
68 3300048927 Ga0496124_0406155 Ga0496124_0406155_115_933 260
69 3300049519 Ga0501296_005724 Ga0501296_005724_50_934 260
70 3300049523 Ga0501300_000849 Ga0501300_000849_2123_3007 260
71 3300049658 Ga0501211_005232 Ga0501211_005232_190_1074 260
72 3300049704 Ga0501221_006153 Ga0501221_006153_461_1345 260
73 3300049706 Ga0501229_005095 Ga0501229_005095_166_1050 260
74 3300053078 Ga0495612_0024087 Ga0495612_0024087_1614_2432 260
75 3300041452 Ga0451793_0212439 Ga0451793_0212439_87_977 261
76 3300053156 Ga0500622_0000390 Ga0500622_0000390_36_926 261
77 3300001989 JGI24739J22299_10047227 JGI24739J22299_100472272 262
78 3300044901 Ga0466960_0014481 Ga0466960_0014481_66_959 262
79 3300053086 Ga0500578_0000064 Ga0500578_0000064_85639_86529 262
80 3300005434 Ga0070709_10000380 Ga0070709_1000038010 263
81 3300005435 Ga0070714_100187876 Ga0070714_1001878762 263
82 3300005437 Ga0070710_10001211 Ga0070710_1000121110 263
83 3300006163 Ga0070715_10088518 Ga0070715_100885181 263
84 3300006173 Ga0070716_100119113 Ga0070716_1001191132 263
85 3300025915 Ga0207693_10044139 Ga0207693_100441393 263
86 3300025916 Ga0207663_10096789 Ga0207663_100967892 263
87 3300025939 Ga0207665_10047803 Ga0207665_100478033 263
88 3300039437 Ga0436365_0622105 Ga0436365_0622105_5254_6156 263
89 3300039453 Ga0436362_0974760 Ga0436362_0974760_1432_2334 263
90 3300009147 Ga0114129_10595650 Ga0114129_105956502 265
91 3300006195 Ga0075366_10229611 Ga0075366_102296111 267
92 3300031456 Ga0307513_10037114 Ga0307513_100371144 267
93 3300031730 Ga0307516_10001622 Ga0307516_1000162214 267
94 3300046660 Ga0495625_0013758 Ga0495625_0013758_5034_5918 267
95 3300047472 Ga0495686_0030481 Ga0495686_0030481_329_1213 267
96 3300049653 Ga0501206_009003 Ga0501206_009003_281_1168 267
97 3300049686 Ga0501257_023167 Ga0501257_023167_130_1017 267
98 3300049762 Ga0501265_002613 Ga0501265_002613_87_968 267
99 3300050493 nmdc:mga0k408_65660_c2 nmdc:mga0k408_65660_c2_616_1500 267
100 iso_pu_bacteria 8016583857 8016595037 267
101 3300005293 Ga0065715_10141072 Ga0065715_101410722 268
102 3300005331 Ga0070670_100082747 Ga0070670_1000827473 268
103 3300005353 Ga0070669_100036727 Ga0070669_1000367274 268
104 3300005354 Ga0070675_100068234 Ga0070675_1000682342 268
105 3300005356 Ga0070674_100007372 Ga0070674_1000073727 268
106 3300005356 Ga0070674_100027773 Ga0070674_1000277734 268
107 3300005364 Ga0070673_100223048 Ga0070673_1002230482 268
108 3300005367 Ga0070667_100078809 Ga0070667_1000788093 268
109 3300005459 Ga0068867_100006086 Ga0068867_1000060861 268
110 3300005459 Ga0068867_100323987 Ga0068867_1003239871 268
111 3300005543 Ga0070672_100006495 Ga0070672_1000064952 268
112 3300005618 Ga0068864_100115854 Ga0068864_1001158542 268
113 3300013308 Ga0157375_10123645 Ga0157375_101236451 268
114 3300014969 Ga0157376_10483021 Ga0157376_104830211 268
115 3300025925 Ga0207650_10003617 Ga0207650_100036173 268
116 3300025926 Ga0207659_10004256 Ga0207659_100042562 268
117 3300025937 Ga0207669_10003348 Ga0207669_100033483 268
118 3300025940 Ga0207691_10015888 Ga0207691_100158885 268
119 3300025972 Ga0207668_10192054 Ga0207668_101920542 268
120 3300026023 Ga0207677_10009064 Ga0207677_100090643 268
121 3300026089 Ga0207648_10034250 Ga0207648_100342504 268
122 3300026095 Ga0207676_10175434 Ga0207676_101754342 268
123 3300031548 Ga0307408_100091004 Ga0307408_1000910042 268
124 3300031731 Ga0307405_10007622 Ga0307405_100076222 268
125 3300031901 Ga0307406_10003755 Ga0307406_100037553 268
126 3300031903 Ga0307407_10027945 Ga0307407_100279454 268
127 3300031995 Ga0307409_100002839 Ga0307409_1000028396 268
128 3300032002 Ga0307416_100047679 Ga0307416_1000476793 268
129 3300032004 Ga0307414_10040421 Ga0307414_100404214 268
130 3300032126 Ga0307415_100008136 Ga0307415_1000081365 268
131 3300005983 Ga0081540_1013750 Ga0081540_10137502 269
132 iso_pu_bacteria 8019668869 8019670035 269
133 3300048922 Ga0496119_0000721 Ga0496119_0000721_42596_43486 270
134 3300048925 Ga0496122_0001180 Ga0496122_0001180_10011_10901 270
135 3300048926 Ga0496123_0002949 Ga0496123_0002949_9125_10015 270
136 3300053104 Ga0500556_0000747 Ga0500556_0000747_17585_18475 270
137 iso_pu_bacteria 2917554339 2917558846 270
138 iso_pu_bacteria 2917554339 2917558853 270
139 3300046524 Ga0495648_0096164 Ga0495648_0096164_10_837 272
140 3300005354 Ga0070675_100042193 Ga0070675_1000421934 273
141 3300005535 Ga0070684_100515146 Ga0070684_1005151462 273
142 3300007265 Ga0099794_10027843 Ga0099794_100278432 273
143 3300049586 Ga0501070_0040998 Ga0501070_0040998_10_867 273
144 3300027671 Ga0209588_1060223 Ga0209588_10602232 274
145 3300009545 Ga0105237_10175131 Ga0105237_101751312 275
146 3300025914 Ga0207671_10083206 Ga0207671_100832062 275
147 3300005365 Ga0070688_100060348 Ga0070688_1000603482 276
148 3300031616 Ga0307508_10032796 Ga0307508_100327964 276
149 3300031730 Ga0307516_10001494 Ga0307516_100014942 276
150 3300031901 Ga0307406_10029649 Ga0307406_100296492 276
151 3300036401 Ga0373937_0140600 Ga0373937_0140600_1372_2238 276
152 3300037068 Ga0373925_0089848 Ga0373925_0089848_827_1693 276
153 3300048928 Ga0496125_0086597 Ga0496125_0086597_1446_2279 276
154 3300049569 Ga0501032_0029214 Ga0501032_0029214_2414_3280 276
155 3300049570 Ga0501033_0060004 Ga0501033_0060004_1190_2056 276
156 3300049571 Ga0501034_0140445 Ga0501034_0140445_394_1260 276
157 3300049579 Ga0501043_0044868 Ga0501043_0044868_2412_3278 276
158 3300049823 Ga0501044_0020484 Ga0501044_0020484_3758_4624 276
159 3300050489 nmdc:mga03683_41928_c2 nmdc:mga03683_41928_c2_493_1338 276
160 3300005340 Ga0070689_100054745 Ga0070689_1000547452 277
161 3300009094 Ga0111539_10413804 Ga0111539_104138042 277
162 3300025936 Ga0207670_10008860 Ga0207670_100088601 277
163 3300003215 JGI25153J46596_10002706 JGI25153J46596_100027067 278
164 3300025297 Ga0209758_1000213 Ga0209758_1000213127 278
165 3300025303 Ga0209051_1011409 Ga0209051_10114093 278
166 3300028666 Ga0265336_10000008 Ga0265336_10000008142 278
167 3300029957 Ga0265324_10001429 Ga0265324_100014299 278
168 3300031730 Ga0307516_10140243 Ga0307516_101402432 278
169 3300032002 Ga0307416_100049968 Ga0307416_1000499683 278
170 3300015683 Ga0183362_10003 Ga0183362_1000319 279
171 3300031730 Ga0307516_10000064 Ga0307516_100000644 279
172 3300053080 Ga0500635_0000003 Ga0500635_0000003_139563_140447 279
173 3300003215 JGI25153J46596_10002003 JGI25153J46596_100020034 280
174 3300003775 Ga0055524_1026803 Ga0055524_10268032 280
175 3300005262 Ga0065165_1005901 Ga0065165_10059014 280
176 3300005367 Ga0070667_100000219 Ga0070667_10000021939 280
177 3300005548 Ga0070665_100429001 Ga0070665_1004290012 280
178 3300006353 Ga0075370_10024822 Ga0075370_100248222 280
179 3300009177 Ga0105248_10309392 Ga0105248_103093921 280
180 3300013308 Ga0157375_10458113 Ga0157375_104581132 280
181 3300025294 Ga0209025_1000245 Ga0209025_10002454 280
182 3300025295 Ga0209564_1003071 Ga0209564_10030713 280
183 3300025297 Ga0209758_1000026 Ga0209758_1000026490 280
184 3300025299 Ga0209256_1002958 Ga0209256_10029588 280
185 3300025304 Ga0209257_1000365 Ga0209257_100036533 280
186 3300037471 Ga0395905_0009931 Ga0395905_0009931_6120_7010 280
187 3300044765 Ga0466970_0050312 Ga0466970_0050312_959_1843 280
188 3300048925 Ga0496122_0057615 Ga0496122_0057615_284_1150 280
189 3300048926 Ga0496123_0000519 Ga0496123_0000519_64308_65174 280
190 3300048927 Ga0496124_0047109 Ga0496124_0047109_919_1785 280
191 3300048928 Ga0496125_0000790 Ga0496125_0000790_50327_51193 280
192 3300048928 Ga0496125_0118562 Ga0496125_0118562_984_1850 280
193 3300048929 Ga0496126_0000466 Ga0496126_0000466_79011_79877 280
194 3300048929 Ga0496126_0017014 Ga0496126_0017014_3146_4012 280
195 3300048929 Ga0496126_0104723 Ga0496126_0104723_672_1565 280
196 3300050496 nmdc:mga07m45_148252_c1 nmdc:mga07m45_148252_c1_43_933 280
197 3300053153 Ga0500616_0082183 Ga0500616_0082183_412_1305 280
198 iso_pu_bacteria 2600254954 2600444420 280
199 iso_pu_bacteria 2600255389 2602011505 280
200 iso_pu_bacteria 2738543020 2739284881 280
201 iso_pu_bacteria 2738543021 2739290195 280
202 iso_pu_bacteria 2823421272 2823423978 280
203 iso_pu_bacteria 2919501602 2919503174 280
204 iso_pu_bacteria 2926063275 2926066255 280
205 iso_pu_bacteria 2952252522 2952253094 280
206 iso_pu_bacteria 8034962539 8034964981 280
207 3300005614 Ga0068856_100107856 Ga0068856_1001078562 281
208 3300025256 Ga0209759_1030804 Ga0209759_10308041 281
209 3300026078 Ga0207702_10131075 Ga0207702_101310753 281
210 3300031616 Ga0307508_10000053 Ga0307508_10000053104 281
211 3300053140 Ga0500573_0062473 Ga0500573_0062473_551_1417 281
212 iso_pu_bacteria 2511231004 2511253304 281
213 iso_pu_bacteria 2511231006 2511267532 281
214 iso_pu_bacteria 2511231007 2511273843 281
215 iso_pu_bacteria 2511231008 2511278829 281
216 iso_pu_bacteria 2511231010 2511288218 281
217 iso_pu_bacteria 2511231011 2511294104 281
218 iso_pu_bacteria 2511231012 2511299355 281
219 iso_pu_bacteria 2511231014 2511311200 281
220 iso_pu_bacteria 2511231015 2511321694 281
221 iso_pu_bacteria 2511231016 2511329009 281
222 iso_pu_bacteria 2511231017 2511334105 281
223 iso_pu_bacteria 2511231018 2511340253 281
224 iso_pu_bacteria 2511231019 2511346938 281
225 iso_pu_bacteria 2511231020 2511348388 281
226 iso_pu_bacteria 2511231021 2511357859 281
227 iso_pu_bacteria 2511231022 2511361082 281
228 iso_pu_bacteria 2511231023 2511370210 281
229 iso_pu_bacteria 2511231031 2511412756 281
230 iso_pu_bacteria 2511231156 2511823941 281
231 iso_pu_bacteria 2512047018 2512325531 281
232 iso_pu_bacteria 2582580891 2583793122 281
233 iso_pu_bacteria 2597489887 2597858930 281
234 iso_pu_bacteria 2597489888 2597864475 281
235 iso_pu_bacteria 2597489889 2597870287 281
236 iso_pu_bacteria 2599185167 2599397602 281
237 iso_pu_bacteria 2599185179 2599452047 281
238 iso_pu_bacteria 2599185185 2599487632 281
239 iso_pu_bacteria 2599185188 2599503182 281
240 iso_pu_bacteria 2599185189 2599506688 281
241 iso_pu_bacteria 2599185190 2599513569 281
242 iso_pu_bacteria 2599185191 2599517929 281
243 iso_pu_bacteria 2599185212 2599614794 281
244 iso_pu_bacteria 2599185248 2599769752 281
245 iso_pu_bacteria 2599185257 2599806042 281
246 iso_pu_bacteria 2599185288 2599880721 281
247 iso_pu_bacteria 2599185289 2599889074 281
248 iso_pu_bacteria 2599185290 2599892246 281
249 iso_pu_bacteria 2599185291 2599901565 281
250 iso_pu_bacteria 2599185300 2599933694 281
251 iso_pu_bacteria 2599185302 2599942805 281
252 iso_pu_bacteria 2599185303 2599949772 281
253 iso_pu_bacteria 2599185304 2599953554 281
254 iso_pu_bacteria 2599185305 2599959223 281
255 iso_pu_bacteria 2599185306 2599964492 281
256 iso_pu_bacteria 2599185308 2599975635 281
257 iso_pu_bacteria 2599185309 2599982185 281
258 iso_pu_bacteria 2599185310 2599988989 281
259 iso_pu_bacteria 2599185311 2599994677 281
260 iso_pu_bacteria 2599185312 2599999547 281
261 iso_pu_bacteria 2599185313 2600007212 281
262 iso_pu_bacteria 2599185314 2600009728 281
263 iso_pu_bacteria 2599185315 2600020554 281
264 iso_pu_bacteria 2599185316 2600022717 281
265 iso_pu_bacteria 2599185317 2600030152 281
266 iso_pu_bacteria 2599185318 2600037779 281
267 iso_pu_bacteria 2599185319 2600042042 281
268 iso_pu_bacteria 2599185320 2600046943 281
269 iso_pu_bacteria 2599185321 2600055067 281
270 iso_pu_bacteria 2599185322 2600057810 281
271 iso_pu_bacteria 2599185323 2600064823 281
272 iso_pu_bacteria 2599185324 2600071715 281
273 iso_pu_bacteria 2599185325 2600076085 281
274 iso_pu_bacteria 2600254930 2600359729 281
275 iso_pu_bacteria 2600254931 2600366750 281
276 iso_pu_bacteria 2600255296 2601690298 281
277 iso_pu_bacteria 2600255318 2601797250 281
278 iso_pu_bacteria 2603880185 2606076019 281
279 iso_pu_bacteria 2603880199 2606130692 281
280 iso_pu_bacteria 2619619299 2621299104 281
281 iso_pu_bacteria 2623620443 2624481515 281
282 iso_pu_bacteria 2623620446 2624493079 281
283 iso_pu_bacteria 2643221565 2643843613 281
284 iso_pu_bacteria 2643221571 2643871165 281
285 iso_pu_bacteria 2643221589 2643954020 281
286 iso_pu_bacteria 2643221602 2644022046 281
287 iso_pu_bacteria 2643221633 2644185564 281
288 iso_pu_bacteria 2643221650 2644285608 281
289 iso_pu_bacteria 2643221713 2644620523 281
290 iso_pu_bacteria 2651869719 2652543812 281
291 iso_pu_bacteria 2667528170 2671093525 281
292 iso_pu_bacteria 2667528176 2671128349 281
293 iso_pu_bacteria 2671180172 2671772892 281
294 iso_pu_bacteria 2675903420 2677899422 281
295 iso_pu_bacteria 2675903515 2678264208 281
296 iso_pu_bacteria 2713897148 2715753621 281
297 iso_pu_bacteria 2713897149 2715756044 281
298 iso_pu_bacteria 2718217725 2718634772 281
299 iso_pu_bacteria 2721755607 2723249177 281
300 iso_pu_bacteria 2738541265 2738672261 281
301 iso_pu_bacteria 2738541282 2738750654 281
302 iso_pu_bacteria 2738541294 2738806157 281
303 iso_pu_bacteria 2738541303 2738859695 281
304 iso_pu_bacteria 2738541309 2738893517 281
305 iso_pu_bacteria 2738543004 2739201305 281
306 iso_pu_bacteria 2738543015 2739259600 281
307 iso_pu_bacteria 2738543025 2739313687 281
308 iso_pu_bacteria 2740892503 2743738452 281
309 iso_pu_bacteria 2744054620 2745004663 281
310 iso_pu_bacteria 2773857670 2774119113 281
311 iso_pu_bacteria 2773857673 2774135106 281
312 iso_pu_bacteria 2784132063 2784265177 281
313 iso_pu_bacteria 2784132072 2784314763 281
314 iso_pu_bacteria 2791355520 2794596683 281
315 iso_pu_bacteria 2808606361 2808857573 281
316 iso_pu_bacteria 2808606373 2808904260 281
317 iso_pu_bacteria 2808606376 2808925227 281
318 iso_pu_bacteria 2808606377 2808931720 281
319 iso_pu_bacteria 2808606378 2808937743 281
320 iso_pu_bacteria 2808606379 2808941874 281
321 iso_pu_bacteria 2808606380 2808947425 281
322 iso_pu_bacteria 2808606381 2808953840 281
323 iso_pu_bacteria 2808606382 2808959068 281
324 iso_pu_bacteria 2808606383 2808966057 281
325 iso_pu_bacteria 2808606385 2808980301 281
326 iso_pu_bacteria 2808606388 2808996022 281
327 iso_pu_bacteria 2808606389 2809000949 281
328 iso_pu_bacteria 2808606445 2809214303 281
329 iso_pu_bacteria 2816332298 2817491815 281
330 iso_pu_bacteria 2818991456 2819657705 281
331 iso_pu_bacteria 2825651385 2825656857 281
332 iso_pu_bacteria 2834028612 2834032615 281
333 iso_pu_bacteria 2842826826 2842830337 281
334 iso_pu_bacteria 2842832357 2842836350 281
335 iso_pu_bacteria 2842837860 2842841929 281
336 iso_pu_bacteria 2842843487 2842844245 281
337 iso_pu_bacteria 2842854478 2842854905 281
338 iso_pu_bacteria 2852612431 2852613896 281
339 iso_pu_bacteria 2852657418 2852659385 281
340 iso_pu_bacteria 2852667396 2852668368 281
341 iso_pu_bacteria 2860339153 2860344306 281
342 iso_pu_bacteria 2860867994 2860870968 281
343 iso_pu_bacteria 2878029506 2878033500 281
344 iso_pu_bacteria 2880230671 2880232785 281
345 iso_pu_bacteria 2904518522 2904520479 281
346 iso_pu_bacteria 2904550169 2904553594 281
347 iso_pu_bacteria 2908446538 2908449003 281
348 iso_pu_bacteria 2912963787 2912965530 281
349 iso_pu_bacteria 2913036834 2913040695 281
350 iso_pu_bacteria 2919063839 2919069191 281
351 iso_pu_bacteria 2919385768 2919387648 281
352 iso_pu_bacteria 2919456309 2919461340 281
353 iso_pu_bacteria 2919481497 2919482195 281
354 iso_pu_bacteria 2919487758 2919490389 281
355 iso_pu_bacteria 2919697872 2919699647 281
356 iso_pu_bacteria 2923153595 2923157509 281
357 iso_pu_bacteria 2923586266 2923587767 281
358 iso_pu_bacteria 2929144301 2929148179 281
359 iso_pu_bacteria 2929189879 2929193044 281
360 iso_pu_bacteria 2931369376 2931374395 281
361 iso_pu_bacteria 2931390751 2931393447 281
362 iso_pu_bacteria 2931396565 2931403036 281
363 iso_pu_bacteria 2939636861 2939640325 281
364 iso_pu_bacteria 2939651529 2939655450 281
365 iso_pu_bacteria 2945928738 2945932964 281
366 iso_pu_bacteria 2945961074 2945964190 281
367 iso_pu_bacteria 2946027586 2946031308 281
368 iso_pu_bacteria 2947233263 2947238285 281
369 iso_pu_bacteria 2969304461 2969308259 281
370 iso_pu_bacteria 2974289157 2974290282 281
371 iso_pu_bacteria 2984286254 2984288630 281
372 iso_pu_bacteria 2988728565 2988729830 281
373 iso_pu_bacteria 2998139840 2998143571 281
374 iso_pu_bacteria 3007395558 3007396831 281
375 iso_pu_bacteria 3007511990 3007515208 281
376 iso_pu_bacteria 3007614139 3007616641 281
377 iso_pu_bacteria 3007619802 3007620963 281
378 iso_pu_bacteria 3007718800 3007719699 281
379 iso_pu_bacteria 3007855910 3007859030 281
380 iso_pu_bacteria 3007861166 3007861441 281
381 iso_pu_bacteria 3007866637 3007868356 281
382 iso_pu_bacteria 8015687852 8015691671 281
383 iso_pu_bacteria 8019775933 8019776082 281
384 iso_pu_bacteria 8029995093 8029997253 281
385 iso_pu_bacteria 8054285046 8054286626 281
386 iso_pu_bacteria 8054347763 8054347855 281
387 iso_pu_bacteria 8054503363 8054506815 281
388 iso_pu_bacteria 8055770955 8055774860 281
389 iso_pu_bacteria 8055817908 8055821606 281
390 iso_pu_bacteria 8056125926 8056129758 281
391 iso_pu_bacteria 8056131705 8056135265 281
392 iso_pu_bacteria 8056143049 8056147080 281
393 iso_pu_bacteria 8056148874 8056154229 281
394 iso_pu_bacteria 8056155041 8056160298 281
395 iso_pu_bacteria 8056161164 8056165612 281
396 iso_pu_bacteria 8056166840 8056167636 281
397 iso_pu_bacteria 8056172158 8056173641 281
398 iso_pu_bacteria 8056177738 8056183857 281
399 iso_pu_bacteria 8056569372 8056573580 281
400 3300005985 Ga0081539_10062720 Ga0081539_100627202 282
401 3300031235 Ga0265330_10000012 Ga0265330_1000001265 282
402 iso_pu_bacteria 2899259804 2899260462 282
403 iso_pu_bacteria 8001845381 8001847366 282
404 3300002704 JGI25155J39150_1000064 JGI25155J39150_100006468 283
405 3300002705 JGI25156J39149_1000085 JGI25156J39149_10000852 283
406 3300002738 JGI25154J39366_1000112 JGI25154J39366_10001122 283
407 3300002741 JGI25157J39369_1000109 JGI25157J39369_100010968 283
408 3300002773 JGI25152J39213_1015154 JGI25152J39213_10151542 283
409 3300002774 JGI25150J39212_1003044 JGI25150J39212_10030444 283
410 3300002987 JGI25159J45721_1009814 JGI25159J45721_10098142 283
411 3300002987 JGI25159J45721_1014117 JGI25159J45721_10141172 283
412 3300003187 JGI25151J46595_10010917 JGI25151J46595_100109172 283
413 3300003187 JGI25151J46595_10028541 JGI25151J46595_100285412 283
414 3300003354 JGI25160J50197_1002743 JGI25160J50197_10027438 283
415 3300003374 JGI25161J50226_1000036 JGI25161J50226_100003669 283
416 3300003771 Ga0055526_1003106 Ga0055526_100310610 283
417 3300003771 Ga0055526_1019348 Ga0055526_10193482 283
418 3300003775 Ga0055524_1000098 Ga0055524_10000986 283
419 3300003790 Ga0055528_1005251 Ga0055528_10052513 283
420 3300003791 Ga0055530_10002119 Ga0055530_100021198 283
421 3300003792 Ga0055540_1000137 Ga0055540_100013761 283
422 3300003794 Ga0055531_10001985 Ga0055531_1000198520 283
423 3300004625 Ga0055543_1000157 Ga0055543_100015717 283
424 3300005262 Ga0065165_1015276 Ga0065165_10152763 283
425 3300006051 Ga0075364_10043500 Ga0075364_100435002 283
426 3300006177 Ga0075362_10038254 Ga0075362_100382542 283
427 3300009176 Ga0105242_10003491 Ga0105242_100034914 283
428 3300012513 Ga0157326_1004788 Ga0157326_10047882 283
429 3300025206 Ga0209435_100002 Ga0209435_100002700 283
430 3300025208 Ga0209436_108835 Ga0209436_1088352 283
431 3300025245 Ga0207425_1007872 Ga0207425_10078722 283
432 3300025245 Ga0207425_1008495 Ga0207425_10084954 283
433 3300025246 Ga0209646_1000001 Ga0209646_10000012843 283
434 3300025250 Ga0209026_1000121 Ga0209026_100012169 283
435 3300025256 Ga0209759_1000001 Ga0209759_10000012474 283
436 3300025263 Ga0209565_1000026 Ga0209565_1000026104 283
437 3300025263 Ga0209565_1001447 Ga0209565_10014476 283
438 3300025273 Ga0209673_1000009 Ga0209673_1000009113 283
439 3300025284 Ga0209130_1000109 Ga0209130_100010958 283
440 3300025284 Ga0209130_1002387 Ga0209130_10023872 283
441 3300025291 Ga0209675_1000246 Ga0209675_10002466 283
442 3300025292 Ga0209676_1000013 Ga0209676_1000013134 283
443 3300025292 Ga0209676_1009189 Ga0209676_10091893 283
444 3300025294 Ga0209025_1009400 Ga0209025_10094002 283
445 3300025294 Ga0209025_1010298 Ga0209025_10102984 283
446 3300025295 Ga0209564_1000243 Ga0209564_100024387 283
447 3300025295 Ga0209564_1003205 Ga0209564_10032053 283
448 3300025295 Ga0209564_1010517 Ga0209564_10105174 283
449 3300025298 Ga0209050_1000008 Ga0209050_1000008134 283
450 3300025298 Ga0209050_1009571 Ga0209050_10095712 283
451 3300025298 Ga0209050_1023748 Ga0209050_10237482 283
452 3300025299 Ga0209256_1000003 Ga0209256_1000003268 283
453 3300025302 Ga0207426_1001071 Ga0207426_100107119 283
454 3300025303 Ga0209051_1000005 Ga0209051_1000005134 283
455 3300025304 Ga0209257_1000048 Ga0209257_1000048134 283
456 3300025934 Ga0207686_10154091 Ga0207686_101540911 283
457 3300031456 Ga0307513_10315343 Ga0307513_103153432 283
458 3300031548 Ga0307408_100010250 Ga0307408_1000102503 283
459 3300031901 Ga0307406_10013191 Ga0307406_100131914 283
460 3300046453 Ga0495627_009802 Ga0495627_009802_2111_2974 283
461 3300048928 Ga0496125_0154525 Ga0496125_0154525_569_1432 283
462 3300050489 nmdc:mga03683_64361_c1 nmdc:mga03683_64361_c1_54_944 283
463 3300053730 Ga0500645_001142 Ga0500645_001142_5274_6164 283
464 iso_pu_bacteria 2643221544 2643743443 283
465 iso_pu_bacteria 2643221603 2644027316 283
466 iso_pu_bacteria 2643221639 2644220056 283
467 iso_pu_bacteria 2643221644 2644245140 283
468 iso_pu_bacteria 2643221646 2644261234 283
469 iso_pu_bacteria 2643221654 2644305686 283
470 iso_pu_bacteria 2643221736 2644743539 283
471 iso_pu_bacteria 2791355196 2793066055 283
472 iso_pu_bacteria 2841760612 2841764508 283
473 iso_pu_bacteria 2844104063 2844108044 283
474 iso_pu_bacteria 2851182111 2851187976 283
475 iso_pu_bacteria 2851246043 2851250150 283
476 iso_pu_bacteria 8057529695 8057533421 283
477 2124908027 MRS2a_Contig_49 MRS2a_00373290 284
478 3300003752 Ga0055539_1000243 Ga0055539_100024325 284
479 3300003756 Ga0055533_1000238 Ga0055533_100023825 284
480 3300003758 Ga0055532_1000259 Ga0055532_100025913 284
481 3300003759 Ga0055525_1000332 Ga0055525_100033225 284
482 3300003761 Ga0055535_1005325 Ga0055535_10053253 284
483 3300003781 Ga0055536_1000082 Ga0055536_10000828 284
484 3300003781 Ga0055536_1000185 Ga0055536_100018519 284
485 3300003791 Ga0055530_10000094 Ga0055530_1000009423 284
486 3300003791 Ga0055530_10001399 Ga0055530_1000139910 284
487 3300003791 Ga0055530_10002109 Ga0055530_100021095 284
488 3300003792 Ga0055540_1000130 Ga0055540_100013023 284
489 3300003792 Ga0055540_1000222 Ga0055540_100022220 284
490 3300003792 Ga0055540_1001438 Ga0055540_10014388 284
491 3300003794 Ga0055531_10000215 Ga0055531_1000021524 284
492 3300003841 Ga0055541_1000146 Ga0055541_100014625 284
493 3300005288 Ga0065714_10006377 Ga0065714_100063773 284
494 3300005288 Ga0065714_10010702 Ga0065714_100107024 284
495 3300005288 Ga0065714_10064795 Ga0065714_100647955 284
496 3300005288 Ga0065714_10068142 Ga0065714_100681425 284
497 3300005289 Ga0065704_10070946 Ga0065704_100709464 284
498 3300005289 Ga0065704_10164190 Ga0065704_101641901 284
499 3300005290 Ga0065712_10081086 Ga0065712_100810862 284
500 3300005290 Ga0065712_10118723 Ga0065712_101187232 284
501 3300005331 Ga0070670_100000760 Ga0070670_10000076017 284
502 3300005344 Ga0070661_100000140 Ga0070661_10000014067 284
503 3300005353 Ga0070669_100001983 Ga0070669_10000198317 284
504 3300005457 Ga0070662_100003380 Ga0070662_1000033802 284
505 3300005539 Ga0068853_100101373 Ga0068853_1001013734 284
506 3300005564 Ga0070664_100000201 Ga0070664_1000002018 284
507 3300005578 Ga0068854_100031155 Ga0068854_1000311553 284
508 3300006051 Ga0075364_10102857 Ga0075364_101028572 284
509 3300006058 Ga0075432_10035898 Ga0075432_100358982 284
510 3300006177 Ga0075362_10062461 Ga0075362_100624612 284
511 3300006186 Ga0075369_10004583 Ga0075369_100045835 284
512 3300006914 Ga0075436_100100690 Ga0075436_1001006902 284
513 3300006946 Ga0079104_1000239 Ga0079104_100023949 284
514 3300006946 Ga0079104_1000325 Ga0079104_100032537 284
515 3300006948 Ga0099826_10044464 Ga0099826_100444642 284
516 3300009011 Ga0105251_10001079 Ga0105251_1000107928 284
517 3300009011 Ga0105251_10006867 Ga0105251_100068675 284
518 3300009011 Ga0105251_10013774 Ga0105251_100137742 284
519 3300009011 Ga0105251_10043277 Ga0105251_100432772 284
520 3300009011 Ga0105251_10065110 Ga0105251_100651102 284
521 3300009036 Ga0105244_10000823 Ga0105244_1000082331 284
522 3300009036 Ga0105244_10019773 Ga0105244_100197733 284
523 3300009036 Ga0105244_10026694 Ga0105244_100266942 284
524 3300009036 Ga0105244_10053196 Ga0105244_100531961 284
525 3300009092 Ga0105250_10000523 Ga0105250_1000052315 284
526 3300009092 Ga0105250_10001345 Ga0105250_1000134510 284
527 3300009092 Ga0105250_10060706 Ga0105250_100607061 284
528 3300009148 Ga0105243_10000587 Ga0105243_1000058731 284
529 3300009148 Ga0105243_10178838 Ga0105243_101788382 284
530 3300009176 Ga0105242_10008807 Ga0105242_100088072 284
531 3300009545 Ga0105237_10000413 Ga0105237_1000041326 284
532 3300011119 Ga0105246_10000239 Ga0105246_1000023918 284
533 3300011119 Ga0105246_10057480 Ga0105246_100574802 284
534 3300011119 Ga0105246_10059504 Ga0105246_100595042 284
535 3300012498 Ga0157345_1000190 Ga0157345_10001904 284
536 3300013100 Ga0157373_10000780 Ga0157373_1000078017 284
537 3300013100 Ga0157373_10008065 Ga0157373_100080656 284
538 3300013100 Ga0157373_10072584 Ga0157373_100725843 284
539 3300013102 Ga0157371_10000189 Ga0157371_1000018964 284
540 3300013102 Ga0157371_10003317 Ga0157371_100033176 284
541 3300013102 Ga0157371_10043122 Ga0157371_100431222 284
542 3300013104 Ga0157370_10088442 Ga0157370_100884424 284
543 3300013104 Ga0157370_10091634 Ga0157370_100916342 284
544 3300013104 Ga0157370_10184755 Ga0157370_101847552 284
545 3300013105 Ga0157369_10004800 Ga0157369_100048008 284
546 3300013105 Ga0157369_10186668 Ga0157369_101866682 284
547 3300013306 Ga0163162_10009532 Ga0163162_100095324 284
548 3300013307 Ga0157372_10283284 Ga0157372_102832842 284
549 3300013308 Ga0157375_10119307 Ga0157375_101193072 284
550 3300014497 Ga0182008_10018498 Ga0182008_100184983 284
551 3300014497 Ga0182008_10026815 Ga0182008_100268154 284
552 3300014497 Ga0182008_10040959 Ga0182008_100409592 284
553 3300015261 Ga0182006_1001489 Ga0182006_10014892 284
554 3300015261 Ga0182006_1078660 Ga0182006_10786601 284
555 3300015262 Ga0182007_10049056 Ga0182007_100490561 284
556 3300015265 Ga0182005_1002866 Ga0182005_10028662 284
557 3300017792 Ga0163161_10048777 Ga0163161_100487772 284
558 3300017792 Ga0163161_10288296 Ga0163161_102882961 284
559 3300025206 Ga0209435_100397 Ga0209435_1003971 284
560 3300025224 Ga0209784_100241 Ga0209784_10024126 284
561 3300025225 Ga0209566_100390 Ga0209566_10039026 284
562 3300025226 Ga0209674_100293 Ga0209674_10029326 284
563 3300025229 Ga0209147_100332 Ga0209147_10033226 284
564 3300025230 Ga0209563_100188 Ga0209563_10018826 284
565 3300025230 Ga0209563_100826 Ga0209563_1008262 284
566 3300025242 Ga0209258_100508 Ga0209258_10050826 284
567 3300025253 Ga0209677_100266 Ga0209677_10026626 284
568 3300025292 Ga0209676_1000002 Ga0209676_1000002304 284
569 3300025292 Ga0209676_1000017 Ga0209676_1000017295 284
570 3300025292 Ga0209676_1000441 Ga0209676_100044110 284
571 3300025292 Ga0209676_1006968 Ga0209676_10069683 284
572 3300025298 Ga0209050_1000079 Ga0209050_100007967 284
573 3300025298 Ga0209050_1000242 Ga0209050_100024274 284
574 3300025298 Ga0209050_1000371 Ga0209050_100037165 284
575 3300025298 Ga0209050_1001174 Ga0209050_100117422 284
576 3300025303 Ga0209051_1000001 Ga0209051_1000001304 284
577 3300025303 Ga0209051_1000054 Ga0209051_100005470 284
578 3300025303 Ga0209051_1000234 Ga0209051_100023466 284
579 3300025304 Ga0209257_1000167 Ga0209257_1000167132 284
580 3300025304 Ga0209257_1023089 Ga0209257_10230892 284
581 3300025711 Ga0207696_1000045 Ga0207696_1000045229 284
582 3300025711 Ga0207696_1000090 Ga0207696_1000090110 284
583 3300025711 Ga0207696_1000147 Ga0207696_100014780 284
584 3300025711 Ga0207696_1006368 Ga0207696_10063684 284
585 3300025711 Ga0207696_1012353 Ga0207696_10123533 284
586 3300025728 Ga0207655_1000140 Ga0207655_100014042 284
587 3300025728 Ga0207655_1000333 Ga0207655_100033331 284
588 3300025728 Ga0207655_1004959 Ga0207655_10049599 284
589 3300025728 Ga0207655_1010972 Ga0207655_10109722 284
590 3300025728 Ga0207655_1015837 Ga0207655_10158374 284
591 3300025728 Ga0207655_1017861 Ga0207655_10178612 284
592 3300025728 Ga0207655_1026928 Ga0207655_10269283 284
593 3300025735 Ga0207713_1001032 Ga0207713_10010322 284
594 3300025735 Ga0207713_1001617 Ga0207713_100161715 284
595 3300025735 Ga0207713_1002467 Ga0207713_10024672 284
596 3300025735 Ga0207713_1002698 Ga0207713_100269811 284
597 3300025735 Ga0207713_1004082 Ga0207713_10040827 284
598 3300025735 Ga0207713_1004181 Ga0207713_10041817 284
599 3300025735 Ga0207713_1024073 Ga0207713_10240734 284
600 3300025735 Ga0207713_1045495 Ga0207713_10454952 284
601 3300025914 Ga0207671_10003125 Ga0207671_1000312510 284
602 3300025920 Ga0207649_10000156 Ga0207649_100001566 284
603 3300025923 Ga0207681_10003803 Ga0207681_100038037 284
604 3300025925 Ga0207650_10000266 Ga0207650_100002661 284
605 3300025933 Ga0207706_10001399 Ga0207706_1000139926 284
606 3300025933 Ga0207706_10510774 Ga0207706_105107741 284
607 3300025934 Ga0207686_10032635 Ga0207686_100326354 284
608 3300025935 Ga0207709_10000014 Ga0207709_10000014399 284
609 3300025935 Ga0207709_10064266 Ga0207709_100642662 284
610 3300025945 Ga0207679_10000016 Ga0207679_1000001693 284
611 3300025981 Ga0207640_10065278 Ga0207640_100652782 284
612 3300026041 Ga0207639_10079348 Ga0207639_100793485 284
613 3300027111 Ga0209281_1000018 Ga0209281_100001863 284
614 3300027111 Ga0209281_1000368 Ga0209281_100036849 284
615 3300027471 Ga0209995_1000788 Ga0209995_10007882 284
616 3300027526 Ga0209968_1019181 Ga0209968_10191812 284
617 3300027665 Ga0209983_1000442 Ga0209983_10004421 284
618 3300027666 Ga0209282_1013266 Ga0209282_10132664 284
619 3300027682 Ga0209971_1001513 Ga0209971_10015134 284
620 3300027876 Ga0209974_10011930 Ga0209974_100119302 284
621 3300027907 Ga0207428_10022614 Ga0207428_100226144 284
622 3300027907 Ga0207428_10044673 Ga0207428_100446733 284
623 3300027907 Ga0207428_10083579 Ga0207428_100835792 284
624 3300027907 Ga0207428_10199749 Ga0207428_101997492 284
625 3300030735 Ga0316178_1063861 Ga0316178_106386114 284
626 3300031344 Ga0265316_10182322 Ga0265316_101823222 284
627 3300031548 Ga0307408_100000004 Ga0307408_10000000417 284
628 3300031548 Ga0307408_100040046 Ga0307408_1000400463 284
629 3300031903 Ga0307407_10088687 Ga0307407_100886872 284
630 3300032005 Ga0307411_10134858 Ga0307411_101348582 284
631 3300033180 Ga0307510_10098920 Ga0307510_100989202 284
632 3300038705 Ga0237819_01625 Ga0237819_01625_3849_4715 284
633 3300041405 Ga0439438_003472 Ga0439438_003472_2830_3696 284
634 3300041405 Ga0439438_035300 Ga0439438_035300_125_991 284
635 3300041407 Ga0439447_005892 Ga0439447_005892_2843_3709 284
636 3300041411 Ga0439466_0005482 Ga0439466_0005482_1178_2044 284
637 3300041411 Ga0439466_0012874 Ga0439466_0012874_421_1287 284
638 3300041411 Ga0439466_0021425 Ga0439466_0021425_867_1733 284
639 3300041411 Ga0439466_0022547 Ga0439466_0022547_993_1859 284
640 3300041411 Ga0439466_0040918 Ga0439466_0040918_91_957 284
641 3300041411 Ga0439466_0063208 Ga0439466_0063208_30_896 284
642 3300042006 Ga0439432_030932 Ga0439432_030932_842_1708 284
643 3300042009 Ga0439451_010177 Ga0439451_010177_553_1419 284
644 3300042009 Ga0439451_014540 Ga0439451_014540_634_1500 284
645 3300042010 Ga0439452_000836 Ga0439452_000836_5163_6029 284
646 3300042010 Ga0439452_002288 Ga0439452_002288_5242_6108 284
647 3300042010 Ga0439452_009502 Ga0439452_009502_632_1498 284
648 3300042010 Ga0439452_033175 Ga0439452_033175_319_1185 284
649 3300042013 Ga0439456_000087 Ga0439456_000087_7331_8194 284
650 3300042013 Ga0439456_000624 Ga0439456_000624_2671_3537 284
651 3300042013 Ga0439456_017042 Ga0439456_017042_197_1063 284
652 3300042016 Ga0439463_002248 Ga0439463_002248_3900_4766 284
653 3300042115 Ga0450911_003188 Ga0450911_003188_744_1610 284
654 3300042145 Ga0450906_005074 Ga0450906_005074_1264_2130 284
655 3300042146 Ga0450907_000564 Ga0450907_000564_5118_5984 284
656 3300042146 Ga0450907_010491 Ga0450907_010491_96_962 284
657 3300042146 Ga0450907_011127 Ga0450907_011127_377_1243 284
658 3300042147 Ga0450910_002768 Ga0450910_002768_1064_1930 284
659 3300042185 Ga0450909_004159 Ga0450909_004159_127_993 284
660 3300042461 Ga0439460_0007129 Ga0439460_0007129_373_1239 284
661 3300042461 Ga0439460_0014220 Ga0439460_0014220_823_1689 284
662 3300042993 Ga0439440_0010703 Ga0439440_0010703_327_1193 284
663 3300046452 Ga0495617_010946 Ga0495617_010946_1099_1965 284
664 3300046452 Ga0495617_012205 Ga0495617_012205_1766_2632 284
665 3300046452 Ga0495617_026539 Ga0495617_026539_849_1715 284
666 3300046453 Ga0495627_002600 Ga0495627_002600_1162_2049 284
667 3300046453 Ga0495627_013398 Ga0495627_013398_508_1374 284
668 3300046453 Ga0495627_019154 Ga0495627_019154_888_1754 284
669 3300046453 Ga0495627_019308 Ga0495627_019308_769_1635 284
670 3300046457 Ga0495590_0018511 Ga0495590_0018511_1075_1941 284
671 3300046458 Ga0495591_005068 Ga0495591_005068_2844_3710 284
672 3300046458 Ga0495591_017468 Ga0495591_017468_1124_1990 284
673 3300046458 Ga0495591_017558 Ga0495591_017558_1280_2143 284
674 3300046458 Ga0495591_025491 Ga0495591_025491_602_1468 284
675 3300046460 Ga0495638_0033980 Ga0495638_0033980_1595_2461 284
676 3300046460 Ga0495638_0073735 Ga0495638_0073735_231_1097 284
677 3300046460 Ga0495638_0115550 Ga0495638_0115550_558_1424 284
678 3300046463 Ga0495653_0077120 Ga0495653_0077120_501_1367 284
679 3300046463 Ga0495653_0079074 Ga0495653_0079074_1187_2053 284
680 3300046463 Ga0495653_0084672 Ga0495653_0084672_1025_1891 284
681 3300046463 Ga0495653_0128795 Ga0495653_0128795_897_1763 284
682 3300046471 Ga0495650_0029859 Ga0495650_0029859_631_1497 284
683 3300046471 Ga0495650_0043880 Ga0495650_0043880_638_1504 284
684 3300046471 Ga0495650_0053415 Ga0495650_0053415_400_1266 284
685 3300046474 Ga0495605_0000045 Ga0495605_0000045_14182_15069 284
686 3300046474 Ga0495605_0035699 Ga0495605_0035699_1572_2438 284
687 3300046474 Ga0495605_0042631 Ga0495605_0042631_563_1429 284
688 3300046475 Ga0495639_0003011 Ga0495639_0003011_1609_2475 284
689 3300046491 Ga0495584_0006050 Ga0495584_0006050_606_1472 284
690 3300046491 Ga0495584_0006946 Ga0495584_0006946_169_1035 284
691 3300046491 Ga0495584_0014142 Ga0495584_0014142_2008_2874 284
692 3300046491 Ga0495584_0023996 Ga0495584_0023996_1066_1932 284
693 3300046491 Ga0495584_0037158 Ga0495584_0037158_528_1394 284
694 3300046491 Ga0495584_0037455 Ga0495584_0037455_1014_1880 284
695 3300046491 Ga0495584_0041671 Ga0495584_0041671_558_1424 284
696 3300046491 Ga0495584_0056978 Ga0495584_0056978_1017_1883 284
697 3300046492 Ga0495585_0028915 Ga0495585_0028915_1361_2227 284
698 3300046492 Ga0495585_0037233 Ga0495585_0037233_766_1632 284
699 3300046492 Ga0495585_0069557 Ga0495585_0069557_492_1358 284
700 3300046499 Ga0495594_0043177 Ga0495594_0043177_1248_2135 284
701 3300046500 Ga0495596_0003925 Ga0495596_0003925_2071_2937 284
702 3300046500 Ga0495596_0052050 Ga0495596_0052050_351_1217 284
703 3300046501 Ga0495607_0007008 Ga0495607_0007008_3436_4302 284
704 3300046501 Ga0495607_0018591 Ga0495607_0018591_2091_2957 284
705 3300046501 Ga0495607_0038180 Ga0495607_0038180_1540_2406 284
706 3300046501 Ga0495607_0078457 Ga0495607_0078457_139_1005 284
707 3300046506 Ga0495583_0002109 Ga0495583_0002109_16269_17135 284
708 3300046506 Ga0495583_0002827 Ga0495583_0002827_7073_7960 284
709 3300046506 Ga0495583_0009758 Ga0495583_0009758_4255_5121 284
710 3300046506 Ga0495583_0035369 Ga0495583_0035369_1080_1946 284
711 3300046506 Ga0495583_0038926 Ga0495583_0038926_261_1127 284
712 3300046507 Ga0495606_0001557 Ga0495606_0001557_1431_2297 284
713 3300046507 Ga0495606_0002202 Ga0495606_0002202_20903_21766 284
714 3300046507 Ga0495606_0004299 Ga0495606_0004299_6166_7032 284
715 3300046507 Ga0495606_0011916 Ga0495606_0011916_5166_6032 284
716 3300046507 Ga0495606_0012904 Ga0495606_0012904_4933_5799 284
717 3300046507 Ga0495606_0049659 Ga0495606_0049659_1159_2025 284
718 3300046507 Ga0495606_0060956 Ga0495606_0060956_1445_2311 284
719 3300046507 Ga0495606_0078390 Ga0495606_0078390_78_944 284
720 3300046507 Ga0495606_0098874 Ga0495606_0098874_78_944 284
721 3300046512 Ga0495610_0017381 Ga0495610_0017381_2976_3839 284
722 3300046512 Ga0495610_0043864 Ga0495610_0043864_490_1356 284
723 3300046512 Ga0495610_0048765 Ga0495610_0048765_1037_1903 284
724 3300046512 Ga0495610_0075000 Ga0495610_0075000_154_1020 284
725 3300046513 Ga0495616_0016127 Ga0495616_0016127_812_1678 284
726 3300046513 Ga0495616_0033659 Ga0495616_0033659_948_1814 284
727 3300046513 Ga0495616_0038723 Ga0495616_0038723_1460_2326 284
728 3300046513 Ga0495616_0041034 Ga0495616_0041034_1029_1895 284
729 3300046513 Ga0495616_0042438 Ga0495616_0042438_903_1769 284
730 3300046513 Ga0495616_0051275 Ga0495616_0051275_1024_1890 284
731 3300046515 Ga0495620_0000001 Ga0495620_0000001_135404_136291 284
732 3300046515 Ga0495620_0009249 Ga0495620_0009249_1760_2626 284
733 3300046515 Ga0495620_0023343 Ga0495620_0023343_529_1395 284
734 3300046515 Ga0495620_0076795 Ga0495620_0076795_94_960 284
735 3300046518 Ga0495631_0019634 Ga0495631_0019634_1220_2086 284
736 3300046518 Ga0495631_0026377 Ga0495631_0026377_1250_2116 284
737 3300046519 Ga0495632_0002643 Ga0495632_0002643_7584_8450 284
738 3300046519 Ga0495632_0005088 Ga0495632_0005088_6720_7586 284
739 3300046519 Ga0495632_0020004 Ga0495632_0020004_995_1861 284
740 3300046519 Ga0495632_0021622 Ga0495632_0021622_438_1304 284
741 3300046519 Ga0495632_0047465 Ga0495632_0047465_901_1767 284
742 3300046520 Ga0495637_0001790 Ga0495637_0001790_2224_3090 284
743 3300046520 Ga0495637_0014025 Ga0495637_0014025_2422_3288 284
744 3300046520 Ga0495637_0015776 Ga0495637_0015776_1582_2448 284
745 3300046520 Ga0495637_0018058 Ga0495637_0018058_1230_2096 284
746 3300046520 Ga0495637_0026474 Ga0495637_0026474_471_1337 284
747 3300046520 Ga0495637_0056900 Ga0495637_0056900_186_1052 284
748 3300046520 Ga0495637_0069799 Ga0495637_0069799_526_1392 284
749 3300046522 Ga0495643_0003239 Ga0495643_0003239_65_928 284
750 3300046522 Ga0495643_0027832 Ga0495643_0027832_2026_2892 284
751 3300046522 Ga0495643_0115583 Ga0495643_0115583_65_928 284
752 3300046523 Ga0495644_0016310 Ga0495644_0016310_927_1793 284
753 3300046523 Ga0495644_0020430 Ga0495644_0020430_1053_1919 284
754 3300046523 Ga0495644_0022569 Ga0495644_0022569_923_1789 284
755 3300046524 Ga0495648_0001740 Ga0495648_0001740_955_1821 284
756 3300046524 Ga0495648_0005382 Ga0495648_0005382_4137_5024 284
757 3300046524 Ga0495648_0010306 Ga0495648_0010306_1761_2627 284
758 3300046524 Ga0495648_0018275 Ga0495648_0018275_591_1457 284
759 3300046524 Ga0495648_0049120 Ga0495648_0049120_1492_2358 284
760 3300046524 Ga0495648_0055774 Ga0495648_0055774_1043_1909 284
761 3300046524 Ga0495648_0147540 Ga0495648_0147540_204_1070 284
762 3300046526 Ga0495666_0044498 Ga0495666_0044498_1021_1887 284
763 3300046528 Ga0495642_0001494 Ga0495642_0001494_9008_9874 284
764 3300046528 Ga0495642_0002271 Ga0495642_0002271_4934_5800 284
765 3300046528 Ga0495642_0003355 Ga0495642_0003355_660_1526 284
766 3300046530 Ga0495654_0005186 Ga0495654_0005186_4625_5491 284
767 3300046530 Ga0495654_0028531 Ga0495654_0028531_1635_2501 284
768 3300046530 Ga0495654_0035572 Ga0495654_0035572_471_1337 284
769 3300046530 Ga0495654_0083190 Ga0495654_0083190_248_1114 284
770 3300046530 Ga0495654_0098157 Ga0495654_0098157_332_1198 284
771 3300046536 Ga0495587_0092871 Ga0495587_0092871_33_899 284
772 3300046538 Ga0495609_0000012 Ga0495609_0000012_173101_173988 284
773 3300046538 Ga0495609_0003344 Ga0495609_0003344_6828_7694 284
774 3300046538 Ga0495609_0003527 Ga0495609_0003527_2402_3268 284
775 3300046538 Ga0495609_0008316 Ga0495609_0008316_3635_4501 284
776 3300046542 Ga0495597_0017788 Ga0495597_0017788_1815_2681 284
777 3300046542 Ga0495597_0040151 Ga0495597_0040151_802_1668 284
778 3300046542 Ga0495597_0067733 Ga0495597_0067733_549_1415 284
779 3300046557 Ga0495622_0005470 Ga0495622_0005470_4917_5783 284
780 3300046557 Ga0495622_0016696 Ga0495622_0016696_1569_2435 284
781 3300046557 Ga0495622_0031473 Ga0495622_0031473_1180_2046 284
782 3300046557 Ga0495622_0076376 Ga0495622_0076376_397_1263 284
783 3300046558 Ga0495633_0000034 Ga0495633_0000034_6457_7344 284
784 3300046558 Ga0495633_0017329 Ga0495633_0017329_1768_2634 284
785 3300046615 Ga0495656_0002963 Ga0495656_0002963_3639_4505 284
786 3300046616 Ga0495668_0022598 Ga0495668_0022598_1711_2577 284
787 3300046642 Ga0495634_0039721 Ga0495634_0039721_1452_2318 284
788 3300046648 Ga0495611_0000087 Ga0495611_0000087_594_1481 284
789 3300046648 Ga0495611_0019217 Ga0495611_0019217_1562_2428 284
790 3300046660 Ga0495625_0014739 Ga0495625_0014739_1071_1937 284
791 3300046660 Ga0495625_0049192 Ga0495625_0049192_1121_1987 284
792 3300046660 Ga0495625_0056382 Ga0495625_0056382_958_1824 284
793 3300046660 Ga0495625_0059637 Ga0495625_0059637_502_1368 284
794 3300046660 Ga0495625_0207763 Ga0495625_0207763_407_1273 284
795 3300046663 Ga0495635_0043323 Ga0495635_0043323_1411_2277 284
796 3300046665 Ga0495661_0000004 Ga0495661_0000004_376693_377580 284
797 3300046665 Ga0495661_0000028 Ga0495661_0000028_172276_173142 284
798 3300046665 Ga0495661_0029104 Ga0495661_0029104_2181_3047 284
799 3300046665 Ga0495661_0033680 Ga0495661_0033680_1664_2530 284
800 3300046665 Ga0495661_0035431 Ga0495661_0035431_1693_2559 284
801 3300046674 Ga0495588_0013704 Ga0495588_0013704_619_1485 284
802 3300046680 Ga0495646_0060500 Ga0495646_0060500_454_1320 284
803 3300046684 Ga0495669_0005702 Ga0495669_0005702_1246_2112 284
804 3300046689 Ga0495613_0089766 Ga0495613_0089766_1020_1886 284
805 3300046690 Ga0495624_0004989 Ga0495624_0004989_1015_1881 284
806 3300046691 Ga0495670_0006645 Ga0495670_0006645_4570_5433 284
807 3300046691 Ga0495670_0023440 Ga0495670_0023440_1009_1875 284
808 3300046691 Ga0495670_0034406 Ga0495670_0034406_483_1349 284
809 3300046691 Ga0495670_0038914 Ga0495670_0038914_849_1715 284
810 3300046692 Ga0495671_0001003 Ga0495671_0001003_4865_5731 284
811 3300046692 Ga0495671_0005757 Ga0495671_0005757_122_985 284
812 3300046692 Ga0495671_0005823 Ga0495671_0005823_5438_6304 284
813 3300046692 Ga0495671_0006451 Ga0495671_0006451_853_1719 284
814 3300046692 Ga0495671_0012528 Ga0495671_0012528_1268_2155 284
815 3300046692 Ga0495671_0027502 Ga0495671_0027502_1524_2390 284
816 3300046692 Ga0495671_0030431 Ga0495671_0030431_449_1315 284
817 3300046692 Ga0495671_0038771 Ga0495671_0038771_1189_2055 284
818 3300046692 Ga0495671_0046929 Ga0495671_0046929_404_1270 284
819 3300046692 Ga0495671_0070167 Ga0495671_0070167_84_950 284
820 3300046694 Ga0495649_0004978 Ga0495649_0004978_119_985 284
821 3300046694 Ga0495649_0013633 Ga0495649_0013633_902_1768 284
822 3300046694 Ga0495649_0017670 Ga0495649_0017670_1483_2346 284
823 3300046694 Ga0495649_0031447 Ga0495649_0031447_501_1367 284
824 3300046694 Ga0495649_0074345 Ga0495649_0074345_104_970 284
825 3300046694 Ga0495649_0077622 Ga0495649_0077622_530_1396 284
826 3300046694 Ga0495649_0089796 Ga0495649_0089796_431_1294 284
827 3300046794 Ga0495589_0004519 Ga0495589_0004519_2756_3622 284
828 3300046794 Ga0495589_0009874 Ga0495589_0009874_1164_2030 284
829 3300046794 Ga0495589_0025524 Ga0495589_0025524_1587_2453 284
830 3300046810 Ga0495660_0005085 Ga0495660_0005085_542_1429 284
831 3300046810 Ga0495660_0008278 Ga0495660_0008278_1811_2677 284
832 3300046810 Ga0495660_0048407 Ga0495660_0048407_1366_2232 284
833 3300046810 Ga0495660_0067759 Ga0495660_0067759_874_1740 284
834 3300046810 Ga0495660_0085531 Ga0495660_0085531_699_1565 284
835 3300047318 Ga0495636_0006933 Ga0495636_0006933_2157_3023 284
836 3300047320 Ga0495672_0007313 Ga0495672_0007313_932_1798 284
837 3300047320 Ga0495672_0034531 Ga0495672_0034531_1654_2520 284
838 3300047320 Ga0495672_0047729 Ga0495672_0047729_1058_1924 284
839 3300047320 Ga0495672_0050453 Ga0495672_0050453_587_1453 284
840 3300047320 Ga0495672_0052406 Ga0495672_0052406_465_1331 284
841 3300047321 Ga0495676_0021883 Ga0495676_0021883_3365_4231 284
842 3300047321 Ga0495676_0088536 Ga0495676_0088536_1029_1895 284
843 3300047322 Ga0495680_0052297 Ga0495680_0052297_32_898 284
844 3300047323 Ga0495683_0000059 Ga0495683_0000059_12946_13812 284
845 3300047323 Ga0495683_0000445 Ga0495683_0000445_17544_18431 284
846 3300047323 Ga0495683_0004382 Ga0495683_0004382_2013_2879 284
847 3300047323 Ga0495683_0013480 Ga0495683_0013480_1063_1929 284
848 3300047323 Ga0495683_0060049 Ga0495683_0060049_521_1387 284
849 3300047443 Ga0495687_019958 Ga0495687_019958_999_1865 284
850 3300047443 Ga0495687_034916 Ga0495687_034916_836_1702 284
851 3300047444 Ga0495675_0049885 Ga0495675_0049885_1528_2394 284
852 3300047446 Ga0495679_004065 Ga0495679_004065_1440_2327 284
853 3300047446 Ga0495679_031872 Ga0495679_031872_19_885 284
854 3300047447 Ga0495685_024708 Ga0495685_024708_82_948 284
855 3300047469 Ga0495673_0006116 Ga0495673_0006116_1064_1930 284
856 3300047469 Ga0495673_0006812 Ga0495673_0006812_885_1751 284
857 3300047469 Ga0495673_0019115 Ga0495673_0019115_661_1527 284
858 3300047469 Ga0495673_0024606 Ga0495673_0024606_813_1679 284
859 3300047469 Ga0495673_0029142 Ga0495673_0029142_1372_2238 284
860 3300047469 Ga0495673_0049795 Ga0495673_0049795_939_1805 284
861 3300047469 Ga0495673_0061554 Ga0495673_0061554_179_1045 284
862 3300047470 Ga0495681_0015785 Ga0495681_0015785_2553_3419 284
863 3300047470 Ga0495681_0022519 Ga0495681_0022519_1174_2040 284
864 3300047470 Ga0495681_0032114 Ga0495681_0032114_1360_2226 284
865 3300047470 Ga0495681_0038614 Ga0495681_0038614_1368_2234 284
866 3300047470 Ga0495681_0055559 Ga0495681_0055559_921_1787 284
867 3300047472 Ga0495686_0037920 Ga0495686_0037920_1169_2035 284
868 3300047472 Ga0495686_0062452 Ga0495686_0062452_576_1442 284
869 3300048088 Ga0495602_0112382 Ga0495602_0112382_987_1853 284
870 3300048091 Ga0495626_0001466 Ga0495626_0001466_16696_17562 284
871 3300048091 Ga0495626_0003622 Ga0495626_0003622_4441_5307 284
872 3300048091 Ga0495626_0003788 Ga0495626_0003788_4436_5302 284
873 3300048091 Ga0495626_0017420 Ga0495626_0017420_1101_1967 284
874 3300048091 Ga0495626_0036982 Ga0495626_0036982_428_1294 284
875 3300048091 Ga0495626_0053732 Ga0495626_0053732_567_1433 284
876 3300048091 Ga0495626_0083251 Ga0495626_0083251_69_935 284
877 3300048905 Ga0496102_0001878 Ga0496102_0001878_11356_12222 284
878 3300048919 Ga0496116_0005694 Ga0496116_0005694_9171_10037 284
879 3300048919 Ga0496116_0036352 Ga0496116_0036352_2305_3171 284
880 3300048919 Ga0496116_0072541 Ga0496116_0072541_431_1297 284
881 3300048920 Ga0496117_0005527 Ga0496117_0005527_837_1703 284
882 3300048920 Ga0496117_0083816 Ga0496117_0083816_662_1528 284
883 3300048920 Ga0496117_0112417 Ga0496117_0112417_291_1157 284
884 3300048921 Ga0496118_0056794 Ga0496118_0056794_662_1528 284
885 3300048921 Ga0496118_0095589 Ga0496118_0095589_578_1444 284
886 3300048924 Ga0496121_0120511 Ga0496121_0120511_149_1015 284
887 3300048925 Ga0496122_0086385 Ga0496122_0086385_974_1840 284
888 3300048926 Ga0496123_0010850 Ga0496123_0010850_652_1539 284
889 3300048926 Ga0496123_0060534 Ga0496123_0060534_608_1474 284
890 3300048927 Ga0496124_0081171 Ga0496124_0081171_295_1161 284
891 3300048929 Ga0496126_0270528 Ga0496126_0270528_68_961 284
892 3300049459 Ga0495678_000036 Ga0495678_000036_182912_183799 284
893 3300049459 Ga0495678_006946 Ga0495678_006946_5043_5909 284
894 3300049459 Ga0495678_025219 Ga0495678_025219_1222_2088 284
895 3300049459 Ga0495678_026220 Ga0495678_026220_366_1232 284
896 3300049459 Ga0495678_059471 Ga0495678_059471_140_1006 284
897 3300049460 Ga0495682_0020359 Ga0495682_0020359_1163_2029 284
898 3300049460 Ga0495682_0059803 Ga0495682_0059803_281_1147 284
899 3300053111 Ga0500572_010015 Ga0500572_010015_991_1857 284
900 iso_pu_bacteria 2507262055 2507507158 284
901 iso_pu_bacteria 2508501009 2508541208 284
902 iso_pu_bacteria 2508501042 2508693456 284
903 iso_pu_bacteria 2508501050 2508729356 284
904 iso_pu_bacteria 2508501114 2509077833 284
905 iso_pu_bacteria 2508501128 2509147101 284
906 iso_pu_bacteria 2510461069 2510840821 284
907 iso_pu_bacteria 2510917030 2511193497 284
908 iso_pu_bacteria 2511231027 2511392114 284
909 iso_pu_bacteria 2511231028 2511397706 284
910 iso_pu_bacteria 2513237092 2513627116 284
911 iso_pu_bacteria 2513237094 2513637225 284
912 iso_pu_bacteria 2513237095 2513651617 284
913 iso_pu_bacteria 2513237096 2513655804 284
914 iso_pu_bacteria 2513237098 2513672006 284
915 iso_pu_bacteria 2513237101 2513696498 284
916 iso_pu_bacteria 2513237102 2513703035 284
917 iso_pu_bacteria 2513237104 2513717409 284
918 iso_pu_bacteria 2513237137 2513856700 284
919 iso_pu_bacteria 2513237138 2513866075 284
920 iso_pu_bacteria 2513237139 2513876779 284
921 iso_pu_bacteria 2513237141 2513887509 284
922 iso_pu_bacteria 2513237145 2513917283 284
923 iso_pu_bacteria 2513237161 2514012183 284
924 iso_pu_bacteria 2513237351 2514589950 284
925 iso_pu_bacteria 2515154112 2515628815 284
926 iso_pu_bacteria 2517093001 2517107370 284
927 iso_pu_bacteria 2517572143 2517895435 284
928 iso_pu_bacteria 2524023205 2524439545 284
929 iso_pu_bacteria 2524023210 2524469215 284
930 iso_pu_bacteria 2524023228 2524539609 284
931 iso_pu_bacteria 2528768022 2528851012 284
932 iso_pu_bacteria 2558860983 2561467802 284
933 iso_pu_bacteria 2582581298 2585226806 284
934 iso_pu_bacteria 2582581299 2585229825 284
935 iso_pu_bacteria 2582581304 2585254935 284
936 iso_pu_bacteria 2582581867 2585404330 284
937 iso_pu_bacteria 2585427529 2585550221 284
938 iso_pu_bacteria 2585427590 2585821970 284
939 iso_pu_bacteria 2585427594 2585843031 284
940 iso_pu_bacteria 2597490356 2599103784 284
941 iso_pu_bacteria 2602042107 2603857789 284
942 iso_pu_bacteria 2617270735 2617348024 284
943 iso_pu_bacteria 2617270741 2617377743 284
944 iso_pu_bacteria 2643221551 2643775556 284
945 iso_pu_bacteria 2643221555 2643794002 284
946 iso_pu_bacteria 2643221568 2643854370 284
947 iso_pu_bacteria 2643221599 2644005499 284
948 iso_pu_bacteria 2643221634 2644192539 284
949 iso_pu_bacteria 2643221637 2644209368 284
950 iso_pu_bacteria 2643221643 2644238487 284
951 iso_pu_bacteria 2643221651 2644291281 284
952 iso_pu_bacteria 2643221653 2644298161 284
953 iso_pu_bacteria 2643221718 2644652896 284
954 iso_pu_bacteria 2643221719 2644656413 284
955 iso_pu_bacteria 2643221733 2644729811 284
956 iso_pu_bacteria 2667528175 2671122110 284
957 iso_pu_bacteria 2693429784 2694634421 284
958 iso_pu_bacteria 2721755755 2723843007 284
959 iso_pu_bacteria 2728368998 2728754409 284
960 iso_pu_bacteria 2738541293 2738804157 284
961 iso_pu_bacteria 2744054633 2745081818 284
962 iso_pu_bacteria 2765235802 2765465976 284
963 iso_pu_bacteria 2767802442 2770196612 284
964 iso_pu_bacteria 2773857925 2774870133 284
965 iso_pu_bacteria 2775506901 2776258694 284
966 iso_pu_bacteria 2775506902 2776267861 284
967 iso_pu_bacteria 2775506902 2776269278 284
968 iso_pu_bacteria 2775506904 2776281832 284
969 iso_pu_bacteria 2775506904 2776283583 284
970 iso_pu_bacteria 2775507049 2776915833 284
971 iso_pu_bacteria 2791355196 2793065978 284
972 iso_pu_bacteria 2791355197 2793069413 284
973 iso_pu_bacteria 2791355199 2793082439 284
974 iso_pu_bacteria 2802429603 2805918759 284
975 iso_pu_bacteria 2816332527 2818243242 284
976 iso_pu_bacteria 2818991272 2819244245 284
977 iso_pu_bacteria 2821123053 2821126665 284
978 iso_pu_bacteria 2824600985 2824605486 284
979 iso_pu_bacteria 2824609381 2824614824 284
980 iso_pu_bacteria 2824617872 2824622612 284
981 iso_pu_bacteria 2824626560 2824631775 284
982 iso_pu_bacteria 2824635225 2824638943 284
983 iso_pu_bacteria 2824644064 2824648875 284
984 iso_pu_bacteria 2824653114 2824658075 284
985 iso_pu_bacteria 2824661429 2824667920 284
986 iso_pu_bacteria 2824671348 2824673919 284
987 iso_pu_bacteria 2824679649 2824681669 284
988 iso_pu_bacteria 2824687955 2824690633 284
989 iso_pu_bacteria 2824696289 2824698154 284
990 iso_pu_bacteria 2824704595 2824707495 284
991 iso_pu_bacteria 2824714736 2824721310 284
992 iso_pu_bacteria 2824723954 2824731315 284
993 iso_pu_bacteria 2824732956 2824736958 284
994 iso_pu_bacteria 2824746037 2824746429 284
995 iso_pu_bacteria 2824753945 2824759244 284
996 iso_pu_bacteria 2824763712 2824769552 284
997 iso_pu_bacteria 2824773399 2824776135 284
998 iso_pu_bacteria 2835312727 2835316298 284
999 iso_pu_bacteria 2837678835 2837683410 284
1000 iso_pu_bacteria 2838122688 2838127007 284
1001 iso_pu_bacteria 2838736955 2838740272 284
1002 iso_pu_bacteria 2839993093 2839993609 284
1003 iso_pu_bacteria 2840764183 2840766630 284
1004 iso_pu_bacteria 2841840854 2841843603 284
1005 iso_pu_bacteria 2841941048 2841945513 284
1006 iso_pu_bacteria 2841949485 2841954729 284
1007 iso_pu_bacteria 2841957949 2841965513 284
1008 iso_pu_bacteria 2841966195 2841974268 284
1009 iso_pu_bacteria 2841974524 2841980570 284
1010 iso_pu_bacteria 2841983080 2841988741 284
1011 iso_pu_bacteria 2842038055 2842045030 284
1012 iso_pu_bacteria 2842045827 2842052784 284
1013 iso_pu_bacteria 2842140634 2842143323 284
1014 iso_pu_bacteria 2842871566 2842874911 284
1015 iso_pu_bacteria 2844315083 2844320529 284
1016 iso_pu_bacteria 2846952575 2846957471 284
1017 iso_pu_bacteria 2847930680 2847938072 284
1018 iso_pu_bacteria 2847939898 2847939987 284
1019 iso_pu_bacteria 2848858292 2848863248 284
1020 iso_pu_bacteria 2849076700 2849077813 284
1021 iso_pu_bacteria 2857509624 2857510989 284
1022 iso_pu_bacteria 2857531043 2857536757 284
1023 iso_pu_bacteria 2874590934 2874596097 284
1024 iso_pu_bacteria 2874604998 2874606339 284
1025 iso_pu_bacteria 2874612657 2874616788 284
1026 iso_pu_bacteria 2874620515 2874625855 284
1027 iso_pu_bacteria 2874628541 2874633173 284
1028 iso_pu_bacteria 2874645413 2874650921 284
1029 iso_pu_bacteria 2876761206 2876769108 284
1030 iso_pu_bacteria 2876771140 2876776075 284
1031 iso_pu_bacteria 2876808645 2876810779 284
1032 iso_pu_bacteria 2876818435 2876820653 284
1033 iso_pu_bacteria 2879074833 2879080164 284
1034 iso_pu_bacteria 2879083081 2879084381 284
1035 iso_pu_bacteria 2879099564 2879100216 284
1036 iso_pu_bacteria 2879110137 2879118116 284
1037 iso_pu_bacteria 2879127579 2879129937 284
1038 iso_pu_bacteria 2879142872 2879147415 284
1039 iso_pu_bacteria 2881364244 2881367797 284
1040 iso_pu_bacteria 2881665667 2881672250 284
1041 iso_pu_bacteria 2882456835 2882461987 284
1042 iso_pu_bacteria 2884298095 2884299590 284
1043 iso_pu_bacteria 2885366525 2885368466 284
1044 iso_pu_bacteria 2885374607 2885382168 284
1045 iso_pu_bacteria 2885383462 2885383705 284
1046 iso_pu_bacteria 2885409591 2885410053 284
1047 iso_pu_bacteria 2888378607 2888386021 284
1048 iso_pu_bacteria 2888388044 2888392264 284
1049 iso_pu_bacteria 2888419890 2888426139 284
1050 iso_pu_bacteria 2889033259 2889033701 284
1051 iso_pu_bacteria 2889790730 2889793573 284
1052 iso_pu_bacteria 2889914905 2889918712 284
1053 iso_pu_bacteria 2893066018 2893068059 284
1054 iso_pu_bacteria 2894232714 2894241995 284
1055 iso_pu_bacteria 2903727486 2903732820 284
1056 iso_pu_bacteria 2903748898 2903750867 284
1057 iso_pu_bacteria 2903768456 2903770059 284
1058 iso_pu_bacteria 2904578770 2904579693 284
1059 iso_pu_bacteria 2904666416 2904673784 284
1060 iso_pu_bacteria 2904690495 2904698780 284
1061 iso_pu_bacteria 2904699407 2904710900 284
1062 iso_pu_bacteria 2904711408 2904717603 284
1063 iso_pu_bacteria 2906602504 2906605619 284
1064 iso_pu_bacteria 2906610324 2906615946 284
1065 iso_pu_bacteria 2906626472 2906627997 284
1066 iso_pu_bacteria 2906635258 2906639043 284
1067 iso_pu_bacteria 2906643746 2906644082 284
1068 iso_pu_bacteria 2906660503 2906662091 284
1069 iso_pu_bacteria 2908739725 2908740960 284
1070 iso_pu_bacteria 2908756301 2908759293 284
1071 iso_pu_bacteria 2908775508 2908782211 284
1072 iso_pu_bacteria 2917699015 2917700190 284
1073 iso_pu_bacteria 2919100787 2919102117 284
1074 iso_pu_bacteria 2919119836 2919120640 284
1075 iso_pu_bacteria 2919119836 2919124363 284
1076 iso_pu_bacteria 2919166419 2919168759 284
1077 iso_pu_bacteria 2919450847 2919455517 284
1078 iso_pu_bacteria 2922361189 2922367058 284
1079 iso_pu_bacteria 2922368715 2922376349 284
1080 iso_pu_bacteria 2922386360 2922390162 284
1081 iso_pu_bacteria 2922393267 2922399933 284
1082 iso_pu_bacteria 2922425934 2922432082 284
1083 iso_pu_bacteria 2923556063 2923558378 284
1084 iso_pu_bacteria 2929615660 2929624005 284
1085 iso_pu_bacteria 2929624759 2929633146 284
1086 iso_pu_bacteria 2932784394 2932792685 284
1087 iso_pu_bacteria 2932794094 2932797848 284
1088 iso_pu_bacteria 2932801729 2932806384 284
1089 iso_pu_bacteria 2932809354 2932815225 284
1090 iso_pu_bacteria 2932818245 2932824496 284
1091 iso_pu_bacteria 2932828146 2932832104 284
1092 iso_pu_bacteria 2933577622 2933585906 284
1093 iso_pu_bacteria 2935608549 2935610463 284
1094 iso_pu_bacteria 2935616580 2935622043 284
1095 iso_pu_bacteria 2935630451 2935631041 284
1096 iso_pu_bacteria 2935638405 2935643947 284
1097 iso_pu_bacteria 2935648319 2935654335 284
1098 iso_pu_bacteria 2935656913 2935663215 284
1099 iso_pu_bacteria 2935665750 2935669138 284
1100 iso_pu_bacteria 2935675223 2935683304 284
1101 iso_pu_bacteria 2935684952 2935692245 284
1102 iso_pu_bacteria 2935694250 2935700584 284
1103 iso_pu_bacteria 2935703347 2935708787 284
1104 iso_pu_bacteria 2935713505 2935720517 284
1105 iso_pu_bacteria 2935722832 2935729798 284
1106 iso_pu_bacteria 2935732158 2935739220 284
1107 iso_pu_bacteria 2935741537 2935748239 284
1108 iso_pu_bacteria 2935750917 2935758442 284
1109 iso_pu_bacteria 2935760218 2935766131 284
1110 iso_pu_bacteria 2935769743 2935771010 284
1111 iso_pu_bacteria 2935777560 2935781179 284
1112 iso_pu_bacteria 2935785616 2935786289 284
1113 iso_pu_bacteria 2935793552 2935793914 284
1114 iso_pu_bacteria 2935801545 2935805854 284
1115 iso_pu_bacteria 2935810662 2935815587 284
1116 iso_pu_bacteria 2935819856 2935823624 284
1117 iso_pu_bacteria 2935827899 2935833199 284
1118 iso_pu_bacteria 2935837841 2935843231 284
1119 iso_pu_bacteria 2935847175 2935849150 284
1120 iso_pu_bacteria 2935855204 2935860290 284
1121 iso_pu_bacteria 2935864058 2935867687 284
1122 iso_pu_bacteria 2935873716 2935878503 284
1123 iso_pu_bacteria 2935883170 2935888391 284
1124 iso_pu_bacteria 2935908558 2935912760 284
1125 iso_pu_bacteria 2935916978 2935922921 284
1126 iso_pu_bacteria 2935926038 2935930346 284
1127 iso_pu_bacteria 2935934488 2935939246 284
1128 iso_pu_bacteria 2935942939 2935946194 284
1129 iso_pu_bacteria 2935951376 2935955531 284
1130 iso_pu_bacteria 2935959822 2935966842 284
1131 iso_pu_bacteria 2935967501 2935972098 284
1132 iso_pu_bacteria 2935975950 2935976032 284
1133 iso_pu_bacteria 2935984226 2935986477 284
1134 iso_pu_bacteria 2935992306 2935998613 284
1135 iso_pu_bacteria 2936002035 2936006920 284
1136 iso_pu_bacteria 2936011229 2936017371 284
1137 iso_pu_bacteria 2936019824 2936025873 284
1138 iso_pu_bacteria 2936028420 2936034719 284
1139 iso_pu_bacteria 2936037263 2936040825 284
1140 iso_pu_bacteria 2936046547 2936052776 284
1141 iso_pu_bacteria 2936055302 2936059971 284
1142 iso_pu_bacteria 2940556831 2940564346 284
1143 iso_pu_bacteria 2941507105 2941507693 284
1144 iso_pu_bacteria 2941515067 2941516120 284
1145 iso_pu_bacteria 2941523033 2941523172 284
1146 iso_pu_bacteria 2941531003 2941531727 284
1147 iso_pu_bacteria 2941538514 2941544777 284
1148 iso_pu_bacteria 2989776772 2989776884 284
1149 iso_pu_bacteria 2996336353 2996337777 284
1150 iso_pu_bacteria 3002141150 3002141988 284
1151 iso_pu_bacteria 3005445848 3005450539 284
1152 iso_pu_bacteria 3005452660 3005457718 284
1153 iso_pu_bacteria 3005474847 3005476895 284
1154 iso_pu_bacteria 3005483717 3005489154 284
1155 iso_pu_bacteria 3005506211 3005511522 284
1156 iso_pu_bacteria 3005587118 3005594400 284
1157 iso_pu_bacteria 3005594810 3005600922 284
1158 iso_pu_bacteria 3005710791 3005716315 284
1159 iso_pu_bacteria 3005718088 3005723706 284
1160 iso_pu_bacteria 641522639 641642203 284
1161 iso_pu_bacteria 8005246636 8005247838 284
1162 iso_pu_bacteria 8006926726 8006932581 284
1163 iso_pu_bacteria 8006933436 8006934522 284
1164 iso_pu_bacteria 8006964411 8006966593 284
1165 iso_pu_bacteria 8006973647 8006974492 284
1166 iso_pu_bacteria 8006984368 8006989442 284
1167 iso_pu_bacteria 8006994254 8006997910 284
1168 iso_pu_bacteria 8016511872 8016520062 284
1169 iso_pu_bacteria 8016522445 8016527981 284
1170 iso_pu_bacteria 8016530956 8016533104 284
1171 iso_pu_bacteria 8016539877 8016546339 284
1172 iso_pu_bacteria 8016548790 8016555786 284
1173 iso_pu_bacteria 8016557553 8016564137 284
1174 iso_pu_bacteria 8016575299 8016575679 284
1175 iso_pu_bacteria 8016595262 8016601840 284
1176 iso_pu_bacteria 8016603502 8016608410 284
1177 iso_pu_bacteria 8016613128 8016616457 284
1178 iso_pu_bacteria 8016622563 8016624681 284
1179 iso_pu_bacteria 8016630954 8016638170 284
1180 iso_pu_bacteria 8017057580 8017065492 284
1181 iso_pu_bacteria 8018150411 8018154128 284
1182 iso_pu_bacteria 8019538911 8019546949 284
1183 iso_pu_bacteria 8019547302 8019551720 284
1184 iso_pu_bacteria 8019555841 8019564157 284
1185 iso_pu_bacteria 8019565922 8019574231 284
1186 iso_pu_bacteria 8019576017 8019584894 284
1187 iso_pu_bacteria 8019608314 8019609765 284
1188 iso_pu_bacteria 8019619141 8019620350 284
1189 iso_pu_bacteria 8019629233 8019632752 284
1190 iso_pu_bacteria 8019638758 8019647179 284
1191 iso_pu_bacteria 8019648815 8019655508 284
1192 iso_pu_bacteria 8019678201 8019686066 284
1193 iso_pu_bacteria 8045864390 8045867823 284
1194 iso_pu_bacteria 8054460903 8054465432 284
1195 iso_pu_bacteria 8055742211 8055744523 284
1196 iso_pu_bacteria 8056673599 8056674938 284
1197 iso_pu_bacteria 8056681323 8056682151 284
1198 iso_pu_bacteria 8056689827 8056694846 284
1199 iso_pu_bacteria 8056875544 8056876433 284
1200 iso_pu_bacteria 8056967851 8056970435 284
1201 3300003794 Ga0055531_10041864 Ga0055531_100418642 285
1202 3300005577 Ga0068857_100458514 Ga0068857_1004585141 285
1203 3300025304 Ga0209257_1000239 Ga0209257_100023927 285
1204 3300046810 Ga0495660_0004735 Ga0495660_0004735_1814_2680 285
1205 3300047469 Ga0495673_0003388 Ga0495673_0003388_626_1492 285
1206 iso_pu_bacteria 2857524615 2857527161 285
1207 iso_pu_bacteria 2919073203 2919078277 285
1208 3300005985 Ga0081539_10018502 Ga0081539_100185024 286
1209 3300007076 Ga0075435_100016626 Ga0075435_1000166264 286
1210 3300031995 Ga0307409_100139382 Ga0307409_1001393822 286
1211 3300032126 Ga0307415_100023443 Ga0307415_1000234433 286
1212 3300050512 nmdc:mga0n895_2560_c1 nmdc:mga0n895_2560_c1_6637_7539 286
1213 3300050513 nmdc:mga0rr50_4914_c1 nmdc:mga0rr50_4914_c1_4818_5720 286
1214 3300053130 Ga0500642_0064108 Ga0500642_0064108_346_1230 286
1215 iso_pu_bacteria 2883291878 2883296292 286
1216 3300002705 JGI25156J39149_1006718 JGI25156J39149_10067181 287
1217 3300002772 JGI25164J39214_1004164 JGI25164J39214_10041642 287
1218 3300002987 JGI25159J45721_1004965 JGI25159J45721_10049654 287
1219 3300003187 JGI25151J46595_10046217 JGI25151J46595_100462172 287
1220 3300003215 JGI25153J46596_10000024 JGI25153J46596_10000024139 287
1221 3300003756 Ga0055533_1000011 Ga0055533_1000011264 287
1222 3300003759 Ga0055525_1000644 Ga0055525_10006447 287
1223 3300003775 Ga0055524_1000382 Ga0055524_10003824 287
1224 3300003791 Ga0055530_10003201 Ga0055530_1000320110 287
1225 3300003792 Ga0055540_1000007 Ga0055540_1000007169 287
1226 3300003794 Ga0055531_10006835 Ga0055531_100068354 287
1227 3300004625 Ga0055543_1004514 Ga0055543_10045144 287
1228 3300004625 Ga0055543_1010096 Ga0055543_10100962 287
1229 3300005262 Ga0065165_1000086 Ga0065165_1000086121 287
1230 3300005262 Ga0065165_1000132 Ga0065165_100013231 287
1231 3300005262 Ga0065165_1000235 Ga0065165_100023557 287
1232 3300005262 Ga0065165_1003449 Ga0065165_10034494 287
1233 3300005327 Ga0070658_10023280 Ga0070658_100232803 287
1234 3300005356 Ga0070674_100142579 Ga0070674_1001425792 287
1235 3300005364 Ga0070673_100139498 Ga0070673_1001394982 287
1236 3300005543 Ga0070672_100173029 Ga0070672_1001730292 287
1237 3300005563 Ga0068855_100159363 Ga0068855_1001593633 287
1238 3300005844 Ga0068862_100033882 Ga0068862_1000338822 287
1239 3300006175 Ga0070712_100005932 Ga0070712_1000059323 287
1240 3300006195 Ga0075366_10052148 Ga0075366_100521483 287
1241 3300006844 Ga0075428_100321704 Ga0075428_1003217042 287
1242 3300006946 Ga0079104_1000009 Ga0079104_1000009132 287
1243 3300013296 Ga0157374_10079053 Ga0157374_100790533 287
1244 3300025226 Ga0209674_100003 Ga0209674_100003563 287
1245 3300025230 Ga0209563_100010 Ga0209563_100010293 287
1246 3300025231 Ga0207427_100729 Ga0207427_1007299 287
1247 3300025242 Ga0209258_100773 Ga0209258_10077311 287
1248 3300025253 Ga0209677_102733 Ga0209677_1027334 287
1249 3300025256 Ga0209759_1001305 Ga0209759_100130512 287
1250 3300025263 Ga0209565_1009765 Ga0209565_10097652 287
1251 3300025273 Ga0209673_1037216 Ga0209673_10372162 287
1252 3300025284 Ga0209130_1000208 Ga0209130_100020840 287
1253 3300025294 Ga0209025_1002291 Ga0209025_10022919 287
1254 3300025294 Ga0209025_1007137 Ga0209025_10071372 287
1255 3300025298 Ga0209050_1005060 Ga0209050_10050607 287
1256 3300025299 Ga0209256_1000019 Ga0209256_1000019188 287
1257 3300025302 Ga0207426_1015005 Ga0207426_10150054 287
1258 3300025303 Ga0209051_1000004 Ga0209051_1000004222 287
1259 3300025304 Ga0209257_1000038 Ga0209257_1000038356 287
1260 3300025304 Ga0209257_1000044 Ga0209257_1000044203 287
1261 3300025904 Ga0207647_10193410 Ga0207647_101934102 287
1262 3300025909 Ga0207705_10037246 Ga0207705_100372463 287
1263 3300025915 Ga0207693_10018506 Ga0207693_100185066 287
1264 3300025925 Ga0207650_10033574 Ga0207650_100335744 287
1265 3300025937 Ga0207669_10093092 Ga0207669_100930922 287
1266 3300026089 Ga0207648_10101244 Ga0207648_101012442 287
1267 3300026116 Ga0207674_10182305 Ga0207674_101823052 287
1268 3300027111 Ga0209281_1000023 Ga0209281_1000023255 287
1269 3300028794 Ga0307515_10153679 Ga0307515_101536792 287
1270 3300031456 Ga0307513_10266951 Ga0307513_102669512 287
1271 3300031456 Ga0307513_10346460 Ga0307513_103464602 287
1272 3300031507 Ga0307509_10005567 Ga0307509_1000556713 287
1273 3300031507 Ga0307509_10098912 Ga0307509_100989122 287
1274 3300031548 Ga0307408_100155007 Ga0307408_1001550072 287
1275 3300031616 Ga0307508_10000273 Ga0307508_1000027320 287
1276 3300031852 Ga0307410_10026075 Ga0307410_100260752 287
1277 3300032004 Ga0307414_10278168 Ga0307414_102781682 287
1278 3300032004 Ga0307414_10326757 Ga0307414_103267572 287
1279 3300032005 Ga0307411_10000039 Ga0307411_100000394 287
1280 3300033180 Ga0307510_10000088 Ga0307510_1000008856 287
1281 3300037068 Ga0373925_0174547 Ga0373925_0174547_232_1116 287
1282 3300037312 Ga0395899_0001797 Ga0395899_0001797_7074_7943 287
1283 3300037418 Ga0395900_0023837 Ga0395900_0023837_1716_2585 287
1284 3300037466 Ga0395898_0029740 Ga0395898_0029740_3443_4312 287
1285 3300037466 Ga0395898_0051921 Ga0395898_0051921_1144_2028 287
1286 3300037471 Ga0395905_0193507 Ga0395905_0193507_134_1108 287
1287 3300038443 Ga0395901_0010231 Ga0395901_0010231_5216_6100 287
1288 3300038443 Ga0395901_0042456 Ga0395901_0042456_1828_2697 287
1289 3300038443 Ga0395901_0176077 Ga0395901_0176077_947_1816 287
1290 3300038443 Ga0395901_0303025 Ga0395901_0303025_306_1208 287
1291 3300042531 Ga0450918_001867 Ga0450918_001867_2606_3490 287
1292 3300044658 Ga0466972_0009712 Ga0466972_0009712_2355_3236 287
1293 3300044684 Ga0466966_0007913 Ga0466966_0007913_1750_2631 287
1294 3300044694 Ga0466963_0004299 Ga0466963_0004299_983_1957 287
1295 3300044694 Ga0466963_0027077 Ga0466963_0027077_564_1436 287
1296 3300044842 Ga0466957_0093125 Ga0466957_0093125_29_1003 287
1297 3300045051 Ga0451576_0019992 Ga0451576_0019992_1466_2350 287
1298 3300046471 Ga0495650_0006054 Ga0495650_0006054_6147_7016 287
1299 3300046507 Ga0495606_0000297 Ga0495606_0000297_16137_17006 287
1300 3300047472 Ga0495686_0016837 Ga0495686_0016837_641_1510 287
1301 3300048905 Ga0496102_0027736 Ga0496102_0027736_1318_2187 287
1302 3300048910 Ga0496107_0043614 Ga0496107_0043614_2315_3199 287
1303 3300048911 Ga0496108_0030667 Ga0496108_0030667_2950_3819 287
1304 3300048912 Ga0496109_0036488 Ga0496109_0036488_2378_3247 287
1305 3300048914 Ga0496111_0045011 Ga0496111_0045011_909_1778 287
1306 3300048917 Ga0496114_0013948 Ga0496114_0013948_5456_6334 287
1307 3300048923 Ga0496120_0090088 Ga0496120_0090088_218_1081 287
1308 3300048924 Ga0496121_0023966 Ga0496121_0023966_3464_4354 287
1309 3300048925 Ga0496122_0055712 Ga0496122_0055712_1737_2600 287
1310 3300048926 Ga0496123_0046294 Ga0496123_0046294_352_1215 287
1311 3300048927 Ga0496124_0059142 Ga0496124_0059142_450_1313 287
1312 3300048928 Ga0496125_0013289 Ga0496125_0013289_6719_7582 287
1313 3300048928 Ga0496125_0014724 Ga0496125_0014724_5272_6162 287
1314 3300048929 Ga0496126_0009052 Ga0496126_0009052_6625_7488 287
1315 3300048929 Ga0496126_0138887 Ga0496126_0138887_212_1102 287
1316 3300049459 Ga0495678_008167 Ga0495678_008167_4129_4998 287
1317 3300049579 Ga0501043_0000101 Ga0501043_0000101_13230_14114 287
1318 3300049580 Ga0501046_0000135 Ga0501046_0000135_64850_65734 287
1319 3300049581 Ga0501047_0000173 Ga0501047_0000173_13337_14221 287
1320 3300049665 Ga0501227_036024 Ga0501227_036024_55_939 287
1321 3300049669 Ga0501235_004940 Ga0501235_004940_1519_2403 287
1322 3300049679 Ga0501249_010268 Ga0501249_010268_406_1290 287
1323 3300049683 Ga0501253_004339 Ga0501253_004339_688_1572 287
1324 3300049824 Ga0501045_0131924 Ga0501045_0131924_503_1387 287
1325 3300050493 nmdc:mga0k408_6933_c1 nmdc:mga0k408_6933_c1_1041_1925 287
1326 3300050511 nmdc:mga08y16_713892_c1 nmdc:mga08y16_713892_c1_18_935 287
1327 3300053090 Ga0500646_0003505 Ga0500646_0003505_2950_3834 287
1328 3300053092 Ga0500583_0041114 Ga0500583_0041114_923_1807 287
1329 3300053094 Ga0500566_0002553 Ga0500566_0002553_1417_2307 287
1330 3300053122 Ga0500608_046152 Ga0500608_046152_883_1773 287
1331 3300053131 Ga0500652_154497 Ga0500652_154497_13_906 287
1332 3300059477 Ga0587084_002539 Ga0587084_002539_437_1306 287
1333 3300059493 Ga0587077_000359 Ga0587077_000359_2574_3443 287
1334 3300059493 Ga0587077_003655 Ga0587077_003655_338_1207 287
1335 3300059645 Ga0587076_010795 Ga0587076_010795_365_1234 287
1336 iso_pu_bacteria 2600255292 2601667769 287
1337 iso_pu_bacteria 2643221628 2644162845 287
1338 iso_pu_bacteria 2643221683 2644469244 287
1339 iso_pu_bacteria 2721755523 2722886137 287
1340 iso_pu_bacteria 2739367655 2739613378 287
1341 iso_pu_bacteria 2839138175 2839144225 287
1342 iso_pu_bacteria 2842677519 2842680220 287
1343 iso_pu_bacteria 2857547612 2857550202 287
1344 iso_pu_bacteria 2857576091 2857577914 287
1345 iso_pu_bacteria 2881927736 2881927835 287
1346 iso_pu_bacteria 2885198086 2885199527 287
1347 iso_pu_bacteria 2885211737 2885213200 287
1348 iso_pu_bacteria 2887375801 2887378025 287
1349 iso_pu_bacteria 2904449895 2904454793 287
1350 iso_pu_bacteria 2904456579 2904462634 287
1351 iso_pu_bacteria 2904541872 2904546769 287
1352 iso_pu_bacteria 2919462493 2919464076 287
1353 iso_pu_bacteria 2919704043 2919708830 287
1354 iso_pu_bacteria 2929160207 2929164242 287
1355 iso_pu_bacteria 2932410948 2932411382 287
1356 iso_pu_bacteria 2932416698 2932419051 287
1357 iso_pu_bacteria 2932422444 2932423142 287
1358 iso_pu_bacteria 2945945610 2945946888 287
1359 iso_pu_bacteria 2954767861 2954771654 287
1360 2010549000 RicEn_C7977 RicEn_140520 288
1361 2162886007 SwRhRL2b_contig_2985449 SwRhRL2b_0269.00004670 288
1362 3300001989 JGI24739J22299_10024874 JGI24739J22299_100248742 288
1363 3300002077 JGI24744J21845_10026991 JGI24744J21845_100269912 288
1364 3300002774 JGI25150J39212_1000123 JGI25150J39212_100012323 288
1365 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008323 288
1366 3300003187 JGI25151J46595_10005526 JGI25151J46595_100055263 288
1367 3300003187 JGI25151J46595_10017014 JGI25151J46595_100170141 288
1368 3300003203 JGI25406J46586_10000042 JGI25406J46586_1000004252 288
1369 3300003203 JGI25406J46586_10023074 JGI25406J46586_100230742 288
1370 3300003215 JGI25153J46596_10000210 JGI25153J46596_1000021041 288
1371 3300003215 JGI25153J46596_10008716 JGI25153J46596_100087164 288
1372 3300003659 JGI25404J52841_10024437 JGI25404J52841_100244372 288
1373 3300003773 Ga0055537_1000224 Ga0055537_100022415 288
1374 3300003781 Ga0055536_1013682 Ga0055536_10136824 288
1375 3300003781 Ga0055536_1013856 Ga0055536_10138562 288
1376 3300003784 Ga0055534_1000273 Ga0055534_100027328 288
1377 3300003784 Ga0055534_1000902 Ga0055534_100090212 288
1378 3300003784 Ga0055534_1004252 Ga0055534_10042524 288
1379 3300003790 Ga0055528_1001031 Ga0055528_10010314 288
1380 3300003792 Ga0055540_1012394 Ga0055540_10123942 288
1381 3300003792 Ga0055540_1026244 Ga0055540_10262442 288
1382 3300003794 Ga0055531_10000322 Ga0055531_1000032244 288
1383 3300003794 Ga0055531_10010330 Ga0055531_100103303 288
1384 3300005262 Ga0065165_1018020 Ga0065165_10180202 288
1385 3300005262 Ga0065165_1021516 Ga0065165_10215162 288
1386 3300005289 Ga0065704_10089375 Ga0065704_100893753 288
1387 3300005289 Ga0065704_10157222 Ga0065704_101572222 288
1388 3300005289 Ga0065704_10206522 Ga0065704_102065222 288
1389 3300005327 Ga0070658_10318478 Ga0070658_103184781 288
1390 3300005329 Ga0070683_100003964 Ga0070683_1000039642 288
1391 3300005329 Ga0070683_100017977 Ga0070683_1000179774 288
1392 3300005329 Ga0070683_100046754 Ga0070683_1000467543 288
1393 3300005329 Ga0070683_100127041 Ga0070683_1001270414 288
1394 3300005329 Ga0070683_100179321 Ga0070683_1001793212 288
1395 3300005331 Ga0070670_100000372 Ga0070670_1000003727 288
1396 3300005336 Ga0070680_100011764 Ga0070680_1000117645 288
1397 3300005336 Ga0070680_100209735 Ga0070680_1002097352 288
1398 3300005339 Ga0070660_100071105 Ga0070660_1000711053 288
1399 3300005339 Ga0070660_100497834 Ga0070660_1004978341 288
1400 3300005344 Ga0070661_100106571 Ga0070661_1001065712 288
1401 3300005344 Ga0070661_100229694 Ga0070661_1002296942 288
1402 3300005344 Ga0070661_100245311 Ga0070661_1002453111 288
1403 3300005355 Ga0070671_100044769 Ga0070671_1000447692 288
1404 3300005355 Ga0070671_100048581 Ga0070671_1000485814 288
1405 3300005355 Ga0070671_100111737 Ga0070671_1001117372 288
1406 3300005356 Ga0070674_100026172 Ga0070674_1000261723 288
1407 3300005356 Ga0070674_100067175 Ga0070674_1000671753 288
1408 3300005367 Ga0070667_100292277 Ga0070667_1002922772 288
1409 3300005434 Ga0070709_10042930 Ga0070709_100429302 288
1410 3300005435 Ga0070714_100072863 Ga0070714_1000728633 288
1411 3300005436 Ga0070713_100025776 Ga0070713_1000257764 288
1412 3300005436 Ga0070713_100031324 Ga0070713_1000313244 288
1413 3300005436 Ga0070713_100107242 Ga0070713_1001072422 288
1414 3300005436 Ga0070713_100262520 Ga0070713_1002625202 288
1415 3300005439 Ga0070711_100023898 Ga0070711_1000238983 288
1416 3300005441 Ga0070700_100031574 Ga0070700_1000315743 288
1417 3300005455 Ga0070663_100119438 Ga0070663_1001194382 288
1418 3300005455 Ga0070663_100199811 Ga0070663_1001998112 288
1419 3300005456 Ga0070678_100055642 Ga0070678_1000556422 288
1420 3300005456 Ga0070678_100194209 Ga0070678_1001942092 288
1421 3300005458 Ga0070681_10002996 Ga0070681_100029965 288
1422 3300005458 Ga0070681_10047095 Ga0070681_100470953 288
1423 3300005458 Ga0070681_10110577 Ga0070681_101105774 288
1424 3300005458 Ga0070681_10139649 Ga0070681_101396492 288
1425 3300005458 Ga0070681_10334927 Ga0070681_103349272 288
1426 3300005459 Ga0068867_100061387 Ga0068867_1000613872 288
1427 3300005530 Ga0070679_100006191 Ga0070679_1000061919 288
1428 3300005530 Ga0070679_100009801 Ga0070679_1000098015 288
1429 3300005530 Ga0070679_100065635 Ga0070679_1000656352 288
1430 3300005530 Ga0070679_100222470 Ga0070679_1002224701 288
1431 3300005535 Ga0070684_100083145 Ga0070684_1000831452 288
1432 3300005535 Ga0070684_100142382 Ga0070684_1001423822 288
1433 3300005535 Ga0070684_100174262 Ga0070684_1001742622 288
1434 3300005536 Ga0070697_100009974 Ga0070697_1000099742 288
1435 3300005536 Ga0070697_100340685 Ga0070697_1003406852 288
1436 3300005539 Ga0068853_100143634 Ga0068853_1001436342 288
1437 3300005543 Ga0070672_100058504 Ga0070672_1000585042 288
1438 3300005544 Ga0070686_100118488 Ga0070686_1001184881 288
1439 3300005546 Ga0070696_100162798 Ga0070696_1001627982 288
1440 3300005547 Ga0070693_100182553 Ga0070693_1001825531 288
1441 3300005547 Ga0070693_100219439 Ga0070693_1002194392 288
1442 3300005548 Ga0070665_100029739 Ga0070665_1000297394 288
1443 3300005548 Ga0070665_100062998 Ga0070665_1000629982 288
1444 3300005548 Ga0070665_100166107 Ga0070665_1001661072 288
1445 3300005548 Ga0070665_100501116 Ga0070665_1005011161 288
1446 3300005563 Ga0068855_100030522 Ga0068855_1000305224 288
1447 3300005563 Ga0068855_100054492 Ga0068855_1000544925 288
1448 3300005563 Ga0068855_100287265 Ga0068855_1002872652 288
1449 3300005563 Ga0068855_100356384 Ga0068855_1003563842 288
1450 3300005563 Ga0068855_100609552 Ga0068855_1006095522 288
1451 3300005564 Ga0070664_100042664 Ga0070664_1000426643 288
1452 3300005564 Ga0070664_100688573 Ga0070664_1006885731 288
1453 3300005577 Ga0068857_100012293 Ga0068857_1000122936 288
1454 3300005577 Ga0068857_100206295 Ga0068857_1002062952 288
1455 3300005577 Ga0068857_100226182 Ga0068857_1002261822 288
1456 3300005577 Ga0068857_100312291 Ga0068857_1003122912 288
1457 3300005614 Ga0068856_100000217 Ga0068856_1000002177 288
1458 3300005614 Ga0068856_100059874 Ga0068856_1000598743 288
1459 3300005614 Ga0068856_100143863 Ga0068856_1001438634 288
1460 3300005614 Ga0068856_100180902 Ga0068856_1001809022 288
1461 3300005616 Ga0068852_100001671 Ga0068852_10000167111 288
1462 3300005616 Ga0068852_100091688 Ga0068852_1000916882 288
1463 3300005616 Ga0068852_100136573 Ga0068852_1001365732 288
1464 3300005842 Ga0068858_100180417 Ga0068858_1001804172 288
1465 3300005842 Ga0068858_100346459 Ga0068858_1003464592 288
1466 3300005843 Ga0068860_100000280 Ga0068860_10000028016 288
1467 3300005844 Ga0068862_100599364 Ga0068862_1005993641 288
1468 3300005937 Ga0081455_10000751 Ga0081455_1000075118 288
1469 3300005937 Ga0081455_10007868 Ga0081455_100078686 288
1470 3300005937 Ga0081455_10013127 Ga0081455_100131274 288
1471 3300005937 Ga0081455_10015126 Ga0081455_100151265 288
1472 3300005937 Ga0081455_10057044 Ga0081455_100570441 288
1473 3300005981 Ga0081538_10045792 Ga0081538_100457924 288
1474 3300005983 Ga0081540_1002153 Ga0081540_100215314 288
1475 3300005983 Ga0081540_1002523 Ga0081540_10025237 288
1476 3300005983 Ga0081540_1005561 Ga0081540_10055618 288
1477 3300005983 Ga0081540_1008122 Ga0081540_10081223 288
1478 3300005983 Ga0081540_1008798 Ga0081540_10087984 288
1479 3300005983 Ga0081540_1028343 Ga0081540_10283434 288
1480 3300005983 Ga0081540_1089062 Ga0081540_10890621 288
1481 3300005983 Ga0081540_1111796 Ga0081540_11117962 288
1482 3300005985 Ga0081539_10000099 Ga0081539_10000099189 288
1483 3300005985 Ga0081539_10001660 Ga0081539_100016606 288
1484 3300005985 Ga0081539_10007918 Ga0081539_100079189 288
1485 3300006028 Ga0070717_10001256 Ga0070717_1000125617 288
1486 3300006028 Ga0070717_10008632 Ga0070717_100086322 288
1487 3300006038 Ga0075365_10020604 Ga0075365_100206044 288
1488 3300006038 Ga0075365_10162934 Ga0075365_101629342 288
1489 3300006038 Ga0075365_10339516 Ga0075365_103395162 288
1490 3300006042 Ga0075368_10020284 Ga0075368_100202844 288
1491 3300006042 Ga0075368_10034251 Ga0075368_100342512 288
1492 3300006051 Ga0075364_10034399 Ga0075364_100343992 288
1493 3300006051 Ga0075364_10046426 Ga0075364_100464263 288
1494 3300006051 Ga0075364_10121122 Ga0075364_101211222 288
1495 3300006058 Ga0075432_10030334 Ga0075432_100303342 288
1496 3300006173 Ga0070716_100048945 Ga0070716_1000489453 288
1497 3300006175 Ga0070712_100008776 Ga0070712_1000087764 288
1498 3300006177 Ga0075362_10021558 Ga0075362_100215582 288
1499 3300006177 Ga0075362_10063030 Ga0075362_100630303 288
1500 3300006177 Ga0075362_10114043 Ga0075362_101140432 288
1501 3300006177 Ga0075362_10148813 Ga0075362_101488131 288
1502 3300006178 Ga0075367_10144208 Ga0075367_101442082 288
1503 3300006178 Ga0075367_10177198 Ga0075367_101771982 288
1504 3300006178 Ga0075367_10215987 Ga0075367_102159872 288
1505 3300006186 Ga0075369_10000180 Ga0075369_1000018013 288
1506 3300006186 Ga0075369_10038880 Ga0075369_100388802 288
1507 3300006186 Ga0075369_10072627 Ga0075369_100726272 288
1508 3300006186 Ga0075369_10108966 Ga0075369_101089661 288
1509 3300006195 Ga0075366_10010769 Ga0075366_100107694 288
1510 3300006195 Ga0075366_10198852 Ga0075366_101988521 288
1511 3300006353 Ga0075370_10034259 Ga0075370_100342592 288
1512 3300006353 Ga0075370_10039025 Ga0075370_100390253 288
1513 3300006353 Ga0075370_10177243 Ga0075370_101772432 288
1514 3300006852 Ga0075433_10253205 Ga0075433_102532052 288
1515 3300006871 Ga0075434_100063130 Ga0075434_1000631303 288
1516 3300006942 Ga0099824_1002075 Ga0099824_100207523 288
1517 3300006943 Ga0099822_1008450 Ga0099822_100845011 288
1518 3300006946 Ga0079104_1000208 Ga0079104_100020820 288
1519 3300006948 Ga0099826_10000135 Ga0099826_100001354 288
1520 3300006948 Ga0099826_10072630 Ga0099826_100726302 288
1521 3300007076 Ga0075435_100108433 Ga0075435_1001084332 288
1522 3300007265 Ga0099794_10019124 Ga0099794_100191242 288
1523 3300007265 Ga0099794_10042728 Ga0099794_100427283 288
1524 3300009092 Ga0105250_10000154 Ga0105250_1000015432 288
1525 3300009093 Ga0105240_10003939 Ga0105240_1000393911 288
1526 3300009093 Ga0105240_10009735 Ga0105240_100097358 288
1527 3300009093 Ga0105240_10208115 Ga0105240_102081152 288
1528 3300009093 Ga0105240_10405279 Ga0105240_104052792 288
1529 3300009101 Ga0105247_10045403 Ga0105247_100454033 288
1530 3300009101 Ga0105247_10083369 Ga0105247_100833692 288
1531 3300009101 Ga0105247_10093409 Ga0105247_100934092 288
1532 3300009147 Ga0114129_10030308 Ga0114129_100303083 288
1533 3300009148 Ga0105243_10003470 Ga0105243_100034709 288
1534 3300009148 Ga0105243_10181233 Ga0105243_101812332 288
1535 3300009148 Ga0105243_10437963 Ga0105243_104379632 288
1536 3300009174 Ga0105241_10041364 Ga0105241_100413642 288
1537 3300009174 Ga0105241_10100281 Ga0105241_101002812 288
1538 3300009174 Ga0105241_10200563 Ga0105241_102005632 288
1539 3300009176 Ga0105242_10314456 Ga0105242_103144562 288
1540 3300009545 Ga0105237_10000711 Ga0105237_100007113 288
1541 3300009545 Ga0105237_10116995 Ga0105237_101169953 288
1542 3300009545 Ga0105237_10140221 Ga0105237_101402212 288
1543 3300009545 Ga0105237_10221020 Ga0105237_102210202 288
1544 3300009545 Ga0105237_10240156 Ga0105237_102401562 288
1545 3300009551 Ga0105238_10013593 Ga0105238_100135934 288
1546 3300009551 Ga0105238_10015307 Ga0105238_100153074 288
1547 3300009551 Ga0105238_10207894 Ga0105238_102078942 288
1548 3300009551 Ga0105238_10248302 Ga0105238_102483022 288
1549 3300009551 Ga0105238_10342465 Ga0105238_103424652 288
1550 3300009551 Ga0105238_10411438 Ga0105238_104114382 288
1551 3300009551 Ga0105238_10459237 Ga0105238_104592372 288
1552 3300010159 Ga0099796_10071740 Ga0099796_100717401 288
1553 3300010375 Ga0105239_10002359 Ga0105239_100023596 288
1554 3300010375 Ga0105239_10047224 Ga0105239_100472244 288
1555 3300010375 Ga0105239_10086633 Ga0105239_100866332 288
1556 3300010375 Ga0105239_10221947 Ga0105239_102219471 288
1557 3300010375 Ga0105239_10473805 Ga0105239_104738052 288
1558 3300011119 Ga0105246_10171290 Ga0105246_101712902 288
1559 3300011119 Ga0105246_10195093 Ga0105246_101950932 288
1560 3300013102 Ga0157371_10007676 Ga0157371_100076764 288
1561 3300013104 Ga0157370_10324402 Ga0157370_103244022 288
1562 3300013104 Ga0157370_10485708 Ga0157370_104857081 288
1563 3300013104 Ga0157370_10508829 Ga0157370_105088292 288
1564 3300013105 Ga0157369_10007499 Ga0157369_1000749910 288
1565 3300013105 Ga0157369_10027452 Ga0157369_100274524 288
1566 3300013105 Ga0157369_10037352 Ga0157369_100373524 288
1567 3300013105 Ga0157369_10043154 Ga0157369_100431546 288
1568 3300013105 Ga0157369_10068644 Ga0157369_100686444 288
1569 3300013105 Ga0157369_10075613 Ga0157369_100756134 288
1570 3300013250 Ga0171462_1016 Ga0171462_101624 288
1571 3300013307 Ga0157372_10030764 Ga0157372_100307641 288
1572 3300013307 Ga0157372_10220737 Ga0157372_102207372 288
1573 3300013308 Ga0157375_10412970 Ga0157375_104129702 288
1574 3300014325 Ga0163163_10129728 Ga0163163_101297283 288
1575 3300014325 Ga0163163_10388765 Ga0163163_103887652 288
1576 3300014969 Ga0157376_10163548 Ga0157376_101635482 288
1577 3300015261 Ga0182006_1000002 Ga0182006_1000002682 288
1578 3300015262 Ga0182007_10000085 Ga0182007_1000008558 288
1579 3300015265 Ga0182005_1000002 Ga0182005_1000002414 288
1580 3300017792 Ga0163161_10015229 Ga0163161_100152294 288
1581 3300021320 Ga0214544_1000136 Ga0214544_100013618 288
1582 3300021321 Ga0214542_1000127 Ga0214542_100012718 288
1583 3300021324 Ga0214545_1000063 Ga0214545_100006380 288
1584 3300021327 Ga0214543_1018162 Ga0214543_10181624 288
1585 3300021361 Ga0213872_10022991 Ga0213872_100229912 288
1586 3300021388 Ga0213875_10044085 Ga0213875_100440852 288
1587 3300025245 Ga0207425_1000024 Ga0207425_1000024225 288
1588 3300025245 Ga0207425_1005788 Ga0207425_10057884 288
1589 3300025245 Ga0207425_1032518 Ga0207425_10325181 288
1590 3300025253 Ga0209677_101929 Ga0209677_1019296 288
1591 3300025253 Ga0209677_102242 Ga0209677_1022424 288
1592 3300025254 Ga0209148_1000879 Ga0209148_10008794 288
1593 3300025254 Ga0209148_1002254 Ga0209148_10022547 288
1594 3300025258 Ga0209129_1000146 Ga0209129_100014621 288
1595 3300025258 Ga0209129_1007872 Ga0209129_10078723 288
1596 3300025261 Ga0209233_1000753 Ga0209233_10007532 288
1597 3300025261 Ga0209233_1001523 Ga0209233_10015237 288
1598 3300025261 Ga0209233_1002406 Ga0209233_10024063 288
1599 3300025263 Ga0209565_1000083 Ga0209565_1000083126 288
1600 3300025272 Ga0209455_1002084 Ga0209455_10020846 288
1601 3300025272 Ga0209455_1005287 Ga0209455_10052873 288
1602 3300025273 Ga0209673_1000534 Ga0209673_100053421 288
1603 3300025273 Ga0209673_1025459 Ga0209673_10254592 288
1604 3300025284 Ga0209130_1004260 Ga0209130_10042604 288
1605 3300025291 Ga0209675_1000081 Ga0209675_1000081126 288
1606 3300025291 Ga0209675_1004057 Ga0209675_10040573 288
1607 3300025292 Ga0209676_1000065 Ga0209676_100006519 288
1608 3300025292 Ga0209676_1001087 Ga0209676_100108711 288
1609 3300025292 Ga0209676_1006060 Ga0209676_10060604 288
1610 3300025294 Ga0209025_1000050 Ga0209025_1000050102 288
1611 3300025294 Ga0209025_1000925 Ga0209025_10009254 288
1612 3300025294 Ga0209025_1001886 Ga0209025_100188622 288
1613 3300025294 Ga0209025_1082996 Ga0209025_10829961 288
1614 3300025295 Ga0209564_1000366 Ga0209564_100036683 288
1615 3300025295 Ga0209564_1000602 Ga0209564_10006026 288
1616 3300025295 Ga0209564_1009126 Ga0209564_10091263 288
1617 3300025295 Ga0209564_1011345 Ga0209564_10113451 288
1618 3300025295 Ga0209564_1027094 Ga0209564_10270942 288
1619 3300025297 Ga0209758_1000011 Ga0209758_1000011884 288
1620 3300025297 Ga0209758_1000083 Ga0209758_1000083155 288
1621 3300025297 Ga0209758_1000455 Ga0209758_100045517 288
1622 3300025297 Ga0209758_1000792 Ga0209758_100079224 288
1623 3300025297 Ga0209758_1001083 Ga0209758_100108331 288
1624 3300025297 Ga0209758_1011163 Ga0209758_10111634 288
1625 3300025297 Ga0209758_1012836 Ga0209758_10128364 288
1626 3300025297 Ga0209758_1013115 Ga0209758_10131154 288
1627 3300025297 Ga0209758_1027818 Ga0209758_10278181 288
1628 3300025298 Ga0209050_1006629 Ga0209050_10066292 288
1629 3300025298 Ga0209050_1018568 Ga0209050_10185683 288
1630 3300025299 Ga0209256_1000934 Ga0209256_10009344 288
1631 3300025299 Ga0209256_1018955 Ga0209256_10189552 288
1632 3300025302 Ga0207426_1007923 Ga0207426_10079233 288
1633 3300025303 Ga0209051_1000244 Ga0209051_100024449 288
1634 3300025303 Ga0209051_1006304 Ga0209051_10063044 288
1635 3300025303 Ga0209051_1008812 Ga0209051_10088126 288
1636 3300025304 Ga0209257_1000144 Ga0209257_1000144130 288
1637 3300025304 Ga0209257_1003906 Ga0209257_10039064 288
1638 3300025304 Ga0209257_1008157 Ga0209257_10081574 288
1639 3300025304 Ga0209257_1046541 Ga0209257_10465412 288
1640 3300025711 Ga0207696_1000388 Ga0207696_100038829 288
1641 3300025893 Ga0207682_10006388 Ga0207682_100063884 288
1642 3300025899 Ga0207642_10018244 Ga0207642_100182442 288
1643 3300025901 Ga0207688_10010905 Ga0207688_100109055 288
1644 3300025901 Ga0207688_10016380 Ga0207688_100163804 288
1645 3300025901 Ga0207688_10077308 Ga0207688_100773082 288
1646 3300025904 Ga0207647_10021071 Ga0207647_100210712 288
1647 3300025904 Ga0207647_10103671 Ga0207647_101036712 288
1648 3300025906 Ga0207699_10037385 Ga0207699_100373852 288
1649 3300025906 Ga0207699_10094522 Ga0207699_100945222 288
1650 3300025906 Ga0207699_10245439 Ga0207699_102454392 288
1651 3300025907 Ga0207645_10023628 Ga0207645_100236284 288
1652 3300025909 Ga0207705_10125185 Ga0207705_101251852 288
1653 3300025910 Ga0207684_10230764 Ga0207684_102307642 288
1654 3300025911 Ga0207654_10110007 Ga0207654_101100072 288
1655 3300025912 Ga0207707_10000183 Ga0207707_1000018329 288
1656 3300025912 Ga0207707_10005958 Ga0207707_100059582 288
1657 3300025912 Ga0207707_10010268 Ga0207707_1001026810 288
1658 3300025912 Ga0207707_10272681 Ga0207707_102726812 288
1659 3300025913 Ga0207695_10000157 Ga0207695_10000157110 288
1660 3300025913 Ga0207695_10012974 Ga0207695_100129744 288
1661 3300025913 Ga0207695_10024944 Ga0207695_100249444 288
1662 3300025913 Ga0207695_10175139 Ga0207695_101751392 288
1663 3300025913 Ga0207695_10455151 Ga0207695_104551511 288
1664 3300025914 Ga0207671_10007248 Ga0207671_100072484 288
1665 3300025914 Ga0207671_10024412 Ga0207671_100244124 288
1666 3300025914 Ga0207671_10099213 Ga0207671_100992132 288
1667 3300025914 Ga0207671_10101625 Ga0207671_101016252 288
1668 3300025914 Ga0207671_10135615 Ga0207671_101356152 288
1669 3300025914 Ga0207671_10341359 Ga0207671_103413592 288
1670 3300025915 Ga0207693_10007368 Ga0207693_100073686 288
1671 3300025915 Ga0207693_10199453 Ga0207693_101994532 288
1672 3300025915 Ga0207693_10230843 Ga0207693_102308432 288
1673 3300025916 Ga0207663_10041718 Ga0207663_100417183 288
1674 3300025919 Ga0207657_10001840 Ga0207657_1000184013 288
1675 3300025919 Ga0207657_10146645 Ga0207657_101466452 288
1676 3300025920 Ga0207649_10028131 Ga0207649_100281312 288
1677 3300025920 Ga0207649_10064178 Ga0207649_100641783 288
1678 3300025921 Ga0207652_10023004 Ga0207652_100230042 288
1679 3300025921 Ga0207652_10131156 Ga0207652_101311562 288
1680 3300025921 Ga0207652_10261848 Ga0207652_102618482 288
1681 3300025923 Ga0207681_10029523 Ga0207681_100295232 288
1682 3300025923 Ga0207681_10509215 Ga0207681_105092151 288
1683 3300025924 Ga0207694_10022641 Ga0207694_100226413 288
1684 3300025924 Ga0207694_10036365 Ga0207694_100363652 288
1685 3300025924 Ga0207694_10078687 Ga0207694_100786872 288
1686 3300025924 Ga0207694_10290708 Ga0207694_102907082 288
1687 3300025925 Ga0207650_10000955 Ga0207650_100009557 288
1688 3300025926 Ga0207659_10037749 Ga0207659_100377492 288
1689 3300025927 Ga0207687_10184232 Ga0207687_101842322 288
1690 3300025928 Ga0207700_10026499 Ga0207700_100264992 288
1691 3300025928 Ga0207700_10111812 Ga0207700_101118122 288
1692 3300025928 Ga0207700_10202496 Ga0207700_102024962 288
1693 3300025928 Ga0207700_10229719 Ga0207700_102297192 288
1694 3300025929 Ga0207664_10041985 Ga0207664_100419852 288
1695 3300025929 Ga0207664_10283126 Ga0207664_102831262 288
1696 3300025931 Ga0207644_10143631 Ga0207644_101436311 288
1697 3300025933 Ga0207706_10093287 Ga0207706_100932873 288
1698 3300025934 Ga0207686_10128424 Ga0207686_101284242 288
1699 3300025935 Ga0207709_10000745 Ga0207709_1000074521 288
1700 3300025935 Ga0207709_10000862 Ga0207709_100008625 288
1701 3300025935 Ga0207709_10152522 Ga0207709_101525222 288
1702 3300025936 Ga0207670_10247359 Ga0207670_102473591 288
1703 3300025937 Ga0207669_10062805 Ga0207669_100628052 288
1704 3300025939 Ga0207665_10034568 Ga0207665_100345683 288
1705 3300025941 Ga0207711_10532840 Ga0207711_105328402 288
1706 3300025944 Ga0207661_10005577 Ga0207661_100055774 288
1707 3300025944 Ga0207661_10009220 Ga0207661_100092202 288
1708 3300025944 Ga0207661_10248092 Ga0207661_102480922 288
1709 3300025945 Ga0207679_10400716 Ga0207679_104007162 288
1710 3300025949 Ga0207667_10025206 Ga0207667_100252066 288
1711 3300025949 Ga0207667_10042544 Ga0207667_100425442 288
1712 3300025949 Ga0207667_10370428 Ga0207667_103704282 288
1713 3300025961 Ga0207712_10353700 Ga0207712_103537002 288
1714 3300025981 Ga0207640_10164788 Ga0207640_101647882 288
1715 3300025986 Ga0207658_10108932 Ga0207658_101089322 288
1716 3300025986 Ga0207658_10143977 Ga0207658_101439772 288
1717 3300026023 Ga0207677_10156526 Ga0207677_101565262 288
1718 3300026035 Ga0207703_10207747 Ga0207703_102077472 288
1719 3300026041 Ga0207639_10057826 Ga0207639_100578262 288
1720 3300026041 Ga0207639_10267734 Ga0207639_102677342 288
1721 3300026067 Ga0207678_10028237 Ga0207678_100282372 288
1722 3300026067 Ga0207678_10056271 Ga0207678_100562714 288
1723 3300026078 Ga0207702_10001581 Ga0207702_1000158119 288
1724 3300026078 Ga0207702_10037097 Ga0207702_100370974 288
1725 3300026078 Ga0207702_10411970 Ga0207702_104119702 288
1726 3300026088 Ga0207641_10033406 Ga0207641_100334064 288
1727 3300026089 Ga0207648_10013832 Ga0207648_100138327 288
1728 3300026116 Ga0207674_10036358 Ga0207674_100363583 288
1729 3300026116 Ga0207674_10100560 Ga0207674_101005603 288
1730 3300026116 Ga0207674_10205855 Ga0207674_102058552 288
1731 3300026116 Ga0207674_10220597 Ga0207674_102205972 288
1732 3300026121 Ga0207683_10045311 Ga0207683_100453114 288
1733 3300026121 Ga0207683_10205221 Ga0207683_102052212 288
1734 3300026142 Ga0207698_10006676 Ga0207698_100066763 288
1735 3300027111 Ga0209281_1000002 Ga0209281_1000002390 288
1736 3300027111 Ga0209281_1000061 Ga0209281_1000061196 288
1737 3300027296 Ga0209389_1034967 Ga0209389_10349671 288
1738 3300027357 Ga0209589_1000002 Ga0209589_100000235 288
1739 3300027357 Ga0209589_1004535 Ga0209589_100453518 288
1740 3300027361 Ga0209489_100002 Ga0209489_10000235 288
1741 3300027361 Ga0209489_100050 Ga0209489_100050130 288
1742 3300027361 Ga0209489_104795 Ga0209489_1047954 288
1743 3300027363 Ga0209700_100002 Ga0209700_10000235 288
1744 3300027363 Ga0209700_100016 Ga0209700_100016238 288
1745 3300027512 Ga0209179_1003151 Ga0209179_10031513 288
1746 3300027614 Ga0209970_1000107 Ga0209970_10001076 288
1747 3300027617 Ga0210002_1016632 Ga0210002_10166321 288
1748 3300027666 Ga0209282_1001739 Ga0209282_10017399 288
1749 3300027671 Ga0209588_1020699 Ga0209588_10206992 288
1750 3300027682 Ga0209971_1001548 Ga0209971_10015484 288
1751 3300027866 Ga0209813_10003068 Ga0209813_100030684 288
1752 3300027866 Ga0209813_10048661 Ga0209813_100486612 288
1753 3300027876 Ga0209974_10007739 Ga0209974_100077393 288
1754 3300027907 Ga0207428_10255836 Ga0207428_102558362 288
1755 3300028379 Ga0268266_10003203 Ga0268266_1000320313 288
1756 3300028379 Ga0268266_10012481 Ga0268266_100124818 288
1757 3300028379 Ga0268266_10039076 Ga0268266_100390764 288
1758 3300028379 Ga0268266_10078930 Ga0268266_100789303 288
1759 3300028379 Ga0268266_10085845 Ga0268266_100858454 288
1760 3300028381 Ga0268264_10000038 Ga0268264_10000038271 288
1761 3300028556 Ga0265337_1005916 Ga0265337_10059162 288
1762 3300028558 Ga0265326_10003140 Ga0265326_100031403 288
1763 3300028563 Ga0265319_1002854 Ga0265319_10028547 288
1764 3300028573 Ga0265334_10001590 Ga0265334_100015905 288
1765 3300028577 Ga0265318_10005470 Ga0265318_100054705 288
1766 3300028653 Ga0265323_10000744 Ga0265323_1000074411 288
1767 3300028654 Ga0265322_10026828 Ga0265322_100268282 288
1768 3300028666 Ga0265336_10000228 Ga0265336_1000022811 288
1769 3300028786 Ga0307517_10000512 Ga0307517_1000051252 288
1770 3300028794 Ga0307515_10007488 Ga0307515_100074887 288
1771 3300028800 Ga0265338_10000116 Ga0265338_1000011641 288
1772 3300029957 Ga0265324_10003977 Ga0265324_100039775 288
1773 3300030521 Ga0307511_10109527 Ga0307511_101095272 288
1774 3300030732 Ga0316176_1097126 Ga0316176_10971261 288
1775 3300031235 Ga0265330_10020866 Ga0265330_100208664 288
1776 3300031235 Ga0265330_10039637 Ga0265330_100396372 288
1777 3300031238 Ga0265332_10117983 Ga0265332_101179832 288
1778 3300031241 Ga0265325_10020132 Ga0265325_100201322 288
1779 3300031247 Ga0265340_10002528 Ga0265340_100025287 288
1780 3300031249 Ga0265339_10001476 Ga0265339_100014767 288
1781 3300031249 Ga0265339_10059648 Ga0265339_100596482 288
1782 3300031250 Ga0265331_10023285 Ga0265331_100232852 288
1783 3300031251 Ga0265327_10025625 Ga0265327_100256253 288
1784 3300031456 Ga0307513_10000028 Ga0307513_10000028185 288
1785 3300031456 Ga0307513_10000206 Ga0307513_1000020678 288
1786 3300031507 Ga0307509_10084915 Ga0307509_100849154 288
1787 3300031507 Ga0307509_10120213 Ga0307509_101202131 288
1788 3300031507 Ga0307509_10379167 Ga0307509_103791672 288
1789 3300031548 Ga0307408_100027214 Ga0307408_1000272141 288
1790 3300031548 Ga0307408_100096358 Ga0307408_1000963581 288
1791 3300031548 Ga0307408_100195868 Ga0307408_1001958681 288
1792 3300031616 Ga0307508_10000008 Ga0307508_1000000864 288
1793 3300031616 Ga0307508_10040908 Ga0307508_100409084 288
1794 3300031616 Ga0307508_10055166 Ga0307508_100551663 288
1795 3300031649 Ga0307514_10000722 Ga0307514_100007224 288
1796 3300031711 Ga0265314_10006545 Ga0265314_1000654511 288
1797 3300031711 Ga0265314_10015462 Ga0265314_100154625 288
1798 3300031711 Ga0265314_10024921 Ga0265314_100249213 288
1799 3300031727 Ga0316576_10017056 Ga0316576_100170561 288
1800 3300031730 Ga0307516_10024119 Ga0307516_100241194 288
1801 3300031731 Ga0307405_10010736 Ga0307405_100107364 288
1802 3300031824 Ga0307413_10232830 Ga0307413_102328302 288
1803 3300031901 Ga0307406_10018898 Ga0307406_100188982 288
1804 3300031911 Ga0307412_10002786 Ga0307412_100027866 288
1805 3300031911 Ga0307412_10026597 Ga0307412_100265972 288
1806 3300031911 Ga0307412_10097399 Ga0307412_100973992 288
1807 3300032002 Ga0307416_100234891 Ga0307416_1002348911 288
1808 3300032002 Ga0307416_100279148 Ga0307416_1002791482 288
1809 3300032004 Ga0307414_10057596 Ga0307414_100575961 288
1810 3300032004 Ga0307414_10132567 Ga0307414_101325672 288
1811 3300032004 Ga0307414_10193040 Ga0307414_101930402 288
1812 3300032004 Ga0307414_10335077 Ga0307414_103350772 288
1813 3300032004 Ga0307414_10428999 Ga0307414_104289992 288
1814 3300032005 Ga0307411_10016890 Ga0307411_100168902 288
1815 3300032005 Ga0307411_10256903 Ga0307411_102569032 288
1816 3300032005 Ga0307411_10418826 Ga0307411_104188262 288
1817 3300033179 Ga0307507_10071426 Ga0307507_100714262 288
1818 3300033180 Ga0307510_10002929 Ga0307510_100029293 288
1819 3300033180 Ga0307510_10021544 Ga0307510_100215444 288
1820 3300033180 Ga0307510_10068402 Ga0307510_100684023 288
1821 3300033442 Ga0315911_1000004 Ga0315911_1000004330 288
1822 3300035083 Ga0373926_0011772 Ga0373926_0011772_1640_2542 288
1823 3300035085 Ga0373929_0011017 Ga0373929_0011017_196_1098 288
1824 3300035086 Ga0373934_0001948 Ga0373934_0001948_6333_7235 288
1825 3300035086 Ga0373934_0012326 Ga0373934_0012326_477_1379 288
1826 3300035112 Ga0373932_0035200 Ga0373932_0035200_393_1295 288
1827 3300035113 Ga0373936_0007174 Ga0373936_0007174_2001_2903 288
1828 3300035116 Ga0373945_0008905 Ga0373945_0008905_2253_3155 288
1829 3300035116 Ga0373945_0020462 Ga0373945_0020462_841_1743 288
1830 3300035117 Ga0373953_0094460 Ga0373953_0094460_139_1041 288
1831 3300035118 Ga0373954_0001852 Ga0373954_0001852_6961_7863 288
1832 3300035118 Ga0373954_0010696 Ga0373954_0010696_1345_2247 288
1833 3300035119 Ga0373956_0003558 Ga0373956_0003558_4086_4988 288
1834 3300035119 Ga0373956_0137522 Ga0373956_0137522_216_1118 288
1835 3300035120 Ga0373957_0010697 Ga0373957_0010697_1711_2613 288
1836 3300035170 Ga0373943_0010932 Ga0373943_0010932_1993_2895 288
1837 3300035170 Ga0373943_0215764 Ga0373943_0215764_138_1040 288
1838 3300035171 Ga0373946_0013875 Ga0373946_0013875_2109_3011 288
1839 3300035172 Ga0373955_0039970 Ga0373955_0039970_899_1801 288
1840 3300035172 Ga0373955_0051885 Ga0373955_0051885_1029_1931 288
1841 3300035242 Ga0373962_0060997 Ga0373962_0060997_103_1005 288
1842 3300035410 Ga0373924_0003246 Ga0373924_0003246_3528_4430 288
1843 3300035691 Ga0373931_0001380 Ga0373931_0001380_5971_6873 288
1844 3300035692 Ga0373935_0000493 Ga0373935_0000493_1715_2617 288
1845 3300035692 Ga0373935_0058231 Ga0373935_0058231_297_1199 288
1846 3300035695 Ga0373927_0000331 Ga0373927_0000331_22299_23201 288
1847 3300035695 Ga0373927_0007766 Ga0373927_0007766_4385_5287 288
1848 3300035695 Ga0373927_0012238 Ga0373927_0012238_554_1456 288
1849 3300035695 Ga0373927_0075732 Ga0373927_0075732_1248_2150 288
1850 3300035695 Ga0373927_0205124 Ga0373927_0205124_161_1063 288
1851 3300035724 Ga0373933_0004248 Ga0373933_0004248_1829_2731 288
1852 3300035724 Ga0373933_0047155 Ga0373933_0047155_855_1757 288
1853 3300035725 Ga0373947_0004776 Ga0373947_0004776_5332_6234 288
1854 3300035725 Ga0373947_0014044 Ga0373947_0014044_1513_2415 288
1855 3300035725 Ga0373947_0055623 Ga0373947_0055623_1454_2353 288
1856 3300035725 Ga0373947_0143620 Ga0373947_0143620_211_1113 288
1857 3300036401 Ga0373937_0009958 Ga0373937_0009958_7131_8033 288
1858 3300036401 Ga0373937_0136963 Ga0373937_0136963_814_1716 288
1859 3300036712 Ga0316584_0161063 Ga0316584_0161063_361_1233 288
1860 3300037068 Ga0373925_0029402 Ga0373925_0029402_1351_2253 288
1861 3300037068 Ga0373925_0053723 Ga0373925_0053723_1695_2603 288
1862 3300037068 Ga0373925_0094066 Ga0373925_0094066_1015_1917 288
1863 3300037312 Ga0395899_0027157 Ga0395899_0027157_2689_3591 288
1864 3300037418 Ga0395900_0000134 Ga0395900_0000134_122647_123549 288
1865 3300037466 Ga0395898_0411805 Ga0395898_0411805_328_1218 288
1866 3300037471 Ga0395905_0155934 Ga0395905_0155934_321_1214 288
1867 3300037471 Ga0395905_0193383 Ga0395905_0193383_180_1082 288
1868 3300038443 Ga0395901_0011149 Ga0395901_0011149_3585_4487 288
1869 3300038443 Ga0395901_0084013 Ga0395901_0084013_1821_2708 288
1870 3300038443 Ga0395901_0091348 Ga0395901_0091348_1501_2403 288
1871 3300039437 Ga0436365_0851563 Ga0436365_0851563_436_1338 288
1872 3300039438 Ga0436360_0042397 Ga0436360_0042397_8896_9798 288
1873 3300039438 Ga0436360_0742143 Ga0436360_0742143_374_1276 288
1874 3300039438 Ga0436360_0766994 Ga0436360_0766994_531_1433 288
1875 3300039438 Ga0436360_0975226 Ga0436360_0975226_654_1556 288
1876 3300039447 Ga0436361_0054229 Ga0436361_0054229_1256_2158 288
1877 3300039450 Ga0436363_0016840 Ga0436363_0016840_50_952 288
1878 3300039450 Ga0436363_1029339 Ga0436363_1029339_729_1631 288
1879 3300041406 Ga0439439_0029169 Ga0439439_0029169_217_1113 288
1880 3300041411 Ga0439466_0044835 Ga0439466_0044835_552_1442 288
1881 3300041486 Ga0451807_0979801 Ga0451807_0979801_286_1188 288
1882 3300042006 Ga0439432_015833 Ga0439432_015833_525_1415 288
1883 3300042007 Ga0439449_0004936 Ga0439449_0004936_441_1328 288
1884 3300042007 Ga0439449_0041706 Ga0439449_0041706_160_1050 288
1885 3300042122 Ga0450920_033559 Ga0450920_033559_73_963 288
1886 3300042145 Ga0450906_010567 Ga0450906_010567_504_1394 288
1887 3300042184 Ga0450908_018115 Ga0450908_018115_83_973 288
1888 3300042531 Ga0450918_004434 Ga0450918_004434_1454_2344 288
1889 3300044673 Ga0453683_0003423 Ga0453683_0003423_6187_7080 288
1890 3300044683 Ga0466965_0030147 Ga0466965_0030147_165_1052 288
1891 3300044684 Ga0466966_0001490 Ga0466966_0001490_12639_13541 288
1892 3300044684 Ga0466966_0049842 Ga0466966_0049842_624_1511 288
1893 3300044693 Ga0466961_0000122 Ga0466961_0000122_37574_38476 288
1894 3300044712 Ga0453684_0000590 Ga0453684_0000590_40998_41894 288
1895 3300044719 Ga0466971_0017005 Ga0466971_0017005_1952_2839 288
1896 3300044735 Ga0466968_0010019 Ga0466968_0010019_1853_2827 288
1897 3300044735 Ga0466968_0030833 Ga0466968_0030833_93_995 288
1898 3300044842 Ga0466957_0039832 Ga0466957_0039832_1391_2278 288
1899 3300045049 Ga0466959_0077781 Ga0466959_0077781_665_1567 288
1900 3300045049 Ga0466959_0149223 Ga0466959_0149223_167_1087 288
1901 3300045051 Ga0451576_0004219 Ga0451576_0004219_2827_3723 288
1902 3300045051 Ga0451576_0029404 Ga0451576_0029404_3202_4104 288
1903 3300045051 Ga0451576_0141235 Ga0451576_0141235_712_1608 288
1904 3300045836 Ga0466958_0036023 Ga0466958_0036023_1917_2804 288
1905 3300045976 Ga0466967_0080214 Ga0466967_0080214_720_1622 288
1906 3300045976 Ga0466967_0081717 Ga0466967_0081717_1984_2892 288
1907 3300046454 Ga0495592_0014473 Ga0495592_0014473_2434_3336 288
1908 3300046454 Ga0495592_0017918 Ga0495592_0017918_3386_4288 288
1909 3300046454 Ga0495592_0023531 Ga0495592_0023531_3558_4460 288
1910 3300046454 Ga0495592_0034500 Ga0495592_0034500_1860_2762 288
1911 3300046455 Ga0495603_0003417 Ga0495603_0003417_2622_3524 288
1912 3300046455 Ga0495603_0031407 Ga0495603_0031407_529_1431 288
1913 3300046455 Ga0495603_0043613 Ga0495603_0043613_904_1806 288
1914 3300046457 Ga0495590_0011066 Ga0495590_0011066_286_1188 288
1915 3300046459 Ga0495629_0001243 Ga0495629_0001243_18616_19518 288
1916 3300046459 Ga0495629_0002500 Ga0495629_0002500_6960_7862 288
1917 3300046459 Ga0495629_0046459 Ga0495629_0046459_202_1104 288
1918 3300046459 Ga0495629_0190955 Ga0495629_0190955_382_1284 288
1919 3300046460 Ga0495638_0017604 Ga0495638_0017604_2144_3118 288
1920 3300046460 Ga0495638_0036612 Ga0495638_0036612_1586_2488 288
1921 3300046460 Ga0495638_0071985 Ga0495638_0071985_329_1234 288
1922 3300046460 Ga0495638_0148590 Ga0495638_0148590_231_1133 288
1923 3300046461 Ga0495641_0006961 Ga0495641_0006961_4320_5222 288
1924 3300046462 Ga0495651_0036982 Ga0495651_0036982_2731_3633 288
1925 3300046462 Ga0495651_0058034 Ga0495651_0058034_834_1736 288
1926 3300046463 Ga0495653_0000821 Ga0495653_0000821_8622_9524 288
1927 3300046463 Ga0495653_0128814 Ga0495653_0128814_549_1451 288
1928 3300046472 Ga0495580_0001284 Ga0495580_0001284_18401_19303 288
1929 3300046472 Ga0495580_0006315 Ga0495580_0006315_44_946 288
1930 3300046472 Ga0495580_0148851 Ga0495580_0148851_325_1227 288
1931 3300046473 Ga0495582_0000166 Ga0495582_0000166_18477_19379 288
1932 3300046473 Ga0495582_0003905 Ga0495582_0003905_1907_2809 288
1933 3300046475 Ga0495639_0001515 Ga0495639_0001515_6834_7736 288
1934 3300046475 Ga0495639_0004799 Ga0495639_0004799_3218_4120 288
1935 3300046475 Ga0495639_0082730 Ga0495639_0082730_325_1227 288
1936 3300046476 Ga0495662_0090495 Ga0495662_0090495_377_1279 288
1937 3300046477 Ga0495664_0002707 Ga0495664_0002707_7591_8505 288
1938 3300046477 Ga0495664_0002890 Ga0495664_0002890_4219_5121 288
1939 3300046477 Ga0495664_0134418 Ga0495664_0134418_519_1421 288
1940 3300046499 Ga0495594_0004296 Ga0495594_0004296_1059_1961 288
1941 3300046499 Ga0495594_0086106 Ga0495594_0086106_385_1287 288
1942 3300046501 Ga0495607_0142386 Ga0495607_0142386_274_1179 288
1943 3300046506 Ga0495583_0037575 Ga0495583_0037575_812_1678 288
1944 3300046507 Ga0495606_0001165 Ga0495606_0001165_35006_35905 288
1945 3300046507 Ga0495606_0058668 Ga0495606_0058668_1214_2116 288
1946 3300046507 Ga0495606_0080355 Ga0495606_0080355_348_1253 288
1947 3300046511 Ga0495608_0002366 Ga0495608_0002366_3176_4078 288
1948 3300046511 Ga0495608_0170921 Ga0495608_0170921_402_1304 288
1949 3300046512 Ga0495610_0018339 Ga0495610_0018339_2506_3372 288
1950 3300046512 Ga0495610_0037307 Ga0495610_0037307_223_1122 288
1951 3300046515 Ga0495620_0062506 Ga0495620_0062506_142_1044 288
1952 3300046516 Ga0495628_0020530 Ga0495628_0020530_236_1138 288
1953 3300046516 Ga0495628_0033373 Ga0495628_0033373_3002_3904 288
1954 3300046516 Ga0495628_0083981 Ga0495628_0083981_475_1377 288
1955 3300046517 Ga0495630_0006088 Ga0495630_0006088_1499_2401 288
1956 3300046517 Ga0495630_0017695 Ga0495630_0017695_2023_2925 288
1957 3300046517 Ga0495630_0167346 Ga0495630_0167346_233_1135 288
1958 3300046517 Ga0495630_0321663 Ga0495630_0321663_47_949 288
1959 3300046519 Ga0495632_0068709 Ga0495632_0068709_291_1157 288
1960 3300046522 Ga0495643_0018119 Ga0495643_0018119_3115_4089 288
1961 3300046524 Ga0495648_0000832 Ga0495648_0000832_2827_3729 288
1962 3300046524 Ga0495648_0001607 Ga0495648_0001607_13115_14017 288
1963 3300046524 Ga0495648_0039513 Ga0495648_0039513_843_1745 288
1964 3300046529 Ga0495652_0026794 Ga0495652_0026794_226_1128 288
1965 3300046529 Ga0495652_0032433 Ga0495652_0032433_492_1394 288
1966 3300046529 Ga0495652_0088960 Ga0495652_0088960_788_1690 288
1967 3300046529 Ga0495652_0113108 Ga0495652_0113108_1258_2160 288
1968 3300046530 Ga0495654_0000207 Ga0495654_0000207_31145_32014 288
1969 3300046531 Ga0495665_0000104 Ga0495665_0000104_24327_25229 288
1970 3300046533 Ga0495640_0004822 Ga0495640_0004822_6656_7558 288
1971 3300046533 Ga0495640_0009631 Ga0495640_0009631_5472_6374 288
1972 3300046533 Ga0495640_0018706 Ga0495640_0018706_528_1430 288
1973 3300046533 Ga0495640_0039260 Ga0495640_0039260_2026_2928 288
1974 3300046535 Ga0495586_0022737 Ga0495586_0022737_324_1226 288
1975 3300046536 Ga0495587_0066179 Ga0495587_0066179_177_1079 288
1976 3300046542 Ga0495597_0016953 Ga0495597_0016953_1517_2419 288
1977 3300046543 Ga0495645_0003878 Ga0495645_0003878_5783_6685 288
1978 3300046543 Ga0495645_0007622 Ga0495645_0007622_1556_2458 288
1979 3300046543 Ga0495645_0024803 Ga0495645_0024803_865_1779 288
1980 3300046543 Ga0495645_0049530 Ga0495645_0049530_1012_1914 288
1981 3300046557 Ga0495622_0035224 Ga0495622_0035224_251_1156 288
1982 3300046557 Ga0495622_0123527 Ga0495622_0123527_110_1084 288
1983 3300046558 Ga0495633_0004906 Ga0495633_0004906_5618_6502 288
1984 3300046559 Ga0495667_0032161 Ga0495667_0032161_110_1012 288
1985 3300046559 Ga0495667_0297173 Ga0495667_0297173_30_932 288
1986 3300046615 Ga0495656_0054834 Ga0495656_0054834_247_1149 288
1987 3300046616 Ga0495668_0179737 Ga0495668_0179737_211_1101 288
1988 3300046642 Ga0495634_0017597 Ga0495634_0017597_2068_2970 288
1989 3300046642 Ga0495634_0032726 Ga0495634_0032726_1167_2069 288
1990 3300046642 Ga0495634_0041737 Ga0495634_0041737_1214_2116 288
1991 3300046648 Ga0495611_0060183 Ga0495611_0060183_364_1266 288
1992 3300046660 Ga0495625_0000637 Ga0495625_0000637_1793_2683 288
1993 3300046660 Ga0495625_0063090 Ga0495625_0063090_1182_2084 288
1994 3300046660 Ga0495625_0183625 Ga0495625_0183625_14_880 288
1995 3300046663 Ga0495635_0000965 Ga0495635_0000965_9494_10396 288
1996 3300046663 Ga0495635_0022910 Ga0495635_0022910_2521_3423 288
1997 3300046664 Ga0495659_0033826 Ga0495659_0033826_638_1540 288
1998 3300046665 Ga0495661_0078549 Ga0495661_0078549_47_949 288
1999 3300046665 Ga0495661_0135855 Ga0495661_0135855_157_1062 288
2000 3300046675 Ga0495657_0003762 Ga0495657_0003762_4330_5232 288
2001 3300046675 Ga0495657_0009942 Ga0495657_0009942_2650_3552 288
2002 3300046675 Ga0495657_0033182 Ga0495657_0033182_893_1795 288
2003 3300046675 Ga0495657_0056668 Ga0495657_0056668_1374_2276 288
2004 3300046678 Ga0495599_0000673 Ga0495599_0000673_13894_14796 288
2005 3300046678 Ga0495599_0054348 Ga0495599_0054348_1394_2296 288
2006 3300046680 Ga0495646_0001365 Ga0495646_0001365_10360_11262 288
2007 3300046680 Ga0495646_0011555 Ga0495646_0011555_85_987 288
2008 3300046680 Ga0495646_0030382 Ga0495646_0030382_1308_2210 288
2009 3300046681 Ga0495647_0034877 Ga0495647_0034877_98_1000 288
2010 3300046683 Ga0495658_0005346 Ga0495658_0005346_656_1558 288
2011 3300046683 Ga0495658_0044779 Ga0495658_0044779_1278_2180 288
2012 3300046683 Ga0495658_0072881 Ga0495658_0072881_866_1768 288
2013 3300046689 Ga0495613_0012606 Ga0495613_0012606_4228_5130 288
2014 3300046689 Ga0495613_0156210 Ga0495613_0156210_125_1027 288
2015 3300046690 Ga0495624_0003391 Ga0495624_0003391_9174_10076 288
2016 3300046690 Ga0495624_0039559 Ga0495624_0039559_1825_2727 288
2017 3300046690 Ga0495624_0052583 Ga0495624_0052583_255_1157 288
2018 3300046691 Ga0495670_0010648 Ga0495670_0010648_492_1397 288
2019 3300046694 Ga0495649_0099289 Ga0495649_0099289_310_1212 288
2020 3300046809 Ga0495600_0002097 Ga0495600_0002097_9494_10396 288
2021 3300046809 Ga0495600_0017523 Ga0495600_0017523_130_1032 288
2022 3300046809 Ga0495600_0118175 Ga0495600_0118175_353_1255 288
2023 3300047315 Ga0495581_0000391 Ga0495581_0000391_18476_19378 288
2024 3300047315 Ga0495581_0066443 Ga0495581_0066443_1165_2067 288
2025 3300047317 Ga0495604_0016096 Ga0495604_0016096_2097_2999 288
2026 3300047317 Ga0495604_0021599 Ga0495604_0021599_1374_2276 288
2027 3300047319 Ga0495674_0001108 Ga0495674_0001108_24331_25233 288
2028 3300047319 Ga0495674_0012073 Ga0495674_0012073_3499_4401 288
2029 3300047319 Ga0495674_0033082 Ga0495674_0033082_3485_4387 288
2030 3300047319 Ga0495674_0137732 Ga0495674_0137732_294_1196 288
2031 3300047319 Ga0495674_0274794 Ga0495674_0274794_32_934 288
2032 3300047320 Ga0495672_0058151 Ga0495672_0058151_929_1831 288
2033 3300047321 Ga0495676_0105399 Ga0495676_0105399_378_1280 288
2034 3300047321 Ga0495676_0238373 Ga0495676_0238373_73_975 288
2035 3300047322 Ga0495680_0006581 Ga0495680_0006581_4330_5232 288
2036 3300047443 Ga0495687_052157 Ga0495687_052157_91_1065 288
2037 3300047444 Ga0495675_0001627 Ga0495675_0001627_7315_8217 288
2038 3300047444 Ga0495675_0031987 Ga0495675_0031987_131_1033 288
2039 3300047469 Ga0495673_0032426 Ga0495673_0032426_1435_2337 288
2040 3300047471 Ga0495684_0001891 Ga0495684_0001891_139_1041 288
2041 3300047471 Ga0495684_0006492 Ga0495684_0006492_2673_3575 288
2042 3300047471 Ga0495684_0020313 Ga0495684_0020313_3622_4524 288
2043 3300047472 Ga0495686_0096606 Ga0495686_0096606_681_1547 288
2044 3300047472 Ga0495686_0131884 Ga0495686_0131884_561_1463 288
2045 3300047673 Ga0495593_0000180 Ga0495593_0000180_18472_19374 288
2046 3300048088 Ga0495602_0029325 Ga0495602_0029325_3726_4628 288
2047 3300048088 Ga0495602_0061892 Ga0495602_0061892_1197_2099 288
2048 3300048088 Ga0495602_0266693 Ga0495602_0266693_140_1042 288
2049 3300048089 Ga0495614_0009204 Ga0495614_0009204_537_1439 288
2050 3300048091 Ga0495626_0047188 Ga0495626_0047188_116_1018 288
2051 3300048903 Ga0496100_0343340 Ga0496100_0343340_94_984 288
2052 3300048904 Ga0496101_0054418 Ga0496101_0054418_67_969 288
2053 3300048905 Ga0496102_0035155 Ga0496102_0035155_1059_1961 288
2054 3300048905 Ga0496102_0149984 Ga0496102_0149984_95_997 288
2055 3300048905 Ga0496102_0268468 Ga0496102_0268468_246_1220 288
2056 3300048906 Ga0496103_0004910 Ga0496103_0004910_471_1445 288
2057 3300048907 Ga0496104_0152143 Ga0496104_0152143_43_1017 288
2058 3300048907 Ga0496104_0157091 Ga0496104_0157091_404_1306 288
2059 3300048907 Ga0496104_0173710 Ga0496104_0173710_633_1523 288
2060 3300048907 Ga0496104_0274899 Ga0496104_0274899_57_1031 288
2061 3300048907 Ga0496104_0505852 Ga0496104_0505852_189_1091 288
2062 3300048908 Ga0496105_0008027 Ga0496105_0008027_538_1440 288
2063 3300048908 Ga0496105_0068092 Ga0496105_0068092_1227_2129 288
2064 3300048908 Ga0496105_0068327 Ga0496105_0068327_1860_2762 288
2065 3300048908 Ga0496105_0090420 Ga0496105_0090420_774_1748 288
2066 3300048908 Ga0496105_0313031 Ga0496105_0313031_333_1235 288
2067 3300048909 Ga0496106_0000201 Ga0496106_0000201_38724_39590 288
2068 3300048909 Ga0496106_0013233 Ga0496106_0013233_4339_5241 288
2069 3300048910 Ga0496107_0133265 Ga0496107_0133265_597_1487 288
2070 3300048911 Ga0496108_0074813 Ga0496108_0074813_1895_2797 288
2071 3300048911 Ga0496108_0106391 Ga0496108_0106391_769_1671 288
2072 3300048911 Ga0496108_0210665 Ga0496108_0210665_181_1086 288
2073 3300048911 Ga0496108_0288637 Ga0496108_0288637_332_1306 288
2074 3300048912 Ga0496109_0024725 Ga0496109_0024725_3286_4188 288
2075 3300048912 Ga0496109_0252270 Ga0496109_0252270_583_1473 288
2076 3300048912 Ga0496109_0291169 Ga0496109_0291169_427_1401 288
2077 3300048913 Ga0496110_0035946 Ga0496110_0035946_2132_3034 288
2078 3300048913 Ga0496110_0088041 Ga0496110_0088041_824_1798 288
2079 3300048914 Ga0496111_0024140 Ga0496111_0024140_2948_3832 288
2080 3300048914 Ga0496111_0038246 Ga0496111_0038246_1878_2780 288
2081 3300048914 Ga0496111_0104793 Ga0496111_0104793_94_996 288
2082 3300048915 Ga0496112_0000092 Ga0496112_0000092_44686_45585 288
2083 3300048915 Ga0496112_0022945 Ga0496112_0022945_567_1469 288
2084 3300048915 Ga0496112_0179532 Ga0496112_0179532_333_1235 288
2085 3300048915 Ga0496112_0181055 Ga0496112_0181055_928_1830 288
2086 3300048915 Ga0496112_0566202 Ga0496112_0566202_129_1031 288
2087 3300048916 Ga0496113_0049855 Ga0496113_0049855_806_1708 288
2088 3300048916 Ga0496113_0274579 Ga0496113_0274579_140_1114 288
2089 3300048917 Ga0496114_0041941 Ga0496114_0041941_1388_2290 288
2090 3300048917 Ga0496114_0156892 Ga0496114_0156892_429_1331 288
2091 3300048917 Ga0496114_0162639 Ga0496114_0162639_944_1846 288
2092 3300048918 Ga0496115_0002825 Ga0496115_0002825_9703_10605 288
2093 3300048918 Ga0496115_0022795 Ga0496115_0022795_446_1336 288
2094 3300048919 Ga0496116_0000061 Ga0496116_0000061_119308_120174 288
2095 3300048919 Ga0496116_0002679 Ga0496116_0002679_16268_17134 288
2096 3300048919 Ga0496116_0004501 Ga0496116_0004501_1123_1989 288
2097 3300048919 Ga0496116_0004648 Ga0496116_0004648_10813_11679 288
2098 3300048919 Ga0496116_0032753 Ga0496116_0032753_1772_2674 288
2099 3300048919 Ga0496116_0089587 Ga0496116_0089587_508_1482 288
2100 3300048920 Ga0496117_0000001 Ga0496117_0000001_1322488_1323372 288
2101 3300048920 Ga0496117_0044016 Ga0496117_0044016_627_1529 288
2102 3300048920 Ga0496117_0108516 Ga0496117_0108516_691_1611 288
2103 3300048920 Ga0496117_0166454 Ga0496117_0166454_78_1052 288
2104 3300048921 Ga0496118_0000002 Ga0496118_0000002_1322488_1323372 288
2105 3300048921 Ga0496118_0009532 Ga0496118_0009532_6982_7884 288
2106 3300048921 Ga0496118_0057074 Ga0496118_0057074_652_1572 288
2107 3300048921 Ga0496118_0061408 Ga0496118_0061408_1215_2117 288
2108 3300048922 Ga0496119_0001636 Ga0496119_0001636_1717_2622 288
2109 3300048922 Ga0496119_0033824 Ga0496119_0033824_2150_3052 288
2110 3300048922 Ga0496119_0190741 Ga0496119_0190741_85_990 288
2111 3300048924 Ga0496121_0000099 Ga0496121_0000099_197375_198277 288
2112 3300048924 Ga0496121_0000684 Ga0496121_0000684_1578_2462 288
2113 3300048924 Ga0496121_0002376 Ga0496121_0002376_25465_26370 288
2114 3300048924 Ga0496121_0002933 Ga0496121_0002933_20668_21537 288
2115 3300048924 Ga0496121_0006287 Ga0496121_0006287_10827_11711 288
2116 3300048924 Ga0496121_0012784 Ga0496121_0012784_861_1766 288
2117 3300048924 Ga0496121_0028225 Ga0496121_0028225_545_1447 288
2118 3300048924 Ga0496121_0032833 Ga0496121_0032833_2866_3840 288
2119 3300048924 Ga0496121_0053578 Ga0496121_0053578_2324_3244 288
2120 3300048924 Ga0496121_0063399 Ga0496121_0063399_43_972 288
2121 3300048924 Ga0496121_0067626 Ga0496121_0067626_1311_2177 288
2122 3300048924 Ga0496121_0087453 Ga0496121_0087453_996_1898 288
2123 3300048924 Ga0496121_0168484 Ga0496121_0168484_311_1210 288
2124 3300048924 Ga0496121_0197206 Ga0496121_0197206_38_940 288
2125 3300048924 Ga0496121_0231043 Ga0496121_0231043_169_1071 288
2126 3300048925 Ga0496122_0005417 Ga0496122_0005417_117_1001 288
2127 3300048925 Ga0496122_0093078 Ga0496122_0093078_33_935 288
2128 3300048925 Ga0496122_0099831 Ga0496122_0099831_100_966 288
2129 3300048925 Ga0496122_0101137 Ga0496122_0101137_517_1419 288
2130 3300048926 Ga0496123_0018674 Ga0496123_0018674_2389_3255 288
2131 3300048926 Ga0496123_0051185 Ga0496123_0051185_900_1805 288
2132 3300048926 Ga0496123_0093223 Ga0496123_0093223_753_1658 288
2133 3300048926 Ga0496123_0108089 Ga0496123_0108089_649_1515 288
2134 3300048927 Ga0496124_0000788 Ga0496124_0000788_982_1884 288
2135 3300048927 Ga0496124_0026389 Ga0496124_0026389_4076_4978 288
2136 3300048927 Ga0496124_0055451 Ga0496124_0055451_2400_3266 288
2137 3300048927 Ga0496124_0058194 Ga0496124_0058194_877_1779 288
2138 3300048928 Ga0496125_0000715 Ga0496125_0000715_45753_46655 288
2139 3300048928 Ga0496125_0003799 Ga0496125_0003799_3750_4655 288
2140 3300048928 Ga0496125_0023769 Ga0496125_0023769_1489_2391 288
2141 3300048928 Ga0496125_0040985 Ga0496125_0040985_1614_2516 288
2142 3300048928 Ga0496125_0045842 Ga0496125_0045842_2424_3326 288
2143 3300048928 Ga0496125_0056254 Ga0496125_0056254_1693_2559 288
2144 3300048928 Ga0496125_0140249 Ga0496125_0140249_527_1501 288
2145 3300048928 Ga0496125_0207685 Ga0496125_0207685_153_1055 288
2146 3300048929 Ga0496126_0000397 Ga0496126_0000397_78788_79654 288
2147 3300048929 Ga0496126_0006480 Ga0496126_0006480_385_1275 288
2148 3300048929 Ga0496126_0014179 Ga0496126_0014179_6107_7009 288
2149 3300048929 Ga0496126_0016190 Ga0496126_0016190_3253_4155 288
2150 3300048929 Ga0496126_0037699 Ga0496126_0037699_918_1820 288
2151 3300048929 Ga0496126_0041380 Ga0496126_0041380_3008_3910 288
2152 3300048929 Ga0496126_0048610 Ga0496126_0048610_716_1621 288
2153 3300048929 Ga0496126_0062027 Ga0496126_0062027_1449_2351 288
2154 3300048929 Ga0496126_0065008 Ga0496126_0065008_1378_2280 288
2155 3300048929 Ga0496126_0081582 Ga0496126_0081582_223_1119 288
2156 3300048929 Ga0496126_0091239 Ga0496126_0091239_1139_2041 288
2157 3300048929 Ga0496126_0112527 Ga0496126_0112527_807_1709 288
2158 3300048929 Ga0496126_0121887 Ga0496126_0121887_912_1817 288
2159 3300048929 Ga0496126_0188274 Ga0496126_0188274_758_1732 288
2160 3300048929 Ga0496126_0197132 Ga0496126_0197132_657_1559 288
2161 3300048929 Ga0496126_0218447 Ga0496126_0218447_462_1364 288
2162 3300048929 Ga0496126_0333399 Ga0496126_0333399_219_1121 288
2163 3300048929 Ga0496126_0421289 Ga0496126_0421289_109_1011 288
2164 3300049460 Ga0495682_0010828 Ga0495682_0010828_2160_3044 288
2165 3300049568 Ga0501031_0006330 Ga0501031_0006330_2074_2976 288
2166 3300049568 Ga0501031_0029630 Ga0501031_0029630_547_1437 288
2167 3300049568 Ga0501031_0051048 Ga0501031_0051048_1235_2101 288
2168 3300049569 Ga0501032_0000088 Ga0501032_0000088_14605_15507 288
2169 3300049569 Ga0501032_0004273 Ga0501032_0004273_9228_10094 288
2170 3300049569 Ga0501032_0023586 Ga0501032_0023586_1978_2883 288
2171 3300049569 Ga0501032_0048350 Ga0501032_0048350_670_1563 288
2172 3300049569 Ga0501032_0049366 Ga0501032_0049366_1571_2437 288
2173 3300049570 Ga0501033_0000724 Ga0501033_0000724_28156_29058 288
2174 3300049570 Ga0501033_0004494 Ga0501033_0004494_1788_2681 288
2175 3300049570 Ga0501033_0004740 Ga0501033_0004740_9348_10214 288
2176 3300049570 Ga0501033_0038006 Ga0501033_0038006_49_951 288
2177 3300049570 Ga0501033_0090768 Ga0501033_0090768_778_1671 288
2178 3300049570 Ga0501033_0091683 Ga0501033_0091683_669_1535 288
2179 3300049570 Ga0501033_0259434 Ga0501033_0259434_220_1086 288
2180 3300049570 Ga0501033_0265378 Ga0501033_0265378_152_1054 288
2181 3300049571 Ga0501034_0000332 Ga0501034_0000332_64784_65686 288
2182 3300049571 Ga0501034_0000413 Ga0501034_0000413_66015_66887 288
2183 3300049571 Ga0501034_0046250 Ga0501034_0046250_518_1384 288
2184 3300049571 Ga0501034_0087844 Ga0501034_0087844_419_1321 288
2185 3300049571 Ga0501034_0133323 Ga0501034_0133323_686_1552 288
2186 3300049571 Ga0501034_0163752 Ga0501034_0163752_1029_1931 288
2187 3300049571 Ga0501034_0184492 Ga0501034_0184492_263_1156 288
2188 3300049571 Ga0501034_0291310 Ga0501034_0291310_693_1559 288
2189 3300049571 Ga0501034_0294452 Ga0501034_0294452_403_1308 288
2190 3300049571 Ga0501034_0409243 Ga0501034_0409243_383_1249 288
2191 3300049572 Ga0501036_0000233 Ga0501036_0000233_28156_29058 288
2192 3300049572 Ga0501036_0019618 Ga0501036_0019618_1837_2730 288
2193 3300049572 Ga0501036_0056239 Ga0501036_0056239_944_1846 288
2194 3300049573 Ga0501037_0000242 Ga0501037_0000242_32867_33733 288
2195 3300049573 Ga0501037_0000421 Ga0501037_0000421_5717_6619 288
2196 3300049573 Ga0501037_0001825 Ga0501037_0001825_1914_2807 288
2197 3300049573 Ga0501037_0144712 Ga0501037_0144712_499_1401 288
2198 3300049573 Ga0501037_0180980 Ga0501037_0180980_263_1129 288
2199 3300049574 Ga0501038_0000049 Ga0501038_0000049_25456_26358 288
2200 3300049574 Ga0501038_0006856 Ga0501038_0006856_8373_9266 288
2201 3300049574 Ga0501038_0097772 Ga0501038_0097772_748_1614 288
2202 3300049574 Ga0501038_0152963 Ga0501038_0152963_867_1733 288
2203 3300049575 Ga0501039_0002402 Ga0501039_0002402_7995_8897 288
2204 3300049575 Ga0501039_0142671 Ga0501039_0142671_648_1514 288
2205 3300049579 Ga0501043_0000440 Ga0501043_0000440_3390_4256 288
2206 3300049579 Ga0501043_0000740 Ga0501043_0000740_19952_20854 288
2207 3300049579 Ga0501043_0013981 Ga0501043_0013981_5165_6058 288
2208 3300049579 Ga0501043_0115632 Ga0501043_0115632_639_1541 288
2209 3300049579 Ga0501043_0186067 Ga0501043_0186067_103_969 288
2210 3300049579 Ga0501043_0227759 Ga0501043_0227759_338_1240 288
2211 3300049580 Ga0501046_0006266 Ga0501046_0006266_3271_4164 288
2212 3300049580 Ga0501046_0008083 Ga0501046_0008083_5020_5922 288
2213 3300049580 Ga0501046_0022355 Ga0501046_0022355_649_1515 288
2214 3300049581 Ga0501047_0000875 Ga0501047_0000875_5028_5930 288
2215 3300049581 Ga0501047_0005968 Ga0501047_0005968_9289_10182 288
2216 3300049581 Ga0501047_0009133 Ga0501047_0009133_7952_8857 288
2217 3300049581 Ga0501047_0031398 Ga0501047_0031398_3920_4786 288
2218 3300049581 Ga0501047_0160289 Ga0501047_0160289_276_1178 288
2219 3300049581 Ga0501047_0431125 Ga0501047_0431125_56_943 288
2220 3300049581 Ga0501047_0491545 Ga0501047_0491545_61_927 288
2221 3300049582 Ga0501048_0005053 Ga0501048_0005053_5107_6009 288
2222 3300049582 Ga0501048_0020879 Ga0501048_0020879_2160_3026 288
2223 3300049582 Ga0501048_0208119 Ga0501048_0208119_332_1234 288
2224 3300049584 Ga0501068_0029721 Ga0501068_0029721_1772_2638 288
2225 3300049585 Ga0501069_0000017 Ga0501069_0000017_22021_22887 288
2226 3300049585 Ga0501069_0021804 Ga0501069_0021804_869_1771 288
2227 3300049585 Ga0501069_0086231 Ga0501069_0086231_227_1093 288
2228 3300049586 Ga0501070_0007767 Ga0501070_0007767_6172_7038 288
2229 3300049586 Ga0501070_0010286 Ga0501070_0010286_3177_4043 288
2230 3300049586 Ga0501070_0025357 Ga0501070_0025357_2417_3283 288
2231 3300049586 Ga0501070_0027733 Ga0501070_0027733_3666_4553 288
2232 3300049586 Ga0501070_0127996 Ga0501070_0127996_1023_1889 288
2233 3300049586 Ga0501070_0235240 Ga0501070_0235240_169_1035 288
2234 3300049587 Ga0501071_0031427 Ga0501071_0031427_44_910 288
2235 3300049588 Ga0501072_0054390 Ga0501072_0054390_2152_3054 288
2236 3300049588 Ga0501072_0197180 Ga0501072_0197180_183_1085 288
2237 3300049589 Ga0501073_0000112 Ga0501073_0000112_48816_49718 288
2238 3300049589 Ga0501073_0117617 Ga0501073_0117617_592_1458 288
2239 3300049590 Ga0501074_0000610 Ga0501074_0000610_8267_9133 288
2240 3300049590 Ga0501074_0006273 Ga0501074_0006273_1889_2791 288
2241 3300049590 Ga0501074_0120179 Ga0501074_0120179_576_1442 288
2242 3300049705 Ga0501225_0017431 Ga0501225_0017431_724_1614 288
2243 3300049741 Ga0501079_0003748 Ga0501079_0003748_9933_10835 288
2244 3300049742 Ga0501080_0000343 Ga0501080_0000343_31772_32674 288
2245 3300049742 Ga0501080_0006075 Ga0501080_0006075_9519_10385 288
2246 3300049742 Ga0501080_0177732 Ga0501080_0177732_193_1059 288
2247 3300049744 Ga0501083_0000724 Ga0501083_0000724_8940_9842 288
2248 3300049744 Ga0501083_0003168 Ga0501083_0003168_4604_5470 288
2249 3300049759 Ga0501262_000189 Ga0501262_000189_1871_2761 288
2250 3300049776 Ga0501280_000460 Ga0501280_000460_728_1597 288
2251 3300049822 Ga0501035_0000101 Ga0501035_0000101_33209_34075 288
2252 3300049822 Ga0501035_0001854 Ga0501035_0001854_2879_3781 288
2253 3300049822 Ga0501035_0003169 Ga0501035_0003169_14218_15084 288
2254 3300049822 Ga0501035_0018035 Ga0501035_0018035_4324_5190 288
2255 3300049822 Ga0501035_0296486 Ga0501035_0296486_78_944 288
2256 3300049822 Ga0501035_0343325 Ga0501035_0343325_215_1081 288
2257 3300049823 Ga0501044_0000010 Ga0501044_0000010_166803_167669 288
2258 3300049823 Ga0501044_0000182 Ga0501044_0000182_15348_16250 288
2259 3300049823 Ga0501044_0000916 Ga0501044_0000916_4620_5513 288
2260 3300049823 Ga0501044_0025590 Ga0501044_0025590_5046_5948 288
2261 3300049823 Ga0501044_0063871 Ga0501044_0063871_175_1041 288
2262 3300049823 Ga0501044_0096823 Ga0501044_0096823_1383_2249 288
2263 3300049823 Ga0501044_0115924 Ga0501044_0115924_683_1549 288
2264 3300049823 Ga0501044_0133026 Ga0501044_0133026_197_1084 288
2265 3300049823 Ga0501044_0321189 Ga0501044_0321189_19_921 288
2266 3300049824 Ga0501045_0086916 Ga0501045_0086916_1258_2160 288
2267 3300049824 Ga0501045_0230577 Ga0501045_0230577_368_1234 288
2268 3300050489 nmdc:mga03683_33107_c1 nmdc:mga03683_33107_c1_64_966 288
2269 3300050491 nmdc:mga00v17_104836_c1 nmdc:mga00v17_104836_c1_590_1564 288
2270 3300050491 nmdc:mga00v17_115762_c1 nmdc:mga00v17_115762_c1_607_1497 288
2271 3300050491 nmdc:mga00v17_50950_c1 nmdc:mga00v17_50950_c1_448_1350 288
2272 3300050492 nmdc:mga0yw44_3131_c1 nmdc:mga0yw44_3131_c1_5815_6717 288
2273 3300050492 nmdc:mga0yw44_34788_c1 nmdc:mga0yw44_34788_c1_903_1877 288
2274 3300050492 nmdc:mga0yw44_4219_c1 nmdc:mga0yw44_4219_c1_2289_3191 288
2275 3300050492 nmdc:mga0yw44_43205_c1 nmdc:mga0yw44_43205_c1_249_1151 288
2276 3300050493 nmdc:mga0k408_13536_c2 nmdc:mga0k408_13536_c2_821_1711 288
2277 3300050493 nmdc:mga0k408_214466_c1 nmdc:mga0k408_214466_c1_105_992 288
2278 3300050493 nmdc:mga0k408_223182_c1 nmdc:mga0k408_223182_c1_153_1043 288
2279 3300050493 nmdc:mga0k408_61822_c1 nmdc:mga0k408_61822_c1_1018_1992 288
2280 3300050494 nmdc:mga06z11_77649_c1 nmdc:mga06z11_77649_c1_344_1246 288
2281 3300050495 nmdc:mga04h51_2456_c1 nmdc:mga04h51_2456_c1_3253_4122 288
2282 3300050495 nmdc:mga04h51_26269_c1 nmdc:mga04h51_26269_c1_544_1518 288
2283 3300050496 nmdc:mga07m45_127312_c1 nmdc:mga07m45_127312_c1_134_1036 288
2284 3300050496 nmdc:mga07m45_2857_c1 nmdc:mga07m45_2857_c1_5530_6420 288
2285 3300050496 nmdc:mga07m45_32439_c1 nmdc:mga07m45_32439_c1_775_1665 288
2286 3300050496 nmdc:mga07m45_700_c1 nmdc:mga07m45_700_c1_11657_12547 288
2287 3300050507 nmdc:mga05p37_510010_c1 nmdc:mga05p37_510010_c1_173_1075 288
2288 3300050515 nmdc:mga0a205_269570_c1 nmdc:mga0a205_269570_c1_101_1003 288
2289 3300050516 nmdc:mga0sz30_13236_c1 nmdc:mga0sz30_13236_c1_2014_2916 288
2290 3300050516 nmdc:mga0sz30_1854_c1 nmdc:mga0sz30_1854_c1_2752_3654 288
2291 3300050516 nmdc:mga0sz30_20265_c1 nmdc:mga0sz30_20265_c1_1304_2278 288
2292 3300053077 Ga0495601_0100329 Ga0495601_0100329_699_1601 288
2293 3300053077 Ga0495601_0137133 Ga0495601_0137133_409_1311 288
2294 3300053077 Ga0495601_0225575 Ga0495601_0225575_260_1162 288
2295 3300053080 Ga0500635_0005930 Ga0500635_0005930_2259_3161 288
2296 3300053084 Ga0495595_0000394 Ga0495595_0000394_8622_9524 288
2297 3300053084 Ga0495595_0043698 Ga0495595_0043698_396_1298 288
2298 3300053085 Ga0495619_0001260 Ga0495619_0001260_6211_7113 288
2299 3300053085 Ga0495619_0075414 Ga0495619_0075414_1259_2161 288
2300 3300053086 Ga0500578_0077167 Ga0500578_0077167_1165_2067 288
2301 3300053086 Ga0500578_0088708 Ga0500578_0088708_437_1411 288
2302 3300053087 Ga0500643_000042 Ga0500643_000042_117720_118622 288
2303 3300053089 Ga0500581_016873 Ga0500581_016873_2715_3620 288
2304 3300053093 Ga0500651_0000751 Ga0500651_0000751_7036_7938 288
2305 3300053093 Ga0500651_0030895 Ga0500651_0030895_2044_2949 288
2306 3300053093 Ga0500651_0039450 Ga0500651_0039450_208_1110 288
2307 3300053094 Ga0500566_0000621 Ga0500566_0000621_4075_4977 288
2308 3300053094 Ga0500566_0005911 Ga0500566_0005911_4686_5591 288
2309 3300053094 Ga0500566_0005990 Ga0500566_0005990_920_1822 288
2310 3300053094 Ga0500566_0007233 Ga0500566_0007233_885_1787 288
2311 3300053102 Ga0500554_024840 Ga0500554_024840_598_1500 288
2312 3300053103 Ga0500555_007469 Ga0500555_007469_2101_3003 288
2313 3300053104 Ga0500556_0000012 Ga0500556_0000012_127547_128452 288
2314 3300053104 Ga0500556_0001028 Ga0500556_0001028_1271_2176 288
2315 3300053105 Ga0500557_000006 Ga0500557_000006_36261_37163 288
2316 3300053108 Ga0500562_010400 Ga0500562_010400_311_1213 288
2317 3300053108 Ga0500562_015423 Ga0500562_015423_663_1568 288
2318 3300053109 Ga0500569_016776 Ga0500569_016776_16_921 288
2319 3300053109 Ga0500569_064462 Ga0500569_064462_32_1006 288
2320 3300053111 Ga0500572_000226 Ga0500572_000226_105_1007 288
2321 3300053111 Ga0500572_006955 Ga0500572_006955_736_1602 288
2322 3300053116 Ga0500592_000296 Ga0500592_000296_2268_3173 288
2323 3300053119 Ga0500595_009264 Ga0500595_009264_729_1631 288
2324 3300053119 Ga0500595_013051 Ga0500595_013051_900_1805 288
2325 3300053119 Ga0500595_026070 Ga0500595_026070_1001_1903 288
2326 3300053122 Ga0500608_003307 Ga0500608_003307_2336_3241 288
2327 3300053122 Ga0500608_048783 Ga0500608_048783_735_1601 288
2328 3300053125 Ga0500618_000025 Ga0500618_000025_64618_65487 288
2329 3300053125 Ga0500618_007682 Ga0500618_007682_1129_2034 288
2330 3300053130 Ga0500642_0000110 Ga0500642_0000110_8301_9206 288
2331 3300053130 Ga0500642_0000686 Ga0500642_0000686_6948_7850 288
2332 3300053130 Ga0500642_0003964 Ga0500642_0003964_2695_3579 288
2333 3300053131 Ga0500652_013163 Ga0500652_013163_603_1508 288
2334 3300053131 Ga0500652_136860 Ga0500652_136860_105_974 288
2335 3300053134 Ga0500658_0036906 Ga0500658_0036906_480_1382 288
2336 3300053136 Ga0500559_0000198 Ga0500559_0000198_22312_23217 288
2337 3300053136 Ga0500559_0005770 Ga0500559_0005770_507_1409 288
2338 3300053136 Ga0500559_0009515 Ga0500559_0009515_1148_2050 288
2339 3300053136 Ga0500559_0052706 Ga0500559_0052706_48_950 288
2340 3300053136 Ga0500559_0068411 Ga0500559_0068411_225_1127 288
2341 3300053136 Ga0500559_0073163 Ga0500559_0073163_541_1443 288
2342 3300053139 Ga0500568_0000262 Ga0500568_0000262_22835_23701 288
2343 3300053139 Ga0500568_0001410 Ga0500568_0001410_2613_3518 288
2344 3300053139 Ga0500568_0009265 Ga0500568_0009265_3585_4490 288
2345 3300053139 Ga0500568_0090095 Ga0500568_0090095_227_1129 288
2346 3300053139 Ga0500568_0104083 Ga0500568_0104083_11_913 288
2347 3300053145 Ga0500586_001269 Ga0500586_001269_3267_4169 288
2348 3300053148 Ga0500590_054917 Ga0500590_054917_353_1255 288
2349 3300053150 Ga0500603_001570 Ga0500603_001570_591_1493 288
2350 3300053151 Ga0500604_0009060 Ga0500604_0009060_1155_2060 288
2351 3300053153 Ga0500616_0000035 Ga0500616_0000035_261295_262200 288
2352 3300053156 Ga0500622_0000647 Ga0500622_0000647_29486_30352 288
2353 3300053156 Ga0500622_0001402 Ga0500622_0001402_6826_7692 288
2354 3300053156 Ga0500622_0006944 Ga0500622_0006944_19_993 288
2355 3300053156 Ga0500622_0011016 Ga0500622_0011016_2931_3836 288
2356 3300053156 Ga0500622_0020165 Ga0500622_0020165_2498_3400 288
2357 3300053159 Ga0500630_002647 Ga0500630_002647_559_1461 288
2358 3300053161 Ga0500634_0103553 Ga0500634_0103553_194_1096 288
2359 3300053162 Ga0500638_046459 Ga0500638_046459_313_1215 288
2360 3300053163 Ga0500639_000029 Ga0500639_000029_55300_56202 288
2361 3300053177 Ga0500636_0000009 Ga0500636_0000009_135426_136292 288
2362 3300053177 Ga0500636_0000711 Ga0500636_0000711_16716_17621 288
2363 3300053177 Ga0500636_0100958 Ga0500636_0100958_731_1597 288
2364 3300053177 Ga0500636_0130136 Ga0500636_0130136_164_1066 288
2365 3300053178 Ga0500637_0000707 Ga0500637_0000707_2383_3285 288
2366 3300053178 Ga0500637_0078591 Ga0500637_0078591_395_1297 288
2367 3300053178 Ga0500637_0084706 Ga0500637_0084706_763_1668 288
2368 3300053178 Ga0500637_0129457 Ga0500637_0129457_203_1105 288
2369 3300053729 Ga0500625_000351 Ga0500625_000351_10195_11097 288
2370 3300053730 Ga0500645_012656 Ga0500645_012656_598_1500 288
2371 3300053730 Ga0500645_039130 Ga0500645_039130_453_1358 288
2372 3300053731 Ga0500609_002203 Ga0500609_002203_1259_2233 288
2373 3300053731 Ga0500609_006122 Ga0500609_006122_522_1424 288
2374 3300053735 Ga0500596_005177 Ga0500596_005177_429_1331 288
2375 3300053737 Ga0500601_001469 Ga0500601_001469_124_1026 288
2376 3300054114 Ga0501084_0041419 Ga0501084_0041419_975_1877 288
2377 3300055283 Ga0500661_009777 Ga0500661_009777_267_1169 288
2378 3300059423 Ga0590074_025951 Ga0590074_025951_28_915 288
2379 3300059426 Ga0590077_031064 Ga0590077_031064_259_1146 288
2380 3300060353 Ga0501082_0002561 Ga0501082_0002561_12007_12909 288
2381 3300060353 Ga0501082_0233918 Ga0501082_0233918_658_1524 288
2382 3300060353 Ga0501082_0253642 Ga0501082_0253642_198_1100 288
2383 3300060353 Ga0501082_0477300 Ga0501082_0477300_54_956 288
2384 3300061719 Ga0466962_0005798 Ga0466962_0005798_3758_4645 288
2385 3300061719 Ga0466962_0027799 Ga0466962_0027799_161_1063 288
2386 iso_pu_bacteria 2885080285 2885082572 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

85

289

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8756 49 277
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8462 49 274
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8312 52 277
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.8291 51 276
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.8228 49 274
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9169 46 283 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9066 46 285 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9024 46 283 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8959 46 283 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8919 46 279 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A529SKP8-F1-model_v4 Sugar ABC transporter permease 0.9842 62 224 GO:0005886
GO:0055085
AF-A0A529SKP8-F1-model_v4 Sugar ABC transporter permease 0.9724 62 224 GO:0005886
GO:0055085
AF-A0A434FWY4-F1-model_v4 Sugar ABC transporter permease 0.9453 68 288 GO:0005886
GO:0055085
AF-A0A434FWY4-F1-model_v4 Sugar ABC transporter permease 0.9412 68 288 GO:0005886
GO:0055085
AF-A0A4Q6F296-F1-model_v4 deleted 0.9393 88 288

Feature Viewer

pLDDT pTM Quality
87.78 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map