F496764
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2386 | 1157 | 1840 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10024874|JGI24739J22299_100248742 |
| Length | 324 |
| Sequence | MDKTINQKAWFLVLPVFLVVAFSAVLPLMTVVNYSMQDTFGNNQFFWNGVGWFKELLDPSTDLGGRFLASLGRNLFFSMVILAIEVPLGIVVALSMPRQGWTVAACLVILALPLLIPWNVVGTIWQIFGRPDIGLLGYVLNHIGLDYNYVSNDIDAWVTVIVMDVWHWTSLVALLCYAGLKSIPEAYYQAAQIDGASRWAVFKAXQLPKMNRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNSTTFVSIELVKIALGQFDLGKAAALSLVYNLIILIVCWIFYTVMTNAGVERKVQAESEPAVEPKASAALKPVPALKPKEGVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 5 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 6 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 7 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 8 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 9 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 10 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 13 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 14 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 15 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 16 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 17 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 18 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 19 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 20 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 21 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 22 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 23 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 24 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 25 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 26 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 27 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 28 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 29 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 30 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 31 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 32 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 33 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 34 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 35 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 36 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 37 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 38 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 39 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 40 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 41 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 42 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 43 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 44 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 45 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 46 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 47 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 48 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 49 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 50 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 51 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 52 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 53 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 54 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 55 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 56 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 57 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 58 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 59 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 60 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 61 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 62 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 63 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 64 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 65 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 66 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 67 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 68 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 69 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 70 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 71 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 72 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 73 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 74 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 75 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 76 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 77 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 78 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 79 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 80 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 81 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 82 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 83 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 84 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 85 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 86 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 87 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 88 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 89 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 90 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 91 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 92 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 93 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 94 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 95 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 96 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 97 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 98 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 99 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 100 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 101 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 102 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 103 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 104 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 105 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 106 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 107 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 108 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 109 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 110 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 111 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 112 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 113 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 114 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 115 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 116 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 117 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 118 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 119 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 120 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 121 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 122 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 123 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 124 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 125 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 126 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 127 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 128 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 129 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 130 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 131 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 132 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 133 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 134 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 135 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 136 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 137 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 138 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 139 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 140 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 141 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 142 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 143 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 144 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 145 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 146 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 147 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 148 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 149 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 150 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 151 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 152 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 153 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 154 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 155 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 156 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 157 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 158 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 159 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 160 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 161 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 162 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 163 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 164 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 165 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 166 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 167 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 168 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 169 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 170 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 171 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 172 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 173 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 174 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 175 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 176 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 177 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 178 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 179 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 180 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 181 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 182 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 183 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 184 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 185 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 186 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 187 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 188 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 189 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 190 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 191 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 192 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 193 | 2791355199 | |||
| 194 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 195 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 196 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 197 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 198 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 199 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 200 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 201 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 202 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 203 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 204 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 205 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 206 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 207 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 208 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 209 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 210 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 211 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 212 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 213 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 214 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 215 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 216 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 217 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 218 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 219 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 220 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 221 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 222 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 223 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 224 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 225 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 226 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 227 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 228 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 229 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 230 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 231 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 232 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 233 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 234 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 235 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 236 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 237 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 238 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 239 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 240 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 241 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 242 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 243 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 244 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 245 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 246 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 247 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 248 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 249 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 250 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 251 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 252 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 253 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 254 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 255 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 256 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 257 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 258 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 259 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 260 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 261 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 262 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 263 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 264 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 265 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 266 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 267 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 268 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 269 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 270 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 271 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 272 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 273 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 274 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 275 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 276 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 277 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 278 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 279 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 280 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 281 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 282 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 283 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 284 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 285 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 286 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 287 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 288 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 289 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 290 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 291 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 292 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 293 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 294 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 295 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 296 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 297 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 298 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 299 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 300 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 301 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 302 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 303 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 304 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 305 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 306 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 307 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 308 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 309 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 310 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 311 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 312 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 313 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 314 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 315 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 316 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 317 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 318 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 319 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 320 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 321 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 322 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 323 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 324 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 325 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 326 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 327 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 328 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 329 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 330 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 331 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 332 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 333 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 334 | 2904699407 | |||
| 335 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 336 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 337 | 2906610324 | |||
| 338 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 339 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 340 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 341 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 342 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 343 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 344 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 345 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 346 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 347 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 348 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 349 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 350 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 351 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 352 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 353 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 354 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 355 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 356 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 357 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 358 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 359 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 360 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 361 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 362 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 363 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 364 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 365 | 2922368715 | |||
| 366 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 367 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 368 | 2922425934 | |||
| 369 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 370 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 371 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 372 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 373 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 374 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 375 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 376 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 377 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 378 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 379 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 380 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 381 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 382 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 383 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 384 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 385 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 386 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 387 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 388 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 389 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 390 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 391 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 392 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 393 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 394 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 395 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 396 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 397 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 398 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 399 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 400 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 401 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 402 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 403 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 404 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 405 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 406 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 407 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 408 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 409 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 410 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 411 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 412 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 413 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 414 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 415 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 416 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 417 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 418 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 419 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 420 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 421 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 422 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 423 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 424 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 425 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 426 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 427 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 428 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 429 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 430 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 431 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 432 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 433 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 434 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 435 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 436 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 437 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 438 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 439 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 440 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 441 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 442 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 443 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 444 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 445 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 446 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 447 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 448 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 449 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 450 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 451 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 452 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 453 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 454 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 455 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 456 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 457 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 458 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 459 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 460 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 461 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 462 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 463 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 464 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 465 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 466 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 467 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 468 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 469 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 470 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 471 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 472 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 473 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 474 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 475 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 476 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 477 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 478 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 479 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 480 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 481 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 482 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 483 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 484 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 485 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 486 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 487 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 488 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 489 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 490 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 491 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 492 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 493 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 494 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 495 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 496 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 497 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 498 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 499 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 500 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 501 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 502 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 503 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 504 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 505 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 506 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 507 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 508 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 509 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 510 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 511 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 512 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 513 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 514 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 515 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 516 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 517 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 518 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 519 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 520 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 521 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 522 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 523 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 524 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 525 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 526 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 527 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 528 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 530 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 532 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 533 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 534 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 535 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 536 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 537 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 538 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 539 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 540 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 541 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 542 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 543 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 544 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 545 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 546 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 547 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 548 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 549 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 550 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 551 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 552 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 553 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 554 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 555 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 556 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 557 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 558 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 559 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 560 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 561 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 562 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 563 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 564 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 565 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 566 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 567 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 568 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 569 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 570 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 571 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 572 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 573 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 574 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 575 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 576 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 577 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 578 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 579 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 580 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 581 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 582 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 584 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 585 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 586 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 587 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 588 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 589 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 590 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 591 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 592 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 593 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 594 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 595 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 596 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 597 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 598 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 600 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 602 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 603 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 604 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 605 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 606 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 607 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 608 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 609 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 610 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 611 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 612 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 613 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 614 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 615 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 616 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 617 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 618 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 619 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 620 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 621 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 622 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 623 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 624 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 625 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 626 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 627 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 628 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 629 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 630 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 631 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 632 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 633 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 634 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 635 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 636 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 637 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 638 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 639 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 640 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 641 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 642 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 643 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 644 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 645 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 646 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 647 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 648 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 649 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 650 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 651 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 652 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 653 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 654 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 655 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 656 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 657 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 658 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 659 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 660 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 661 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 662 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 663 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 664 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 665 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 666 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 669 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 673 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 674 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 675 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 676 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 677 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 678 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 679 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 682 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 684 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 691 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 693 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 697 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 700 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 703 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 704 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 705 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 706 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 707 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 709 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 711 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 712 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 713 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 715 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 716 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 717 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 718 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 719 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 720 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 721 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 722 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 723 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 724 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 725 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 726 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 727 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 728 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 729 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 730 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 731 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 732 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 733 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 734 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 735 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 736 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 737 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 738 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 739 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 740 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 741 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 742 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 743 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 744 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 745 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 746 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 747 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 748 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 749 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 750 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 751 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 752 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 753 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 754 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 755 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 756 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 757 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 758 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 759 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 760 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 761 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 762 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 763 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 764 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 765 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 766 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 767 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 768 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 769 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 770 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 771 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 772 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 773 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 774 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 775 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 776 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 777 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 778 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 779 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 780 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 781 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 782 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 783 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 784 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 785 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 786 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 787 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 788 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 789 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 790 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 791 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 792 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 793 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 794 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 795 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 796 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 797 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 798 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 799 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 800 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 801 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 802 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 803 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 804 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 805 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 806 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 807 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 808 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 809 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 810 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 811 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 812 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 813 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 814 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 815 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 816 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 817 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 818 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 819 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 820 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 821 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 822 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 823 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 824 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 825 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 826 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 827 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 828 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 829 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 830 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 831 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 832 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 833 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 834 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 835 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 836 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 837 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 838 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 839 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 840 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 841 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 842 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 843 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 844 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 845 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 846 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 847 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 848 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 849 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 850 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 851 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 852 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 853 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 854 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 855 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 856 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 857 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 858 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 859 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 860 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 861 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 862 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 863 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 864 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 865 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 866 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 867 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 868 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 869 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 870 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 871 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 872 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 873 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 874 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 875 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 876 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 877 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 878 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 879 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 880 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 881 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 882 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 883 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 884 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 885 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 886 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 887 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 888 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 889 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 890 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 891 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 892 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 894 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 900 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 901 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 902 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 903 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 904 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 905 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 906 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 907 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 908 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 909 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 910 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 911 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 912 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 916 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 917 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 918 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 919 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 920 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 922 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 933 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 936 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 937 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 938 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 939 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 940 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 941 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 942 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 943 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 944 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 945 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 946 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 947 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 948 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 949 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 950 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 951 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 952 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 953 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 954 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 955 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 956 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 957 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 958 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 959 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 960 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 961 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 962 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 963 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 964 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 965 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 966 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 967 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 968 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 969 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 970 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 971 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 972 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 973 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 974 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 975 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 976 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 977 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 978 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 979 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 980 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 981 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 982 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 983 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 984 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 985 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 986 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 987 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 988 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 989 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 990 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 991 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 992 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 993 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 994 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 995 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 996 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 997 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 998 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 999 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1000 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1001 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1002 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1003 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1004 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1005 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 1006 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 1007 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 1008 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 1009 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 1010 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 1011 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 1012 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 1013 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 1014 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 1015 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1016 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1017 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1018 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 1019 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 1020 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1021 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1022 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1023 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1024 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1025 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1026 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1027 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1028 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1029 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1030 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1031 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1032 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1033 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1034 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1035 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1036 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1037 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1038 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1039 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1040 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1041 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1042 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1043 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1044 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 1045 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1046 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 1047 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1048 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1049 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 1050 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 1051 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1052 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1053 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1054 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1055 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1056 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1057 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1058 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1059 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1060 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1061 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 1062 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1063 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1064 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1065 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1066 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 1067 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1068 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 1069 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1070 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1071 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1072 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1073 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 1074 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1075 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 1076 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 1077 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1078 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1079 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 1080 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1081 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 1082 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 1083 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 1084 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1085 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 1086 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1087 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1088 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1089 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1090 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1091 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1092 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 1093 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 1094 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1095 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1096 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 1097 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 1098 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 1099 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 1100 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 1101 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 1102 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 1103 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1104 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1105 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 1106 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 1107 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 1108 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1109 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1110 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 1111 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1112 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1113 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1114 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1115 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1116 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1117 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1118 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1119 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1120 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 1121 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 1122 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1123 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 1124 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1125 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1126 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1127 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1128 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1129 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1130 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 1131 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 1132 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 1133 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 1134 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1135 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 1136 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 1137 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1138 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 1139 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1140 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 1141 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 1142 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 1143 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 1144 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 1145 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 1146 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 1147 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 1148 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 1149 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 1150 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 1151 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 1152 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 1153 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 1154 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 1155 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1156 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1157 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.11 |
| Metatranscriptomes | 0.17 |
| Isolates | 22.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.51 |
| Nodule | 9.51 |
| Rhizoplane | 4.65 |
| Rhizosphere | 56.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C7977 | 2010549000 | Bacteria | 2394 |
| 2 | MRS2a_Contig_49 | 2124908027 | Bacteria | 14994 |
| 3 | SwRhRL2b_contig_2985449 | 2162886007 | Bacteria | 1769 |
| 4 | JGI24739J22299_10024874 | 3300001989 | Bacteria | 2109 |
| 5 | JGI24739J22299_10047227 | 3300001989 | Bacteria | 1406 |
| 6 | JGI24744J21845_10026991 | 3300002077 | Bacteria | 1112 |
| 7 | JGI25155J39150_1000064 | 3300002704 | Bacteria | 69949 |
| 8 | JGI25156J39149_1000085 | 3300002705 | Bacteria | 69953 |
| 9 | JGI25156J39149_1006718 | 3300002705 | Bacteria | 3105 |
| 10 | JGI25154J39366_1000112 | 3300002738 | Bacteria | 69961 |
| 11 | JGI25157J39369_1000109 | 3300002741 | Bacteria | 69961 |
| 12 | JGI25164J39214_1004164 | 3300002772 | Bacteria | 1700 |
| 13 | JGI25152J39213_1003372 | 3300002773 | Bacteria | 5481 |
| 14 | JGI25152J39213_1015154 | 3300002773 | Bacteria | 1529 |
| 15 | JGI25150J39212_1000123 | 3300002774 | Bacteria | 43588 |
| 16 | JGI25150J39212_1003044 | 3300002774 | Bacteria | 4020 |
| 17 | JGI25150J39212_1016369 | 3300002774 | Bacteria | 1217 |
| 18 | JGI25159J45721_1004965 | 3300002987 | Bacteria | 4263 |
| 19 | JGI25159J45721_1009814 | 3300002987 | Bacteria | 2494 |
| 20 | JGI25159J45721_1014117 | 3300002987 | Bacteria | 1817 |
| 21 | JGI25151J46595_10000083 | 3300003187 | Bacteria | 130658 |
| 22 | JGI25151J46595_10005526 | 3300003187 | Bacteria | 6512 |
| 23 | JGI25151J46595_10010917 | 3300003187 | Bacteria | 4199 |
| 24 | JGI25151J46595_10017014 | 3300003187 | Bacteria | 3166 |
| 25 | JGI25151J46595_10028541 | 3300003187 | Bacteria | 2221 |
| 26 | JGI25151J46595_10046217 | 3300003187 | Bacteria | 1527 |
| 27 | JGI25406J46586_10000042 | 3300003203 | Bacteria | 56211 |
| 28 | JGI25406J46586_10023074 | 3300003203 | Bacteria | 2465 |
| 29 | JGI25153J46596_10000024 | 3300003215 | Bacteria | 238285 |
| 30 | JGI25153J46596_10000210 | 3300003215 | Bacteria | 52714 |
| 31 | JGI25153J46596_10002003 | 3300003215 | Bacteria | 12033 |
| 32 | JGI25153J46596_10002706 | 3300003215 | Bacteria | 10105 |
| 33 | JGI25153J46596_10004494 | 3300003215 | Bacteria | 7510 |
| 34 | JGI25153J46596_10008716 | 3300003215 | Bacteria | 4809 |
| 35 | JGI25160J50197_1002743 | 3300003354 | Bacteria | 8080 |
| 36 | JGI25161J50226_1000036 | 3300003374 | Bacteria | 133407 |
| 37 | JGI25404J52841_10024437 | 3300003659 | Bacteria | 1302 |
| 38 | Ga0055539_1000243 | 3300003752 | Bacteria | 35448 |
| 39 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 40 | Ga0055533_1000238 | 3300003756 | Bacteria | 35448 |
| 41 | Ga0055532_1000259 | 3300003758 | Bacteria | 35444 |
| 42 | Ga0055525_1000332 | 3300003759 | Bacteria | 35448 |
| 43 | Ga0055525_1000644 | 3300003759 | Bacteria | 13803 |
| 44 | Ga0055535_1005325 | 3300003761 | Bacteria | 2853 |
| 45 | Ga0055526_1003106 | 3300003771 | Bacteria | 10770 |
| 46 | Ga0055526_1008436 | 3300003771 | Bacteria | 5142 |
| 47 | Ga0055526_1019348 | 3300003771 | Bacteria | 2485 |
| 48 | Ga0055537_1000224 | 3300003773 | Bacteria | 41826 |
| 49 | Ga0055524_1000098 | 3300003775 | Bacteria | 108095 |
| 50 | Ga0055524_1000382 | 3300003775 | Bacteria | 38462 |
| 51 | Ga0055524_1026803 | 3300003775 | Bacteria | 1769 |
| 52 | Ga0055536_1000082 | 3300003781 | Bacteria | 81873 |
| 53 | Ga0055536_1000185 | 3300003781 | Bacteria | 51529 |
| 54 | Ga0055536_1013682 | 3300003781 | Bacteria | 2904 |
| 55 | Ga0055536_1013856 | 3300003781 | Bacteria | 2873 |
| 56 | Ga0055534_1000273 | 3300003784 | Bacteria | 35227 |
| 57 | Ga0055534_1000902 | 3300003784 | Bacteria | 13393 |
| 58 | Ga0055534_1004252 | 3300003784 | Bacteria | 4213 |
| 59 | Ga0055528_1001031 | 3300003790 | Bacteria | 18417 |
| 60 | Ga0055528_1005251 | 3300003790 | Bacteria | 6078 |
| 61 | Ga0055530_10000094 | 3300003791 | Bacteria | 76102 |
| 62 | Ga0055530_10001399 | 3300003791 | Bacteria | 17849 |
| 63 | Ga0055530_10002109 | 3300003791 | Bacteria | 13253 |
| 64 | Ga0055530_10002119 | 3300003791 | Bacteria | 13196 |
| 65 | Ga0055530_10003201 | 3300003791 | Bacteria | 9596 |
| 66 | Ga0055530_10006660 | 3300003791 | Bacteria | 5093 |
| 67 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 68 | Ga0055540_1000130 | 3300003792 | Bacteria | 76102 |
| 69 | Ga0055540_1000137 | 3300003792 | Bacteria | 73229 |
| 70 | Ga0055540_1000222 | 3300003792 | Bacteria | 53630 |
| 71 | Ga0055540_1001438 | 3300003792 | Bacteria | 14188 |
| 72 | Ga0055540_1012394 | 3300003792 | Bacteria | 2679 |
| 73 | Ga0055540_1026244 | 3300003792 | Bacteria | 1412 |
| 74 | Ga0055531_10000215 | 3300003794 | Bacteria | 63490 |
| 75 | Ga0055531_10000322 | 3300003794 | Bacteria | 47122 |
| 76 | Ga0055531_10001985 | 3300003794 | Bacteria | 14214 |
| 77 | Ga0055531_10006835 | 3300003794 | Bacteria | 6365 |
| 78 | Ga0055531_10010330 | 3300003794 | Bacteria | 4651 |
| 79 | Ga0055531_10041864 | 3300003794 | Bacteria | 1319 |
| 80 | Ga0055541_1000146 | 3300003841 | Bacteria | 35448 |
| 81 | Ga0055543_1000157 | 3300004625 | Bacteria | 57172 |
| 82 | Ga0055543_1004514 | 3300004625 | Bacteria | 3769 |
| 83 | Ga0055543_1010096 | 3300004625 | Bacteria | 1996 |
| 84 | Ga0065165_1000086 | 3300005262 | Bacteria | 154235 |
| 85 | Ga0065165_1000132 | 3300005262 | Bacteria | 128732 |
| 86 | Ga0065165_1000235 | 3300005262 | Bacteria | 96698 |
| 87 | Ga0065165_1002164 | 3300005262 | Bacteria | 17774 |
| 88 | Ga0065165_1003449 | 3300005262 | Bacteria | 11100 |
| 89 | Ga0065165_1005901 | 3300005262 | Bacteria | 6648 |
| 90 | Ga0065165_1015276 | 3300005262 | Bacteria | 2935 |
| 91 | Ga0065165_1018020 | 3300005262 | Bacteria | 2576 |
| 92 | Ga0065165_1021516 | 3300005262 | Bacteria | 2238 |
| 93 | Ga0065714_10006377 | 3300005288 | Bacteria | 5429 |
| 94 | Ga0065714_10010702 | 3300005288 | Bacteria | 4792 |
| 95 | Ga0065714_10064795 | 3300005288 | Bacteria | 18680 |
| 96 | Ga0065714_10068142 | 3300005288 | Bacteria | 4933 |
| 97 | Ga0065704_10070946 | 3300005289 | Bacteria | 14338 |
| 98 | Ga0065704_10089375 | 3300005289 | Bacteria | 2864 |
| 99 | Ga0065704_10157222 | 3300005289 | Bacteria | 1382 |
| 100 | Ga0065704_10164190 | 3300005289 | Bacteria | 1333 |
| 101 | Ga0065704_10206522 | 3300005289 | Bacteria | 1124 |
| 102 | Ga0065712_10081086 | 3300005290 | Bacteria | 3039 |
| 103 | Ga0065712_10118723 | 3300005290 | Bacteria | 1702 |
| 104 | Ga0065715_10141072 | 3300005293 | Bacteria | 1853 |
| 105 | Ga0070658_10023280 | 3300005327 | Bacteria | 4972 |
| 106 | Ga0070658_10139932 | 3300005327 | Bacteria | 2021 |
| 107 | Ga0070658_10318478 | 3300005327 | Bacteria | 1328 |
| 108 | Ga0070676_10050547 | 3300005328 | Bacteria | 2437 |
| 109 | Ga0070683_100003964 | 3300005329 | Bacteria | 12115 |
| 110 | Ga0070683_100017977 | 3300005329 | Bacteria | 6252 |
| 111 | Ga0070683_100046754 | 3300005329 | Bacteria | 3999 |
| 112 | Ga0070683_100127041 | 3300005329 | Bacteria | 2410 |
| 113 | Ga0070683_100179321 | 3300005329 | Bacteria | 2011 |
| 114 | Ga0070670_100000372 | 3300005331 | Bacteria | 37330 |
| 115 | Ga0070670_100000760 | 3300005331 | Bacteria | 25035 |
| 116 | Ga0070670_100082747 | 3300005331 | Bacteria | 2758 |
| 117 | Ga0070670_100114378 | 3300005331 | Bacteria | 2326 |
| 118 | Ga0070680_100011764 | 3300005336 | Bacteria | 6786 |
| 119 | Ga0070680_100209735 | 3300005336 | Bacteria | 1643 |
| 120 | Ga0070682_100128666 | 3300005337 | Bacteria | 1711 |
| 121 | Ga0068868_100077236 | 3300005338 | Bacteria | 2664 |
| 122 | Ga0070660_100071105 | 3300005339 | Bacteria | 2716 |
| 123 | Ga0070660_100497834 | 3300005339 | Bacteria | 1014 |
| 124 | Ga0070689_100054745 | 3300005340 | Bacteria | 3089 |
| 125 | Ga0070661_100000140 | 3300005344 | Bacteria | 60039 |
| 126 | Ga0070661_100106571 | 3300005344 | Bacteria | 2090 |
| 127 | Ga0070661_100229694 | 3300005344 | Bacteria | 1426 |
| 128 | Ga0070661_100245311 | 3300005344 | Bacteria | 1381 |
| 129 | Ga0070669_100001983 | 3300005353 | Bacteria | 14798 |
| 130 | Ga0070669_100036727 | 3300005353 | Bacteria | 3551 |
| 131 | Ga0070675_100042193 | 3300005354 | Bacteria | 3727 |
| 132 | Ga0070675_100068234 | 3300005354 | Bacteria | 2944 |
| 133 | Ga0070671_100044769 | 3300005355 | Bacteria | 3678 |
| 134 | Ga0070671_100048581 | 3300005355 | Bacteria | 3529 |
| 135 | Ga0070671_100111737 | 3300005355 | Bacteria | 2295 |
| 136 | Ga0070674_100007372 | 3300005356 | Bacteria | 6487 |
| 137 | Ga0070674_100026172 | 3300005356 | Bacteria | 3807 |
| 138 | Ga0070674_100027773 | 3300005356 | Bacteria | 3711 |
| 139 | Ga0070674_100067175 | 3300005356 | Bacteria | 2521 |
| 140 | Ga0070674_100142579 | 3300005356 | Bacteria | 1800 |
| 141 | Ga0070673_100139498 | 3300005364 | Bacteria | 2043 |
| 142 | Ga0070673_100223048 | 3300005364 | Bacteria | 1632 |
| 143 | Ga0070688_100060348 | 3300005365 | Bacteria | 2395 |
| 144 | Ga0070667_100000219 | 3300005367 | Bacteria | 66264 |
| 145 | Ga0070667_100078809 | 3300005367 | Bacteria | 2815 |
| 146 | Ga0070667_100292277 | 3300005367 | Bacteria | 1466 |
| 147 | Ga0070667_100311231 | 3300005367 | Bacteria | 1419 |
| 148 | Ga0070709_10000380 | 3300005434 | Bacteria | 27434 |
| 149 | Ga0070709_10042930 | 3300005434 | Bacteria | 2794 |
| 150 | Ga0070714_100072863 | 3300005435 | Bacteria | 2975 |
| 151 | Ga0070714_100187876 | 3300005435 | Bacteria | 1884 |
| 152 | Ga0070713_100025776 | 3300005436 | Bacteria | 4603 |
| 153 | Ga0070713_100031324 | 3300005436 | Bacteria | 4235 |
| 154 | Ga0070713_100107242 | 3300005436 | Bacteria | 2430 |
| 155 | Ga0070713_100262520 | 3300005436 | Bacteria | 1579 |
| 156 | Ga0070710_10001211 | 3300005437 | Bacteria | 12205 |
| 157 | Ga0070711_100023898 | 3300005439 | Bacteria | 3981 |
| 158 | Ga0070700_100031574 | 3300005441 | Bacteria | 3175 |
| 159 | Ga0070663_100119438 | 3300005455 | Bacteria | 1989 |
| 160 | Ga0070663_100199811 | 3300005455 | Bacteria | 1560 |
| 161 | Ga0070678_100055642 | 3300005456 | Bacteria | 2889 |
| 162 | Ga0070678_100194209 | 3300005456 | Bacteria | 1671 |
| 163 | Ga0070662_100003380 | 3300005457 | Bacteria | 9944 |
| 164 | Ga0070681_10002996 | 3300005458 | Bacteria | 15672 |
| 165 | Ga0070681_10047095 | 3300005458 | Bacteria | 4309 |
| 166 | Ga0070681_10110577 | 3300005458 | Bacteria | 2687 |
| 167 | Ga0070681_10139649 | 3300005458 | Bacteria | 2353 |
| 168 | Ga0070681_10334927 | 3300005458 | Bacteria | 1423 |
| 169 | Ga0068867_100006086 | 3300005459 | Bacteria | 8545 |
| 170 | Ga0068867_100061387 | 3300005459 | Bacteria | 2791 |
| 171 | Ga0068867_100323987 | 3300005459 | Bacteria | 1277 |
| 172 | Ga0070706_100060692 | 3300005467 | Bacteria | 3490 |
| 173 | Ga0070707_100037612 | 3300005468 | Bacteria | 4620 |
| 174 | Ga0070679_100006191 | 3300005530 | Bacteria | 11141 |
| 175 | Ga0070679_100009801 | 3300005530 | Bacteria | 9063 |
| 176 | Ga0070679_100065635 | 3300005530 | Bacteria | 3617 |
| 177 | Ga0070679_100222470 | 3300005530 | Bacteria | 1848 |
| 178 | Ga0070684_100083145 | 3300005535 | Bacteria | 2836 |
| 179 | Ga0070684_100142382 | 3300005535 | Bacteria | 2169 |
| 180 | Ga0070684_100174262 | 3300005535 | Bacteria | 1954 |
| 181 | Ga0070684_100515146 | 3300005535 | Bacteria | 1108 |
| 182 | Ga0070697_100009974 | 3300005536 | Bacteria | 7412 |
| 183 | Ga0070697_100340685 | 3300005536 | Bacteria | 1294 |
| 184 | Ga0068853_100101373 | 3300005539 | Bacteria | 2546 |
| 185 | Ga0068853_100143634 | 3300005539 | Bacteria | 2143 |
| 186 | Ga0070672_100006495 | 3300005543 | Bacteria | 7859 |
| 187 | Ga0070672_100058504 | 3300005543 | Bacteria | 3030 |
| 188 | Ga0070672_100173029 | 3300005543 | Bacteria | 1796 |
| 189 | Ga0070686_100118488 | 3300005544 | Bacteria | 1814 |
| 190 | Ga0070696_100162798 | 3300005546 | Bacteria | 1645 |
| 191 | Ga0070693_100123400 | 3300005547 | Bacteria | 1609 |
| 192 | Ga0070693_100182553 | 3300005547 | Bacteria | 1352 |
| 193 | Ga0070693_100219439 | 3300005547 | Bacteria | 1245 |
| 194 | Ga0070665_100029739 | 3300005548 | Bacteria | 5497 |
| 195 | Ga0070665_100062998 | 3300005548 | Bacteria | 3718 |
| 196 | Ga0070665_100166107 | 3300005548 | Bacteria | 2209 |
| 197 | Ga0070665_100429001 | 3300005548 | Bacteria | 1331 |
| 198 | Ga0070665_100501116 | 3300005548 | Bacteria | 1225 |
| 199 | Ga0068855_100030522 | 3300005563 | Bacteria | 6446 |
| 200 | Ga0068855_100054492 | 3300005563 | Bacteria | 4700 |
| 201 | Ga0068855_100159363 | 3300005563 | Bacteria | 2562 |
| 202 | Ga0068855_100287265 | 3300005563 | Bacteria | 1824 |
| 203 | Ga0068855_100356384 | 3300005563 | Bacteria | 1610 |
| 204 | Ga0068855_100609552 | 3300005563 | Bacteria | 1176 |
| 205 | Ga0070664_100000201 | 3300005564 | Bacteria | 42562 |
| 206 | Ga0070664_100042664 | 3300005564 | Bacteria | 3828 |
| 207 | Ga0070664_100688573 | 3300005564 | Bacteria | 952 |
| 208 | Ga0068857_100012293 | 3300005577 | Bacteria | 7448 |
| 209 | Ga0068857_100206295 | 3300005577 | Bacteria | 1793 |
| 210 | Ga0068857_100226182 | 3300005577 | Bacteria | 1710 |
| 211 | Ga0068857_100312291 | 3300005577 | Bacteria | 1450 |
| 212 | Ga0068857_100458514 | 3300005577 | Bacteria | 1192 |
| 213 | Ga0068857_100570279 | 3300005577 | Bacteria | 1068 |
| 214 | Ga0068854_100031155 | 3300005578 | Bacteria | 3704 |
| 215 | Ga0068856_100000217 | 3300005614 | Bacteria | 61831 |
| 216 | Ga0068856_100059874 | 3300005614 | Bacteria | 3762 |
| 217 | Ga0068856_100107856 | 3300005614 | Bacteria | 2781 |
| 218 | Ga0068856_100143863 | 3300005614 | Bacteria | 2392 |
| 219 | Ga0068856_100180902 | 3300005614 | Bacteria | 2121 |
| 220 | Ga0068852_100001671 | 3300005616 | Bacteria | 15117 |
| 221 | Ga0068852_100091688 | 3300005616 | Bacteria | 2720 |
| 222 | Ga0068852_100136573 | 3300005616 | Bacteria | 2264 |
| 223 | Ga0068852_100153236 | 3300005616 | Bacteria | 2145 |
| 224 | Ga0068864_100115854 | 3300005618 | Bacteria | 2391 |
| 225 | Ga0068858_100180417 | 3300005842 | Bacteria | 1994 |
| 226 | Ga0068858_100346459 | 3300005842 | Bacteria | 1422 |
| 227 | Ga0068860_100000280 | 3300005843 | Bacteria | 72849 |
| 228 | Ga0068862_100033882 | 3300005844 | Bacteria | 4320 |
| 229 | Ga0068862_100599364 | 3300005844 | Bacteria | 1057 |
| 230 | Ga0081455_10000751 | 3300005937 | Bacteria | 42140 |
| 231 | Ga0081455_10007868 | 3300005937 | Bacteria | 11160 |
| 232 | Ga0081455_10013127 | 3300005937 | Bacteria | 8211 |
| 233 | Ga0081455_10015126 | 3300005937 | Bacteria | 7510 |
| 234 | Ga0081455_10057044 | 3300005937 | Bacteria | 3312 |
| 235 | Ga0081538_10045792 | 3300005981 | Bacteria | 2707 |
| 236 | Ga0081540_1002153 | 3300005983 | Bacteria | 16368 |
| 237 | Ga0081540_1002523 | 3300005983 | Bacteria | 14863 |
| 238 | Ga0081540_1005561 | 3300005983 | Bacteria | 9385 |
| 239 | Ga0081540_1008122 | 3300005983 | Bacteria | 7368 |
| 240 | Ga0081540_1008798 | 3300005983 | Bacteria | 7015 |
| 241 | Ga0081540_1013750 | 3300005983 | Bacteria | 5244 |
| 242 | Ga0081540_1028343 | 3300005983 | Bacteria | 3147 |
| 243 | Ga0081540_1089062 | 3300005983 | Bacteria | 1363 |
| 244 | Ga0081540_1111796 | 3300005983 | Bacteria | 1153 |
| 245 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 246 | Ga0081539_10001660 | 3300005985 | Bacteria | 36067 |
| 247 | Ga0081539_10007918 | 3300005985 | Bacteria | 9466 |
| 248 | Ga0081539_10018502 | 3300005985 | Bacteria | 4830 |
| 249 | Ga0081539_10062720 | 3300005985 | Bacteria | 2030 |
| 250 | Ga0070717_10001256 | 3300006028 | Bacteria | 17303 |
| 251 | Ga0070717_10008632 | 3300006028 | Bacteria | 7619 |
| 252 | Ga0075365_10020604 | 3300006038 | Bacteria | 4092 |
| 253 | Ga0075365_10162934 | 3300006038 | Bacteria | 1554 |
| 254 | Ga0075365_10224057 | 3300006038 | Bacteria | 1319 |
| 255 | Ga0075365_10339516 | 3300006038 | Bacteria | 1058 |
| 256 | Ga0075368_10020284 | 3300006042 | Bacteria | 2516 |
| 257 | Ga0075368_10034251 | 3300006042 | Bacteria | 1978 |
| 258 | Ga0075364_10034399 | 3300006051 | Bacteria | 3269 |
| 259 | Ga0075364_10043500 | 3300006051 | Bacteria | 2920 |
| 260 | Ga0075364_10046426 | 3300006051 | Bacteria | 2828 |
| 261 | Ga0075364_10102857 | 3300006051 | Bacteria | 1902 |
| 262 | Ga0075364_10121122 | 3300006051 | Bacteria | 1751 |
| 263 | Ga0075432_10030334 | 3300006058 | Bacteria | 1868 |
| 264 | Ga0075432_10035898 | 3300006058 | Bacteria | 1722 |
| 265 | Ga0070715_10088518 | 3300006163 | Bacteria | 1419 |
| 266 | Ga0070716_100048945 | 3300006173 | Bacteria | 2392 |
| 267 | Ga0070716_100119113 | 3300006173 | Bacteria | 1650 |
| 268 | Ga0070712_100005932 | 3300006175 | Bacteria | 7558 |
| 269 | Ga0070712_100008776 | 3300006175 | Bacteria | 6363 |
| 270 | Ga0075362_10021558 | 3300006177 | Bacteria | 2706 |
| 271 | Ga0075362_10038254 | 3300006177 | Bacteria | 2107 |
| 272 | Ga0075362_10062461 | 3300006177 | Bacteria | 1687 |
| 273 | Ga0075362_10063030 | 3300006177 | Bacteria | 1681 |
| 274 | Ga0075362_10114043 | 3300006177 | Bacteria | 1275 |
| 275 | Ga0075362_10148813 | 3300006177 | Bacteria | 1122 |
| 276 | Ga0075367_10144208 | 3300006178 | Bacteria | 1476 |
| 277 | Ga0075367_10177198 | 3300006178 | Bacteria | 1329 |
| 278 | Ga0075367_10215987 | 3300006178 | Bacteria | 1200 |
| 279 | Ga0075369_10000180 | 3300006186 | Bacteria | 18073 |
| 280 | Ga0075369_10004583 | 3300006186 | Bacteria | 5124 |
| 281 | Ga0075369_10038880 | 3300006186 | Bacteria | 2031 |
| 282 | Ga0075369_10072627 | 3300006186 | Bacteria | 1516 |
| 283 | Ga0075369_10108966 | 3300006186 | Bacteria | 1247 |
| 284 | Ga0075366_10010769 | 3300006195 | Bacteria | 5141 |
| 285 | Ga0075366_10052148 | 3300006195 | Bacteria | 2431 |
| 286 | Ga0075366_10147616 | 3300006195 | Bacteria | 1423 |
| 287 | Ga0075366_10198852 | 3300006195 | Bacteria | 1218 |
| 288 | Ga0075366_10229611 | 3300006195 | Bacteria | 1131 |
| 289 | Ga0097621_100209497 | 3300006237 | Bacteria | 1695 |
| 290 | Ga0075370_10024822 | 3300006353 | Bacteria | 3314 |
| 291 | Ga0075370_10034259 | 3300006353 | Bacteria | 2847 |
| 292 | Ga0075370_10036798 | 3300006353 | Bacteria | 2750 |
| 293 | Ga0075370_10039025 | 3300006353 | Bacteria | 2674 |
| 294 | Ga0075370_10177243 | 3300006353 | Bacteria | 1254 |
| 295 | Ga0075370_10228650 | 3300006353 | Bacteria | 1100 |
| 296 | Ga0075428_100321704 | 3300006844 | Bacteria | 1662 |
| 297 | Ga0075433_10253205 | 3300006852 | Bacteria | 1562 |
| 298 | Ga0075434_100063130 | 3300006871 | Bacteria | 3687 |
| 299 | Ga0075436_100100690 | 3300006914 | Bacteria | 2012 |
| 300 | Ga0099824_1002075 | 3300006942 | Bacteria | 29088 |
| 301 | Ga0099822_1008450 | 3300006943 | Bacteria | 13161 |
| 302 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 303 | Ga0079104_1000208 | 3300006946 | Bacteria | 82037 |
| 304 | Ga0079104_1000239 | 3300006946 | Bacteria | 73048 |
| 305 | Ga0079104_1000325 | 3300006946 | Bacteria | 58566 |
| 306 | Ga0099826_10000135 | 3300006948 | Bacteria | 31697 |
| 307 | Ga0099826_10044464 | 3300006948 | Bacteria | 3047 |
| 308 | Ga0099826_10072630 | 3300006948 | Bacteria | 2177 |
| 309 | Ga0075435_100016626 | 3300007076 | Bacteria | 5548 |
| 310 | Ga0075435_100108433 | 3300007076 | Bacteria | 2307 |
| 311 | Ga0099794_10019124 | 3300007265 | Bacteria | 3081 |
| 312 | Ga0099794_10027843 | 3300007265 | Bacteria | 2623 |
| 313 | Ga0099794_10042728 | 3300007265 | Bacteria | 2162 |
| 314 | Ga0105251_10001079 | 3300009011 | Bacteria | 23858 |
| 315 | Ga0105251_10006867 | 3300009011 | Bacteria | 7154 |
| 316 | Ga0105251_10013774 | 3300009011 | Bacteria | 4505 |
| 317 | Ga0105251_10043277 | 3300009011 | Bacteria | 2182 |
| 318 | Ga0105251_10065110 | 3300009011 | Bacteria | 1706 |
| 319 | Ga0105244_10000823 | 3300009036 | Bacteria | 26208 |
| 320 | Ga0105244_10019773 | 3300009036 | Bacteria | 3750 |
| 321 | Ga0105244_10026694 | 3300009036 | Bacteria | 3122 |
| 322 | Ga0105244_10053196 | 3300009036 | Bacteria | 2059 |
| 323 | Ga0105250_10000154 | 3300009092 | Bacteria | 59676 |
| 324 | Ga0105250_10000523 | 3300009092 | Bacteria | 26747 |
| 325 | Ga0105250_10001345 | 3300009092 | Bacteria | 13406 |
| 326 | Ga0105250_10060706 | 3300009092 | Bacteria | 1519 |
| 327 | Ga0105240_10003939 | 3300009093 | Bacteria | 22940 |
| 328 | Ga0105240_10009735 | 3300009093 | Bacteria | 13572 |
| 329 | Ga0105240_10208115 | 3300009093 | Bacteria | 2288 |
| 330 | Ga0105240_10405279 | 3300009093 | Bacteria | 1535 |
| 331 | Ga0111539_10413804 | 3300009094 | Bacteria | 1570 |
| 332 | Ga0105247_10045403 | 3300009101 | Bacteria | 2695 |
| 333 | Ga0105247_10083369 | 3300009101 | Bacteria | 2019 |
| 334 | Ga0105247_10093409 | 3300009101 | Bacteria | 1912 |
| 335 | Ga0114129_10030308 | 3300009147 | Bacteria | 7657 |
| 336 | Ga0114129_10595650 | 3300009147 | Bacteria | 1433 |
| 337 | Ga0105243_10000587 | 3300009148 | Bacteria | 36543 |
| 338 | Ga0105243_10003470 | 3300009148 | Bacteria | 12726 |
| 339 | Ga0105243_10178838 | 3300009148 | Bacteria | 1843 |
| 340 | Ga0105243_10181233 | 3300009148 | Bacteria | 1832 |
| 341 | Ga0105243_10437963 | 3300009148 | Bacteria | 1223 |
| 342 | Ga0105241_10041364 | 3300009174 | Bacteria | 3482 |
| 343 | Ga0105241_10100281 | 3300009174 | Bacteria | 2301 |
| 344 | Ga0105241_10200563 | 3300009174 | Bacteria | 1666 |
| 345 | Ga0105242_10003491 | 3300009176 | Bacteria | 12216 |
| 346 | Ga0105242_10008807 | 3300009176 | Bacteria | 7743 |
| 347 | Ga0105242_10314456 | 3300009176 | Bacteria | 1434 |
| 348 | Ga0105242_10551563 | 3300009176 | Bacteria | 1105 |
| 349 | Ga0105248_10309392 | 3300009177 | Bacteria | 1779 |
| 350 | Ga0105237_10000413 | 3300009545 | Bacteria | 60829 |
| 351 | Ga0105237_10000711 | 3300009545 | Bacteria | 46033 |
| 352 | Ga0105237_10005231 | 3300009545 | Bacteria | 14681 |
| 353 | Ga0105237_10116995 | 3300009545 | Bacteria | 2659 |
| 354 | Ga0105237_10140221 | 3300009545 | Bacteria | 2412 |
| 355 | Ga0105237_10175131 | 3300009545 | Bacteria | 2146 |
| 356 | Ga0105237_10221020 | 3300009545 | Bacteria | 1894 |
| 357 | Ga0105237_10240156 | 3300009545 | Bacteria | 1813 |
| 358 | Ga0105238_10013593 | 3300009551 | Bacteria | 8221 |
| 359 | Ga0105238_10015307 | 3300009551 | Bacteria | 7769 |
| 360 | Ga0105238_10207894 | 3300009551 | Bacteria | 1933 |
| 361 | Ga0105238_10248302 | 3300009551 | Bacteria | 1757 |
| 362 | Ga0105238_10342465 | 3300009551 | Bacteria | 1483 |
| 363 | Ga0105238_10411438 | 3300009551 | Bacteria | 1346 |
| 364 | Ga0105238_10459237 | 3300009551 | Bacteria | 1271 |
| 365 | Ga0099796_10071740 | 3300010159 | Bacteria | 1252 |
| 366 | Ga0105239_10002359 | 3300010375 | Bacteria | 24075 |
| 367 | Ga0105239_10047224 | 3300010375 | Bacteria | 4719 |
| 368 | Ga0105239_10086633 | 3300010375 | Bacteria | 3452 |
| 369 | Ga0105239_10093907 | 3300010375 | Bacteria | 3313 |
| 370 | Ga0105239_10221947 | 3300010375 | Bacteria | 2119 |
| 371 | Ga0105239_10473805 | 3300010375 | Bacteria | 1422 |
| 372 | Ga0105246_10000239 | 3300011119 | Bacteria | 28228 |
| 373 | Ga0105246_10057480 | 3300011119 | Bacteria | 2691 |
| 374 | Ga0105246_10059504 | 3300011119 | Bacteria | 2650 |
| 375 | Ga0105246_10171290 | 3300011119 | Bacteria | 1663 |
| 376 | Ga0105246_10195093 | 3300011119 | Bacteria | 1570 |
| 377 | Ga0157345_1000190 | 3300012498 | Bacteria | 9610 |
| 378 | Ga0157326_1004788 | 3300012513 | Bacteria | 1425 |
| 379 | Ga0157373_10000780 | 3300013100 | Bacteria | 24491 |
| 380 | Ga0157373_10008065 | 3300013100 | Bacteria | 7827 |
| 381 | Ga0157373_10072584 | 3300013100 | Bacteria | 2429 |
| 382 | Ga0157371_10000189 | 3300013102 | Bacteria | 91155 |
| 383 | Ga0157371_10003317 | 3300013102 | Bacteria | 14714 |
| 384 | Ga0157371_10007676 | 3300013102 | Bacteria | 8684 |
| 385 | Ga0157371_10043122 | 3300013102 | Bacteria | 3214 |
| 386 | Ga0157370_10088442 | 3300013104 | Bacteria | 2909 |
| 387 | Ga0157370_10091634 | 3300013104 | Bacteria | 2853 |
| 388 | Ga0157370_10184755 | 3300013104 | Bacteria | 1936 |
| 389 | Ga0157370_10324402 | 3300013104 | Bacteria | 1420 |
| 390 | Ga0157370_10485708 | 3300013104 | Bacteria | 1135 |
| 391 | Ga0157370_10508829 | 3300013104 | Bacteria | 1106 |
| 392 | Ga0157369_10004800 | 3300013105 | Bacteria | 15885 |
| 393 | Ga0157369_10007499 | 3300013105 | Bacteria | 12554 |
| 394 | Ga0157369_10027452 | 3300013105 | Bacteria | 6311 |
| 395 | Ga0157369_10037352 | 3300013105 | Bacteria | 5317 |
| 396 | Ga0157369_10043154 | 3300013105 | Bacteria | 4916 |
| 397 | Ga0157369_10068644 | 3300013105 | Bacteria | 3809 |
| 398 | Ga0157369_10075613 | 3300013105 | Bacteria | 3610 |
| 399 | Ga0157369_10093152 | 3300013105 | Bacteria | 3216 |
| 400 | Ga0157369_10186668 | 3300013105 | Bacteria | 2180 |
| 401 | Ga0171462_1016 | 3300013250 | Bacteria | 164601 |
| 402 | Ga0157374_10079053 | 3300013296 | Bacteria | 3116 |
| 403 | Ga0163162_10009532 | 3300013306 | Bacteria | 9444 |
| 404 | Ga0157372_10030764 | 3300013307 | Bacteria | 5874 |
| 405 | Ga0157372_10220737 | 3300013307 | Bacteria | 2197 |
| 406 | Ga0157372_10283284 | 3300013307 | Bacteria | 1927 |
| 407 | Ga0157375_10119307 | 3300013308 | Bacteria | 2745 |
| 408 | Ga0157375_10123645 | 3300013308 | Bacteria | 2700 |
| 409 | Ga0157375_10412970 | 3300013308 | Bacteria | 1516 |
| 410 | Ga0157375_10458113 | 3300013308 | Bacteria | 1441 |
| 411 | Ga0163163_10129728 | 3300014325 | Bacteria | 2561 |
| 412 | Ga0163163_10388765 | 3300014325 | Bacteria | 1453 |
| 413 | Ga0163163_10519134 | 3300014325 | Bacteria | 1253 |
| 414 | Ga0182008_10018498 | 3300014497 | Bacteria | 3607 |
| 415 | Ga0182008_10026815 | 3300014497 | Bacteria | 2921 |
| 416 | Ga0182008_10040959 | 3300014497 | Bacteria | 2311 |
| 417 | Ga0157376_10163548 | 3300014969 | Bacteria | 2020 |
| 418 | Ga0157376_10483021 | 3300014969 | Bacteria | 1214 |
| 419 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 420 | Ga0182006_1001489 | 3300015261 | Bacteria | 14067 |
| 421 | Ga0182006_1078660 | 3300015261 | Bacteria | 1207 |
| 422 | Ga0182007_10000085 | 3300015262 | Bacteria | 70105 |
| 423 | Ga0182007_10049056 | 3300015262 | Bacteria | 1395 |
| 424 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 425 | Ga0182005_1002866 | 3300015265 | Bacteria | 6003 |
| 426 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 427 | Ga0163161_10015229 | 3300017792 | Bacteria | 5358 |
| 428 | Ga0163161_10048777 | 3300017792 | Bacteria | 3058 |
| 429 | Ga0163161_10288296 | 3300017792 | Bacteria | 1290 |
| 430 | Ga0214544_1000136 | 3300021320 | Bacteria | 107814 |
| 431 | Ga0214542_1000127 | 3300021321 | Bacteria | 107829 |
| 432 | Ga0214545_1000063 | 3300021324 | Bacteria | 107829 |
| 433 | Ga0214543_1018162 | 3300021327 | Bacteria | 6572 |
| 434 | Ga0213872_10022991 | 3300021361 | Bacteria | 2869 |
| 435 | Ga0213875_10044085 | 3300021388 | Bacteria | 2095 |
| 436 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 437 | Ga0209435_100397 | 3300025206 | Bacteria | 9379 |
| 438 | Ga0209436_108835 | 3300025208 | Bacteria | 1968 |
| 439 | Ga0209784_100241 | 3300025224 | Bacteria | 35519 |
| 440 | Ga0209566_100390 | 3300025225 | Bacteria | 35519 |
| 441 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 442 | Ga0209674_100293 | 3300025226 | Bacteria | 35519 |
| 443 | Ga0209147_100332 | 3300025229 | Bacteria | 35519 |
| 444 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 445 | Ga0209563_100188 | 3300025230 | Bacteria | 35519 |
| 446 | Ga0209563_100826 | 3300025230 | Bacteria | 9245 |
| 447 | Ga0207427_100729 | 3300025231 | Bacteria | 15297 |
| 448 | Ga0209258_100508 | 3300025242 | Bacteria | 37664 |
| 449 | Ga0209258_100773 | 3300025242 | Bacteria | 19494 |
| 450 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 451 | Ga0207425_1000789 | 3300025245 | Bacteria | 16158 |
| 452 | Ga0207425_1005788 | 3300025245 | Bacteria | 3478 |
| 453 | Ga0207425_1007872 | 3300025245 | Bacteria | 2775 |
| 454 | Ga0207425_1008495 | 3300025245 | Bacteria | 2622 |
| 455 | Ga0207425_1032518 | 3300025245 | Bacteria | 1032 |
| 456 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 457 | Ga0209026_1000121 | 3300025250 | Bacteria | 126801 |
| 458 | Ga0209677_100266 | 3300025253 | Bacteria | 35519 |
| 459 | Ga0209677_101929 | 3300025253 | Bacteria | 8294 |
| 460 | Ga0209677_102242 | 3300025253 | Bacteria | 7490 |
| 461 | Ga0209677_102733 | 3300025253 | Bacteria | 6327 |
| 462 | Ga0209148_1000879 | 3300025254 | Bacteria | 20675 |
| 463 | Ga0209148_1002254 | 3300025254 | Bacteria | 6983 |
| 464 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 465 | Ga0209759_1001305 | 3300025256 | Bacteria | 14725 |
| 466 | Ga0209759_1030804 | 3300025256 | Bacteria | 1054 |
| 467 | Ga0209129_1000146 | 3300025258 | Bacteria | 115180 |
| 468 | Ga0209129_1000212 | 3300025258 | Bacteria | 67061 |
| 469 | Ga0209129_1007872 | 3300025258 | Bacteria | 3072 |
| 470 | Ga0209233_1000753 | 3300025261 | Bacteria | 14662 |
| 471 | Ga0209233_1001523 | 3300025261 | Bacteria | 9085 |
| 472 | Ga0209233_1002406 | 3300025261 | Bacteria | 6910 |
| 473 | Ga0209565_1000026 | 3300025263 | Bacteria | 365910 |
| 474 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 475 | Ga0209565_1001447 | 3300025263 | Bacteria | 10465 |
| 476 | Ga0209565_1009765 | 3300025263 | Bacteria | 2412 |
| 477 | Ga0209455_1002084 | 3300025272 | Bacteria | 8009 |
| 478 | Ga0209455_1005287 | 3300025272 | Bacteria | 4025 |
| 479 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 480 | Ga0209673_1000534 | 3300025273 | Bacteria | 62274 |
| 481 | Ga0209673_1025459 | 3300025273 | Bacteria | 1966 |
| 482 | Ga0209673_1028549 | 3300025273 | Bacteria | 1793 |
| 483 | Ga0209673_1037216 | 3300025273 | Bacteria | 1433 |
| 484 | Ga0209130_1000109 | 3300025284 | Bacteria | 133520 |
| 485 | Ga0209130_1000208 | 3300025284 | Bacteria | 78707 |
| 486 | Ga0209130_1002387 | 3300025284 | Bacteria | 9506 |
| 487 | Ga0209130_1004260 | 3300025284 | Bacteria | 5542 |
| 488 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 489 | Ga0209675_1000246 | 3300025291 | Bacteria | 53700 |
| 490 | Ga0209675_1004057 | 3300025291 | Bacteria | 6669 |
| 491 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 492 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 493 | Ga0209676_1000017 | 3300025292 | Bacteria | 643409 |
| 494 | Ga0209676_1000065 | 3300025292 | Bacteria | 318605 |
| 495 | Ga0209676_1000441 | 3300025292 | Bacteria | 70795 |
| 496 | Ga0209676_1001087 | 3300025292 | Bacteria | 30566 |
| 497 | Ga0209676_1006060 | 3300025292 | Bacteria | 6087 |
| 498 | Ga0209676_1006968 | 3300025292 | Bacteria | 5440 |
| 499 | Ga0209676_1009189 | 3300025292 | Bacteria | 4299 |
| 500 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 501 | Ga0209025_1000245 | 3300025294 | Bacteria | 127801 |
| 502 | Ga0209025_1000925 | 3300025294 | Bacteria | 44920 |
| 503 | Ga0209025_1001886 | 3300025294 | Bacteria | 24515 |
| 504 | Ga0209025_1002291 | 3300025294 | Bacteria | 20787 |
| 505 | Ga0209025_1007137 | 3300025294 | Bacteria | 8441 |
| 506 | Ga0209025_1009400 | 3300025294 | Bacteria | 6817 |
| 507 | Ga0209025_1010298 | 3300025294 | Bacteria | 6352 |
| 508 | Ga0209025_1082996 | 3300025294 | Bacteria | 1080 |
| 509 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 510 | Ga0209564_1000243 | 3300025295 | Bacteria | 118066 |
| 511 | Ga0209564_1000366 | 3300025295 | Bacteria | 83994 |
| 512 | Ga0209564_1000602 | 3300025295 | Bacteria | 56176 |
| 513 | Ga0209564_1003071 | 3300025295 | Bacteria | 11841 |
| 514 | Ga0209564_1003205 | 3300025295 | Bacteria | 11491 |
| 515 | Ga0209564_1009126 | 3300025295 | Bacteria | 4772 |
| 516 | Ga0209564_1010517 | 3300025295 | Bacteria | 4250 |
| 517 | Ga0209564_1011345 | 3300025295 | Bacteria | 4004 |
| 518 | Ga0209564_1027094 | 3300025295 | Bacteria | 1871 |
| 519 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 520 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 521 | Ga0209758_1000083 | 3300025297 | Bacteria | 257283 |
| 522 | Ga0209758_1000213 | 3300025297 | Bacteria | 126745 |
| 523 | Ga0209758_1000455 | 3300025297 | Bacteria | 68279 |
| 524 | Ga0209758_1000558 | 3300025297 | Bacteria | 58712 |
| 525 | Ga0209758_1000792 | 3300025297 | Bacteria | 45045 |
| 526 | Ga0209758_1001083 | 3300025297 | Bacteria | 35356 |
| 527 | Ga0209758_1011163 | 3300025297 | Bacteria | 5244 |
| 528 | Ga0209758_1012836 | 3300025297 | Bacteria | 4640 |
| 529 | Ga0209758_1013115 | 3300025297 | Bacteria | 4554 |
| 530 | Ga0209758_1027818 | 3300025297 | Bacteria | 2407 |
| 531 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 532 | Ga0209050_1000079 | 3300025298 | Bacteria | 277803 |
| 533 | Ga0209050_1000242 | 3300025298 | Bacteria | 118006 |
| 534 | Ga0209050_1000371 | 3300025298 | Bacteria | 85791 |
| 535 | Ga0209050_1001174 | 3300025298 | Bacteria | 30903 |
| 536 | Ga0209050_1002504 | 3300025298 | Bacteria | 15481 |
| 537 | Ga0209050_1005060 | 3300025298 | Bacteria | 8522 |
| 538 | Ga0209050_1006629 | 3300025298 | Bacteria | 6785 |
| 539 | Ga0209050_1009571 | 3300025298 | Bacteria | 4936 |
| 540 | Ga0209050_1018568 | 3300025298 | Bacteria | 2694 |
| 541 | Ga0209050_1023748 | 3300025298 | Bacteria | 2145 |
| 542 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 543 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 544 | Ga0209256_1000934 | 3300025299 | Bacteria | 35520 |
| 545 | Ga0209256_1002958 | 3300025299 | Bacteria | 12732 |
| 546 | Ga0209256_1018955 | 3300025299 | Bacteria | 2212 |
| 547 | Ga0207426_1001071 | 3300025302 | Bacteria | 25720 |
| 548 | Ga0207426_1007923 | 3300025302 | Bacteria | 4378 |
| 549 | Ga0207426_1015005 | 3300025302 | Bacteria | 2826 |
| 550 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 551 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 552 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 553 | Ga0209051_1000054 | 3300025303 | Bacteria | 280804 |
| 554 | Ga0209051_1000234 | 3300025303 | Bacteria | 92914 |
| 555 | Ga0209051_1000244 | 3300025303 | Bacteria | 91505 |
| 556 | Ga0209051_1006304 | 3300025303 | Bacteria | 6718 |
| 557 | Ga0209051_1008812 | 3300025303 | Bacteria | 5288 |
| 558 | Ga0209051_1011409 | 3300025303 | Bacteria | 4389 |
| 559 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 560 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 561 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 562 | Ga0209257_1000144 | 3300025304 | Bacteria | 197078 |
| 563 | Ga0209257_1000167 | 3300025304 | Bacteria | 171342 |
| 564 | Ga0209257_1000239 | 3300025304 | Bacteria | 128383 |
| 565 | Ga0209257_1000365 | 3300025304 | Bacteria | 91586 |
| 566 | Ga0209257_1003906 | 3300025304 | Bacteria | 12134 |
| 567 | Ga0209257_1008157 | 3300025304 | Bacteria | 6068 |
| 568 | Ga0209257_1023089 | 3300025304 | Bacteria | 2198 |
| 569 | Ga0209257_1046541 | 3300025304 | Bacteria | 1252 |
| 570 | Ga0207696_1000045 | 3300025711 | Bacteria | 296484 |
| 571 | Ga0207696_1000090 | 3300025711 | Bacteria | 188474 |
| 572 | Ga0207696_1000147 | 3300025711 | Bacteria | 120603 |
| 573 | Ga0207696_1000388 | 3300025711 | Bacteria | 42044 |
| 574 | Ga0207696_1006368 | 3300025711 | Bacteria | 4764 |
| 575 | Ga0207696_1012353 | 3300025711 | Bacteria | 3023 |
| 576 | Ga0207655_1000140 | 3300025728 | Bacteria | 139110 |
| 577 | Ga0207655_1000333 | 3300025728 | Bacteria | 68997 |
| 578 | Ga0207655_1004959 | 3300025728 | Bacteria | 9224 |
| 579 | Ga0207655_1010972 | 3300025728 | Bacteria | 5442 |
| 580 | Ga0207655_1015837 | 3300025728 | Bacteria | 4163 |
| 581 | Ga0207655_1017861 | 3300025728 | Bacteria | 3803 |
| 582 | Ga0207655_1026928 | 3300025728 | Bacteria | 2751 |
| 583 | Ga0207713_1001032 | 3300025735 | Bacteria | 24214 |
| 584 | Ga0207713_1001617 | 3300025735 | Bacteria | 17558 |
| 585 | Ga0207713_1002467 | 3300025735 | Bacteria | 13449 |
| 586 | Ga0207713_1002698 | 3300025735 | Bacteria | 12677 |
| 587 | Ga0207713_1004082 | 3300025735 | Bacteria | 9622 |
| 588 | Ga0207713_1004181 | 3300025735 | Bacteria | 9468 |
| 589 | Ga0207713_1024073 | 3300025735 | Bacteria | 2848 |
| 590 | Ga0207713_1045495 | 3300025735 | Bacteria | 1792 |
| 591 | Ga0207682_10006388 | 3300025893 | Bacteria | 4752 |
| 592 | Ga0207642_10018244 | 3300025899 | Bacteria | 2688 |
| 593 | Ga0207688_10010905 | 3300025901 | Bacteria | 4944 |
| 594 | Ga0207688_10016380 | 3300025901 | Bacteria | 4020 |
| 595 | Ga0207688_10077308 | 3300025901 | Bacteria | 1896 |
| 596 | Ga0207647_10021071 | 3300025904 | Bacteria | 4357 |
| 597 | Ga0207647_10103671 | 3300025904 | Bacteria | 1686 |
| 598 | Ga0207647_10193410 | 3300025904 | Bacteria | 1178 |
| 599 | Ga0207699_10037385 | 3300025906 | Bacteria | 2775 |
| 600 | Ga0207699_10094522 | 3300025906 | Bacteria | 1883 |
| 601 | Ga0207699_10245439 | 3300025906 | Bacteria | 1232 |
| 602 | Ga0207645_10023628 | 3300025907 | Bacteria | 3991 |
| 603 | Ga0207643_10043732 | 3300025908 | Bacteria | 2528 |
| 604 | Ga0207705_10037246 | 3300025909 | Bacteria | 3480 |
| 605 | Ga0207705_10125185 | 3300025909 | Bacteria | 1909 |
| 606 | Ga0207684_10015383 | 3300025910 | Bacteria | 6586 |
| 607 | Ga0207684_10230764 | 3300025910 | Bacteria | 1597 |
| 608 | Ga0207654_10110007 | 3300025911 | Bacteria | 1713 |
| 609 | Ga0207707_10000183 | 3300025912 | Bacteria | 65793 |
| 610 | Ga0207707_10005958 | 3300025912 | Bacteria | 10662 |
| 611 | Ga0207707_10010268 | 3300025912 | Bacteria | 8126 |
| 612 | Ga0207707_10272681 | 3300025912 | Bacteria | 1466 |
| 613 | Ga0207695_10000157 | 3300025913 | Bacteria | 204140 |
| 614 | Ga0207695_10012974 | 3300025913 | Bacteria | 9958 |
| 615 | Ga0207695_10024944 | 3300025913 | Bacteria | 6710 |
| 616 | Ga0207695_10175139 | 3300025913 | Bacteria | 2068 |
| 617 | Ga0207695_10455151 | 3300025913 | Bacteria | 1163 |
| 618 | Ga0207671_10003125 | 3300025914 | Bacteria | 16823 |
| 619 | Ga0207671_10007248 | 3300025914 | Bacteria | 9659 |
| 620 | Ga0207671_10024412 | 3300025914 | Bacteria | 4546 |
| 621 | Ga0207671_10025871 | 3300025914 | Bacteria | 4403 |
| 622 | Ga0207671_10083206 | 3300025914 | Bacteria | 2402 |
| 623 | Ga0207671_10099213 | 3300025914 | Bacteria | 2204 |
| 624 | Ga0207671_10101625 | 3300025914 | Bacteria | 2178 |
| 625 | Ga0207671_10135615 | 3300025914 | Bacteria | 1892 |
| 626 | Ga0207671_10341359 | 3300025914 | Bacteria | 1187 |
| 627 | Ga0207693_10007368 | 3300025915 | Bacteria | 9045 |
| 628 | Ga0207693_10018506 | 3300025915 | Bacteria | 5547 |
| 629 | Ga0207693_10044139 | 3300025915 | Bacteria | 3503 |
| 630 | Ga0207693_10199453 | 3300025915 | Bacteria | 1574 |
| 631 | Ga0207693_10230843 | 3300025915 | Bacteria | 1453 |
| 632 | Ga0207663_10041718 | 3300025916 | Bacteria | 2798 |
| 633 | Ga0207663_10096789 | 3300025916 | Bacteria | 1972 |
| 634 | Ga0207657_10001840 | 3300025919 | Bacteria | 22916 |
| 635 | Ga0207657_10146645 | 3300025919 | Bacteria | 1924 |
| 636 | Ga0207649_10000156 | 3300025920 | Bacteria | 55743 |
| 637 | Ga0207649_10028131 | 3300025920 | Bacteria | 3308 |
| 638 | Ga0207649_10064178 | 3300025920 | Bacteria | 2321 |
| 639 | Ga0207652_10023004 | 3300025921 | Bacteria | 5163 |
| 640 | Ga0207652_10131156 | 3300025921 | Bacteria | 2236 |
| 641 | Ga0207652_10261848 | 3300025921 | Bacteria | 1560 |
| 642 | Ga0207646_10205293 | 3300025922 | Bacteria | 1780 |
| 643 | Ga0207681_10003803 | 3300025923 | Bacteria | 9365 |
| 644 | Ga0207681_10029523 | 3300025923 | Bacteria | 3563 |
| 645 | Ga0207681_10509215 | 3300025923 | Bacteria | 986 |
| 646 | Ga0207694_10022641 | 3300025924 | Bacteria | 4767 |
| 647 | Ga0207694_10036365 | 3300025924 | Bacteria | 3779 |
| 648 | Ga0207694_10078687 | 3300025924 | Bacteria | 2585 |
| 649 | Ga0207694_10290708 | 3300025924 | Bacteria | 1344 |
| 650 | Ga0207650_10000266 | 3300025925 | Bacteria | 55293 |
| 651 | Ga0207650_10000955 | 3300025925 | Bacteria | 21744 |
| 652 | Ga0207650_10003617 | 3300025925 | Bacteria | 10596 |
| 653 | Ga0207650_10027888 | 3300025925 | Bacteria | 4044 |
| 654 | Ga0207650_10033574 | 3300025925 | Bacteria | 3717 |
| 655 | Ga0207659_10004256 | 3300025926 | Bacteria | 8651 |
| 656 | Ga0207659_10037749 | 3300025926 | Bacteria | 3356 |
| 657 | Ga0207687_10184232 | 3300025927 | Bacteria | 1620 |
| 658 | Ga0207700_10026499 | 3300025928 | Bacteria | 4042 |
| 659 | Ga0207700_10111812 | 3300025928 | Bacteria | 2199 |
| 660 | Ga0207700_10202496 | 3300025928 | Bacteria | 1674 |
| 661 | Ga0207700_10229719 | 3300025928 | Bacteria | 1577 |
| 662 | Ga0207664_10041985 | 3300025929 | Bacteria | 3567 |
| 663 | Ga0207664_10283126 | 3300025929 | Bacteria | 1455 |
| 664 | Ga0207644_10143631 | 3300025931 | Bacteria | 1840 |
| 665 | Ga0207706_10001399 | 3300025933 | Bacteria | 24113 |
| 666 | Ga0207706_10093287 | 3300025933 | Bacteria | 2647 |
| 667 | Ga0207706_10510774 | 3300025933 | Bacteria | 1037 |
| 668 | Ga0207686_10032635 | 3300025934 | Bacteria | 3100 |
| 669 | Ga0207686_10128424 | 3300025934 | Bacteria | 1735 |
| 670 | Ga0207686_10154091 | 3300025934 | Bacteria | 1603 |
| 671 | Ga0207709_10000014 | 3300025935 | Bacteria | 526302 |
| 672 | Ga0207709_10000745 | 3300025935 | Bacteria | 25844 |
| 673 | Ga0207709_10000862 | 3300025935 | Bacteria | 23149 |
| 674 | Ga0207709_10064266 | 3300025935 | Bacteria | 2303 |
| 675 | Ga0207709_10152522 | 3300025935 | Bacteria | 1602 |
| 676 | Ga0207670_10008860 | 3300025936 | Bacteria | 5702 |
| 677 | Ga0207670_10247359 | 3300025936 | Bacteria | 1376 |
| 678 | Ga0207669_10003348 | 3300025937 | Bacteria | 6939 |
| 679 | Ga0207669_10062805 | 3300025937 | Bacteria | 2289 |
| 680 | Ga0207669_10093092 | 3300025937 | Bacteria | 1968 |
| 681 | Ga0207665_10034568 | 3300025939 | Bacteria | 3354 |
| 682 | Ga0207665_10047803 | 3300025939 | Bacteria | 2870 |
| 683 | Ga0207691_10015888 | 3300025940 | Bacteria | 7152 |
| 684 | Ga0207711_10532840 | 3300025941 | Bacteria | 1095 |
| 685 | Ga0207661_10005577 | 3300025944 | Bacteria | 8874 |
| 686 | Ga0207661_10009220 | 3300025944 | Bacteria | 7071 |
| 687 | Ga0207661_10248092 | 3300025944 | Bacteria | 1581 |
| 688 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 689 | Ga0207679_10400716 | 3300025945 | Bacteria | 1207 |
| 690 | Ga0207667_10025206 | 3300025949 | Bacteria | 6514 |
| 691 | Ga0207667_10042544 | 3300025949 | Bacteria | 4827 |
| 692 | Ga0207667_10370428 | 3300025949 | Bacteria | 1460 |
| 693 | Ga0207651_10040199 | 3300025960 | Bacteria | 3091 |
| 694 | Ga0207712_10353700 | 3300025961 | Bacteria | 1222 |
| 695 | Ga0207668_10192054 | 3300025972 | Bacteria | 1619 |
| 696 | Ga0207640_10065278 | 3300025981 | Bacteria | 2428 |
| 697 | Ga0207640_10164788 | 3300025981 | Bacteria | 1644 |
| 698 | Ga0207658_10108932 | 3300025986 | Bacteria | 2186 |
| 699 | Ga0207658_10143977 | 3300025986 | Bacteria | 1933 |
| 700 | Ga0207677_10009064 | 3300026023 | Bacteria | 5584 |
| 701 | Ga0207677_10156526 | 3300026023 | Bacteria | 1765 |
| 702 | Ga0207703_10207747 | 3300026035 | Bacteria | 1744 |
| 703 | Ga0207639_10057826 | 3300026041 | Bacteria | 2980 |
| 704 | Ga0207639_10079348 | 3300026041 | Bacteria | 2594 |
| 705 | Ga0207639_10267734 | 3300026041 | Bacteria | 1497 |
| 706 | Ga0207678_10028237 | 3300026067 | Bacteria | 4899 |
| 707 | Ga0207678_10056271 | 3300026067 | Bacteria | 3386 |
| 708 | Ga0207702_10001581 | 3300026078 | Bacteria | 22550 |
| 709 | Ga0207702_10037097 | 3300026078 | Bacteria | 4078 |
| 710 | Ga0207702_10131075 | 3300026078 | Bacteria | 2256 |
| 711 | Ga0207702_10411970 | 3300026078 | Bacteria | 1305 |
| 712 | Ga0207641_10033406 | 3300026088 | Bacteria | 4274 |
| 713 | Ga0207648_10013832 | 3300026089 | Bacteria | 7485 |
| 714 | Ga0207648_10034250 | 3300026089 | Bacteria | 4477 |
| 715 | Ga0207648_10101244 | 3300026089 | Bacteria | 2525 |
| 716 | Ga0207676_10175434 | 3300026095 | Bacteria | 1871 |
| 717 | Ga0207674_10036358 | 3300026116 | Bacteria | 5133 |
| 718 | Ga0207674_10076492 | 3300026116 | Bacteria | 3354 |
| 719 | Ga0207674_10100560 | 3300026116 | Bacteria | 2873 |
| 720 | Ga0207674_10182305 | 3300026116 | Bacteria | 2051 |
| 721 | Ga0207674_10205855 | 3300026116 | Bacteria | 1917 |
| 722 | Ga0207674_10220597 | 3300026116 | Bacteria | 1844 |
| 723 | Ga0207683_10045311 | 3300026121 | Bacteria | 3846 |
| 724 | Ga0207683_10205221 | 3300026121 | Bacteria | 1792 |
| 725 | Ga0207698_10006676 | 3300026142 | Bacteria | 7210 |
| 726 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 727 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 728 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 729 | Ga0209281_1000061 | 3300027111 | Bacteria | 293814 |
| 730 | Ga0209281_1000368 | 3300027111 | Bacteria | 73062 |
| 731 | Ga0209389_1034967 | 3300027296 | Bacteria | 4091 |
| 732 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 733 | Ga0209589_1004535 | 3300027357 | Bacteria | 23952 |
| 734 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 735 | Ga0209489_100050 | 3300027361 | Bacteria | 154669 |
| 736 | Ga0209489_104795 | 3300027361 | Bacteria | 24473 |
| 737 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 738 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 739 | Ga0209995_1000788 | 3300027471 | Bacteria | 4862 |
| 740 | Ga0209179_1003151 | 3300027512 | Bacteria | 2337 |
| 741 | Ga0209968_1019181 | 3300027526 | Bacteria | 1100 |
| 742 | Ga0209970_1000107 | 3300027614 | Bacteria | 11851 |
| 743 | Ga0210002_1016632 | 3300027617 | Bacteria | 1165 |
| 744 | Ga0209983_1000442 | 3300027665 | Bacteria | 8967 |
| 745 | Ga0209282_1001739 | 3300027666 | Bacteria | 12179 |
| 746 | Ga0209282_1013266 | 3300027666 | Bacteria | 5249 |
| 747 | Ga0209588_1020699 | 3300027671 | Bacteria | 2061 |
| 748 | Ga0209588_1060223 | 3300027671 | Bacteria | 1227 |
| 749 | Ga0209971_1001513 | 3300027682 | Bacteria | 5755 |
| 750 | Ga0209971_1001548 | 3300027682 | Bacteria | 5688 |
| 751 | Ga0209813_10003068 | 3300027866 | Bacteria | 3884 |
| 752 | Ga0209813_10048661 | 3300027866 | Bacteria | 1317 |
| 753 | Ga0209974_10007739 | 3300027876 | Bacteria | 3694 |
| 754 | Ga0209974_10011930 | 3300027876 | Bacteria | 2912 |
| 755 | Ga0207428_10022614 | 3300027907 | Bacteria | 5303 |
| 756 | Ga0207428_10044673 | 3300027907 | Bacteria | 3573 |
| 757 | Ga0207428_10083579 | 3300027907 | Bacteria | 2490 |
| 758 | Ga0207428_10199749 | 3300027907 | Bacteria | 1505 |
| 759 | Ga0207428_10255836 | 3300027907 | Bacteria | 1305 |
| 760 | Ga0268266_10003203 | 3300028379 | Bacteria | 16557 |
| 761 | Ga0268266_10012481 | 3300028379 | Bacteria | 7342 |
| 762 | Ga0268266_10039076 | 3300028379 | Bacteria | 4041 |
| 763 | Ga0268266_10078930 | 3300028379 | Bacteria | 2865 |
| 764 | Ga0268266_10085845 | 3300028379 | Bacteria | 2751 |
| 765 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 766 | Ga0265337_1005916 | 3300028556 | Bacteria | 4789 |
| 767 | Ga0265326_10003140 | 3300028558 | Bacteria | 5466 |
| 768 | Ga0265319_1002854 | 3300028563 | Bacteria | 9237 |
| 769 | Ga0265334_10001590 | 3300028573 | Bacteria | 10915 |
| 770 | Ga0265318_10005470 | 3300028577 | Bacteria | 5963 |
| 771 | Ga0265323_10000744 | 3300028653 | Bacteria | 17485 |
| 772 | Ga0265322_10026828 | 3300028654 | Bacteria | 1646 |
| 773 | Ga0265336_10000008 | 3300028666 | Bacteria | 336082 |
| 774 | Ga0265336_10000228 | 3300028666 | Bacteria | 39886 |
| 775 | Ga0307517_10000512 | 3300028786 | Bacteria | 66501 |
| 776 | Ga0307515_10002738 | 3300028794 | Bacteria | 37712 |
| 777 | Ga0307515_10007488 | 3300028794 | Bacteria | 21572 |
| 778 | Ga0307515_10153679 | 3300028794 | Bacteria | 2389 |
| 779 | Ga0265338_10000116 | 3300028800 | Bacteria | 146839 |
| 780 | Ga0265324_10001429 | 3300029957 | Bacteria | 13685 |
| 781 | Ga0265324_10003977 | 3300029957 | Bacteria | 6822 |
| 782 | Ga0307511_10109527 | 3300030521 | Bacteria | 1765 |
| 783 | Ga0316176_1097126 | 3300030732 | Bacteria | 1928 |
| 784 | Ga0316178_1063861 | 3300030735 | Bacteria | 18113 |
| 785 | Ga0265330_10000012 | 3300031235 | Bacteria | 180837 |
| 786 | Ga0265330_10020866 | 3300031235 | Bacteria | 2993 |
| 787 | Ga0265330_10039637 | 3300031235 | Bacteria | 2093 |
| 788 | Ga0265332_10117983 | 3300031238 | Bacteria | 1115 |
| 789 | Ga0265325_10020132 | 3300031241 | Bacteria | 3681 |
| 790 | Ga0265340_10002528 | 3300031247 | Bacteria | 10391 |
| 791 | Ga0265339_10001476 | 3300031249 | Bacteria | 17368 |
| 792 | Ga0265339_10059648 | 3300031249 | Bacteria | 2057 |
| 793 | Ga0265331_10023285 | 3300031250 | Bacteria | 3148 |
| 794 | Ga0265327_10025625 | 3300031251 | Bacteria | 3434 |
| 795 | Ga0265316_10182322 | 3300031344 | Bacteria | 1563 |
| 796 | Ga0307513_10000028 | 3300031456 | Bacteria | 193264 |
| 797 | Ga0307513_10000206 | 3300031456 | Bacteria | 85338 |
| 798 | Ga0307513_10037114 | 3300031456 | Bacteria | 5426 |
| 799 | Ga0307513_10266951 | 3300031456 | Bacteria | 1497 |
| 800 | Ga0307513_10315343 | 3300031456 | Bacteria | 1324 |
| 801 | Ga0307513_10346460 | 3300031456 | Bacteria | 1235 |
| 802 | Ga0307509_10005567 | 3300031507 | Bacteria | 17451 |
| 803 | Ga0307509_10084915 | 3300031507 | Bacteria | 3259 |
| 804 | Ga0307509_10098912 | 3300031507 | Bacteria | 2960 |
| 805 | Ga0307509_10120213 | 3300031507 | Bacteria | 2606 |
| 806 | Ga0307509_10379167 | 3300031507 | Bacteria | 1127 |
| 807 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 808 | Ga0307408_100010250 | 3300031548 | Bacteria | 6181 |
| 809 | Ga0307408_100027214 | 3300031548 | Bacteria | 3938 |
| 810 | Ga0307408_100040046 | 3300031548 | Bacteria | 3316 |
| 811 | Ga0307408_100091004 | 3300031548 | Bacteria | 2303 |
| 812 | Ga0307408_100096358 | 3300031548 | Bacteria | 2244 |
| 813 | Ga0307408_100155007 | 3300031548 | Bacteria | 1813 |
| 814 | Ga0307408_100195868 | 3300031548 | Bacteria | 1631 |
| 815 | Ga0307508_10000008 | 3300031616 | Bacteria | 265023 |
| 816 | Ga0307508_10000053 | 3300031616 | Bacteria | 128020 |
| 817 | Ga0307508_10000273 | 3300031616 | Bacteria | 63550 |
| 818 | Ga0307508_10032796 | 3300031616 | Bacteria | 4690 |
| 819 | Ga0307508_10040908 | 3300031616 | Bacteria | 4161 |
| 820 | Ga0307508_10055166 | 3300031616 | Bacteria | 3521 |
| 821 | Ga0307514_10000722 | 3300031649 | Bacteria | 57107 |
| 822 | Ga0265314_10006545 | 3300031711 | Bacteria | 10278 |
| 823 | Ga0265314_10015462 | 3300031711 | Bacteria | 6055 |
| 824 | Ga0265314_10024921 | 3300031711 | Bacteria | 4524 |
| 825 | Ga0316576_10017056 | 3300031727 | Bacteria | 4925 |
| 826 | Ga0307516_10000064 | 3300031730 | Bacteria | 115074 |
| 827 | Ga0307516_10001494 | 3300031730 | Bacteria | 32199 |
| 828 | Ga0307516_10001622 | 3300031730 | Bacteria | 30969 |
| 829 | Ga0307516_10024119 | 3300031730 | Bacteria | 6217 |
| 830 | Ga0307516_10140243 | 3300031730 | Bacteria | 2188 |
| 831 | Ga0307405_10007622 | 3300031731 | Bacteria | 5430 |
| 832 | Ga0307405_10010736 | 3300031731 | Bacteria | 4761 |
| 833 | Ga0307413_10232830 | 3300031824 | Bacteria | 1354 |
| 834 | Ga0307410_10026075 | 3300031852 | Bacteria | 3674 |
| 835 | Ga0307406_10003755 | 3300031901 | Bacteria | 8259 |
| 836 | Ga0307406_10013191 | 3300031901 | Bacteria | 4729 |
| 837 | Ga0307406_10018898 | 3300031901 | Bacteria | 4036 |
| 838 | Ga0307406_10029649 | 3300031901 | Bacteria | 3315 |
| 839 | Ga0307407_10027945 | 3300031903 | Bacteria | 3009 |
| 840 | Ga0307407_10088687 | 3300031903 | Bacteria | 1890 |
| 841 | Ga0307412_10002786 | 3300031911 | Bacteria | 9713 |
| 842 | Ga0307412_10026597 | 3300031911 | Bacteria | 3598 |
| 843 | Ga0307412_10097399 | 3300031911 | Bacteria | 2072 |
| 844 | Ga0307409_100002839 | 3300031995 | Bacteria | 9162 |
| 845 | Ga0307409_100139382 | 3300031995 | Bacteria | 2087 |
| 846 | Ga0307416_100047679 | 3300032002 | Bacteria | 3393 |
| 847 | Ga0307416_100049968 | 3300032002 | Bacteria | 3329 |
| 848 | Ga0307416_100234891 | 3300032002 | Bacteria | 1771 |
| 849 | Ga0307416_100279148 | 3300032002 | Bacteria | 1646 |
| 850 | Ga0307414_10040421 | 3300032004 | Bacteria | 3150 |
| 851 | Ga0307414_10057596 | 3300032004 | Bacteria | 2732 |
| 852 | Ga0307414_10132567 | 3300032004 | Bacteria | 1937 |
| 853 | Ga0307414_10193040 | 3300032004 | Bacteria | 1649 |
| 854 | Ga0307414_10278168 | 3300032004 | Bacteria | 1405 |
| 855 | Ga0307414_10326757 | 3300032004 | Bacteria | 1308 |
| 856 | Ga0307414_10335077 | 3300032004 | Bacteria | 1293 |
| 857 | Ga0307414_10428999 | 3300032004 | Bacteria | 1154 |
| 858 | Ga0307411_10000039 | 3300032005 | Bacteria | 40183 |
| 859 | Ga0307411_10016890 | 3300032005 | Bacteria | 4141 |
| 860 | Ga0307411_10134858 | 3300032005 | Bacteria | 1810 |
| 861 | Ga0307411_10256903 | 3300032005 | Bacteria | 1377 |
| 862 | Ga0307411_10418826 | 3300032005 | Bacteria | 1112 |
| 863 | Ga0307415_100008136 | 3300032126 | Bacteria | 5795 |
| 864 | Ga0307415_100023443 | 3300032126 | Bacteria | 3831 |
| 865 | Ga0307507_10071426 | 3300033179 | Bacteria | 3139 |
| 866 | Ga0307510_10000088 | 3300033180 | Bacteria | 69071 |
| 867 | Ga0307510_10002929 | 3300033180 | Bacteria | 19628 |
| 868 | Ga0307510_10021544 | 3300033180 | Bacteria | 7509 |
| 869 | Ga0307510_10068402 | 3300033180 | Bacteria | 3564 |
| 870 | Ga0307510_10098920 | 3300033180 | Bacteria | 2718 |
| 871 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 872 | Ga0373926_0011772 | 3300035083 | Bacteria | 2951 |
| 873 | Ga0373929_0011017 | 3300035085 | Bacteria | 1698 |
| 874 | Ga0373934_0001948 | 3300035086 | Bacteria | 7568 |
| 875 | Ga0373934_0012326 | 3300035086 | Bacteria | 3227 |
| 876 | Ga0373932_0035200 | 3300035112 | Bacteria | 1415 |
| 877 | Ga0373936_0007174 | 3300035113 | Bacteria | 4195 |
| 878 | Ga0373945_0008905 | 3300035116 | Bacteria | 3279 |
| 879 | Ga0373945_0020462 | 3300035116 | Bacteria | 2265 |
| 880 | Ga0373953_0094460 | 3300035117 | Bacteria | 1253 |
| 881 | Ga0373954_0001852 | 3300035118 | Bacteria | 8731 |
| 882 | Ga0373954_0010696 | 3300035118 | Bacteria | 4055 |
| 883 | Ga0373956_0003558 | 3300035119 | Bacteria | 6278 |
| 884 | Ga0373956_0137522 | 3300035119 | Bacteria | 1146 |
| 885 | Ga0373957_0010697 | 3300035120 | Bacteria | 3041 |
| 886 | Ga0373943_0010932 | 3300035170 | Bacteria | 4079 |
| 887 | Ga0373943_0215764 | 3300035170 | Bacteria | 1067 |
| 888 | Ga0373946_0013875 | 3300035171 | Bacteria | 3033 |
| 889 | Ga0373955_0039970 | 3300035172 | Bacteria | 2506 |
| 890 | Ga0373955_0051885 | 3300035172 | Bacteria | 2235 |
| 891 | Ga0373962_0060997 | 3300035242 | Bacteria | 1108 |
| 892 | Ga0373924_0003246 | 3300035410 | Bacteria | 5563 |
| 893 | Ga0373931_0001380 | 3300035691 | Bacteria | 10387 |
| 894 | Ga0373935_0000493 | 3300035692 | Bacteria | 20439 |
| 895 | Ga0373935_0058231 | 3300035692 | Bacteria | 2467 |
| 896 | Ga0373927_0000331 | 3300035695 | Bacteria | 37139 |
| 897 | Ga0373927_0007766 | 3300035695 | Bacteria | 7255 |
| 898 | Ga0373927_0012238 | 3300035695 | Bacteria | 5708 |
| 899 | Ga0373927_0075732 | 3300035695 | Bacteria | 2179 |
| 900 | Ga0373927_0205124 | 3300035695 | Bacteria | 1294 |
| 901 | Ga0373933_0004248 | 3300035724 | Bacteria | 7890 |
| 902 | Ga0373933_0047155 | 3300035724 | Bacteria | 2561 |
| 903 | Ga0373933_0369114 | 3300035724 | Bacteria | 934 |
| 904 | Ga0373947_0004776 | 3300035725 | Bacteria | 7937 |
| 905 | Ga0373947_0014044 | 3300035725 | Bacteria | 4591 |
| 906 | Ga0373947_0055623 | 3300035725 | Bacteria | 2390 |
| 907 | Ga0373947_0143620 | 3300035725 | Bacteria | 1533 |
| 908 | Ga0373937_0009958 | 3300036401 | Bacteria | 8289 |
| 909 | Ga0373937_0136963 | 3300036401 | Bacteria | 2289 |
| 910 | Ga0373937_0140600 | 3300036401 | Bacteria | 2258 |
| 911 | Ga0373937_0188612 | 3300036401 | Bacteria | 1937 |
| 912 | Ga0316584_0161063 | 3300036712 | Bacteria | 1667 |
| 913 | Ga0373925_0029402 | 3300037068 | Bacteria | 4032 |
| 914 | Ga0373925_0053723 | 3300037068 | Bacteria | 3012 |
| 915 | Ga0373925_0089848 | 3300037068 | Bacteria | 2347 |
| 916 | Ga0373925_0094066 | 3300037068 | Bacteria | 2294 |
| 917 | Ga0373925_0174547 | 3300037068 | Bacteria | 1698 |
| 918 | Ga0373925_0499995 | 3300037068 | Bacteria | 998 |
| 919 | Ga0395899_0001797 | 3300037312 | Bacteria | 17769 |
| 920 | Ga0395899_0027157 | 3300037312 | Bacteria | 4318 |
| 921 | Ga0395900_0000134 | 3300037418 | Bacteria | 124444 |
| 922 | Ga0395900_0023837 | 3300037418 | Bacteria | 6261 |
| 923 | Ga0395898_0029740 | 3300037466 | Bacteria | 5467 |
| 924 | Ga0395898_0051921 | 3300037466 | Bacteria | 4007 |
| 925 | Ga0395898_0411805 | 3300037466 | Bacteria | 1289 |
| 926 | Ga0395905_0009931 | 3300037471 | Bacteria | 9272 |
| 927 | Ga0395905_0155934 | 3300037471 | Bacteria | 2148 |
| 928 | Ga0395905_0193383 | 3300037471 | Bacteria | 1908 |
| 929 | Ga0395905_0193507 | 3300037471 | Bacteria | 1907 |
| 930 | Ga0395901_0010231 | 3300038443 | Bacteria | 9503 |
| 931 | Ga0395901_0011149 | 3300038443 | Bacteria | 9108 |
| 932 | Ga0395901_0042456 | 3300038443 | Bacteria | 4714 |
| 933 | Ga0395901_0084013 | 3300038443 | Bacteria | 3328 |
| 934 | Ga0395901_0091348 | 3300038443 | Bacteria | 3187 |
| 935 | Ga0395901_0176077 | 3300038443 | Bacteria | 2244 |
| 936 | Ga0395901_0303025 | 3300038443 | Bacteria | 1656 |
| 937 | Ga0237819_01625 | 3300038705 | Bacteria | 5565 |
| 938 | Ga0436365_0622105 | 3300039437 | Bacteria | 10561 |
| 939 | Ga0436365_0851563 | 3300039437 | Bacteria | 1441 |
| 940 | Ga0436360_0042397 | 3300039438 | Bacteria | 10982 |
| 941 | Ga0436360_0742143 | 3300039438 | Bacteria | 1447 |
| 942 | Ga0436360_0766994 | 3300039438 | Bacteria | 2327 |
| 943 | Ga0436360_0975226 | 3300039438 | Bacteria | 1622 |
| 944 | Ga0436361_0054229 | 3300039447 | Bacteria | 4060 |
| 945 | Ga0436363_0016840 | 3300039450 | Bacteria | 1060 |
| 946 | Ga0436363_1029339 | 3300039450 | Bacteria | 1723 |
| 947 | Ga0436362_0974760 | 3300039453 | Bacteria | 2641 |
| 948 | Ga0439438_003472 | 3300041405 | Bacteria | 6366 |
| 949 | Ga0439438_035300 | 3300041405 | Bacteria | 1314 |
| 950 | Ga0439439_0029169 | 3300041406 | Bacteria | 1400 |
| 951 | Ga0439447_005892 | 3300041407 | Bacteria | 4027 |
| 952 | Ga0439466_0005482 | 3300041411 | Bacteria | 4845 |
| 953 | Ga0439466_0012874 | 3300041411 | Bacteria | 3069 |
| 954 | Ga0439466_0021425 | 3300041411 | Bacteria | 2290 |
| 955 | Ga0439466_0022547 | 3300041411 | Bacteria | 2221 |
| 956 | Ga0439466_0040918 | 3300041411 | Bacteria | 1548 |
| 957 | Ga0439466_0044835 | 3300041411 | Bacteria | 1464 |
| 958 | Ga0439466_0063208 | 3300041411 | Bacteria | 1188 |
| 959 | Ga0451793_0212439 | 3300041452 | Bacteria | 1879 |
| 960 | Ga0451795_0009169 | 3300041456 | Bacteria | 2183 |
| 961 | Ga0451798_0710666 | 3300041458 | Bacteria | 1025 |
| 962 | Ga0451807_0979801 | 3300041486 | Bacteria | 1396 |
| 963 | Ga0439432_015833 | 3300042006 | Bacteria | 2541 |
| 964 | Ga0439432_030932 | 3300042006 | Bacteria | 1733 |
| 965 | Ga0439449_0004936 | 3300042007 | Bacteria | 5136 |
| 966 | Ga0439449_0041706 | 3300042007 | Bacteria | 1706 |
| 967 | Ga0439451_010177 | 3300042009 | Bacteria | 1897 |
| 968 | Ga0439451_014540 | 3300042009 | Bacteria | 1588 |
| 969 | Ga0439452_000836 | 3300042010 | Bacteria | 14300 |
| 970 | Ga0439452_002288 | 3300042010 | Bacteria | 7154 |
| 971 | Ga0439452_009502 | 3300042010 | Bacteria | 2861 |
| 972 | Ga0439452_033175 | 3300042010 | Bacteria | 1255 |
| 973 | Ga0439456_000087 | 3300042013 | Bacteria | 31983 |
| 974 | Ga0439456_000624 | 3300042013 | Bacteria | 7398 |
| 975 | Ga0439456_017042 | 3300042013 | Bacteria | 1521 |
| 976 | Ga0439463_002248 | 3300042016 | Bacteria | 4954 |
| 977 | Ga0450911_003188 | 3300042115 | Bacteria | 2956 |
| 978 | Ga0450920_033559 | 3300042122 | Bacteria | 1015 |
| 979 | Ga0450906_005074 | 3300042145 | Bacteria | 2730 |
| 980 | Ga0450906_010567 | 3300042145 | Bacteria | 1744 |
| 981 | Ga0450907_000564 | 3300042146 | Bacteria | 10035 |
| 982 | Ga0450907_010491 | 3300042146 | Bacteria | 1537 |
| 983 | Ga0450907_011127 | 3300042146 | Bacteria | 1494 |
| 984 | Ga0450910_002768 | 3300042147 | Bacteria | 2306 |
| 985 | Ga0450908_018115 | 3300042184 | Bacteria | 1247 |
| 986 | Ga0450909_004159 | 3300042185 | Bacteria | 2064 |
| 987 | Ga0439460_0007129 | 3300042461 | Bacteria | 2788 |
| 988 | Ga0439460_0014220 | 3300042461 | Bacteria | 2090 |
| 989 | Ga0450918_001867 | 3300042531 | Bacteria | 4090 |
| 990 | Ga0450918_004434 | 3300042531 | Bacteria | 2555 |
| 991 | Ga0439440_0010703 | 3300042993 | Bacteria | 1922 |
| 992 | Ga0466972_0009712 | 3300044658 | Bacteria | 4828 |
| 993 | Ga0453683_0003423 | 3300044673 | Bacteria | 11701 |
| 994 | Ga0466965_0030147 | 3300044683 | Bacteria | 2642 |
| 995 | Ga0466966_0001490 | 3300044684 | Bacteria | 15014 |
| 996 | Ga0466966_0007913 | 3300044684 | Bacteria | 7038 |
| 997 | Ga0466966_0049842 | 3300044684 | Bacteria | 2665 |
| 998 | Ga0466961_0000122 | 3300044693 | Bacteria | 52002 |
| 999 | Ga0466963_0004299 | 3300044694 | Bacteria | 8266 |
| 1000 | Ga0466963_0027077 | 3300044694 | Bacteria | 3668 |
| 1001 | Ga0453684_0000590 | 3300044712 | Bacteria | 134718 |
| 1002 | Ga0466971_0017005 | 3300044719 | Bacteria | 3215 |
| 1003 | Ga0466968_0010019 | 3300044735 | Bacteria | 3661 |
| 1004 | Ga0466968_0030833 | 3300044735 | Bacteria | 2223 |
| 1005 | Ga0466970_0050312 | 3300044765 | Bacteria | 2222 |
| 1006 | Ga0466957_0039832 | 3300044842 | Bacteria | 2836 |
| 1007 | Ga0466957_0093125 | 3300044842 | Bacteria | 1891 |
| 1008 | Ga0466960_0014481 | 3300044901 | Bacteria | 3377 |
| 1009 | Ga0466959_0077781 | 3300045049 | Bacteria | 2393 |
| 1010 | Ga0466959_0149223 | 3300045049 | Bacteria | 1649 |
| 1011 | Ga0451576_0004219 | 3300045051 | Bacteria | 18885 |
| 1012 | Ga0451576_0019992 | 3300045051 | Bacteria | 7299 |
| 1013 | Ga0451576_0029404 | 3300045051 | Bacteria | 5881 |
| 1014 | Ga0451576_0141235 | 3300045051 | Bacteria | 2511 |
| 1015 | Ga0466958_0036023 | 3300045836 | Bacteria | 2959 |
| 1016 | Ga0466967_0080214 | 3300045976 | Bacteria | 2944 |
| 1017 | Ga0466967_0081717 | 3300045976 | Bacteria | 2919 |
| 1018 | Ga0495617_010946 | 3300046452 | Bacteria | 3101 |
| 1019 | Ga0495617_012205 | 3300046452 | Bacteria | 2926 |
| 1020 | Ga0495617_026539 | 3300046452 | Bacteria | 1950 |
| 1021 | Ga0495627_002600 | 3300046453 | Bacteria | 8516 |
| 1022 | Ga0495627_009802 | 3300046453 | Bacteria | 3509 |
| 1023 | Ga0495627_013398 | 3300046453 | Bacteria | 2884 |
| 1024 | Ga0495627_019154 | 3300046453 | Bacteria | 2299 |
| 1025 | Ga0495627_019308 | 3300046453 | Bacteria | 2287 |
| 1026 | Ga0495592_0014473 | 3300046454 | Bacteria | 5987 |
| 1027 | Ga0495592_0017918 | 3300046454 | Bacteria | 5382 |
| 1028 | Ga0495592_0023531 | 3300046454 | Bacteria | 4685 |
| 1029 | Ga0495592_0034500 | 3300046454 | Bacteria | 3814 |
| 1030 | Ga0495603_0003417 | 3300046455 | Bacteria | 9451 |
| 1031 | Ga0495603_0029842 | 3300046455 | Bacteria | 3286 |
| 1032 | Ga0495603_0031407 | 3300046455 | Bacteria | 3197 |
| 1033 | Ga0495603_0043613 | 3300046455 | Bacteria | 2677 |
| 1034 | Ga0495590_0011066 | 3300046457 | Bacteria | 3381 |
| 1035 | Ga0495590_0018511 | 3300046457 | Bacteria | 2493 |
| 1036 | Ga0495591_005068 | 3300046458 | Bacteria | 6187 |
| 1037 | Ga0495591_017468 | 3300046458 | Bacteria | 2462 |
| 1038 | Ga0495591_017558 | 3300046458 | Bacteria | 2453 |
| 1039 | Ga0495591_025491 | 3300046458 | Bacteria | 1854 |
| 1040 | Ga0495629_0001243 | 3300046459 | Bacteria | 20022 |
| 1041 | Ga0495629_0002500 | 3300046459 | Bacteria | 14110 |
| 1042 | Ga0495629_0046459 | 3300046459 | Bacteria | 3045 |
| 1043 | Ga0495629_0190955 | 3300046459 | Bacteria | 1418 |
| 1044 | Ga0495638_0017604 | 3300046460 | Bacteria | 4759 |
| 1045 | Ga0495638_0033980 | 3300046460 | Bacteria | 3258 |
| 1046 | Ga0495638_0036612 | 3300046460 | Bacteria | 3125 |
| 1047 | Ga0495638_0071985 | 3300046460 | Bacteria | 2113 |
| 1048 | Ga0495638_0073735 | 3300046460 | Bacteria | 2082 |
| 1049 | Ga0495638_0115550 | 3300046460 | Bacteria | 1590 |
| 1050 | Ga0495638_0148590 | 3300046460 | Bacteria | 1361 |
| 1051 | Ga0495638_0173274 | 3300046460 | Bacteria | 1236 |
| 1052 | Ga0495641_0006961 | 3300046461 | Bacteria | 7194 |
| 1053 | Ga0495651_0036982 | 3300046462 | Bacteria | 3801 |
| 1054 | Ga0495651_0058034 | 3300046462 | Bacteria | 2970 |
| 1055 | Ga0495653_0000821 | 3300046463 | Bacteria | 23881 |
| 1056 | Ga0495653_0077120 | 3300046463 | Bacteria | 2475 |
| 1057 | Ga0495653_0079074 | 3300046463 | Bacteria | 2436 |
| 1058 | Ga0495653_0084672 | 3300046463 | Bacteria | 2335 |
| 1059 | Ga0495653_0128795 | 3300046463 | Bacteria | 1794 |
| 1060 | Ga0495653_0128814 | 3300046463 | Bacteria | 1794 |
| 1061 | Ga0495650_0006054 | 3300046471 | Bacteria | 7641 |
| 1062 | Ga0495650_0029859 | 3300046471 | Bacteria | 2478 |
| 1063 | Ga0495650_0043880 | 3300046471 | Bacteria | 1893 |
| 1064 | Ga0495650_0053415 | 3300046471 | Bacteria | 1654 |
| 1065 | Ga0495580_0001284 | 3300046472 | Bacteria | 22130 |
| 1066 | Ga0495580_0006315 | 3300046472 | Bacteria | 9680 |
| 1067 | Ga0495580_0148851 | 3300046472 | Bacteria | 1622 |
| 1068 | Ga0495582_0000166 | 3300046473 | Bacteria | 35616 |
| 1069 | Ga0495582_0003905 | 3300046473 | Bacteria | 8370 |
| 1070 | Ga0495605_0000045 | 3300046474 | Bacteria | 176155 |
| 1071 | Ga0495605_0035699 | 3300046474 | Bacteria | 2511 |
| 1072 | Ga0495605_0042631 | 3300046474 | Bacteria | 2254 |
| 1073 | Ga0495639_0001515 | 3300046475 | Bacteria | 10358 |
| 1074 | Ga0495639_0003011 | 3300046475 | Bacteria | 7338 |
| 1075 | Ga0495639_0004799 | 3300046475 | Bacteria | 5814 |
| 1076 | Ga0495639_0082730 | 3300046475 | Bacteria | 1497 |
| 1077 | Ga0495662_0090495 | 3300046476 | Bacteria | 1492 |
| 1078 | Ga0495664_0002707 | 3300046477 | Bacteria | 9527 |
| 1079 | Ga0495664_0002890 | 3300046477 | Bacteria | 9261 |
| 1080 | Ga0495664_0134418 | 3300046477 | Bacteria | 1498 |
| 1081 | Ga0495584_0006050 | 3300046491 | Bacteria | 6373 |
| 1082 | Ga0495584_0006946 | 3300046491 | Bacteria | 5913 |
| 1083 | Ga0495584_0014142 | 3300046491 | Bacteria | 4067 |
| 1084 | Ga0495584_0023996 | 3300046491 | Bacteria | 3091 |
| 1085 | Ga0495584_0037158 | 3300046491 | Bacteria | 2460 |
| 1086 | Ga0495584_0037455 | 3300046491 | Bacteria | 2451 |
| 1087 | Ga0495584_0041671 | 3300046491 | Bacteria | 2317 |
| 1088 | Ga0495584_0056978 | 3300046491 | Bacteria | 1966 |
| 1089 | Ga0495585_0028915 | 3300046492 | Bacteria | 3158 |
| 1090 | Ga0495585_0037233 | 3300046492 | Bacteria | 2740 |
| 1091 | Ga0495585_0069557 | 3300046492 | Bacteria | 1921 |
| 1092 | Ga0495594_0004296 | 3300046499 | Bacteria | 7321 |
| 1093 | Ga0495594_0043177 | 3300046499 | Bacteria | 2470 |
| 1094 | Ga0495594_0086106 | 3300046499 | Bacteria | 1758 |
| 1095 | Ga0495596_0003925 | 3300046500 | Bacteria | 7371 |
| 1096 | Ga0495596_0052050 | 3300046500 | Bacteria | 1603 |
| 1097 | Ga0495607_0007008 | 3300046501 | Bacteria | 7844 |
| 1098 | Ga0495607_0018591 | 3300046501 | Bacteria | 4428 |
| 1099 | Ga0495607_0038180 | 3300046501 | Bacteria | 2879 |
| 1100 | Ga0495607_0078457 | 3300046501 | Bacteria | 1822 |
| 1101 | Ga0495607_0142386 | 3300046501 | Bacteria | 1235 |
| 1102 | Ga0495583_0002109 | 3300046506 | Bacteria | 17877 |
| 1103 | Ga0495583_0002827 | 3300046506 | Bacteria | 14170 |
| 1104 | Ga0495583_0009758 | 3300046506 | Bacteria | 5698 |
| 1105 | Ga0495583_0035369 | 3300046506 | Bacteria | 2384 |
| 1106 | Ga0495583_0037575 | 3300046506 | Bacteria | 2294 |
| 1107 | Ga0495583_0038926 | 3300046506 | Bacteria | 2243 |
| 1108 | Ga0495606_0000297 | 3300046507 | Bacteria | 85779 |
| 1109 | Ga0495606_0001165 | 3300046507 | Bacteria | 37175 |
| 1110 | Ga0495606_0001557 | 3300046507 | Bacteria | 30137 |
| 1111 | Ga0495606_0002202 | 3300046507 | Bacteria | 23347 |
| 1112 | Ga0495606_0004299 | 3300046507 | Bacteria | 14339 |
| 1113 | Ga0495606_0011916 | 3300046507 | Bacteria | 7033 |
| 1114 | Ga0495606_0012904 | 3300046507 | Bacteria | 6649 |
| 1115 | Ga0495606_0049659 | 3300046507 | Bacteria | 2749 |
| 1116 | Ga0495606_0058668 | 3300046507 | Bacteria | 2472 |
| 1117 | Ga0495606_0060956 | 3300046507 | Bacteria | 2414 |
| 1118 | Ga0495606_0078390 | 3300046507 | Bacteria | 2060 |
| 1119 | Ga0495606_0080355 | 3300046507 | Bacteria | 2029 |
| 1120 | Ga0495606_0098874 | 3300046507 | Bacteria | 1779 |
| 1121 | Ga0495608_0002366 | 3300046511 | Bacteria | 13571 |
| 1122 | Ga0495608_0170921 | 3300046511 | Bacteria | 1378 |
| 1123 | Ga0495610_0017381 | 3300046512 | Bacteria | 4103 |
| 1124 | Ga0495610_0018339 | 3300046512 | Bacteria | 3958 |
| 1125 | Ga0495610_0037307 | 3300046512 | Bacteria | 2475 |
| 1126 | Ga0495610_0043864 | 3300046512 | Bacteria | 2224 |
| 1127 | Ga0495610_0048765 | 3300046512 | Bacteria | 2077 |
| 1128 | Ga0495610_0075000 | 3300046512 | Bacteria | 1567 |
| 1129 | Ga0495616_0016127 | 3300046513 | Bacteria | 4140 |
| 1130 | Ga0495616_0033659 | 3300046513 | Bacteria | 2667 |
| 1131 | Ga0495616_0038723 | 3300046513 | Bacteria | 2446 |
| 1132 | Ga0495616_0041034 | 3300046513 | Bacteria | 2362 |
| 1133 | Ga0495616_0042438 | 3300046513 | Bacteria | 2315 |
| 1134 | Ga0495616_0051275 | 3300046513 | Bacteria | 2059 |
| 1135 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 1136 | Ga0495620_0009249 | 3300046515 | Bacteria | 5247 |
| 1137 | Ga0495620_0023343 | 3300046515 | Bacteria | 2959 |
| 1138 | Ga0495620_0062506 | 3300046515 | Bacteria | 1546 |
| 1139 | Ga0495620_0076795 | 3300046515 | Bacteria | 1357 |
| 1140 | Ga0495628_0020530 | 3300046516 | Bacteria | 5446 |
| 1141 | Ga0495628_0033373 | 3300046516 | Bacteria | 4149 |
| 1142 | Ga0495628_0083981 | 3300046516 | Bacteria | 2471 |
| 1143 | Ga0495630_0006088 | 3300046517 | Bacteria | 8550 |
| 1144 | Ga0495630_0017695 | 3300046517 | Bacteria | 5225 |
| 1145 | Ga0495630_0167346 | 3300046517 | Bacteria | 1674 |
| 1146 | Ga0495630_0321663 | 3300046517 | Bacteria | 1183 |
| 1147 | Ga0495631_0019634 | 3300046518 | Bacteria | 3167 |
| 1148 | Ga0495631_0026377 | 3300046518 | Bacteria | 2669 |
| 1149 | Ga0495632_0002643 | 3300046519 | Bacteria | 13474 |
| 1150 | Ga0495632_0005088 | 3300046519 | Bacteria | 8796 |
| 1151 | Ga0495632_0020004 | 3300046519 | Bacteria | 3635 |
| 1152 | Ga0495632_0021622 | 3300046519 | Bacteria | 3463 |
| 1153 | Ga0495632_0047465 | 3300046519 | Bacteria | 2129 |
| 1154 | Ga0495632_0068709 | 3300046519 | Bacteria | 1706 |
| 1155 | Ga0495637_0001790 | 3300046520 | Bacteria | 12300 |
| 1156 | Ga0495637_0014025 | 3300046520 | Bacteria | 3791 |
| 1157 | Ga0495637_0015776 | 3300046520 | Bacteria | 3540 |
| 1158 | Ga0495637_0018058 | 3300046520 | Bacteria | 3275 |
| 1159 | Ga0495637_0026474 | 3300046520 | Bacteria | 2602 |
| 1160 | Ga0495637_0056900 | 3300046520 | Bacteria | 1617 |
| 1161 | Ga0495637_0069799 | 3300046520 | Bacteria | 1420 |
| 1162 | Ga0495643_0003239 | 3300046522 | Bacteria | 12058 |
| 1163 | Ga0495643_0018119 | 3300046522 | Bacteria | 4100 |
| 1164 | Ga0495643_0027832 | 3300046522 | Bacteria | 3172 |
| 1165 | Ga0495643_0115583 | 3300046522 | Bacteria | 1360 |
| 1166 | Ga0495644_0016310 | 3300046523 | Bacteria | 2843 |
| 1167 | Ga0495644_0020430 | 3300046523 | Bacteria | 2527 |
| 1168 | Ga0495644_0022569 | 3300046523 | Bacteria | 2398 |
| 1169 | Ga0495644_0159890 | 3300046523 | Bacteria | 863 |
| 1170 | Ga0495648_0000832 | 3300046524 | Bacteria | 32621 |
| 1171 | Ga0495648_0001607 | 3300046524 | Bacteria | 21994 |
| 1172 | Ga0495648_0001740 | 3300046524 | Bacteria | 21030 |
| 1173 | Ga0495648_0005382 | 3300046524 | Bacteria | 10643 |
| 1174 | Ga0495648_0010306 | 3300046524 | Bacteria | 7130 |
| 1175 | Ga0495648_0018275 | 3300046524 | Bacteria | 4972 |
| 1176 | Ga0495648_0039513 | 3300046524 | Bacteria | 3002 |
| 1177 | Ga0495648_0049120 | 3300046524 | Bacteria | 2589 |
| 1178 | Ga0495648_0055774 | 3300046524 | Bacteria | 2380 |
| 1179 | Ga0495648_0096164 | 3300046524 | Bacteria | 1646 |
| 1180 | Ga0495648_0147540 | 3300046524 | Bacteria | 1230 |
| 1181 | Ga0495666_0044498 | 3300046526 | Bacteria | 2143 |
| 1182 | Ga0495642_0001494 | 3300046528 | Bacteria | 10440 |
| 1183 | Ga0495642_0002271 | 3300046528 | Bacteria | 7848 |
| 1184 | Ga0495642_0003355 | 3300046528 | Bacteria | 6328 |
| 1185 | Ga0495652_0026794 | 3300046529 | Bacteria | 5086 |
| 1186 | Ga0495652_0032433 | 3300046529 | Bacteria | 4568 |
| 1187 | Ga0495652_0088960 | 3300046529 | Bacteria | 2529 |
| 1188 | Ga0495652_0113108 | 3300046529 | Bacteria | 2179 |
| 1189 | Ga0495654_0000207 | 3300046530 | Bacteria | 55932 |
| 1190 | Ga0495654_0000407 | 3300046530 | Bacteria | 36796 |
| 1191 | Ga0495654_0005186 | 3300046530 | Bacteria | 7599 |
| 1192 | Ga0495654_0028531 | 3300046530 | Bacteria | 2853 |
| 1193 | Ga0495654_0035572 | 3300046530 | Bacteria | 2506 |
| 1194 | Ga0495654_0083190 | 3300046530 | Bacteria | 1496 |
| 1195 | Ga0495654_0098157 | 3300046530 | Bacteria | 1351 |
| 1196 | Ga0495665_0000104 | 3300046531 | Bacteria | 39624 |
| 1197 | Ga0495640_0004822 | 3300046533 | Bacteria | 10741 |
| 1198 | Ga0495640_0009631 | 3300046533 | Bacteria | 7514 |
| 1199 | Ga0495640_0018706 | 3300046533 | Bacteria | 5128 |
| 1200 | Ga0495640_0039260 | 3300046533 | Bacteria | 3323 |
| 1201 | Ga0495586_0022737 | 3300046535 | Bacteria | 3346 |
| 1202 | Ga0495587_0066179 | 3300046536 | Bacteria | 2108 |
| 1203 | Ga0495587_0092871 | 3300046536 | Bacteria | 1742 |
| 1204 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 1205 | Ga0495609_0003344 | 3300046538 | Bacteria | 9246 |
| 1206 | Ga0495609_0003527 | 3300046538 | Bacteria | 8914 |
| 1207 | Ga0495609_0008316 | 3300046538 | Bacteria | 5086 |
| 1208 | Ga0495597_0016953 | 3300046542 | Bacteria | 3435 |
| 1209 | Ga0495597_0017788 | 3300046542 | Bacteria | 3340 |
| 1210 | Ga0495597_0040151 | 3300046542 | Bacteria | 2092 |
| 1211 | Ga0495597_0067733 | 3300046542 | Bacteria | 1543 |
| 1212 | Ga0495597_0097453 | 3300046542 | Bacteria | 1242 |
| 1213 | Ga0495645_0003878 | 3300046543 | Bacteria | 10187 |
| 1214 | Ga0495645_0007622 | 3300046543 | Bacteria | 7533 |
| 1215 | Ga0495645_0024803 | 3300046543 | Bacteria | 4350 |
| 1216 | Ga0495645_0049530 | 3300046543 | Bacteria | 3059 |
| 1217 | Ga0495622_0005470 | 3300046557 | Bacteria | 5890 |
| 1218 | Ga0495622_0016696 | 3300046557 | Bacteria | 3418 |
| 1219 | Ga0495622_0031473 | 3300046557 | Bacteria | 2478 |
| 1220 | Ga0495622_0035224 | 3300046557 | Bacteria | 2335 |
| 1221 | Ga0495622_0076376 | 3300046557 | Bacteria | 1543 |
| 1222 | Ga0495622_0123527 | 3300046557 | Bacteria | 1181 |
| 1223 | Ga0495633_0000034 | 3300046558 | Bacteria | 185552 |
| 1224 | Ga0495633_0004906 | 3300046558 | Bacteria | 8354 |
| 1225 | Ga0495633_0017329 | 3300046558 | Bacteria | 3686 |
| 1226 | Ga0495667_0032161 | 3300046559 | Bacteria | 3518 |
| 1227 | Ga0495667_0297173 | 3300046559 | Bacteria | 1023 |
| 1228 | Ga0495656_0002963 | 3300046615 | Bacteria | 5698 |
| 1229 | Ga0495656_0054834 | 3300046615 | Bacteria | 1716 |
| 1230 | Ga0495668_0022598 | 3300046616 | Bacteria | 3594 |
| 1231 | Ga0495668_0179737 | 3300046616 | Bacteria | 1159 |
| 1232 | Ga0495634_0017597 | 3300046642 | Bacteria | 5097 |
| 1233 | Ga0495634_0032726 | 3300046642 | Bacteria | 3574 |
| 1234 | Ga0495634_0039721 | 3300046642 | Bacteria | 3203 |
| 1235 | Ga0495634_0041737 | 3300046642 | Bacteria | 3115 |
| 1236 | Ga0495611_0000087 | 3300046648 | Bacteria | 66051 |
| 1237 | Ga0495611_0019217 | 3300046648 | Bacteria | 2934 |
| 1238 | Ga0495611_0060183 | 3300046648 | Bacteria | 1725 |
| 1239 | Ga0495625_0000637 | 3300046660 | Bacteria | 50416 |
| 1240 | Ga0495625_0012781 | 3300046660 | Bacteria | 6789 |
| 1241 | Ga0495625_0013758 | 3300046660 | Bacteria | 6487 |
| 1242 | Ga0495625_0014739 | 3300046660 | Bacteria | 6223 |
| 1243 | Ga0495625_0049192 | 3300046660 | Bacteria | 3031 |
| 1244 | Ga0495625_0056382 | 3300046660 | Bacteria | 2797 |
| 1245 | Ga0495625_0059637 | 3300046660 | Bacteria | 2706 |
| 1246 | Ga0495625_0063090 | 3300046660 | Bacteria | 2617 |
| 1247 | Ga0495625_0183625 | 3300046660 | Bacteria | 1389 |
| 1248 | Ga0495625_0207763 | 3300046660 | Bacteria | 1288 |
| 1249 | Ga0495635_0000965 | 3300046663 | Bacteria | 18965 |
| 1250 | Ga0495635_0022910 | 3300046663 | Bacteria | 4353 |
| 1251 | Ga0495635_0043323 | 3300046663 | Bacteria | 3106 |
| 1252 | Ga0495659_0033826 | 3300046664 | Bacteria | 1795 |
| 1253 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 1254 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 1255 | Ga0495661_0029104 | 3300046665 | Bacteria | 3528 |
| 1256 | Ga0495661_0033680 | 3300046665 | Bacteria | 3229 |
| 1257 | Ga0495661_0035431 | 3300046665 | Bacteria | 3131 |
| 1258 | Ga0495661_0078549 | 3300046665 | Bacteria | 1909 |
| 1259 | Ga0495661_0135855 | 3300046665 | Bacteria | 1342 |
| 1260 | Ga0495588_0013704 | 3300046674 | Bacteria | 3866 |
| 1261 | Ga0495657_0003762 | 3300046675 | Bacteria | 12281 |
| 1262 | Ga0495657_0009942 | 3300046675 | Bacteria | 7179 |
| 1263 | Ga0495657_0033182 | 3300046675 | Bacteria | 3596 |
| 1264 | Ga0495657_0056668 | 3300046675 | Bacteria | 2608 |
| 1265 | Ga0495599_0000673 | 3300046678 | Bacteria | 19348 |
| 1266 | Ga0495599_0054348 | 3300046678 | Bacteria | 2509 |
| 1267 | Ga0495646_0001365 | 3300046680 | Bacteria | 14447 |
| 1268 | Ga0495646_0011555 | 3300046680 | Bacteria | 5607 |
| 1269 | Ga0495646_0030382 | 3300046680 | Bacteria | 3374 |
| 1270 | Ga0495646_0060500 | 3300046680 | Bacteria | 2258 |
| 1271 | Ga0495647_0034877 | 3300046681 | Bacteria | 1887 |
| 1272 | Ga0495658_0005346 | 3300046683 | Bacteria | 6313 |
| 1273 | Ga0495658_0044779 | 3300046683 | Bacteria | 2480 |
| 1274 | Ga0495658_0072881 | 3300046683 | Bacteria | 1998 |
| 1275 | Ga0495669_0005702 | 3300046684 | Bacteria | 5193 |
| 1276 | Ga0495613_0012606 | 3300046689 | Bacteria | 6286 |
| 1277 | Ga0495613_0089766 | 3300046689 | Bacteria | 2226 |
| 1278 | Ga0495613_0156210 | 3300046689 | Bacteria | 1625 |
| 1279 | Ga0495624_0003391 | 3300046690 | Bacteria | 11822 |
| 1280 | Ga0495624_0004989 | 3300046690 | Bacteria | 9615 |
| 1281 | Ga0495624_0039559 | 3300046690 | Bacteria | 3022 |
| 1282 | Ga0495624_0052583 | 3300046690 | Bacteria | 2573 |
| 1283 | Ga0495670_0006645 | 3300046691 | Bacteria | 5687 |
| 1284 | Ga0495670_0010648 | 3300046691 | Bacteria | 4519 |
| 1285 | Ga0495670_0023440 | 3300046691 | Bacteria | 3046 |
| 1286 | Ga0495670_0034406 | 3300046691 | Bacteria | 2523 |
| 1287 | Ga0495670_0038914 | 3300046691 | Bacteria | 2371 |
| 1288 | Ga0495671_0001003 | 3300046692 | Bacteria | 19655 |
| 1289 | Ga0495671_0005757 | 3300046692 | Bacteria | 7226 |
| 1290 | Ga0495671_0005823 | 3300046692 | Bacteria | 7178 |
| 1291 | Ga0495671_0006451 | 3300046692 | Bacteria | 6774 |
| 1292 | Ga0495671_0012528 | 3300046692 | Bacteria | 4627 |
| 1293 | Ga0495671_0027502 | 3300046692 | Bacteria | 2937 |
| 1294 | Ga0495671_0030431 | 3300046692 | Bacteria | 2764 |
| 1295 | Ga0495671_0038771 | 3300046692 | Bacteria | 2407 |
| 1296 | Ga0495671_0046929 | 3300046692 | Bacteria | 2159 |
| 1297 | Ga0495671_0070167 | 3300046692 | Bacteria | 1721 |
| 1298 | Ga0495649_0004978 | 3300046694 | Bacteria | 8550 |
| 1299 | Ga0495649_0013633 | 3300046694 | Bacteria | 4684 |
| 1300 | Ga0495649_0017670 | 3300046694 | Bacteria | 4022 |
| 1301 | Ga0495649_0031447 | 3300046694 | Bacteria | 2926 |
| 1302 | Ga0495649_0058833 | 3300046694 | Bacteria | 2070 |
| 1303 | Ga0495649_0074345 | 3300046694 | Bacteria | 1820 |
| 1304 | Ga0495649_0077622 | 3300046694 | Bacteria | 1777 |
| 1305 | Ga0495649_0089796 | 3300046694 | Bacteria | 1638 |
| 1306 | Ga0495649_0099289 | 3300046694 | Bacteria | 1548 |
| 1307 | Ga0495589_0004519 | 3300046794 | Bacteria | 7392 |
| 1308 | Ga0495589_0009874 | 3300046794 | Bacteria | 4957 |
| 1309 | Ga0495589_0025524 | 3300046794 | Bacteria | 2998 |
| 1310 | Ga0495600_0002097 | 3300046809 | Bacteria | 11264 |
| 1311 | Ga0495600_0017523 | 3300046809 | Bacteria | 4557 |
| 1312 | Ga0495600_0118175 | 3300046809 | Bacteria | 1725 |
| 1313 | Ga0495660_0004735 | 3300046810 | Bacteria | 8214 |
| 1314 | Ga0495660_0005085 | 3300046810 | Bacteria | 7901 |
| 1315 | Ga0495660_0008278 | 3300046810 | Bacteria | 6091 |
| 1316 | Ga0495660_0048407 | 3300046810 | Bacteria | 2324 |
| 1317 | Ga0495660_0067759 | 3300046810 | Bacteria | 1900 |
| 1318 | Ga0495660_0085531 | 3300046810 | Bacteria | 1647 |
| 1319 | Ga0495581_0000391 | 3300047315 | Bacteria | 22000 |
| 1320 | Ga0495581_0066443 | 3300047315 | Bacteria | 2085 |
| 1321 | Ga0495604_0016096 | 3300047317 | Bacteria | 5973 |
| 1322 | Ga0495604_0021599 | 3300047317 | Bacteria | 5139 |
| 1323 | Ga0495636_0006933 | 3300047318 | Bacteria | 4455 |
| 1324 | Ga0495674_0001108 | 3300047319 | Bacteria | 25886 |
| 1325 | Ga0495674_0012073 | 3300047319 | Bacteria | 8141 |
| 1326 | Ga0495674_0033082 | 3300047319 | Bacteria | 4686 |
| 1327 | Ga0495674_0137732 | 3300047319 | Bacteria | 2053 |
| 1328 | Ga0495674_0274794 | 3300047319 | Bacteria | 1381 |
| 1329 | Ga0495672_0007313 | 3300047320 | Bacteria | 8329 |
| 1330 | Ga0495672_0034531 | 3300047320 | Bacteria | 3123 |
| 1331 | Ga0495672_0047729 | 3300047320 | Bacteria | 2544 |
| 1332 | Ga0495672_0050453 | 3300047320 | Bacteria | 2455 |
| 1333 | Ga0495672_0052406 | 3300047320 | Bacteria | 2397 |
| 1334 | Ga0495672_0058151 | 3300047320 | Bacteria | 2242 |
| 1335 | Ga0495676_0021883 | 3300047321 | Bacteria | 5573 |
| 1336 | Ga0495676_0088536 | 3300047321 | Bacteria | 2321 |
| 1337 | Ga0495676_0105399 | 3300047321 | Bacteria | 2079 |
| 1338 | Ga0495676_0238373 | 3300047321 | Bacteria | 1246 |
| 1339 | Ga0495680_0006581 | 3300047322 | Bacteria | 10780 |
| 1340 | Ga0495680_0052297 | 3300047322 | Bacteria | 3184 |
| 1341 | Ga0495683_0000059 | 3300047323 | Bacteria | 116530 |
| 1342 | Ga0495683_0000445 | 3300047323 | Bacteria | 32636 |
| 1343 | Ga0495683_0004382 | 3300047323 | Bacteria | 8028 |
| 1344 | Ga0495683_0013480 | 3300047323 | Bacteria | 4274 |
| 1345 | Ga0495683_0060049 | 3300047323 | Bacteria | 1885 |
| 1346 | Ga0495687_000664 | 3300047443 | Bacteria | 39326 |
| 1347 | Ga0495687_019958 | 3300047443 | Bacteria | 3275 |
| 1348 | Ga0495687_022811 | 3300047443 | Bacteria | 2999 |
| 1349 | Ga0495687_034916 | 3300047443 | Bacteria | 2266 |
| 1350 | Ga0495687_043519 | 3300047443 | Bacteria | 1955 |
| 1351 | Ga0495687_052157 | 3300047443 | Bacteria | 1731 |
| 1352 | Ga0495675_0001627 | 3300047444 | Bacteria | 13504 |
| 1353 | Ga0495675_0031987 | 3300047444 | Bacteria | 3359 |
| 1354 | Ga0495675_0049885 | 3300047444 | Bacteria | 2659 |
| 1355 | Ga0495679_004065 | 3300047446 | Bacteria | 6855 |
| 1356 | Ga0495679_031872 | 3300047446 | Bacteria | 1696 |
| 1357 | Ga0495685_024708 | 3300047447 | Bacteria | 2068 |
| 1358 | Ga0495673_0003388 | 3300047469 | Bacteria | 10528 |
| 1359 | Ga0495673_0006116 | 3300047469 | Bacteria | 7146 |
| 1360 | Ga0495673_0006812 | 3300047469 | Bacteria | 6671 |
| 1361 | Ga0495673_0019115 | 3300047469 | Bacteria | 3439 |
| 1362 | Ga0495673_0024606 | 3300047469 | Bacteria | 2905 |
| 1363 | Ga0495673_0029142 | 3300047469 | Bacteria | 2608 |
| 1364 | Ga0495673_0032426 | 3300047469 | Bacteria | 2436 |
| 1365 | Ga0495673_0049795 | 3300047469 | Bacteria | 1842 |
| 1366 | Ga0495673_0061554 | 3300047469 | Bacteria | 1606 |
| 1367 | Ga0495681_0015785 | 3300047470 | Bacteria | 4263 |
| 1368 | Ga0495681_0022519 | 3300047470 | Bacteria | 3368 |
| 1369 | Ga0495681_0032114 | 3300047470 | Bacteria | 2646 |
| 1370 | Ga0495681_0038614 | 3300047470 | Bacteria | 2338 |
| 1371 | Ga0495681_0055559 | 3300047470 | Bacteria | 1845 |
| 1372 | Ga0495684_0001891 | 3300047471 | Bacteria | 16776 |
| 1373 | Ga0495684_0006492 | 3300047471 | Bacteria | 9076 |
| 1374 | Ga0495684_0020313 | 3300047471 | Bacteria | 5117 |
| 1375 | Ga0495686_0016837 | 3300047472 | Bacteria | 4943 |
| 1376 | Ga0495686_0030481 | 3300047472 | Bacteria | 3503 |
| 1377 | Ga0495686_0037920 | 3300047472 | Bacteria | 3085 |
| 1378 | Ga0495686_0062452 | 3300047472 | Bacteria | 2310 |
| 1379 | Ga0495686_0096606 | 3300047472 | Bacteria | 1788 |
| 1380 | Ga0495686_0131884 | 3300047472 | Bacteria | 1481 |
| 1381 | Ga0495593_0000180 | 3300047673 | Bacteria | 32786 |
| 1382 | Ga0495602_0029325 | 3300048088 | Bacteria | 5242 |
| 1383 | Ga0495602_0061892 | 3300048088 | Bacteria | 3250 |
| 1384 | Ga0495602_0112382 | 3300048088 | Bacteria | 2210 |
| 1385 | Ga0495602_0266693 | 3300048088 | Bacteria | 1267 |
| 1386 | Ga0495614_0009204 | 3300048089 | Bacteria | 4375 |
| 1387 | Ga0495626_0001466 | 3300048091 | Bacteria | 18636 |
| 1388 | Ga0495626_0003622 | 3300048091 | Bacteria | 9826 |
| 1389 | Ga0495626_0003788 | 3300048091 | Bacteria | 9512 |
| 1390 | Ga0495626_0017420 | 3300048091 | Bacteria | 3627 |
| 1391 | Ga0495626_0036982 | 3300048091 | Bacteria | 2322 |
| 1392 | Ga0495626_0047188 | 3300048091 | Bacteria | 2003 |
| 1393 | Ga0495626_0053732 | 3300048091 | Bacteria | 1852 |
| 1394 | Ga0495626_0083251 | 3300048091 | Bacteria | 1417 |
| 1395 | Ga0496100_0343340 | 3300048903 | Bacteria | 1126 |
| 1396 | Ga0496101_0054418 | 3300048904 | Bacteria | 2889 |
| 1397 | Ga0496102_0001878 | 3300048905 | Bacteria | 18100 |
| 1398 | Ga0496102_0027736 | 3300048905 | Bacteria | 5057 |
| 1399 | Ga0496102_0035155 | 3300048905 | Bacteria | 4508 |
| 1400 | Ga0496102_0149984 | 3300048905 | Bacteria | 2190 |
| 1401 | Ga0496102_0268468 | 3300048905 | Bacteria | 1608 |
| 1402 | Ga0496103_0004910 | 3300048906 | Bacteria | 8073 |
| 1403 | Ga0496104_0152143 | 3300048907 | Bacteria | 2220 |
| 1404 | Ga0496104_0157091 | 3300048907 | Bacteria | 2182 |
| 1405 | Ga0496104_0173710 | 3300048907 | Bacteria | 2065 |
| 1406 | Ga0496104_0274899 | 3300048907 | Bacteria | 1597 |
| 1407 | Ga0496104_0408223 | 3300048907 | Bacteria | 1270 |
| 1408 | Ga0496104_0505852 | 3300048907 | Bacteria | 1119 |
| 1409 | Ga0496105_0008027 | 3300048908 | Bacteria | 8200 |
| 1410 | Ga0496105_0068092 | 3300048908 | Bacteria | 2940 |
| 1411 | Ga0496105_0068327 | 3300048908 | Bacteria | 2935 |
| 1412 | Ga0496105_0090420 | 3300048908 | Bacteria | 2528 |
| 1413 | Ga0496105_0313031 | 3300048908 | Bacteria | 1260 |
| 1414 | Ga0496106_0000201 | 3300048909 | Bacteria | 41935 |
| 1415 | Ga0496106_0013233 | 3300048909 | Bacteria | 6090 |
| 1416 | Ga0496107_0043614 | 3300048910 | Bacteria | 3223 |
| 1417 | Ga0496107_0133265 | 3300048910 | Bacteria | 1835 |
| 1418 | Ga0496108_0030667 | 3300048911 | Bacteria | 4456 |
| 1419 | Ga0496108_0074813 | 3300048911 | Bacteria | 2860 |
| 1420 | Ga0496108_0106391 | 3300048911 | Bacteria | 2395 |
| 1421 | Ga0496108_0210665 | 3300048911 | Bacteria | 1687 |
| 1422 | Ga0496108_0288637 | 3300048911 | Bacteria | 1428 |
| 1423 | Ga0496109_0024725 | 3300048912 | Bacteria | 5343 |
| 1424 | Ga0496109_0036488 | 3300048912 | Bacteria | 4437 |
| 1425 | Ga0496109_0252270 | 3300048912 | Bacteria | 1662 |
| 1426 | Ga0496109_0291169 | 3300048912 | Bacteria | 1539 |
| 1427 | Ga0496110_0035946 | 3300048913 | Bacteria | 4301 |
| 1428 | Ga0496110_0088041 | 3300048913 | Bacteria | 2773 |
| 1429 | Ga0496111_0024140 | 3300048914 | Bacteria | 4278 |
| 1430 | Ga0496111_0038246 | 3300048914 | Bacteria | 3437 |
| 1431 | Ga0496111_0045011 | 3300048914 | Bacteria | 3174 |
| 1432 | Ga0496111_0104793 | 3300048914 | Bacteria | 2080 |
| 1433 | Ga0496112_0000092 | 3300048915 | Bacteria | 58800 |
| 1434 | Ga0496112_0022945 | 3300048915 | Bacteria | 5955 |
| 1435 | Ga0496112_0179532 | 3300048915 | Bacteria | 2081 |
| 1436 | Ga0496112_0181055 | 3300048915 | Bacteria | 2071 |
| 1437 | Ga0496112_0566202 | 3300048915 | Bacteria | 1069 |
| 1438 | Ga0496113_0049855 | 3300048916 | Bacteria | 3119 |
| 1439 | Ga0496113_0274579 | 3300048916 | Bacteria | 1347 |
| 1440 | Ga0496114_0013948 | 3300048917 | Bacteria | 6444 |
| 1441 | Ga0496114_0041941 | 3300048917 | Bacteria | 3792 |
| 1442 | Ga0496114_0156892 | 3300048917 | Bacteria | 1976 |
| 1443 | Ga0496114_0162639 | 3300048917 | Bacteria | 1942 |
| 1444 | Ga0496115_0002825 | 3300048918 | Bacteria | 12488 |
| 1445 | Ga0496115_0022795 | 3300048918 | Bacteria | 4855 |
| 1446 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 1447 | Ga0496116_0002679 | 3300048919 | Bacteria | 18404 |
| 1448 | Ga0496116_0004501 | 3300048919 | Bacteria | 13269 |
| 1449 | Ga0496116_0004648 | 3300048919 | Bacteria | 13000 |
| 1450 | Ga0496116_0005694 | 3300048919 | Bacteria | 11461 |
| 1451 | Ga0496116_0032753 | 3300048919 | Bacteria | 3699 |
| 1452 | Ga0496116_0036352 | 3300048919 | Bacteria | 3448 |
| 1453 | Ga0496116_0072541 | 3300048919 | Bacteria | 2175 |
| 1454 | Ga0496116_0089587 | 3300048919 | Bacteria | 1876 |
| 1455 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 1456 | Ga0496117_0005527 | 3300048920 | Bacteria | 13235 |
| 1457 | Ga0496117_0044016 | 3300048920 | Bacteria | 3237 |
| 1458 | Ga0496117_0083816 | 3300048920 | Bacteria | 2082 |
| 1459 | Ga0496117_0108516 | 3300048920 | Bacteria | 1736 |
| 1460 | Ga0496117_0112417 | 3300048920 | Bacteria | 1693 |
| 1461 | Ga0496117_0166454 | 3300048920 | Bacteria | 1285 |
| 1462 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 1463 | Ga0496118_0009532 | 3300048921 | Bacteria | 9782 |
| 1464 | Ga0496118_0056794 | 3300048921 | Bacteria | 2939 |
| 1465 | Ga0496118_0057074 | 3300048921 | Bacteria | 2930 |
| 1466 | Ga0496118_0061408 | 3300048921 | Bacteria | 2783 |
| 1467 | Ga0496118_0095589 | 3300048921 | Bacteria | 2027 |
| 1468 | Ga0496118_0143524 | 3300048921 | Bacteria | 1508 |
| 1469 | Ga0496119_0000721 | 3300048922 | Bacteria | 44515 |
| 1470 | Ga0496119_0001636 | 3300048922 | Bacteria | 26397 |
| 1471 | Ga0496119_0033824 | 3300048922 | Bacteria | 3381 |
| 1472 | Ga0496119_0190741 | 3300048922 | Bacteria | 1068 |
| 1473 | Ga0496119_0204069 | 3300048922 | Bacteria | 1021 |
| 1474 | Ga0496120_0090088 | 3300048923 | Bacteria | 1641 |
| 1475 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 1476 | Ga0496121_0000684 | 3300048924 | Bacteria | 63147 |
| 1477 | Ga0496121_0002376 | 3300048924 | Bacteria | 28938 |
| 1478 | Ga0496121_0002933 | 3300048924 | Bacteria | 24956 |
| 1479 | Ga0496121_0006287 | 3300048924 | Bacteria | 14847 |
| 1480 | Ga0496121_0012784 | 3300048924 | Bacteria | 9091 |
| 1481 | Ga0496121_0023966 | 3300048924 | Bacteria | 5852 |
| 1482 | Ga0496121_0028225 | 3300048924 | Bacteria | 5229 |
| 1483 | Ga0496121_0032833 | 3300048924 | Bacteria | 4709 |
| 1484 | Ga0496121_0053578 | 3300048924 | Bacteria | 3378 |
| 1485 | Ga0496121_0063399 | 3300048924 | Bacteria | 3020 |
| 1486 | Ga0496121_0067626 | 3300048924 | Bacteria | 2894 |
| 1487 | Ga0496121_0087453 | 3300048924 | Bacteria | 2446 |
| 1488 | Ga0496121_0120511 | 3300048924 | Bacteria | 1982 |
| 1489 | Ga0496121_0168484 | 3300048924 | Bacteria | 1594 |
| 1490 | Ga0496121_0197206 | 3300048924 | Bacteria | 1438 |
| 1491 | Ga0496121_0231043 | 3300048924 | Bacteria | 1295 |
| 1492 | Ga0496122_0001180 | 3300048925 | Bacteria | 44683 |
| 1493 | Ga0496122_0005417 | 3300048925 | Bacteria | 15218 |
| 1494 | Ga0496122_0055712 | 3300048925 | Bacteria | 2954 |
| 1495 | Ga0496122_0057615 | 3300048925 | Bacteria | 2883 |
| 1496 | Ga0496122_0086385 | 3300048925 | Bacteria | 2159 |
| 1497 | Ga0496122_0093078 | 3300048925 | Bacteria | 2046 |
| 1498 | Ga0496122_0099831 | 3300048925 | Bacteria | 1944 |
| 1499 | Ga0496122_0101137 | 3300048925 | Bacteria | 1927 |
| 1500 | Ga0496123_0000519 | 3300048926 | Bacteria | 66923 |
| 1501 | Ga0496123_0002949 | 3300048926 | Bacteria | 19872 |
| 1502 | Ga0496123_0010850 | 3300048926 | Bacteria | 7984 |
| 1503 | Ga0496123_0018674 | 3300048926 | Bacteria | 5498 |
| 1504 | Ga0496123_0046294 | 3300048926 | Bacteria | 2951 |
| 1505 | Ga0496123_0051185 | 3300048926 | Bacteria | 2752 |
| 1506 | Ga0496123_0060534 | 3300048926 | Bacteria | 2440 |
| 1507 | Ga0496123_0093223 | 3300048926 | Bacteria | 1779 |
| 1508 | Ga0496123_0108089 | 3300048926 | Bacteria | 1598 |
| 1509 | Ga0496124_0000788 | 3300048927 | Bacteria | 51794 |
| 1510 | Ga0496124_0026389 | 3300048927 | Bacteria | 5239 |
| 1511 | Ga0496124_0047109 | 3300048927 | Bacteria | 3689 |
| 1512 | Ga0496124_0055451 | 3300048927 | Bacteria | 3349 |
| 1513 | Ga0496124_0058194 | 3300048927 | Bacteria | 3252 |
| 1514 | Ga0496124_0059142 | 3300048927 | Bacteria | 3220 |
| 1515 | Ga0496124_0081171 | 3300048927 | Bacteria | 2666 |
| 1516 | Ga0496124_0406155 | 3300048927 | Bacteria | 944 |
| 1517 | Ga0496125_0000715 | 3300048928 | Bacteria | 54933 |
| 1518 | Ga0496125_0000790 | 3300048928 | Bacteria | 51640 |
| 1519 | Ga0496125_0003799 | 3300048928 | Bacteria | 17957 |
| 1520 | Ga0496125_0013289 | 3300048928 | Bacteria | 8100 |
| 1521 | Ga0496125_0014724 | 3300048928 | Bacteria | 7601 |
| 1522 | Ga0496125_0023769 | 3300048928 | Bacteria | 5650 |
| 1523 | Ga0496125_0040985 | 3300048928 | Bacteria | 3964 |
| 1524 | Ga0496125_0045842 | 3300048928 | Bacteria | 3674 |
| 1525 | Ga0496125_0056254 | 3300048928 | Bacteria | 3196 |
| 1526 | Ga0496125_0086597 | 3300048928 | Bacteria | 2369 |
| 1527 | Ga0496125_0118562 | 3300048928 | Bacteria | 1895 |
| 1528 | Ga0496125_0140249 | 3300048928 | Bacteria | 1682 |
| 1529 | Ga0496125_0154525 | 3300048928 | Bacteria | 1570 |
| 1530 | Ga0496125_0207685 | 3300048928 | Bacteria | 1275 |
| 1531 | Ga0496126_0000397 | 3300048929 | Bacteria | 89305 |
| 1532 | Ga0496126_0000466 | 3300048929 | Bacteria | 80395 |
| 1533 | Ga0496126_0006480 | 3300048929 | Bacteria | 13035 |
| 1534 | Ga0496126_0009052 | 3300048929 | Bacteria | 10644 |
| 1535 | Ga0496126_0014179 | 3300048929 | Bacteria | 8067 |
| 1536 | Ga0496126_0016190 | 3300048929 | Bacteria | 7468 |
| 1537 | Ga0496126_0017014 | 3300048929 | Bacteria | 7255 |
| 1538 | Ga0496126_0037699 | 3300048929 | Bacteria | 4507 |
| 1539 | Ga0496126_0041380 | 3300048929 | Bacteria | 4265 |
| 1540 | Ga0496126_0048610 | 3300048929 | Bacteria | 3875 |
| 1541 | Ga0496126_0062027 | 3300048929 | Bacteria | 3355 |
| 1542 | Ga0496126_0065008 | 3300048929 | Bacteria | 3265 |
| 1543 | Ga0496126_0081582 | 3300048929 | Bacteria | 2859 |
| 1544 | Ga0496126_0091239 | 3300048929 | Bacteria | 2679 |
| 1545 | Ga0496126_0104723 | 3300048929 | Bacteria | 2471 |
| 1546 | Ga0496126_0112527 | 3300048929 | Bacteria | 2370 |
| 1547 | Ga0496126_0121887 | 3300048929 | Bacteria | 2260 |
| 1548 | Ga0496126_0138887 | 3300048929 | Bacteria | 2093 |
| 1549 | Ga0496126_0188274 | 3300048929 | Bacteria | 1749 |
| 1550 | Ga0496126_0197132 | 3300048929 | Bacteria | 1702 |
| 1551 | Ga0496126_0218447 | 3300048929 | Bacteria | 1602 |
| 1552 | Ga0496126_0270528 | 3300048929 | Bacteria | 1410 |
| 1553 | Ga0496126_0333399 | 3300048929 | Bacteria | 1244 |
| 1554 | Ga0496126_0421289 | 3300048929 | Bacteria | 1079 |
| 1555 | Ga0495678_000036 | 3300049459 | Bacteria | 198018 |
| 1556 | Ga0495678_006946 | 3300049459 | Bacteria | 5940 |
| 1557 | Ga0495678_008167 | 3300049459 | Bacteria | 5320 |
| 1558 | Ga0495678_025219 | 3300049459 | Bacteria | 2556 |
| 1559 | Ga0495678_026220 | 3300049459 | Bacteria | 2491 |
| 1560 | Ga0495678_059471 | 3300049459 | Bacteria | 1440 |
| 1561 | Ga0495682_0010828 | 3300049460 | Bacteria | 3516 |
| 1562 | Ga0495682_0020359 | 3300049460 | Bacteria | 2490 |
| 1563 | Ga0495682_0059803 | 3300049460 | Bacteria | 1376 |
| 1564 | Ga0501296_005724 | 3300049519 | Bacteria | 1394 |
| 1565 | Ga0501300_000849 | 3300049523 | Bacteria | 4654 |
| 1566 | Ga0501031_0006330 | 3300049568 | Bacteria | 7718 |
| 1567 | Ga0501031_0029630 | 3300049568 | Bacteria | 3570 |
| 1568 | Ga0501031_0051048 | 3300049568 | Bacteria | 2694 |
| 1569 | Ga0501032_0000088 | 3300049569 | Bacteria | 79913 |
| 1570 | Ga0501032_0004273 | 3300049569 | Bacteria | 10788 |
| 1571 | Ga0501032_0023586 | 3300049569 | Bacteria | 4247 |
| 1572 | Ga0501032_0029214 | 3300049569 | Bacteria | 3786 |
| 1573 | Ga0501032_0048350 | 3300049569 | Bacteria | 2872 |
| 1574 | Ga0501032_0049366 | 3300049569 | Bacteria | 2838 |
| 1575 | Ga0501033_0000724 | 3300049570 | Bacteria | 30292 |
| 1576 | Ga0501033_0004494 | 3300049570 | Bacteria | 11160 |
| 1577 | Ga0501033_0004740 | 3300049570 | Bacteria | 10881 |
| 1578 | Ga0501033_0038006 | 3300049570 | Bacteria | 3601 |
| 1579 | Ga0501033_0060004 | 3300049570 | Bacteria | 2807 |
| 1580 | Ga0501033_0090768 | 3300049570 | Bacteria | 2235 |
| 1581 | Ga0501033_0091683 | 3300049570 | Bacteria | 2223 |
| 1582 | Ga0501033_0259434 | 3300049570 | Bacteria | 1230 |
| 1583 | Ga0501033_0265378 | 3300049570 | Bacteria | 1214 |
| 1584 | Ga0501034_0000332 | 3300049571 | Bacteria | 82900 |
| 1585 | Ga0501034_0000413 | 3300049571 | Bacteria | 71861 |
| 1586 | Ga0501034_0046250 | 3300049571 | Bacteria | 4398 |
| 1587 | Ga0501034_0087844 | 3300049571 | Bacteria | 3108 |
| 1588 | Ga0501034_0133323 | 3300049571 | Bacteria | 2466 |
| 1589 | Ga0501034_0140445 | 3300049571 | Bacteria | 2395 |
| 1590 | Ga0501034_0163752 | 3300049571 | Bacteria | 2193 |
| 1591 | Ga0501034_0184492 | 3300049571 | Bacteria | 2050 |
| 1592 | Ga0501034_0291310 | 3300049571 | Bacteria | 1570 |
| 1593 | Ga0501034_0294452 | 3300049571 | Bacteria | 1560 |
| 1594 | Ga0501034_0409243 | 3300049571 | Bacteria | 1278 |
| 1595 | Ga0501036_0000233 | 3300049572 | Bacteria | 37220 |
| 1596 | Ga0501036_0019618 | 3300049572 | Bacteria | 5676 |
| 1597 | Ga0501036_0056239 | 3300049572 | Bacteria | 3333 |
| 1598 | Ga0501037_0000242 | 3300049573 | Bacteria | 46822 |
| 1599 | Ga0501037_0000421 | 3300049573 | Bacteria | 35090 |
| 1600 | Ga0501037_0001825 | 3300049573 | Bacteria | 15467 |
| 1601 | Ga0501037_0144712 | 3300049573 | Bacteria | 1700 |
| 1602 | Ga0501037_0180980 | 3300049573 | Bacteria | 1495 |
| 1603 | Ga0501038_0000049 | 3300049574 | Bacteria | 100279 |
| 1604 | Ga0501038_0006856 | 3300049574 | Bacteria | 10523 |
| 1605 | Ga0501038_0097772 | 3300049574 | Bacteria | 2448 |
| 1606 | Ga0501038_0152963 | 3300049574 | Bacteria | 1880 |
| 1607 | Ga0501039_0002402 | 3300049575 | Bacteria | 13924 |
| 1608 | Ga0501039_0142671 | 3300049575 | Bacteria | 1881 |
| 1609 | Ga0501043_0000101 | 3300049579 | Bacteria | 78983 |
| 1610 | Ga0501043_0000440 | 3300049579 | Bacteria | 37461 |
| 1611 | Ga0501043_0000740 | 3300049579 | Bacteria | 28916 |
| 1612 | Ga0501043_0013981 | 3300049579 | Bacteria | 6281 |
| 1613 | Ga0501043_0044868 | 3300049579 | Bacteria | 3476 |
| 1614 | Ga0501043_0115632 | 3300049579 | Bacteria | 2105 |
| 1615 | Ga0501043_0186067 | 3300049579 | Bacteria | 1617 |
| 1616 | Ga0501043_0227759 | 3300049579 | Bacteria | 1440 |
| 1617 | Ga0501046_0000135 | 3300049580 | Bacteria | 79084 |
| 1618 | Ga0501046_0006266 | 3300049580 | Bacteria | 10552 |
| 1619 | Ga0501046_0008083 | 3300049580 | Bacteria | 9194 |
| 1620 | Ga0501046_0022355 | 3300049580 | Bacteria | 5209 |
| 1621 | Ga0501047_0000173 | 3300049581 | Bacteria | 79071 |
| 1622 | Ga0501047_0000875 | 3300049581 | Bacteria | 30740 |
| 1623 | Ga0501047_0005968 | 3300049581 | Bacteria | 11448 |
| 1624 | Ga0501047_0009133 | 3300049581 | Bacteria | 9361 |
| 1625 | Ga0501047_0031398 | 3300049581 | Bacteria | 5123 |
| 1626 | Ga0501047_0160289 | 3300049581 | Bacteria | 2121 |
| 1627 | Ga0501047_0431125 | 3300049581 | Bacteria | 1149 |
| 1628 | Ga0501047_0491545 | 3300049581 | Bacteria | 1054 |
| 1629 | Ga0501048_0005053 | 3300049582 | Bacteria | 10056 |
| 1630 | Ga0501048_0020879 | 3300049582 | Bacteria | 4797 |
| 1631 | Ga0501048_0208119 | 3300049582 | Bacteria | 1387 |
| 1632 | Ga0501068_0029721 | 3300049584 | Bacteria | 3238 |
| 1633 | Ga0501069_0000017 | 3300049585 | Bacteria | 141492 |
| 1634 | Ga0501069_0021804 | 3300049585 | Bacteria | 3479 |
| 1635 | Ga0501069_0086231 | 3300049585 | Bacteria | 1772 |
| 1636 | Ga0501070_0007767 | 3300049586 | Bacteria | 9093 |
| 1637 | Ga0501070_0010286 | 3300049586 | Bacteria | 7911 |
| 1638 | Ga0501070_0025357 | 3300049586 | Bacteria | 4973 |
| 1639 | Ga0501070_0027733 | 3300049586 | Bacteria | 4751 |
| 1640 | Ga0501070_0040998 | 3300049586 | Bacteria | 3857 |
| 1641 | Ga0501070_0127996 | 3300049586 | Bacteria | 2098 |
| 1642 | Ga0501070_0235240 | 3300049586 | Bacteria | 1500 |
| 1643 | Ga0501071_0031427 | 3300049587 | Bacteria | 3763 |
| 1644 | Ga0501072_0054390 | 3300049588 | Bacteria | 3153 |
| 1645 | Ga0501072_0197180 | 3300049588 | Bacteria | 1605 |
| 1646 | Ga0501073_0000112 | 3300049589 | Bacteria | 52280 |
| 1647 | Ga0501073_0117617 | 3300049589 | Bacteria | 1842 |
| 1648 | Ga0501074_0000610 | 3300049590 | Bacteria | 22218 |
| 1649 | Ga0501074_0006273 | 3300049590 | Bacteria | 8584 |
| 1650 | Ga0501074_0120179 | 3300049590 | Bacteria | 1879 |
| 1651 | Ga0501206_009003 | 3300049653 | Bacteria | 1324 |
| 1652 | Ga0501211_005232 | 3300049658 | Bacteria | 1303 |
| 1653 | Ga0501227_036024 | 3300049665 | Bacteria | 1207 |
| 1654 | Ga0501235_004940 | 3300049669 | Bacteria | 2890 |
| 1655 | Ga0501249_010268 | 3300049679 | Bacteria | 1956 |
| 1656 | Ga0501253_004339 | 3300049683 | Bacteria | 1783 |
| 1657 | Ga0501257_023167 | 3300049686 | Bacteria | 1472 |
| 1658 | Ga0501221_006153 | 3300049704 | Bacteria | 2023 |
| 1659 | Ga0501225_0017431 | 3300049705 | Bacteria | 1993 |
| 1660 | Ga0501229_005095 | 3300049706 | Bacteria | 1605 |
| 1661 | Ga0501079_0003748 | 3300049741 | Bacteria | 11218 |
| 1662 | Ga0501080_0000343 | 3300049742 | Bacteria | 35792 |
| 1663 | Ga0501080_0006075 | 3300049742 | Bacteria | 10826 |
| 1664 | Ga0501080_0177732 | 3300049742 | Bacteria | 1960 |
| 1665 | Ga0501083_0000724 | 3300049744 | Bacteria | 21483 |
| 1666 | Ga0501083_0003168 | 3300049744 | Bacteria | 11450 |
| 1667 | Ga0501262_000189 | 3300049759 | Bacteria | 7646 |
| 1668 | Ga0501265_002613 | 3300049762 | Bacteria | 2041 |
| 1669 | Ga0501280_000460 | 3300049776 | Bacteria | 9712 |
| 1670 | Ga0501035_0000101 | 3300049822 | Bacteria | 106949 |
| 1671 | Ga0501035_0001854 | 3300049822 | Bacteria | 21280 |
| 1672 | Ga0501035_0003169 | 3300049822 | Bacteria | 15796 |
| 1673 | Ga0501035_0018035 | 3300049822 | Bacteria | 6504 |
| 1674 | Ga0501035_0296486 | 3300049822 | Bacteria | 1363 |
| 1675 | Ga0501035_0343325 | 3300049822 | Bacteria | 1250 |
| 1676 | Ga0501044_0000010 | 3300049823 | Bacteria | 260121 |
| 1677 | Ga0501044_0000182 | 3300049823 | Bacteria | 78052 |
| 1678 | Ga0501044_0000916 | 3300049823 | Bacteria | 35511 |
| 1679 | Ga0501044_0020484 | 3300049823 | Bacteria | 7062 |
| 1680 | Ga0501044_0025590 | 3300049823 | Bacteria | 6256 |
| 1681 | Ga0501044_0063871 | 3300049823 | Bacteria | 3759 |
| 1682 | Ga0501044_0096823 | 3300049823 | Bacteria | 2972 |
| 1683 | Ga0501044_0115924 | 3300049823 | Bacteria | 2684 |
| 1684 | Ga0501044_0133026 | 3300049823 | Bacteria | 2480 |
| 1685 | Ga0501044_0321189 | 3300049823 | Bacteria | 1472 |
| 1686 | Ga0501045_0086916 | 3300049824 | Bacteria | 2308 |
| 1687 | Ga0501045_0131924 | 3300049824 | Bacteria | 1857 |
| 1688 | Ga0501045_0230577 | 3300049824 | Bacteria | 1378 |
| 1689 | nmdc:mga03683_33107_c1 | 3300050489 | Bacteria | 2082 |
| 1690 | nmdc:mga03683_41928_c2 | 3300050489 | Bacteria | 1348 |
| 1691 | nmdc:mga03683_64361_c1 | 3300050489 | Bacteria | 1556 |
| 1692 | nmdc:mga00v17_104836_c1 | 3300050491 | Bacteria | 1788 |
| 1693 | nmdc:mga00v17_115762_c1 | 3300050491 | Bacteria | 1704 |
| 1694 | nmdc:mga00v17_50950_c1 | 3300050491 | Bacteria | 2517 |
| 1695 | nmdc:mga0yw44_3131_c1 | 3300050492 | Bacteria | 7259 |
| 1696 | nmdc:mga0yw44_34788_c1 | 3300050492 | Bacteria | 2955 |
| 1697 | nmdc:mga0yw44_4219_c1 | 3300050492 | Bacteria | 6543 |
| 1698 | nmdc:mga0yw44_43205_c1 | 3300050492 | Bacteria | 2690 |
| 1699 | nmdc:mga0k408_13536_c2 | 3300050493 | Bacteria | 2967 |
| 1700 | nmdc:mga0k408_214466_c1 | 3300050493 | Bacteria | 1149 |
| 1701 | nmdc:mga0k408_223182_c1 | 3300050493 | Bacteria | 1125 |
| 1702 | nmdc:mga0k408_47167_c1 | 3300050493 | Bacteria | 2490 |
| 1703 | nmdc:mga0k408_61822_c1 | 3300050493 | Bacteria | 2177 |
| 1704 | nmdc:mga0k408_65660_c2 | 3300050493 | Bacteria | 1531 |
| 1705 | nmdc:mga0k408_6933_c1 | 3300050493 | Bacteria | 6042 |
| 1706 | nmdc:mga06z11_77649_c1 | 3300050494 | Bacteria | 1773 |
| 1707 | nmdc:mga04h51_2456_c1 | 3300050495 | Bacteria | 4404 |
| 1708 | nmdc:mga04h51_26269_c1 | 3300050495 | Bacteria | 1799 |
| 1709 | nmdc:mga07m45_127312_c1 | 3300050496 | Bacteria | 1473 |
| 1710 | nmdc:mga07m45_146317_c1 | 3300050496 | Bacteria | 1370 |
| 1711 | nmdc:mga07m45_148252_c1 | 3300050496 | Bacteria | 1360 |
| 1712 | nmdc:mga07m45_21735_c1 | 3300050496 | Bacteria | 3497 |
| 1713 | nmdc:mga07m45_2857_c1 | 3300050496 | Bacteria | 8178 |
| 1714 | nmdc:mga07m45_32439_c1 | 3300050496 | Bacteria | 2897 |
| 1715 | nmdc:mga07m45_700_c1 | 3300050496 | Bacteria | 14224 |
| 1716 | nmdc:mga07m45_72475_c1 | 3300050496 | Bacteria | 1961 |
| 1717 | nmdc:mga05p37_510010_c1 | 3300050507 | Bacteria | 1378 |
| 1718 | nmdc:mga08y16_713892_c1 | 3300050511 | Bacteria | 1001 |
| 1719 | nmdc:mga0n895_2560_c1 | 3300050512 | Bacteria | 14260 |
| 1720 | nmdc:mga0rr50_4914_c1 | 3300050513 | Bacteria | 7910 |
| 1721 | nmdc:mga0a205_269570_c1 | 3300050515 | Bacteria | 1579 |
| 1722 | nmdc:mga0sz30_13236_c1 | 3300050516 | Bacteria | 3227 |
| 1723 | nmdc:mga0sz30_1854_c1 | 3300050516 | Bacteria | 7525 |
| 1724 | nmdc:mga0sz30_20265_c1 | 3300050516 | Bacteria | 2442 |
| 1725 | Ga0495601_0100329 | 3300053077 | Bacteria | 1869 |
| 1726 | Ga0495601_0137133 | 3300053077 | Bacteria | 1595 |
| 1727 | Ga0495601_0225575 | 3300053077 | Bacteria | 1224 |
| 1728 | Ga0495612_0024087 | 3300053078 | Bacteria | 2444 |
| 1729 | Ga0500635_0000003 | 3300053080 | Bacteria | 216927 |
| 1730 | Ga0500635_0005930 | 3300053080 | Bacteria | 3241 |
| 1731 | Ga0495595_0000394 | 3300053084 | Bacteria | 16586 |
| 1732 | Ga0495595_0043698 | 3300053084 | Bacteria | 2056 |
| 1733 | Ga0495619_0001260 | 3300053085 | Bacteria | 16606 |
| 1734 | Ga0495619_0075414 | 3300053085 | Bacteria | 2263 |
| 1735 | Ga0500578_0000064 | 3300053086 | Bacteria | 117170 |
| 1736 | Ga0500578_0077167 | 3300053086 | Bacteria | 2121 |
| 1737 | Ga0500578_0088708 | 3300053086 | Bacteria | 1964 |
| 1738 | Ga0500643_000042 | 3300053087 | Bacteria | 158933 |
| 1739 | Ga0500581_016873 | 3300053089 | Bacteria | 3661 |
| 1740 | Ga0500646_0003505 | 3300053090 | Bacteria | 4024 |
| 1741 | Ga0500583_0041114 | 3300053092 | Bacteria | 2098 |
| 1742 | Ga0500651_0000751 | 3300053093 | Bacteria | 15835 |
| 1743 | Ga0500651_0030895 | 3300053093 | Bacteria | 3372 |
| 1744 | Ga0500651_0039450 | 3300053093 | Bacteria | 2974 |
| 1745 | Ga0500566_0000621 | 3300053094 | Bacteria | 19875 |
| 1746 | Ga0500566_0002553 | 3300053094 | Bacteria | 10831 |
| 1747 | Ga0500566_0005911 | 3300053094 | Bacteria | 7277 |
| 1748 | Ga0500566_0005990 | 3300053094 | Bacteria | 7226 |
| 1749 | Ga0500566_0007233 | 3300053094 | Bacteria | 6576 |
| 1750 | Ga0500554_024840 | 3300053102 | Bacteria | 1702 |
| 1751 | Ga0500555_007469 | 3300053103 | Bacteria | 3105 |
| 1752 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 1753 | Ga0500556_0000747 | 3300053104 | Bacteria | 19402 |
| 1754 | Ga0500556_0001028 | 3300053104 | Bacteria | 14579 |
| 1755 | Ga0500557_000006 | 3300053105 | Bacteria | 141252 |
| 1756 | Ga0500562_010400 | 3300053108 | Bacteria | 2358 |
| 1757 | Ga0500562_015423 | 3300053108 | Bacteria | 1959 |
| 1758 | Ga0500569_016776 | 3300053109 | Bacteria | 1861 |
| 1759 | Ga0500569_064462 | 3300053109 | Bacteria | 1139 |
| 1760 | Ga0500572_000226 | 3300053111 | Bacteria | 19903 |
| 1761 | Ga0500572_006955 | 3300053111 | Bacteria | 2605 |
| 1762 | Ga0500572_010015 | 3300053111 | Bacteria | 2255 |
| 1763 | Ga0500592_000296 | 3300053116 | Bacteria | 8664 |
| 1764 | Ga0500595_009264 | 3300053119 | Bacteria | 3980 |
| 1765 | Ga0500595_013051 | 3300053119 | Bacteria | 3191 |
| 1766 | Ga0500595_026070 | 3300053119 | Bacteria | 2018 |
| 1767 | Ga0500608_003307 | 3300053122 | Bacteria | 6019 |
| 1768 | Ga0500608_046152 | 3300053122 | Bacteria | 2093 |
| 1769 | Ga0500608_048783 | 3300053122 | Bacteria | 2035 |
| 1770 | Ga0500618_000025 | 3300053125 | Bacteria | 150583 |
| 1771 | Ga0500618_007682 | 3300053125 | Bacteria | 3056 |
| 1772 | Ga0500642_0000110 | 3300053130 | Bacteria | 38826 |
| 1773 | Ga0500642_0000686 | 3300053130 | Bacteria | 10021 |
| 1774 | Ga0500642_0003964 | 3300053130 | Bacteria | 4565 |
| 1775 | Ga0500642_0064108 | 3300053130 | Bacteria | 1658 |
| 1776 | Ga0500652_013163 | 3300053131 | Bacteria | 2922 |
| 1777 | Ga0500652_136860 | 3300053131 | Bacteria | 1020 |
| 1778 | Ga0500652_154497 | 3300053131 | Bacteria | 951 |
| 1779 | Ga0500658_0036906 | 3300053134 | Bacteria | 1941 |
| 1780 | Ga0500559_0000198 | 3300053136 | Bacteria | 47902 |
| 1781 | Ga0500559_0005770 | 3300053136 | Bacteria | 5646 |
| 1782 | Ga0500559_0009515 | 3300053136 | Bacteria | 4199 |
| 1783 | Ga0500559_0052706 | 3300053136 | Bacteria | 1799 |
| 1784 | Ga0500559_0068411 | 3300053136 | Bacteria | 1595 |
| 1785 | Ga0500559_0073163 | 3300053136 | Bacteria | 1546 |
| 1786 | Ga0500568_0000262 | 3300053139 | Bacteria | 44734 |
| 1787 | Ga0500568_0001410 | 3300053139 | Bacteria | 15597 |
| 1788 | Ga0500568_0009265 | 3300053139 | Bacteria | 4691 |
| 1789 | Ga0500568_0090095 | 3300053139 | Bacteria | 1157 |
| 1790 | Ga0500568_0104083 | 3300053139 | Bacteria | 1064 |
| 1791 | Ga0500573_0062473 | 3300053140 | Bacteria | 2132 |
| 1792 | Ga0500586_001269 | 3300053145 | Bacteria | 5291 |
| 1793 | Ga0500590_054917 | 3300053148 | Bacteria | 2016 |
| 1794 | Ga0500590_127444 | 3300053148 | Bacteria | 1183 |
| 1795 | Ga0500603_001570 | 3300053150 | Bacteria | 5163 |
| 1796 | Ga0500604_0009060 | 3300053151 | Bacteria | 2647 |
| 1797 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 1798 | Ga0500616_0082183 | 3300053153 | Bacteria | 1616 |
| 1799 | Ga0500622_0000390 | 3300053156 | Bacteria | 42468 |
| 1800 | Ga0500622_0000647 | 3300053156 | Bacteria | 31120 |
| 1801 | Ga0500622_0001402 | 3300053156 | Bacteria | 19418 |
| 1802 | Ga0500622_0006944 | 3300053156 | Bacteria | 6481 |
| 1803 | Ga0500622_0011016 | 3300053156 | Bacteria | 4934 |
| 1804 | Ga0500622_0020165 | 3300053156 | Bacteria | 3540 |
| 1805 | Ga0500627_0123460 | 3300053158 | Bacteria | 1168 |
| 1806 | Ga0500630_002647 | 3300053159 | Bacteria | 8611 |
| 1807 | Ga0500634_0103553 | 3300053161 | Bacteria | 1419 |
| 1808 | Ga0500638_046459 | 3300053162 | Bacteria | 2104 |
| 1809 | Ga0500639_000029 | 3300053163 | Bacteria | 76014 |
| 1810 | Ga0500636_0000009 | 3300053177 | Bacteria | 155504 |
| 1811 | Ga0500636_0000711 | 3300053177 | Bacteria | 17869 |
| 1812 | Ga0500636_0100958 | 3300053177 | Bacteria | 1640 |
| 1813 | Ga0500636_0130136 | 3300053177 | Bacteria | 1402 |
| 1814 | Ga0500637_0000707 | 3300053178 | Bacteria | 13299 |
| 1815 | Ga0500637_0078591 | 3300053178 | Bacteria | 1904 |
| 1816 | Ga0500637_0084706 | 3300053178 | Bacteria | 1833 |
| 1817 | Ga0500637_0129457 | 3300053178 | Bacteria | 1464 |
| 1818 | Ga0500625_000351 | 3300053729 | Bacteria | 11670 |
| 1819 | Ga0500645_001142 | 3300053730 | Bacteria | 14384 |
| 1820 | Ga0500645_012656 | 3300053730 | Bacteria | 2724 |
| 1821 | Ga0500645_022107 | 3300053730 | Bacteria | 1959 |
| 1822 | Ga0500645_039130 | 3300053730 | Bacteria | 1406 |
| 1823 | Ga0500609_002203 | 3300053731 | Bacteria | 2784 |
| 1824 | Ga0500609_006122 | 3300053731 | Bacteria | 1640 |
| 1825 | Ga0500596_005177 | 3300053735 | Bacteria | 2321 |
| 1826 | Ga0500601_001469 | 3300053737 | Bacteria | 2585 |
| 1827 | Ga0501084_0041419 | 3300054114 | Bacteria | 3854 |
| 1828 | Ga0500661_009777 | 3300055283 | Bacteria | 1751 |
| 1829 | Ga0590074_025951 | 3300059423 | Bacteria | 1023 |
| 1830 | Ga0590077_031064 | 3300059426 | Bacteria | 1166 |
| 1831 | Ga0587084_002539 | 3300059477 | Bacteria | 1905 |
| 1832 | Ga0587077_000359 | 3300059493 | Bacteria | 3671 |
| 1833 | Ga0587077_003655 | 3300059493 | Bacteria | 1954 |
| 1834 | Ga0587076_010795 | 3300059645 | Bacteria | 1328 |
| 1835 | Ga0501082_0002561 | 3300060353 | Bacteria | 15915 |
| 1836 | Ga0501082_0233918 | 3300060353 | Bacteria | 1599 |
| 1837 | Ga0501082_0253642 | 3300060353 | Bacteria | 1531 |
| 1838 | Ga0501082_0477300 | 3300060353 | Bacteria | 1090 |
| 1839 | Ga0466962_0005798 | 3300061719 | Bacteria | 5932 |
| 1840 | Ga0466962_0027799 | 3300061719 | Bacteria | 2712 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041456 | Ga0451795_0009169 | Ga0451795_0009169_10_819 | 234 |
| 2 | 3300041458 | Ga0451798_0710666 | Ga0451798_0710666_10_819 | 234 |
| 3 | 3300047443 | Ga0495687_000664 | Ga0495687_000664_1582_2463 | 251 |
| 4 | iso_pu_bacteria | 8019586578 | 8019592847 | 251 |
| 5 | 3300005338 | Ga0068868_100077236 | Ga0068868_1000772362 | 252 |
| 6 | 3300005327 | Ga0070658_10139932 | Ga0070658_101399322 | 253 |
| 7 | 3300005328 | Ga0070676_10050547 | Ga0070676_100505471 | 253 |
| 8 | 3300005337 | Ga0070682_100128666 | Ga0070682_1001286662 | 253 |
| 9 | 3300005367 | Ga0070667_100311231 | Ga0070667_1003112312 | 253 |
| 10 | 3300005547 | Ga0070693_100123400 | Ga0070693_1001234002 | 253 |
| 11 | 3300005577 | Ga0068857_100570279 | Ga0068857_1005702791 | 253 |
| 12 | 3300005616 | Ga0068852_100153236 | Ga0068852_1001532362 | 253 |
| 13 | 3300006237 | Ga0097621_100209497 | Ga0097621_1002094972 | 253 |
| 14 | 3300006353 | Ga0075370_10228650 | Ga0075370_102286501 | 253 |
| 15 | 3300009176 | Ga0105242_10551563 | Ga0105242_105515631 | 253 |
| 16 | 3300009545 | Ga0105237_10005231 | Ga0105237_100052315 | 253 |
| 17 | 3300010375 | Ga0105239_10093907 | Ga0105239_100939073 | 253 |
| 18 | 3300013105 | Ga0157369_10093152 | Ga0157369_100931522 | 253 |
| 19 | 3300025908 | Ga0207643_10043732 | Ga0207643_100437322 | 253 |
| 20 | 3300025914 | Ga0207671_10025871 | Ga0207671_100258712 | 253 |
| 21 | 3300026116 | Ga0207674_10076492 | Ga0207674_100764925 | 253 |
| 22 | 3300037068 | Ga0373925_0499995 | Ga0373925_0499995_11_808 | 253 |
| 23 | 3300046460 | Ga0495638_0173274 | Ga0495638_0173274_428_1225 | 253 |
| 24 | 3300046523 | Ga0495644_0159890 | Ga0495644_0159890_53_850 | 253 |
| 25 | 3300046542 | Ga0495597_0097453 | Ga0495597_0097453_15_884 | 253 |
| 26 | 3300046660 | Ga0495625_0012781 | Ga0495625_0012781_3883_4764 | 253 |
| 27 | 3300046694 | Ga0495649_0058833 | Ga0495649_0058833_55_936 | 253 |
| 28 | 3300047443 | Ga0495687_022811 | Ga0495687_022811_1532_2413 | 253 |
| 29 | 3300047443 | Ga0495687_043519 | Ga0495687_043519_587_1468 | 253 |
| 30 | 3300048907 | Ga0496104_0408223 | Ga0496104_0408223_10_807 | 253 |
| 31 | 3300048922 | Ga0496119_0204069 | Ga0496119_0204069_13_882 | 253 |
| 32 | 3300050493 | nmdc:mga0k408_47167_c1 | nmdc:mga0k408_47167_c1_575_1456 | 253 |
| 33 | 3300050496 | nmdc:mga07m45_146317_c1 | nmdc:mga07m45_146317_c1_302_1183 | 253 |
| 34 | 3300050496 | nmdc:mga07m45_72475_c1 | nmdc:mga07m45_72475_c1_567_1448 | 253 |
| 35 | 3300053148 | Ga0500590_127444 | Ga0500590_127444_15_812 | 253 |
| 36 | 3300053158 | Ga0500627_0123460 | Ga0500627_0123460_361_1158 | 253 |
| 37 | 3300036401 | Ga0373937_0188612 | Ga0373937_0188612_632_1516 | 255 |
| 38 | 3300053730 | Ga0500645_022107 | Ga0500645_022107_578_1468 | 255 |
| 39 | 3300005467 | Ga0070706_100060692 | Ga0070706_1000606923 | 256 |
| 40 | 3300005468 | Ga0070707_100037612 | Ga0070707_1000376124 | 256 |
| 41 | 3300006038 | Ga0075365_10224057 | Ga0075365_102240572 | 256 |
| 42 | 3300006195 | Ga0075366_10147616 | Ga0075366_101476161 | 256 |
| 43 | 3300006353 | Ga0075370_10036798 | Ga0075370_100367983 | 256 |
| 44 | 3300025910 | Ga0207684_10015383 | Ga0207684_100153834 | 256 |
| 45 | 3300025922 | Ga0207646_10205293 | Ga0207646_102052932 | 256 |
| 46 | 3300050496 | nmdc:mga07m45_21735_c1 | nmdc:mga07m45_21735_c1_2463_3344 | 256 |
| 47 | 3300005331 | Ga0070670_100114378 | Ga0070670_1001143782 | 257 |
| 48 | 3300014325 | Ga0163163_10519134 | Ga0163163_105191342 | 257 |
| 49 | 3300025925 | Ga0207650_10027888 | Ga0207650_100278884 | 257 |
| 50 | 3300046455 | Ga0495603_0029842 | Ga0495603_0029842_2469_3254 | 258 |
| 51 | 3300046530 | Ga0495654_0000407 | Ga0495654_0000407_16329_17114 | 258 |
| 52 | 3300002773 | JGI25152J39213_1003372 | JGI25152J39213_10033722 | 260 |
| 53 | 3300002774 | JGI25150J39212_1016369 | JGI25150J39212_10163692 | 260 |
| 54 | 3300003215 | JGI25153J46596_10004494 | JGI25153J46596_100044946 | 260 |
| 55 | 3300003771 | Ga0055526_1008436 | Ga0055526_10084364 | 260 |
| 56 | 3300003791 | Ga0055530_10006660 | Ga0055530_100066605 | 260 |
| 57 | 3300005262 | Ga0065165_1002164 | Ga0065165_10021647 | 260 |
| 58 | 3300025245 | Ga0207425_1000789 | Ga0207425_100078912 | 260 |
| 59 | 3300025258 | Ga0209129_1000212 | Ga0209129_100021227 | 260 |
| 60 | 3300025273 | Ga0209673_1028549 | Ga0209673_10285492 | 260 |
| 61 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024169 | 260 |
| 62 | 3300025297 | Ga0209758_1000558 | Ga0209758_100055859 | 260 |
| 63 | 3300025298 | Ga0209050_1002504 | Ga0209050_10025047 | 260 |
| 64 | 3300025960 | Ga0207651_10040199 | Ga0207651_100401994 | 260 |
| 65 | 3300028794 | Ga0307515_10002738 | Ga0307515_100027382 | 260 |
| 66 | 3300035724 | Ga0373933_0369114 | Ga0373933_0369114_122_910 | 260 |
| 67 | 3300048921 | Ga0496118_0143524 | Ga0496118_0143524_12_902 | 260 |
| 68 | 3300048927 | Ga0496124_0406155 | Ga0496124_0406155_115_933 | 260 |
| 69 | 3300049519 | Ga0501296_005724 | Ga0501296_005724_50_934 | 260 |
| 70 | 3300049523 | Ga0501300_000849 | Ga0501300_000849_2123_3007 | 260 |
| 71 | 3300049658 | Ga0501211_005232 | Ga0501211_005232_190_1074 | 260 |
| 72 | 3300049704 | Ga0501221_006153 | Ga0501221_006153_461_1345 | 260 |
| 73 | 3300049706 | Ga0501229_005095 | Ga0501229_005095_166_1050 | 260 |
| 74 | 3300053078 | Ga0495612_0024087 | Ga0495612_0024087_1614_2432 | 260 |
| 75 | 3300041452 | Ga0451793_0212439 | Ga0451793_0212439_87_977 | 261 |
| 76 | 3300053156 | Ga0500622_0000390 | Ga0500622_0000390_36_926 | 261 |
| 77 | 3300001989 | JGI24739J22299_10047227 | JGI24739J22299_100472272 | 262 |
| 78 | 3300044901 | Ga0466960_0014481 | Ga0466960_0014481_66_959 | 262 |
| 79 | 3300053086 | Ga0500578_0000064 | Ga0500578_0000064_85639_86529 | 262 |
| 80 | 3300005434 | Ga0070709_10000380 | Ga0070709_1000038010 | 263 |
| 81 | 3300005435 | Ga0070714_100187876 | Ga0070714_1001878762 | 263 |
| 82 | 3300005437 | Ga0070710_10001211 | Ga0070710_1000121110 | 263 |
| 83 | 3300006163 | Ga0070715_10088518 | Ga0070715_100885181 | 263 |
| 84 | 3300006173 | Ga0070716_100119113 | Ga0070716_1001191132 | 263 |
| 85 | 3300025915 | Ga0207693_10044139 | Ga0207693_100441393 | 263 |
| 86 | 3300025916 | Ga0207663_10096789 | Ga0207663_100967892 | 263 |
| 87 | 3300025939 | Ga0207665_10047803 | Ga0207665_100478033 | 263 |
| 88 | 3300039437 | Ga0436365_0622105 | Ga0436365_0622105_5254_6156 | 263 |
| 89 | 3300039453 | Ga0436362_0974760 | Ga0436362_0974760_1432_2334 | 263 |
| 90 | 3300009147 | Ga0114129_10595650 | Ga0114129_105956502 | 265 |
| 91 | 3300006195 | Ga0075366_10229611 | Ga0075366_102296111 | 267 |
| 92 | 3300031456 | Ga0307513_10037114 | Ga0307513_100371144 | 267 |
| 93 | 3300031730 | Ga0307516_10001622 | Ga0307516_1000162214 | 267 |
| 94 | 3300046660 | Ga0495625_0013758 | Ga0495625_0013758_5034_5918 | 267 |
| 95 | 3300047472 | Ga0495686_0030481 | Ga0495686_0030481_329_1213 | 267 |
| 96 | 3300049653 | Ga0501206_009003 | Ga0501206_009003_281_1168 | 267 |
| 97 | 3300049686 | Ga0501257_023167 | Ga0501257_023167_130_1017 | 267 |
| 98 | 3300049762 | Ga0501265_002613 | Ga0501265_002613_87_968 | 267 |
| 99 | 3300050493 | nmdc:mga0k408_65660_c2 | nmdc:mga0k408_65660_c2_616_1500 | 267 |
| 100 | iso_pu_bacteria | 8016583857 | 8016595037 | 267 |
| 101 | 3300005293 | Ga0065715_10141072 | Ga0065715_101410722 | 268 |
| 102 | 3300005331 | Ga0070670_100082747 | Ga0070670_1000827473 | 268 |
| 103 | 3300005353 | Ga0070669_100036727 | Ga0070669_1000367274 | 268 |
| 104 | 3300005354 | Ga0070675_100068234 | Ga0070675_1000682342 | 268 |
| 105 | 3300005356 | Ga0070674_100007372 | Ga0070674_1000073727 | 268 |
| 106 | 3300005356 | Ga0070674_100027773 | Ga0070674_1000277734 | 268 |
| 107 | 3300005364 | Ga0070673_100223048 | Ga0070673_1002230482 | 268 |
| 108 | 3300005367 | Ga0070667_100078809 | Ga0070667_1000788093 | 268 |
| 109 | 3300005459 | Ga0068867_100006086 | Ga0068867_1000060861 | 268 |
| 110 | 3300005459 | Ga0068867_100323987 | Ga0068867_1003239871 | 268 |
| 111 | 3300005543 | Ga0070672_100006495 | Ga0070672_1000064952 | 268 |
| 112 | 3300005618 | Ga0068864_100115854 | Ga0068864_1001158542 | 268 |
| 113 | 3300013308 | Ga0157375_10123645 | Ga0157375_101236451 | 268 |
| 114 | 3300014969 | Ga0157376_10483021 | Ga0157376_104830211 | 268 |
| 115 | 3300025925 | Ga0207650_10003617 | Ga0207650_100036173 | 268 |
| 116 | 3300025926 | Ga0207659_10004256 | Ga0207659_100042562 | 268 |
| 117 | 3300025937 | Ga0207669_10003348 | Ga0207669_100033483 | 268 |
| 118 | 3300025940 | Ga0207691_10015888 | Ga0207691_100158885 | 268 |
| 119 | 3300025972 | Ga0207668_10192054 | Ga0207668_101920542 | 268 |
| 120 | 3300026023 | Ga0207677_10009064 | Ga0207677_100090643 | 268 |
| 121 | 3300026089 | Ga0207648_10034250 | Ga0207648_100342504 | 268 |
| 122 | 3300026095 | Ga0207676_10175434 | Ga0207676_101754342 | 268 |
| 123 | 3300031548 | Ga0307408_100091004 | Ga0307408_1000910042 | 268 |
| 124 | 3300031731 | Ga0307405_10007622 | Ga0307405_100076222 | 268 |
| 125 | 3300031901 | Ga0307406_10003755 | Ga0307406_100037553 | 268 |
| 126 | 3300031903 | Ga0307407_10027945 | Ga0307407_100279454 | 268 |
| 127 | 3300031995 | Ga0307409_100002839 | Ga0307409_1000028396 | 268 |
| 128 | 3300032002 | Ga0307416_100047679 | Ga0307416_1000476793 | 268 |
| 129 | 3300032004 | Ga0307414_10040421 | Ga0307414_100404214 | 268 |
| 130 | 3300032126 | Ga0307415_100008136 | Ga0307415_1000081365 | 268 |
| 131 | 3300005983 | Ga0081540_1013750 | Ga0081540_10137502 | 269 |
| 132 | iso_pu_bacteria | 8019668869 | 8019670035 | 269 |
| 133 | 3300048922 | Ga0496119_0000721 | Ga0496119_0000721_42596_43486 | 270 |
| 134 | 3300048925 | Ga0496122_0001180 | Ga0496122_0001180_10011_10901 | 270 |
| 135 | 3300048926 | Ga0496123_0002949 | Ga0496123_0002949_9125_10015 | 270 |
| 136 | 3300053104 | Ga0500556_0000747 | Ga0500556_0000747_17585_18475 | 270 |
| 137 | iso_pu_bacteria | 2917554339 | 2917558846 | 270 |
| 138 | iso_pu_bacteria | 2917554339 | 2917558853 | 270 |
| 139 | 3300046524 | Ga0495648_0096164 | Ga0495648_0096164_10_837 | 272 |
| 140 | 3300005354 | Ga0070675_100042193 | Ga0070675_1000421934 | 273 |
| 141 | 3300005535 | Ga0070684_100515146 | Ga0070684_1005151462 | 273 |
| 142 | 3300007265 | Ga0099794_10027843 | Ga0099794_100278432 | 273 |
| 143 | 3300049586 | Ga0501070_0040998 | Ga0501070_0040998_10_867 | 273 |
| 144 | 3300027671 | Ga0209588_1060223 | Ga0209588_10602232 | 274 |
| 145 | 3300009545 | Ga0105237_10175131 | Ga0105237_101751312 | 275 |
| 146 | 3300025914 | Ga0207671_10083206 | Ga0207671_100832062 | 275 |
| 147 | 3300005365 | Ga0070688_100060348 | Ga0070688_1000603482 | 276 |
| 148 | 3300031616 | Ga0307508_10032796 | Ga0307508_100327964 | 276 |
| 149 | 3300031730 | Ga0307516_10001494 | Ga0307516_100014942 | 276 |
| 150 | 3300031901 | Ga0307406_10029649 | Ga0307406_100296492 | 276 |
| 151 | 3300036401 | Ga0373937_0140600 | Ga0373937_0140600_1372_2238 | 276 |
| 152 | 3300037068 | Ga0373925_0089848 | Ga0373925_0089848_827_1693 | 276 |
| 153 | 3300048928 | Ga0496125_0086597 | Ga0496125_0086597_1446_2279 | 276 |
| 154 | 3300049569 | Ga0501032_0029214 | Ga0501032_0029214_2414_3280 | 276 |
| 155 | 3300049570 | Ga0501033_0060004 | Ga0501033_0060004_1190_2056 | 276 |
| 156 | 3300049571 | Ga0501034_0140445 | Ga0501034_0140445_394_1260 | 276 |
| 157 | 3300049579 | Ga0501043_0044868 | Ga0501043_0044868_2412_3278 | 276 |
| 158 | 3300049823 | Ga0501044_0020484 | Ga0501044_0020484_3758_4624 | 276 |
| 159 | 3300050489 | nmdc:mga03683_41928_c2 | nmdc:mga03683_41928_c2_493_1338 | 276 |
| 160 | 3300005340 | Ga0070689_100054745 | Ga0070689_1000547452 | 277 |
| 161 | 3300009094 | Ga0111539_10413804 | Ga0111539_104138042 | 277 |
| 162 | 3300025936 | Ga0207670_10008860 | Ga0207670_100088601 | 277 |
| 163 | 3300003215 | JGI25153J46596_10002706 | JGI25153J46596_100027067 | 278 |
| 164 | 3300025297 | Ga0209758_1000213 | Ga0209758_1000213127 | 278 |
| 165 | 3300025303 | Ga0209051_1011409 | Ga0209051_10114093 | 278 |
| 166 | 3300028666 | Ga0265336_10000008 | Ga0265336_10000008142 | 278 |
| 167 | 3300029957 | Ga0265324_10001429 | Ga0265324_100014299 | 278 |
| 168 | 3300031730 | Ga0307516_10140243 | Ga0307516_101402432 | 278 |
| 169 | 3300032002 | Ga0307416_100049968 | Ga0307416_1000499683 | 278 |
| 170 | 3300015683 | Ga0183362_10003 | Ga0183362_1000319 | 279 |
| 171 | 3300031730 | Ga0307516_10000064 | Ga0307516_100000644 | 279 |
| 172 | 3300053080 | Ga0500635_0000003 | Ga0500635_0000003_139563_140447 | 279 |
| 173 | 3300003215 | JGI25153J46596_10002003 | JGI25153J46596_100020034 | 280 |
| 174 | 3300003775 | Ga0055524_1026803 | Ga0055524_10268032 | 280 |
| 175 | 3300005262 | Ga0065165_1005901 | Ga0065165_10059014 | 280 |
| 176 | 3300005367 | Ga0070667_100000219 | Ga0070667_10000021939 | 280 |
| 177 | 3300005548 | Ga0070665_100429001 | Ga0070665_1004290012 | 280 |
| 178 | 3300006353 | Ga0075370_10024822 | Ga0075370_100248222 | 280 |
| 179 | 3300009177 | Ga0105248_10309392 | Ga0105248_103093921 | 280 |
| 180 | 3300013308 | Ga0157375_10458113 | Ga0157375_104581132 | 280 |
| 181 | 3300025294 | Ga0209025_1000245 | Ga0209025_10002454 | 280 |
| 182 | 3300025295 | Ga0209564_1003071 | Ga0209564_10030713 | 280 |
| 183 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026490 | 280 |
| 184 | 3300025299 | Ga0209256_1002958 | Ga0209256_10029588 | 280 |
| 185 | 3300025304 | Ga0209257_1000365 | Ga0209257_100036533 | 280 |
| 186 | 3300037471 | Ga0395905_0009931 | Ga0395905_0009931_6120_7010 | 280 |
| 187 | 3300044765 | Ga0466970_0050312 | Ga0466970_0050312_959_1843 | 280 |
| 188 | 3300048925 | Ga0496122_0057615 | Ga0496122_0057615_284_1150 | 280 |
| 189 | 3300048926 | Ga0496123_0000519 | Ga0496123_0000519_64308_65174 | 280 |
| 190 | 3300048927 | Ga0496124_0047109 | Ga0496124_0047109_919_1785 | 280 |
| 191 | 3300048928 | Ga0496125_0000790 | Ga0496125_0000790_50327_51193 | 280 |
| 192 | 3300048928 | Ga0496125_0118562 | Ga0496125_0118562_984_1850 | 280 |
| 193 | 3300048929 | Ga0496126_0000466 | Ga0496126_0000466_79011_79877 | 280 |
| 194 | 3300048929 | Ga0496126_0017014 | Ga0496126_0017014_3146_4012 | 280 |
| 195 | 3300048929 | Ga0496126_0104723 | Ga0496126_0104723_672_1565 | 280 |
| 196 | 3300050496 | nmdc:mga07m45_148252_c1 | nmdc:mga07m45_148252_c1_43_933 | 280 |
| 197 | 3300053153 | Ga0500616_0082183 | Ga0500616_0082183_412_1305 | 280 |
| 198 | iso_pu_bacteria | 2600254954 | 2600444420 | 280 |
| 199 | iso_pu_bacteria | 2600255389 | 2602011505 | 280 |
| 200 | iso_pu_bacteria | 2738543020 | 2739284881 | 280 |
| 201 | iso_pu_bacteria | 2738543021 | 2739290195 | 280 |
| 202 | iso_pu_bacteria | 2823421272 | 2823423978 | 280 |
| 203 | iso_pu_bacteria | 2919501602 | 2919503174 | 280 |
| 204 | iso_pu_bacteria | 2926063275 | 2926066255 | 280 |
| 205 | iso_pu_bacteria | 2952252522 | 2952253094 | 280 |
| 206 | iso_pu_bacteria | 8034962539 | 8034964981 | 280 |
| 207 | 3300005614 | Ga0068856_100107856 | Ga0068856_1001078562 | 281 |
| 208 | 3300025256 | Ga0209759_1030804 | Ga0209759_10308041 | 281 |
| 209 | 3300026078 | Ga0207702_10131075 | Ga0207702_101310753 | 281 |
| 210 | 3300031616 | Ga0307508_10000053 | Ga0307508_10000053104 | 281 |
| 211 | 3300053140 | Ga0500573_0062473 | Ga0500573_0062473_551_1417 | 281 |
| 212 | iso_pu_bacteria | 2511231004 | 2511253304 | 281 |
| 213 | iso_pu_bacteria | 2511231006 | 2511267532 | 281 |
| 214 | iso_pu_bacteria | 2511231007 | 2511273843 | 281 |
| 215 | iso_pu_bacteria | 2511231008 | 2511278829 | 281 |
| 216 | iso_pu_bacteria | 2511231010 | 2511288218 | 281 |
| 217 | iso_pu_bacteria | 2511231011 | 2511294104 | 281 |
| 218 | iso_pu_bacteria | 2511231012 | 2511299355 | 281 |
| 219 | iso_pu_bacteria | 2511231014 | 2511311200 | 281 |
| 220 | iso_pu_bacteria | 2511231015 | 2511321694 | 281 |
| 221 | iso_pu_bacteria | 2511231016 | 2511329009 | 281 |
| 222 | iso_pu_bacteria | 2511231017 | 2511334105 | 281 |
| 223 | iso_pu_bacteria | 2511231018 | 2511340253 | 281 |
| 224 | iso_pu_bacteria | 2511231019 | 2511346938 | 281 |
| 225 | iso_pu_bacteria | 2511231020 | 2511348388 | 281 |
| 226 | iso_pu_bacteria | 2511231021 | 2511357859 | 281 |
| 227 | iso_pu_bacteria | 2511231022 | 2511361082 | 281 |
| 228 | iso_pu_bacteria | 2511231023 | 2511370210 | 281 |
| 229 | iso_pu_bacteria | 2511231031 | 2511412756 | 281 |
| 230 | iso_pu_bacteria | 2511231156 | 2511823941 | 281 |
| 231 | iso_pu_bacteria | 2512047018 | 2512325531 | 281 |
| 232 | iso_pu_bacteria | 2582580891 | 2583793122 | 281 |
| 233 | iso_pu_bacteria | 2597489887 | 2597858930 | 281 |
| 234 | iso_pu_bacteria | 2597489888 | 2597864475 | 281 |
| 235 | iso_pu_bacteria | 2597489889 | 2597870287 | 281 |
| 236 | iso_pu_bacteria | 2599185167 | 2599397602 | 281 |
| 237 | iso_pu_bacteria | 2599185179 | 2599452047 | 281 |
| 238 | iso_pu_bacteria | 2599185185 | 2599487632 | 281 |
| 239 | iso_pu_bacteria | 2599185188 | 2599503182 | 281 |
| 240 | iso_pu_bacteria | 2599185189 | 2599506688 | 281 |
| 241 | iso_pu_bacteria | 2599185190 | 2599513569 | 281 |
| 242 | iso_pu_bacteria | 2599185191 | 2599517929 | 281 |
| 243 | iso_pu_bacteria | 2599185212 | 2599614794 | 281 |
| 244 | iso_pu_bacteria | 2599185248 | 2599769752 | 281 |
| 245 | iso_pu_bacteria | 2599185257 | 2599806042 | 281 |
| 246 | iso_pu_bacteria | 2599185288 | 2599880721 | 281 |
| 247 | iso_pu_bacteria | 2599185289 | 2599889074 | 281 |
| 248 | iso_pu_bacteria | 2599185290 | 2599892246 | 281 |
| 249 | iso_pu_bacteria | 2599185291 | 2599901565 | 281 |
| 250 | iso_pu_bacteria | 2599185300 | 2599933694 | 281 |
| 251 | iso_pu_bacteria | 2599185302 | 2599942805 | 281 |
| 252 | iso_pu_bacteria | 2599185303 | 2599949772 | 281 |
| 253 | iso_pu_bacteria | 2599185304 | 2599953554 | 281 |
| 254 | iso_pu_bacteria | 2599185305 | 2599959223 | 281 |
| 255 | iso_pu_bacteria | 2599185306 | 2599964492 | 281 |
| 256 | iso_pu_bacteria | 2599185308 | 2599975635 | 281 |
| 257 | iso_pu_bacteria | 2599185309 | 2599982185 | 281 |
| 258 | iso_pu_bacteria | 2599185310 | 2599988989 | 281 |
| 259 | iso_pu_bacteria | 2599185311 | 2599994677 | 281 |
| 260 | iso_pu_bacteria | 2599185312 | 2599999547 | 281 |
| 261 | iso_pu_bacteria | 2599185313 | 2600007212 | 281 |
| 262 | iso_pu_bacteria | 2599185314 | 2600009728 | 281 |
| 263 | iso_pu_bacteria | 2599185315 | 2600020554 | 281 |
| 264 | iso_pu_bacteria | 2599185316 | 2600022717 | 281 |
| 265 | iso_pu_bacteria | 2599185317 | 2600030152 | 281 |
| 266 | iso_pu_bacteria | 2599185318 | 2600037779 | 281 |
| 267 | iso_pu_bacteria | 2599185319 | 2600042042 | 281 |
| 268 | iso_pu_bacteria | 2599185320 | 2600046943 | 281 |
| 269 | iso_pu_bacteria | 2599185321 | 2600055067 | 281 |
| 270 | iso_pu_bacteria | 2599185322 | 2600057810 | 281 |
| 271 | iso_pu_bacteria | 2599185323 | 2600064823 | 281 |
| 272 | iso_pu_bacteria | 2599185324 | 2600071715 | 281 |
| 273 | iso_pu_bacteria | 2599185325 | 2600076085 | 281 |
| 274 | iso_pu_bacteria | 2600254930 | 2600359729 | 281 |
| 275 | iso_pu_bacteria | 2600254931 | 2600366750 | 281 |
| 276 | iso_pu_bacteria | 2600255296 | 2601690298 | 281 |
| 277 | iso_pu_bacteria | 2600255318 | 2601797250 | 281 |
| 278 | iso_pu_bacteria | 2603880185 | 2606076019 | 281 |
| 279 | iso_pu_bacteria | 2603880199 | 2606130692 | 281 |
| 280 | iso_pu_bacteria | 2619619299 | 2621299104 | 281 |
| 281 | iso_pu_bacteria | 2623620443 | 2624481515 | 281 |
| 282 | iso_pu_bacteria | 2623620446 | 2624493079 | 281 |
| 283 | iso_pu_bacteria | 2643221565 | 2643843613 | 281 |
| 284 | iso_pu_bacteria | 2643221571 | 2643871165 | 281 |
| 285 | iso_pu_bacteria | 2643221589 | 2643954020 | 281 |
| 286 | iso_pu_bacteria | 2643221602 | 2644022046 | 281 |
| 287 | iso_pu_bacteria | 2643221633 | 2644185564 | 281 |
| 288 | iso_pu_bacteria | 2643221650 | 2644285608 | 281 |
| 289 | iso_pu_bacteria | 2643221713 | 2644620523 | 281 |
| 290 | iso_pu_bacteria | 2651869719 | 2652543812 | 281 |
| 291 | iso_pu_bacteria | 2667528170 | 2671093525 | 281 |
| 292 | iso_pu_bacteria | 2667528176 | 2671128349 | 281 |
| 293 | iso_pu_bacteria | 2671180172 | 2671772892 | 281 |
| 294 | iso_pu_bacteria | 2675903420 | 2677899422 | 281 |
| 295 | iso_pu_bacteria | 2675903515 | 2678264208 | 281 |
| 296 | iso_pu_bacteria | 2713897148 | 2715753621 | 281 |
| 297 | iso_pu_bacteria | 2713897149 | 2715756044 | 281 |
| 298 | iso_pu_bacteria | 2718217725 | 2718634772 | 281 |
| 299 | iso_pu_bacteria | 2721755607 | 2723249177 | 281 |
| 300 | iso_pu_bacteria | 2738541265 | 2738672261 | 281 |
| 301 | iso_pu_bacteria | 2738541282 | 2738750654 | 281 |
| 302 | iso_pu_bacteria | 2738541294 | 2738806157 | 281 |
| 303 | iso_pu_bacteria | 2738541303 | 2738859695 | 281 |
| 304 | iso_pu_bacteria | 2738541309 | 2738893517 | 281 |
| 305 | iso_pu_bacteria | 2738543004 | 2739201305 | 281 |
| 306 | iso_pu_bacteria | 2738543015 | 2739259600 | 281 |
| 307 | iso_pu_bacteria | 2738543025 | 2739313687 | 281 |
| 308 | iso_pu_bacteria | 2740892503 | 2743738452 | 281 |
| 309 | iso_pu_bacteria | 2744054620 | 2745004663 | 281 |
| 310 | iso_pu_bacteria | 2773857670 | 2774119113 | 281 |
| 311 | iso_pu_bacteria | 2773857673 | 2774135106 | 281 |
| 312 | iso_pu_bacteria | 2784132063 | 2784265177 | 281 |
| 313 | iso_pu_bacteria | 2784132072 | 2784314763 | 281 |
| 314 | iso_pu_bacteria | 2791355520 | 2794596683 | 281 |
| 315 | iso_pu_bacteria | 2808606361 | 2808857573 | 281 |
| 316 | iso_pu_bacteria | 2808606373 | 2808904260 | 281 |
| 317 | iso_pu_bacteria | 2808606376 | 2808925227 | 281 |
| 318 | iso_pu_bacteria | 2808606377 | 2808931720 | 281 |
| 319 | iso_pu_bacteria | 2808606378 | 2808937743 | 281 |
| 320 | iso_pu_bacteria | 2808606379 | 2808941874 | 281 |
| 321 | iso_pu_bacteria | 2808606380 | 2808947425 | 281 |
| 322 | iso_pu_bacteria | 2808606381 | 2808953840 | 281 |
| 323 | iso_pu_bacteria | 2808606382 | 2808959068 | 281 |
| 324 | iso_pu_bacteria | 2808606383 | 2808966057 | 281 |
| 325 | iso_pu_bacteria | 2808606385 | 2808980301 | 281 |
| 326 | iso_pu_bacteria | 2808606388 | 2808996022 | 281 |
| 327 | iso_pu_bacteria | 2808606389 | 2809000949 | 281 |
| 328 | iso_pu_bacteria | 2808606445 | 2809214303 | 281 |
| 329 | iso_pu_bacteria | 2816332298 | 2817491815 | 281 |
| 330 | iso_pu_bacteria | 2818991456 | 2819657705 | 281 |
| 331 | iso_pu_bacteria | 2825651385 | 2825656857 | 281 |
| 332 | iso_pu_bacteria | 2834028612 | 2834032615 | 281 |
| 333 | iso_pu_bacteria | 2842826826 | 2842830337 | 281 |
| 334 | iso_pu_bacteria | 2842832357 | 2842836350 | 281 |
| 335 | iso_pu_bacteria | 2842837860 | 2842841929 | 281 |
| 336 | iso_pu_bacteria | 2842843487 | 2842844245 | 281 |
| 337 | iso_pu_bacteria | 2842854478 | 2842854905 | 281 |
| 338 | iso_pu_bacteria | 2852612431 | 2852613896 | 281 |
| 339 | iso_pu_bacteria | 2852657418 | 2852659385 | 281 |
| 340 | iso_pu_bacteria | 2852667396 | 2852668368 | 281 |
| 341 | iso_pu_bacteria | 2860339153 | 2860344306 | 281 |
| 342 | iso_pu_bacteria | 2860867994 | 2860870968 | 281 |
| 343 | iso_pu_bacteria | 2878029506 | 2878033500 | 281 |
| 344 | iso_pu_bacteria | 2880230671 | 2880232785 | 281 |
| 345 | iso_pu_bacteria | 2904518522 | 2904520479 | 281 |
| 346 | iso_pu_bacteria | 2904550169 | 2904553594 | 281 |
| 347 | iso_pu_bacteria | 2908446538 | 2908449003 | 281 |
| 348 | iso_pu_bacteria | 2912963787 | 2912965530 | 281 |
| 349 | iso_pu_bacteria | 2913036834 | 2913040695 | 281 |
| 350 | iso_pu_bacteria | 2919063839 | 2919069191 | 281 |
| 351 | iso_pu_bacteria | 2919385768 | 2919387648 | 281 |
| 352 | iso_pu_bacteria | 2919456309 | 2919461340 | 281 |
| 353 | iso_pu_bacteria | 2919481497 | 2919482195 | 281 |
| 354 | iso_pu_bacteria | 2919487758 | 2919490389 | 281 |
| 355 | iso_pu_bacteria | 2919697872 | 2919699647 | 281 |
| 356 | iso_pu_bacteria | 2923153595 | 2923157509 | 281 |
| 357 | iso_pu_bacteria | 2923586266 | 2923587767 | 281 |
| 358 | iso_pu_bacteria | 2929144301 | 2929148179 | 281 |
| 359 | iso_pu_bacteria | 2929189879 | 2929193044 | 281 |
| 360 | iso_pu_bacteria | 2931369376 | 2931374395 | 281 |
| 361 | iso_pu_bacteria | 2931390751 | 2931393447 | 281 |
| 362 | iso_pu_bacteria | 2931396565 | 2931403036 | 281 |
| 363 | iso_pu_bacteria | 2939636861 | 2939640325 | 281 |
| 364 | iso_pu_bacteria | 2939651529 | 2939655450 | 281 |
| 365 | iso_pu_bacteria | 2945928738 | 2945932964 | 281 |
| 366 | iso_pu_bacteria | 2945961074 | 2945964190 | 281 |
| 367 | iso_pu_bacteria | 2946027586 | 2946031308 | 281 |
| 368 | iso_pu_bacteria | 2947233263 | 2947238285 | 281 |
| 369 | iso_pu_bacteria | 2969304461 | 2969308259 | 281 |
| 370 | iso_pu_bacteria | 2974289157 | 2974290282 | 281 |
| 371 | iso_pu_bacteria | 2984286254 | 2984288630 | 281 |
| 372 | iso_pu_bacteria | 2988728565 | 2988729830 | 281 |
| 373 | iso_pu_bacteria | 2998139840 | 2998143571 | 281 |
| 374 | iso_pu_bacteria | 3007395558 | 3007396831 | 281 |
| 375 | iso_pu_bacteria | 3007511990 | 3007515208 | 281 |
| 376 | iso_pu_bacteria | 3007614139 | 3007616641 | 281 |
| 377 | iso_pu_bacteria | 3007619802 | 3007620963 | 281 |
| 378 | iso_pu_bacteria | 3007718800 | 3007719699 | 281 |
| 379 | iso_pu_bacteria | 3007855910 | 3007859030 | 281 |
| 380 | iso_pu_bacteria | 3007861166 | 3007861441 | 281 |
| 381 | iso_pu_bacteria | 3007866637 | 3007868356 | 281 |
| 382 | iso_pu_bacteria | 8015687852 | 8015691671 | 281 |
| 383 | iso_pu_bacteria | 8019775933 | 8019776082 | 281 |
| 384 | iso_pu_bacteria | 8029995093 | 8029997253 | 281 |
| 385 | iso_pu_bacteria | 8054285046 | 8054286626 | 281 |
| 386 | iso_pu_bacteria | 8054347763 | 8054347855 | 281 |
| 387 | iso_pu_bacteria | 8054503363 | 8054506815 | 281 |
| 388 | iso_pu_bacteria | 8055770955 | 8055774860 | 281 |
| 389 | iso_pu_bacteria | 8055817908 | 8055821606 | 281 |
| 390 | iso_pu_bacteria | 8056125926 | 8056129758 | 281 |
| 391 | iso_pu_bacteria | 8056131705 | 8056135265 | 281 |
| 392 | iso_pu_bacteria | 8056143049 | 8056147080 | 281 |
| 393 | iso_pu_bacteria | 8056148874 | 8056154229 | 281 |
| 394 | iso_pu_bacteria | 8056155041 | 8056160298 | 281 |
| 395 | iso_pu_bacteria | 8056161164 | 8056165612 | 281 |
| 396 | iso_pu_bacteria | 8056166840 | 8056167636 | 281 |
| 397 | iso_pu_bacteria | 8056172158 | 8056173641 | 281 |
| 398 | iso_pu_bacteria | 8056177738 | 8056183857 | 281 |
| 399 | iso_pu_bacteria | 8056569372 | 8056573580 | 281 |
| 400 | 3300005985 | Ga0081539_10062720 | Ga0081539_100627202 | 282 |
| 401 | 3300031235 | Ga0265330_10000012 | Ga0265330_1000001265 | 282 |
| 402 | iso_pu_bacteria | 2899259804 | 2899260462 | 282 |
| 403 | iso_pu_bacteria | 8001845381 | 8001847366 | 282 |
| 404 | 3300002704 | JGI25155J39150_1000064 | JGI25155J39150_100006468 | 283 |
| 405 | 3300002705 | JGI25156J39149_1000085 | JGI25156J39149_10000852 | 283 |
| 406 | 3300002738 | JGI25154J39366_1000112 | JGI25154J39366_10001122 | 283 |
| 407 | 3300002741 | JGI25157J39369_1000109 | JGI25157J39369_100010968 | 283 |
| 408 | 3300002773 | JGI25152J39213_1015154 | JGI25152J39213_10151542 | 283 |
| 409 | 3300002774 | JGI25150J39212_1003044 | JGI25150J39212_10030444 | 283 |
| 410 | 3300002987 | JGI25159J45721_1009814 | JGI25159J45721_10098142 | 283 |
| 411 | 3300002987 | JGI25159J45721_1014117 | JGI25159J45721_10141172 | 283 |
| 412 | 3300003187 | JGI25151J46595_10010917 | JGI25151J46595_100109172 | 283 |
| 413 | 3300003187 | JGI25151J46595_10028541 | JGI25151J46595_100285412 | 283 |
| 414 | 3300003354 | JGI25160J50197_1002743 | JGI25160J50197_10027438 | 283 |
| 415 | 3300003374 | JGI25161J50226_1000036 | JGI25161J50226_100003669 | 283 |
| 416 | 3300003771 | Ga0055526_1003106 | Ga0055526_100310610 | 283 |
| 417 | 3300003771 | Ga0055526_1019348 | Ga0055526_10193482 | 283 |
| 418 | 3300003775 | Ga0055524_1000098 | Ga0055524_10000986 | 283 |
| 419 | 3300003790 | Ga0055528_1005251 | Ga0055528_10052513 | 283 |
| 420 | 3300003791 | Ga0055530_10002119 | Ga0055530_100021198 | 283 |
| 421 | 3300003792 | Ga0055540_1000137 | Ga0055540_100013761 | 283 |
| 422 | 3300003794 | Ga0055531_10001985 | Ga0055531_1000198520 | 283 |
| 423 | 3300004625 | Ga0055543_1000157 | Ga0055543_100015717 | 283 |
| 424 | 3300005262 | Ga0065165_1015276 | Ga0065165_10152763 | 283 |
| 425 | 3300006051 | Ga0075364_10043500 | Ga0075364_100435002 | 283 |
| 426 | 3300006177 | Ga0075362_10038254 | Ga0075362_100382542 | 283 |
| 427 | 3300009176 | Ga0105242_10003491 | Ga0105242_100034914 | 283 |
| 428 | 3300012513 | Ga0157326_1004788 | Ga0157326_10047882 | 283 |
| 429 | 3300025206 | Ga0209435_100002 | Ga0209435_100002700 | 283 |
| 430 | 3300025208 | Ga0209436_108835 | Ga0209436_1088352 | 283 |
| 431 | 3300025245 | Ga0207425_1007872 | Ga0207425_10078722 | 283 |
| 432 | 3300025245 | Ga0207425_1008495 | Ga0207425_10084954 | 283 |
| 433 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012843 | 283 |
| 434 | 3300025250 | Ga0209026_1000121 | Ga0209026_100012169 | 283 |
| 435 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000012474 | 283 |
| 436 | 3300025263 | Ga0209565_1000026 | Ga0209565_1000026104 | 283 |
| 437 | 3300025263 | Ga0209565_1001447 | Ga0209565_10014476 | 283 |
| 438 | 3300025273 | Ga0209673_1000009 | Ga0209673_1000009113 | 283 |
| 439 | 3300025284 | Ga0209130_1000109 | Ga0209130_100010958 | 283 |
| 440 | 3300025284 | Ga0209130_1002387 | Ga0209130_10023872 | 283 |
| 441 | 3300025291 | Ga0209675_1000246 | Ga0209675_10002466 | 283 |
| 442 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013134 | 283 |
| 443 | 3300025292 | Ga0209676_1009189 | Ga0209676_10091893 | 283 |
| 444 | 3300025294 | Ga0209025_1009400 | Ga0209025_10094002 | 283 |
| 445 | 3300025294 | Ga0209025_1010298 | Ga0209025_10102984 | 283 |
| 446 | 3300025295 | Ga0209564_1000243 | Ga0209564_100024387 | 283 |
| 447 | 3300025295 | Ga0209564_1003205 | Ga0209564_10032053 | 283 |
| 448 | 3300025295 | Ga0209564_1010517 | Ga0209564_10105174 | 283 |
| 449 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008134 | 283 |
| 450 | 3300025298 | Ga0209050_1009571 | Ga0209050_10095712 | 283 |
| 451 | 3300025298 | Ga0209050_1023748 | Ga0209050_10237482 | 283 |
| 452 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003268 | 283 |
| 453 | 3300025302 | Ga0207426_1001071 | Ga0207426_100107119 | 283 |
| 454 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005134 | 283 |
| 455 | 3300025304 | Ga0209257_1000048 | Ga0209257_1000048134 | 283 |
| 456 | 3300025934 | Ga0207686_10154091 | Ga0207686_101540911 | 283 |
| 457 | 3300031456 | Ga0307513_10315343 | Ga0307513_103153432 | 283 |
| 458 | 3300031548 | Ga0307408_100010250 | Ga0307408_1000102503 | 283 |
| 459 | 3300031901 | Ga0307406_10013191 | Ga0307406_100131914 | 283 |
| 460 | 3300046453 | Ga0495627_009802 | Ga0495627_009802_2111_2974 | 283 |
| 461 | 3300048928 | Ga0496125_0154525 | Ga0496125_0154525_569_1432 | 283 |
| 462 | 3300050489 | nmdc:mga03683_64361_c1 | nmdc:mga03683_64361_c1_54_944 | 283 |
| 463 | 3300053730 | Ga0500645_001142 | Ga0500645_001142_5274_6164 | 283 |
| 464 | iso_pu_bacteria | 2643221544 | 2643743443 | 283 |
| 465 | iso_pu_bacteria | 2643221603 | 2644027316 | 283 |
| 466 | iso_pu_bacteria | 2643221639 | 2644220056 | 283 |
| 467 | iso_pu_bacteria | 2643221644 | 2644245140 | 283 |
| 468 | iso_pu_bacteria | 2643221646 | 2644261234 | 283 |
| 469 | iso_pu_bacteria | 2643221654 | 2644305686 | 283 |
| 470 | iso_pu_bacteria | 2643221736 | 2644743539 | 283 |
| 471 | iso_pu_bacteria | 2791355196 | 2793066055 | 283 |
| 472 | iso_pu_bacteria | 2841760612 | 2841764508 | 283 |
| 473 | iso_pu_bacteria | 2844104063 | 2844108044 | 283 |
| 474 | iso_pu_bacteria | 2851182111 | 2851187976 | 283 |
| 475 | iso_pu_bacteria | 2851246043 | 2851250150 | 283 |
| 476 | iso_pu_bacteria | 8057529695 | 8057533421 | 283 |
| 477 | 2124908027 | MRS2a_Contig_49 | MRS2a_00373290 | 284 |
| 478 | 3300003752 | Ga0055539_1000243 | Ga0055539_100024325 | 284 |
| 479 | 3300003756 | Ga0055533_1000238 | Ga0055533_100023825 | 284 |
| 480 | 3300003758 | Ga0055532_1000259 | Ga0055532_100025913 | 284 |
| 481 | 3300003759 | Ga0055525_1000332 | Ga0055525_100033225 | 284 |
| 482 | 3300003761 | Ga0055535_1005325 | Ga0055535_10053253 | 284 |
| 483 | 3300003781 | Ga0055536_1000082 | Ga0055536_10000828 | 284 |
| 484 | 3300003781 | Ga0055536_1000185 | Ga0055536_100018519 | 284 |
| 485 | 3300003791 | Ga0055530_10000094 | Ga0055530_1000009423 | 284 |
| 486 | 3300003791 | Ga0055530_10001399 | Ga0055530_1000139910 | 284 |
| 487 | 3300003791 | Ga0055530_10002109 | Ga0055530_100021095 | 284 |
| 488 | 3300003792 | Ga0055540_1000130 | Ga0055540_100013023 | 284 |
| 489 | 3300003792 | Ga0055540_1000222 | Ga0055540_100022220 | 284 |
| 490 | 3300003792 | Ga0055540_1001438 | Ga0055540_10014388 | 284 |
| 491 | 3300003794 | Ga0055531_10000215 | Ga0055531_1000021524 | 284 |
| 492 | 3300003841 | Ga0055541_1000146 | Ga0055541_100014625 | 284 |
| 493 | 3300005288 | Ga0065714_10006377 | Ga0065714_100063773 | 284 |
| 494 | 3300005288 | Ga0065714_10010702 | Ga0065714_100107024 | 284 |
| 495 | 3300005288 | Ga0065714_10064795 | Ga0065714_100647955 | 284 |
| 496 | 3300005288 | Ga0065714_10068142 | Ga0065714_100681425 | 284 |
| 497 | 3300005289 | Ga0065704_10070946 | Ga0065704_100709464 | 284 |
| 498 | 3300005289 | Ga0065704_10164190 | Ga0065704_101641901 | 284 |
| 499 | 3300005290 | Ga0065712_10081086 | Ga0065712_100810862 | 284 |
| 500 | 3300005290 | Ga0065712_10118723 | Ga0065712_101187232 | 284 |
| 501 | 3300005331 | Ga0070670_100000760 | Ga0070670_10000076017 | 284 |
| 502 | 3300005344 | Ga0070661_100000140 | Ga0070661_10000014067 | 284 |
| 503 | 3300005353 | Ga0070669_100001983 | Ga0070669_10000198317 | 284 |
| 504 | 3300005457 | Ga0070662_100003380 | Ga0070662_1000033802 | 284 |
| 505 | 3300005539 | Ga0068853_100101373 | Ga0068853_1001013734 | 284 |
| 506 | 3300005564 | Ga0070664_100000201 | Ga0070664_1000002018 | 284 |
| 507 | 3300005578 | Ga0068854_100031155 | Ga0068854_1000311553 | 284 |
| 508 | 3300006051 | Ga0075364_10102857 | Ga0075364_101028572 | 284 |
| 509 | 3300006058 | Ga0075432_10035898 | Ga0075432_100358982 | 284 |
| 510 | 3300006177 | Ga0075362_10062461 | Ga0075362_100624612 | 284 |
| 511 | 3300006186 | Ga0075369_10004583 | Ga0075369_100045835 | 284 |
| 512 | 3300006914 | Ga0075436_100100690 | Ga0075436_1001006902 | 284 |
| 513 | 3300006946 | Ga0079104_1000239 | Ga0079104_100023949 | 284 |
| 514 | 3300006946 | Ga0079104_1000325 | Ga0079104_100032537 | 284 |
| 515 | 3300006948 | Ga0099826_10044464 | Ga0099826_100444642 | 284 |
| 516 | 3300009011 | Ga0105251_10001079 | Ga0105251_1000107928 | 284 |
| 517 | 3300009011 | Ga0105251_10006867 | Ga0105251_100068675 | 284 |
| 518 | 3300009011 | Ga0105251_10013774 | Ga0105251_100137742 | 284 |
| 519 | 3300009011 | Ga0105251_10043277 | Ga0105251_100432772 | 284 |
| 520 | 3300009011 | Ga0105251_10065110 | Ga0105251_100651102 | 284 |
| 521 | 3300009036 | Ga0105244_10000823 | Ga0105244_1000082331 | 284 |
| 522 | 3300009036 | Ga0105244_10019773 | Ga0105244_100197733 | 284 |
| 523 | 3300009036 | Ga0105244_10026694 | Ga0105244_100266942 | 284 |
| 524 | 3300009036 | Ga0105244_10053196 | Ga0105244_100531961 | 284 |
| 525 | 3300009092 | Ga0105250_10000523 | Ga0105250_1000052315 | 284 |
| 526 | 3300009092 | Ga0105250_10001345 | Ga0105250_1000134510 | 284 |
| 527 | 3300009092 | Ga0105250_10060706 | Ga0105250_100607061 | 284 |
| 528 | 3300009148 | Ga0105243_10000587 | Ga0105243_1000058731 | 284 |
| 529 | 3300009148 | Ga0105243_10178838 | Ga0105243_101788382 | 284 |
| 530 | 3300009176 | Ga0105242_10008807 | Ga0105242_100088072 | 284 |
| 531 | 3300009545 | Ga0105237_10000413 | Ga0105237_1000041326 | 284 |
| 532 | 3300011119 | Ga0105246_10000239 | Ga0105246_1000023918 | 284 |
| 533 | 3300011119 | Ga0105246_10057480 | Ga0105246_100574802 | 284 |
| 534 | 3300011119 | Ga0105246_10059504 | Ga0105246_100595042 | 284 |
| 535 | 3300012498 | Ga0157345_1000190 | Ga0157345_10001904 | 284 |
| 536 | 3300013100 | Ga0157373_10000780 | Ga0157373_1000078017 | 284 |
| 537 | 3300013100 | Ga0157373_10008065 | Ga0157373_100080656 | 284 |
| 538 | 3300013100 | Ga0157373_10072584 | Ga0157373_100725843 | 284 |
| 539 | 3300013102 | Ga0157371_10000189 | Ga0157371_1000018964 | 284 |
| 540 | 3300013102 | Ga0157371_10003317 | Ga0157371_100033176 | 284 |
| 541 | 3300013102 | Ga0157371_10043122 | Ga0157371_100431222 | 284 |
| 542 | 3300013104 | Ga0157370_10088442 | Ga0157370_100884424 | 284 |
| 543 | 3300013104 | Ga0157370_10091634 | Ga0157370_100916342 | 284 |
| 544 | 3300013104 | Ga0157370_10184755 | Ga0157370_101847552 | 284 |
| 545 | 3300013105 | Ga0157369_10004800 | Ga0157369_100048008 | 284 |
| 546 | 3300013105 | Ga0157369_10186668 | Ga0157369_101866682 | 284 |
| 547 | 3300013306 | Ga0163162_10009532 | Ga0163162_100095324 | 284 |
| 548 | 3300013307 | Ga0157372_10283284 | Ga0157372_102832842 | 284 |
| 549 | 3300013308 | Ga0157375_10119307 | Ga0157375_101193072 | 284 |
| 550 | 3300014497 | Ga0182008_10018498 | Ga0182008_100184983 | 284 |
| 551 | 3300014497 | Ga0182008_10026815 | Ga0182008_100268154 | 284 |
| 552 | 3300014497 | Ga0182008_10040959 | Ga0182008_100409592 | 284 |
| 553 | 3300015261 | Ga0182006_1001489 | Ga0182006_10014892 | 284 |
| 554 | 3300015261 | Ga0182006_1078660 | Ga0182006_10786601 | 284 |
| 555 | 3300015262 | Ga0182007_10049056 | Ga0182007_100490561 | 284 |
| 556 | 3300015265 | Ga0182005_1002866 | Ga0182005_10028662 | 284 |
| 557 | 3300017792 | Ga0163161_10048777 | Ga0163161_100487772 | 284 |
| 558 | 3300017792 | Ga0163161_10288296 | Ga0163161_102882961 | 284 |
| 559 | 3300025206 | Ga0209435_100397 | Ga0209435_1003971 | 284 |
| 560 | 3300025224 | Ga0209784_100241 | Ga0209784_10024126 | 284 |
| 561 | 3300025225 | Ga0209566_100390 | Ga0209566_10039026 | 284 |
| 562 | 3300025226 | Ga0209674_100293 | Ga0209674_10029326 | 284 |
| 563 | 3300025229 | Ga0209147_100332 | Ga0209147_10033226 | 284 |
| 564 | 3300025230 | Ga0209563_100188 | Ga0209563_10018826 | 284 |
| 565 | 3300025230 | Ga0209563_100826 | Ga0209563_1008262 | 284 |
| 566 | 3300025242 | Ga0209258_100508 | Ga0209258_10050826 | 284 |
| 567 | 3300025253 | Ga0209677_100266 | Ga0209677_10026626 | 284 |
| 568 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002304 | 284 |
| 569 | 3300025292 | Ga0209676_1000017 | Ga0209676_1000017295 | 284 |
| 570 | 3300025292 | Ga0209676_1000441 | Ga0209676_100044110 | 284 |
| 571 | 3300025292 | Ga0209676_1006968 | Ga0209676_10069683 | 284 |
| 572 | 3300025298 | Ga0209050_1000079 | Ga0209050_100007967 | 284 |
| 573 | 3300025298 | Ga0209050_1000242 | Ga0209050_100024274 | 284 |
| 574 | 3300025298 | Ga0209050_1000371 | Ga0209050_100037165 | 284 |
| 575 | 3300025298 | Ga0209050_1001174 | Ga0209050_100117422 | 284 |
| 576 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001304 | 284 |
| 577 | 3300025303 | Ga0209051_1000054 | Ga0209051_100005470 | 284 |
| 578 | 3300025303 | Ga0209051_1000234 | Ga0209051_100023466 | 284 |
| 579 | 3300025304 | Ga0209257_1000167 | Ga0209257_1000167132 | 284 |
| 580 | 3300025304 | Ga0209257_1023089 | Ga0209257_10230892 | 284 |
| 581 | 3300025711 | Ga0207696_1000045 | Ga0207696_1000045229 | 284 |
| 582 | 3300025711 | Ga0207696_1000090 | Ga0207696_1000090110 | 284 |
| 583 | 3300025711 | Ga0207696_1000147 | Ga0207696_100014780 | 284 |
| 584 | 3300025711 | Ga0207696_1006368 | Ga0207696_10063684 | 284 |
| 585 | 3300025711 | Ga0207696_1012353 | Ga0207696_10123533 | 284 |
| 586 | 3300025728 | Ga0207655_1000140 | Ga0207655_100014042 | 284 |
| 587 | 3300025728 | Ga0207655_1000333 | Ga0207655_100033331 | 284 |
| 588 | 3300025728 | Ga0207655_1004959 | Ga0207655_10049599 | 284 |
| 589 | 3300025728 | Ga0207655_1010972 | Ga0207655_10109722 | 284 |
| 590 | 3300025728 | Ga0207655_1015837 | Ga0207655_10158374 | 284 |
| 591 | 3300025728 | Ga0207655_1017861 | Ga0207655_10178612 | 284 |
| 592 | 3300025728 | Ga0207655_1026928 | Ga0207655_10269283 | 284 |
| 593 | 3300025735 | Ga0207713_1001032 | Ga0207713_10010322 | 284 |
| 594 | 3300025735 | Ga0207713_1001617 | Ga0207713_100161715 | 284 |
| 595 | 3300025735 | Ga0207713_1002467 | Ga0207713_10024672 | 284 |
| 596 | 3300025735 | Ga0207713_1002698 | Ga0207713_100269811 | 284 |
| 597 | 3300025735 | Ga0207713_1004082 | Ga0207713_10040827 | 284 |
| 598 | 3300025735 | Ga0207713_1004181 | Ga0207713_10041817 | 284 |
| 599 | 3300025735 | Ga0207713_1024073 | Ga0207713_10240734 | 284 |
| 600 | 3300025735 | Ga0207713_1045495 | Ga0207713_10454952 | 284 |
| 601 | 3300025914 | Ga0207671_10003125 | Ga0207671_1000312510 | 284 |
| 602 | 3300025920 | Ga0207649_10000156 | Ga0207649_100001566 | 284 |
| 603 | 3300025923 | Ga0207681_10003803 | Ga0207681_100038037 | 284 |
| 604 | 3300025925 | Ga0207650_10000266 | Ga0207650_100002661 | 284 |
| 605 | 3300025933 | Ga0207706_10001399 | Ga0207706_1000139926 | 284 |
| 606 | 3300025933 | Ga0207706_10510774 | Ga0207706_105107741 | 284 |
| 607 | 3300025934 | Ga0207686_10032635 | Ga0207686_100326354 | 284 |
| 608 | 3300025935 | Ga0207709_10000014 | Ga0207709_10000014399 | 284 |
| 609 | 3300025935 | Ga0207709_10064266 | Ga0207709_100642662 | 284 |
| 610 | 3300025945 | Ga0207679_10000016 | Ga0207679_1000001693 | 284 |
| 611 | 3300025981 | Ga0207640_10065278 | Ga0207640_100652782 | 284 |
| 612 | 3300026041 | Ga0207639_10079348 | Ga0207639_100793485 | 284 |
| 613 | 3300027111 | Ga0209281_1000018 | Ga0209281_100001863 | 284 |
| 614 | 3300027111 | Ga0209281_1000368 | Ga0209281_100036849 | 284 |
| 615 | 3300027471 | Ga0209995_1000788 | Ga0209995_10007882 | 284 |
| 616 | 3300027526 | Ga0209968_1019181 | Ga0209968_10191812 | 284 |
| 617 | 3300027665 | Ga0209983_1000442 | Ga0209983_10004421 | 284 |
| 618 | 3300027666 | Ga0209282_1013266 | Ga0209282_10132664 | 284 |
| 619 | 3300027682 | Ga0209971_1001513 | Ga0209971_10015134 | 284 |
| 620 | 3300027876 | Ga0209974_10011930 | Ga0209974_100119302 | 284 |
| 621 | 3300027907 | Ga0207428_10022614 | Ga0207428_100226144 | 284 |
| 622 | 3300027907 | Ga0207428_10044673 | Ga0207428_100446733 | 284 |
| 623 | 3300027907 | Ga0207428_10083579 | Ga0207428_100835792 | 284 |
| 624 | 3300027907 | Ga0207428_10199749 | Ga0207428_101997492 | 284 |
| 625 | 3300030735 | Ga0316178_1063861 | Ga0316178_106386114 | 284 |
| 626 | 3300031344 | Ga0265316_10182322 | Ga0265316_101823222 | 284 |
| 627 | 3300031548 | Ga0307408_100000004 | Ga0307408_10000000417 | 284 |
| 628 | 3300031548 | Ga0307408_100040046 | Ga0307408_1000400463 | 284 |
| 629 | 3300031903 | Ga0307407_10088687 | Ga0307407_100886872 | 284 |
| 630 | 3300032005 | Ga0307411_10134858 | Ga0307411_101348582 | 284 |
| 631 | 3300033180 | Ga0307510_10098920 | Ga0307510_100989202 | 284 |
| 632 | 3300038705 | Ga0237819_01625 | Ga0237819_01625_3849_4715 | 284 |
| 633 | 3300041405 | Ga0439438_003472 | Ga0439438_003472_2830_3696 | 284 |
| 634 | 3300041405 | Ga0439438_035300 | Ga0439438_035300_125_991 | 284 |
| 635 | 3300041407 | Ga0439447_005892 | Ga0439447_005892_2843_3709 | 284 |
| 636 | 3300041411 | Ga0439466_0005482 | Ga0439466_0005482_1178_2044 | 284 |
| 637 | 3300041411 | Ga0439466_0012874 | Ga0439466_0012874_421_1287 | 284 |
| 638 | 3300041411 | Ga0439466_0021425 | Ga0439466_0021425_867_1733 | 284 |
| 639 | 3300041411 | Ga0439466_0022547 | Ga0439466_0022547_993_1859 | 284 |
| 640 | 3300041411 | Ga0439466_0040918 | Ga0439466_0040918_91_957 | 284 |
| 641 | 3300041411 | Ga0439466_0063208 | Ga0439466_0063208_30_896 | 284 |
| 642 | 3300042006 | Ga0439432_030932 | Ga0439432_030932_842_1708 | 284 |
| 643 | 3300042009 | Ga0439451_010177 | Ga0439451_010177_553_1419 | 284 |
| 644 | 3300042009 | Ga0439451_014540 | Ga0439451_014540_634_1500 | 284 |
| 645 | 3300042010 | Ga0439452_000836 | Ga0439452_000836_5163_6029 | 284 |
| 646 | 3300042010 | Ga0439452_002288 | Ga0439452_002288_5242_6108 | 284 |
| 647 | 3300042010 | Ga0439452_009502 | Ga0439452_009502_632_1498 | 284 |
| 648 | 3300042010 | Ga0439452_033175 | Ga0439452_033175_319_1185 | 284 |
| 649 | 3300042013 | Ga0439456_000087 | Ga0439456_000087_7331_8194 | 284 |
| 650 | 3300042013 | Ga0439456_000624 | Ga0439456_000624_2671_3537 | 284 |
| 651 | 3300042013 | Ga0439456_017042 | Ga0439456_017042_197_1063 | 284 |
| 652 | 3300042016 | Ga0439463_002248 | Ga0439463_002248_3900_4766 | 284 |
| 653 | 3300042115 | Ga0450911_003188 | Ga0450911_003188_744_1610 | 284 |
| 654 | 3300042145 | Ga0450906_005074 | Ga0450906_005074_1264_2130 | 284 |
| 655 | 3300042146 | Ga0450907_000564 | Ga0450907_000564_5118_5984 | 284 |
| 656 | 3300042146 | Ga0450907_010491 | Ga0450907_010491_96_962 | 284 |
| 657 | 3300042146 | Ga0450907_011127 | Ga0450907_011127_377_1243 | 284 |
| 658 | 3300042147 | Ga0450910_002768 | Ga0450910_002768_1064_1930 | 284 |
| 659 | 3300042185 | Ga0450909_004159 | Ga0450909_004159_127_993 | 284 |
| 660 | 3300042461 | Ga0439460_0007129 | Ga0439460_0007129_373_1239 | 284 |
| 661 | 3300042461 | Ga0439460_0014220 | Ga0439460_0014220_823_1689 | 284 |
| 662 | 3300042993 | Ga0439440_0010703 | Ga0439440_0010703_327_1193 | 284 |
| 663 | 3300046452 | Ga0495617_010946 | Ga0495617_010946_1099_1965 | 284 |
| 664 | 3300046452 | Ga0495617_012205 | Ga0495617_012205_1766_2632 | 284 |
| 665 | 3300046452 | Ga0495617_026539 | Ga0495617_026539_849_1715 | 284 |
| 666 | 3300046453 | Ga0495627_002600 | Ga0495627_002600_1162_2049 | 284 |
| 667 | 3300046453 | Ga0495627_013398 | Ga0495627_013398_508_1374 | 284 |
| 668 | 3300046453 | Ga0495627_019154 | Ga0495627_019154_888_1754 | 284 |
| 669 | 3300046453 | Ga0495627_019308 | Ga0495627_019308_769_1635 | 284 |
| 670 | 3300046457 | Ga0495590_0018511 | Ga0495590_0018511_1075_1941 | 284 |
| 671 | 3300046458 | Ga0495591_005068 | Ga0495591_005068_2844_3710 | 284 |
| 672 | 3300046458 | Ga0495591_017468 | Ga0495591_017468_1124_1990 | 284 |
| 673 | 3300046458 | Ga0495591_017558 | Ga0495591_017558_1280_2143 | 284 |
| 674 | 3300046458 | Ga0495591_025491 | Ga0495591_025491_602_1468 | 284 |
| 675 | 3300046460 | Ga0495638_0033980 | Ga0495638_0033980_1595_2461 | 284 |
| 676 | 3300046460 | Ga0495638_0073735 | Ga0495638_0073735_231_1097 | 284 |
| 677 | 3300046460 | Ga0495638_0115550 | Ga0495638_0115550_558_1424 | 284 |
| 678 | 3300046463 | Ga0495653_0077120 | Ga0495653_0077120_501_1367 | 284 |
| 679 | 3300046463 | Ga0495653_0079074 | Ga0495653_0079074_1187_2053 | 284 |
| 680 | 3300046463 | Ga0495653_0084672 | Ga0495653_0084672_1025_1891 | 284 |
| 681 | 3300046463 | Ga0495653_0128795 | Ga0495653_0128795_897_1763 | 284 |
| 682 | 3300046471 | Ga0495650_0029859 | Ga0495650_0029859_631_1497 | 284 |
| 683 | 3300046471 | Ga0495650_0043880 | Ga0495650_0043880_638_1504 | 284 |
| 684 | 3300046471 | Ga0495650_0053415 | Ga0495650_0053415_400_1266 | 284 |
| 685 | 3300046474 | Ga0495605_0000045 | Ga0495605_0000045_14182_15069 | 284 |
| 686 | 3300046474 | Ga0495605_0035699 | Ga0495605_0035699_1572_2438 | 284 |
| 687 | 3300046474 | Ga0495605_0042631 | Ga0495605_0042631_563_1429 | 284 |
| 688 | 3300046475 | Ga0495639_0003011 | Ga0495639_0003011_1609_2475 | 284 |
| 689 | 3300046491 | Ga0495584_0006050 | Ga0495584_0006050_606_1472 | 284 |
| 690 | 3300046491 | Ga0495584_0006946 | Ga0495584_0006946_169_1035 | 284 |
| 691 | 3300046491 | Ga0495584_0014142 | Ga0495584_0014142_2008_2874 | 284 |
| 692 | 3300046491 | Ga0495584_0023996 | Ga0495584_0023996_1066_1932 | 284 |
| 693 | 3300046491 | Ga0495584_0037158 | Ga0495584_0037158_528_1394 | 284 |
| 694 | 3300046491 | Ga0495584_0037455 | Ga0495584_0037455_1014_1880 | 284 |
| 695 | 3300046491 | Ga0495584_0041671 | Ga0495584_0041671_558_1424 | 284 |
| 696 | 3300046491 | Ga0495584_0056978 | Ga0495584_0056978_1017_1883 | 284 |
| 697 | 3300046492 | Ga0495585_0028915 | Ga0495585_0028915_1361_2227 | 284 |
| 698 | 3300046492 | Ga0495585_0037233 | Ga0495585_0037233_766_1632 | 284 |
| 699 | 3300046492 | Ga0495585_0069557 | Ga0495585_0069557_492_1358 | 284 |
| 700 | 3300046499 | Ga0495594_0043177 | Ga0495594_0043177_1248_2135 | 284 |
| 701 | 3300046500 | Ga0495596_0003925 | Ga0495596_0003925_2071_2937 | 284 |
| 702 | 3300046500 | Ga0495596_0052050 | Ga0495596_0052050_351_1217 | 284 |
| 703 | 3300046501 | Ga0495607_0007008 | Ga0495607_0007008_3436_4302 | 284 |
| 704 | 3300046501 | Ga0495607_0018591 | Ga0495607_0018591_2091_2957 | 284 |
| 705 | 3300046501 | Ga0495607_0038180 | Ga0495607_0038180_1540_2406 | 284 |
| 706 | 3300046501 | Ga0495607_0078457 | Ga0495607_0078457_139_1005 | 284 |
| 707 | 3300046506 | Ga0495583_0002109 | Ga0495583_0002109_16269_17135 | 284 |
| 708 | 3300046506 | Ga0495583_0002827 | Ga0495583_0002827_7073_7960 | 284 |
| 709 | 3300046506 | Ga0495583_0009758 | Ga0495583_0009758_4255_5121 | 284 |
| 710 | 3300046506 | Ga0495583_0035369 | Ga0495583_0035369_1080_1946 | 284 |
| 711 | 3300046506 | Ga0495583_0038926 | Ga0495583_0038926_261_1127 | 284 |
| 712 | 3300046507 | Ga0495606_0001557 | Ga0495606_0001557_1431_2297 | 284 |
| 713 | 3300046507 | Ga0495606_0002202 | Ga0495606_0002202_20903_21766 | 284 |
| 714 | 3300046507 | Ga0495606_0004299 | Ga0495606_0004299_6166_7032 | 284 |
| 715 | 3300046507 | Ga0495606_0011916 | Ga0495606_0011916_5166_6032 | 284 |
| 716 | 3300046507 | Ga0495606_0012904 | Ga0495606_0012904_4933_5799 | 284 |
| 717 | 3300046507 | Ga0495606_0049659 | Ga0495606_0049659_1159_2025 | 284 |
| 718 | 3300046507 | Ga0495606_0060956 | Ga0495606_0060956_1445_2311 | 284 |
| 719 | 3300046507 | Ga0495606_0078390 | Ga0495606_0078390_78_944 | 284 |
| 720 | 3300046507 | Ga0495606_0098874 | Ga0495606_0098874_78_944 | 284 |
| 721 | 3300046512 | Ga0495610_0017381 | Ga0495610_0017381_2976_3839 | 284 |
| 722 | 3300046512 | Ga0495610_0043864 | Ga0495610_0043864_490_1356 | 284 |
| 723 | 3300046512 | Ga0495610_0048765 | Ga0495610_0048765_1037_1903 | 284 |
| 724 | 3300046512 | Ga0495610_0075000 | Ga0495610_0075000_154_1020 | 284 |
| 725 | 3300046513 | Ga0495616_0016127 | Ga0495616_0016127_812_1678 | 284 |
| 726 | 3300046513 | Ga0495616_0033659 | Ga0495616_0033659_948_1814 | 284 |
| 727 | 3300046513 | Ga0495616_0038723 | Ga0495616_0038723_1460_2326 | 284 |
| 728 | 3300046513 | Ga0495616_0041034 | Ga0495616_0041034_1029_1895 | 284 |
| 729 | 3300046513 | Ga0495616_0042438 | Ga0495616_0042438_903_1769 | 284 |
| 730 | 3300046513 | Ga0495616_0051275 | Ga0495616_0051275_1024_1890 | 284 |
| 731 | 3300046515 | Ga0495620_0000001 | Ga0495620_0000001_135404_136291 | 284 |
| 732 | 3300046515 | Ga0495620_0009249 | Ga0495620_0009249_1760_2626 | 284 |
| 733 | 3300046515 | Ga0495620_0023343 | Ga0495620_0023343_529_1395 | 284 |
| 734 | 3300046515 | Ga0495620_0076795 | Ga0495620_0076795_94_960 | 284 |
| 735 | 3300046518 | Ga0495631_0019634 | Ga0495631_0019634_1220_2086 | 284 |
| 736 | 3300046518 | Ga0495631_0026377 | Ga0495631_0026377_1250_2116 | 284 |
| 737 | 3300046519 | Ga0495632_0002643 | Ga0495632_0002643_7584_8450 | 284 |
| 738 | 3300046519 | Ga0495632_0005088 | Ga0495632_0005088_6720_7586 | 284 |
| 739 | 3300046519 | Ga0495632_0020004 | Ga0495632_0020004_995_1861 | 284 |
| 740 | 3300046519 | Ga0495632_0021622 | Ga0495632_0021622_438_1304 | 284 |
| 741 | 3300046519 | Ga0495632_0047465 | Ga0495632_0047465_901_1767 | 284 |
| 742 | 3300046520 | Ga0495637_0001790 | Ga0495637_0001790_2224_3090 | 284 |
| 743 | 3300046520 | Ga0495637_0014025 | Ga0495637_0014025_2422_3288 | 284 |
| 744 | 3300046520 | Ga0495637_0015776 | Ga0495637_0015776_1582_2448 | 284 |
| 745 | 3300046520 | Ga0495637_0018058 | Ga0495637_0018058_1230_2096 | 284 |
| 746 | 3300046520 | Ga0495637_0026474 | Ga0495637_0026474_471_1337 | 284 |
| 747 | 3300046520 | Ga0495637_0056900 | Ga0495637_0056900_186_1052 | 284 |
| 748 | 3300046520 | Ga0495637_0069799 | Ga0495637_0069799_526_1392 | 284 |
| 749 | 3300046522 | Ga0495643_0003239 | Ga0495643_0003239_65_928 | 284 |
| 750 | 3300046522 | Ga0495643_0027832 | Ga0495643_0027832_2026_2892 | 284 |
| 751 | 3300046522 | Ga0495643_0115583 | Ga0495643_0115583_65_928 | 284 |
| 752 | 3300046523 | Ga0495644_0016310 | Ga0495644_0016310_927_1793 | 284 |
| 753 | 3300046523 | Ga0495644_0020430 | Ga0495644_0020430_1053_1919 | 284 |
| 754 | 3300046523 | Ga0495644_0022569 | Ga0495644_0022569_923_1789 | 284 |
| 755 | 3300046524 | Ga0495648_0001740 | Ga0495648_0001740_955_1821 | 284 |
| 756 | 3300046524 | Ga0495648_0005382 | Ga0495648_0005382_4137_5024 | 284 |
| 757 | 3300046524 | Ga0495648_0010306 | Ga0495648_0010306_1761_2627 | 284 |
| 758 | 3300046524 | Ga0495648_0018275 | Ga0495648_0018275_591_1457 | 284 |
| 759 | 3300046524 | Ga0495648_0049120 | Ga0495648_0049120_1492_2358 | 284 |
| 760 | 3300046524 | Ga0495648_0055774 | Ga0495648_0055774_1043_1909 | 284 |
| 761 | 3300046524 | Ga0495648_0147540 | Ga0495648_0147540_204_1070 | 284 |
| 762 | 3300046526 | Ga0495666_0044498 | Ga0495666_0044498_1021_1887 | 284 |
| 763 | 3300046528 | Ga0495642_0001494 | Ga0495642_0001494_9008_9874 | 284 |
| 764 | 3300046528 | Ga0495642_0002271 | Ga0495642_0002271_4934_5800 | 284 |
| 765 | 3300046528 | Ga0495642_0003355 | Ga0495642_0003355_660_1526 | 284 |
| 766 | 3300046530 | Ga0495654_0005186 | Ga0495654_0005186_4625_5491 | 284 |
| 767 | 3300046530 | Ga0495654_0028531 | Ga0495654_0028531_1635_2501 | 284 |
| 768 | 3300046530 | Ga0495654_0035572 | Ga0495654_0035572_471_1337 | 284 |
| 769 | 3300046530 | Ga0495654_0083190 | Ga0495654_0083190_248_1114 | 284 |
| 770 | 3300046530 | Ga0495654_0098157 | Ga0495654_0098157_332_1198 | 284 |
| 771 | 3300046536 | Ga0495587_0092871 | Ga0495587_0092871_33_899 | 284 |
| 772 | 3300046538 | Ga0495609_0000012 | Ga0495609_0000012_173101_173988 | 284 |
| 773 | 3300046538 | Ga0495609_0003344 | Ga0495609_0003344_6828_7694 | 284 |
| 774 | 3300046538 | Ga0495609_0003527 | Ga0495609_0003527_2402_3268 | 284 |
| 775 | 3300046538 | Ga0495609_0008316 | Ga0495609_0008316_3635_4501 | 284 |
| 776 | 3300046542 | Ga0495597_0017788 | Ga0495597_0017788_1815_2681 | 284 |
| 777 | 3300046542 | Ga0495597_0040151 | Ga0495597_0040151_802_1668 | 284 |
| 778 | 3300046542 | Ga0495597_0067733 | Ga0495597_0067733_549_1415 | 284 |
| 779 | 3300046557 | Ga0495622_0005470 | Ga0495622_0005470_4917_5783 | 284 |
| 780 | 3300046557 | Ga0495622_0016696 | Ga0495622_0016696_1569_2435 | 284 |
| 781 | 3300046557 | Ga0495622_0031473 | Ga0495622_0031473_1180_2046 | 284 |
| 782 | 3300046557 | Ga0495622_0076376 | Ga0495622_0076376_397_1263 | 284 |
| 783 | 3300046558 | Ga0495633_0000034 | Ga0495633_0000034_6457_7344 | 284 |
| 784 | 3300046558 | Ga0495633_0017329 | Ga0495633_0017329_1768_2634 | 284 |
| 785 | 3300046615 | Ga0495656_0002963 | Ga0495656_0002963_3639_4505 | 284 |
| 786 | 3300046616 | Ga0495668_0022598 | Ga0495668_0022598_1711_2577 | 284 |
| 787 | 3300046642 | Ga0495634_0039721 | Ga0495634_0039721_1452_2318 | 284 |
| 788 | 3300046648 | Ga0495611_0000087 | Ga0495611_0000087_594_1481 | 284 |
| 789 | 3300046648 | Ga0495611_0019217 | Ga0495611_0019217_1562_2428 | 284 |
| 790 | 3300046660 | Ga0495625_0014739 | Ga0495625_0014739_1071_1937 | 284 |
| 791 | 3300046660 | Ga0495625_0049192 | Ga0495625_0049192_1121_1987 | 284 |
| 792 | 3300046660 | Ga0495625_0056382 | Ga0495625_0056382_958_1824 | 284 |
| 793 | 3300046660 | Ga0495625_0059637 | Ga0495625_0059637_502_1368 | 284 |
| 794 | 3300046660 | Ga0495625_0207763 | Ga0495625_0207763_407_1273 | 284 |
| 795 | 3300046663 | Ga0495635_0043323 | Ga0495635_0043323_1411_2277 | 284 |
| 796 | 3300046665 | Ga0495661_0000004 | Ga0495661_0000004_376693_377580 | 284 |
| 797 | 3300046665 | Ga0495661_0000028 | Ga0495661_0000028_172276_173142 | 284 |
| 798 | 3300046665 | Ga0495661_0029104 | Ga0495661_0029104_2181_3047 | 284 |
| 799 | 3300046665 | Ga0495661_0033680 | Ga0495661_0033680_1664_2530 | 284 |
| 800 | 3300046665 | Ga0495661_0035431 | Ga0495661_0035431_1693_2559 | 284 |
| 801 | 3300046674 | Ga0495588_0013704 | Ga0495588_0013704_619_1485 | 284 |
| 802 | 3300046680 | Ga0495646_0060500 | Ga0495646_0060500_454_1320 | 284 |
| 803 | 3300046684 | Ga0495669_0005702 | Ga0495669_0005702_1246_2112 | 284 |
| 804 | 3300046689 | Ga0495613_0089766 | Ga0495613_0089766_1020_1886 | 284 |
| 805 | 3300046690 | Ga0495624_0004989 | Ga0495624_0004989_1015_1881 | 284 |
| 806 | 3300046691 | Ga0495670_0006645 | Ga0495670_0006645_4570_5433 | 284 |
| 807 | 3300046691 | Ga0495670_0023440 | Ga0495670_0023440_1009_1875 | 284 |
| 808 | 3300046691 | Ga0495670_0034406 | Ga0495670_0034406_483_1349 | 284 |
| 809 | 3300046691 | Ga0495670_0038914 | Ga0495670_0038914_849_1715 | 284 |
| 810 | 3300046692 | Ga0495671_0001003 | Ga0495671_0001003_4865_5731 | 284 |
| 811 | 3300046692 | Ga0495671_0005757 | Ga0495671_0005757_122_985 | 284 |
| 812 | 3300046692 | Ga0495671_0005823 | Ga0495671_0005823_5438_6304 | 284 |
| 813 | 3300046692 | Ga0495671_0006451 | Ga0495671_0006451_853_1719 | 284 |
| 814 | 3300046692 | Ga0495671_0012528 | Ga0495671_0012528_1268_2155 | 284 |
| 815 | 3300046692 | Ga0495671_0027502 | Ga0495671_0027502_1524_2390 | 284 |
| 816 | 3300046692 | Ga0495671_0030431 | Ga0495671_0030431_449_1315 | 284 |
| 817 | 3300046692 | Ga0495671_0038771 | Ga0495671_0038771_1189_2055 | 284 |
| 818 | 3300046692 | Ga0495671_0046929 | Ga0495671_0046929_404_1270 | 284 |
| 819 | 3300046692 | Ga0495671_0070167 | Ga0495671_0070167_84_950 | 284 |
| 820 | 3300046694 | Ga0495649_0004978 | Ga0495649_0004978_119_985 | 284 |
| 821 | 3300046694 | Ga0495649_0013633 | Ga0495649_0013633_902_1768 | 284 |
| 822 | 3300046694 | Ga0495649_0017670 | Ga0495649_0017670_1483_2346 | 284 |
| 823 | 3300046694 | Ga0495649_0031447 | Ga0495649_0031447_501_1367 | 284 |
| 824 | 3300046694 | Ga0495649_0074345 | Ga0495649_0074345_104_970 | 284 |
| 825 | 3300046694 | Ga0495649_0077622 | Ga0495649_0077622_530_1396 | 284 |
| 826 | 3300046694 | Ga0495649_0089796 | Ga0495649_0089796_431_1294 | 284 |
| 827 | 3300046794 | Ga0495589_0004519 | Ga0495589_0004519_2756_3622 | 284 |
| 828 | 3300046794 | Ga0495589_0009874 | Ga0495589_0009874_1164_2030 | 284 |
| 829 | 3300046794 | Ga0495589_0025524 | Ga0495589_0025524_1587_2453 | 284 |
| 830 | 3300046810 | Ga0495660_0005085 | Ga0495660_0005085_542_1429 | 284 |
| 831 | 3300046810 | Ga0495660_0008278 | Ga0495660_0008278_1811_2677 | 284 |
| 832 | 3300046810 | Ga0495660_0048407 | Ga0495660_0048407_1366_2232 | 284 |
| 833 | 3300046810 | Ga0495660_0067759 | Ga0495660_0067759_874_1740 | 284 |
| 834 | 3300046810 | Ga0495660_0085531 | Ga0495660_0085531_699_1565 | 284 |
| 835 | 3300047318 | Ga0495636_0006933 | Ga0495636_0006933_2157_3023 | 284 |
| 836 | 3300047320 | Ga0495672_0007313 | Ga0495672_0007313_932_1798 | 284 |
| 837 | 3300047320 | Ga0495672_0034531 | Ga0495672_0034531_1654_2520 | 284 |
| 838 | 3300047320 | Ga0495672_0047729 | Ga0495672_0047729_1058_1924 | 284 |
| 839 | 3300047320 | Ga0495672_0050453 | Ga0495672_0050453_587_1453 | 284 |
| 840 | 3300047320 | Ga0495672_0052406 | Ga0495672_0052406_465_1331 | 284 |
| 841 | 3300047321 | Ga0495676_0021883 | Ga0495676_0021883_3365_4231 | 284 |
| 842 | 3300047321 | Ga0495676_0088536 | Ga0495676_0088536_1029_1895 | 284 |
| 843 | 3300047322 | Ga0495680_0052297 | Ga0495680_0052297_32_898 | 284 |
| 844 | 3300047323 | Ga0495683_0000059 | Ga0495683_0000059_12946_13812 | 284 |
| 845 | 3300047323 | Ga0495683_0000445 | Ga0495683_0000445_17544_18431 | 284 |
| 846 | 3300047323 | Ga0495683_0004382 | Ga0495683_0004382_2013_2879 | 284 |
| 847 | 3300047323 | Ga0495683_0013480 | Ga0495683_0013480_1063_1929 | 284 |
| 848 | 3300047323 | Ga0495683_0060049 | Ga0495683_0060049_521_1387 | 284 |
| 849 | 3300047443 | Ga0495687_019958 | Ga0495687_019958_999_1865 | 284 |
| 850 | 3300047443 | Ga0495687_034916 | Ga0495687_034916_836_1702 | 284 |
| 851 | 3300047444 | Ga0495675_0049885 | Ga0495675_0049885_1528_2394 | 284 |
| 852 | 3300047446 | Ga0495679_004065 | Ga0495679_004065_1440_2327 | 284 |
| 853 | 3300047446 | Ga0495679_031872 | Ga0495679_031872_19_885 | 284 |
| 854 | 3300047447 | Ga0495685_024708 | Ga0495685_024708_82_948 | 284 |
| 855 | 3300047469 | Ga0495673_0006116 | Ga0495673_0006116_1064_1930 | 284 |
| 856 | 3300047469 | Ga0495673_0006812 | Ga0495673_0006812_885_1751 | 284 |
| 857 | 3300047469 | Ga0495673_0019115 | Ga0495673_0019115_661_1527 | 284 |
| 858 | 3300047469 | Ga0495673_0024606 | Ga0495673_0024606_813_1679 | 284 |
| 859 | 3300047469 | Ga0495673_0029142 | Ga0495673_0029142_1372_2238 | 284 |
| 860 | 3300047469 | Ga0495673_0049795 | Ga0495673_0049795_939_1805 | 284 |
| 861 | 3300047469 | Ga0495673_0061554 | Ga0495673_0061554_179_1045 | 284 |
| 862 | 3300047470 | Ga0495681_0015785 | Ga0495681_0015785_2553_3419 | 284 |
| 863 | 3300047470 | Ga0495681_0022519 | Ga0495681_0022519_1174_2040 | 284 |
| 864 | 3300047470 | Ga0495681_0032114 | Ga0495681_0032114_1360_2226 | 284 |
| 865 | 3300047470 | Ga0495681_0038614 | Ga0495681_0038614_1368_2234 | 284 |
| 866 | 3300047470 | Ga0495681_0055559 | Ga0495681_0055559_921_1787 | 284 |
| 867 | 3300047472 | Ga0495686_0037920 | Ga0495686_0037920_1169_2035 | 284 |
| 868 | 3300047472 | Ga0495686_0062452 | Ga0495686_0062452_576_1442 | 284 |
| 869 | 3300048088 | Ga0495602_0112382 | Ga0495602_0112382_987_1853 | 284 |
| 870 | 3300048091 | Ga0495626_0001466 | Ga0495626_0001466_16696_17562 | 284 |
| 871 | 3300048091 | Ga0495626_0003622 | Ga0495626_0003622_4441_5307 | 284 |
| 872 | 3300048091 | Ga0495626_0003788 | Ga0495626_0003788_4436_5302 | 284 |
| 873 | 3300048091 | Ga0495626_0017420 | Ga0495626_0017420_1101_1967 | 284 |
| 874 | 3300048091 | Ga0495626_0036982 | Ga0495626_0036982_428_1294 | 284 |
| 875 | 3300048091 | Ga0495626_0053732 | Ga0495626_0053732_567_1433 | 284 |
| 876 | 3300048091 | Ga0495626_0083251 | Ga0495626_0083251_69_935 | 284 |
| 877 | 3300048905 | Ga0496102_0001878 | Ga0496102_0001878_11356_12222 | 284 |
| 878 | 3300048919 | Ga0496116_0005694 | Ga0496116_0005694_9171_10037 | 284 |
| 879 | 3300048919 | Ga0496116_0036352 | Ga0496116_0036352_2305_3171 | 284 |
| 880 | 3300048919 | Ga0496116_0072541 | Ga0496116_0072541_431_1297 | 284 |
| 881 | 3300048920 | Ga0496117_0005527 | Ga0496117_0005527_837_1703 | 284 |
| 882 | 3300048920 | Ga0496117_0083816 | Ga0496117_0083816_662_1528 | 284 |
| 883 | 3300048920 | Ga0496117_0112417 | Ga0496117_0112417_291_1157 | 284 |
| 884 | 3300048921 | Ga0496118_0056794 | Ga0496118_0056794_662_1528 | 284 |
| 885 | 3300048921 | Ga0496118_0095589 | Ga0496118_0095589_578_1444 | 284 |
| 886 | 3300048924 | Ga0496121_0120511 | Ga0496121_0120511_149_1015 | 284 |
| 887 | 3300048925 | Ga0496122_0086385 | Ga0496122_0086385_974_1840 | 284 |
| 888 | 3300048926 | Ga0496123_0010850 | Ga0496123_0010850_652_1539 | 284 |
| 889 | 3300048926 | Ga0496123_0060534 | Ga0496123_0060534_608_1474 | 284 |
| 890 | 3300048927 | Ga0496124_0081171 | Ga0496124_0081171_295_1161 | 284 |
| 891 | 3300048929 | Ga0496126_0270528 | Ga0496126_0270528_68_961 | 284 |
| 892 | 3300049459 | Ga0495678_000036 | Ga0495678_000036_182912_183799 | 284 |
| 893 | 3300049459 | Ga0495678_006946 | Ga0495678_006946_5043_5909 | 284 |
| 894 | 3300049459 | Ga0495678_025219 | Ga0495678_025219_1222_2088 | 284 |
| 895 | 3300049459 | Ga0495678_026220 | Ga0495678_026220_366_1232 | 284 |
| 896 | 3300049459 | Ga0495678_059471 | Ga0495678_059471_140_1006 | 284 |
| 897 | 3300049460 | Ga0495682_0020359 | Ga0495682_0020359_1163_2029 | 284 |
| 898 | 3300049460 | Ga0495682_0059803 | Ga0495682_0059803_281_1147 | 284 |
| 899 | 3300053111 | Ga0500572_010015 | Ga0500572_010015_991_1857 | 284 |
| 900 | iso_pu_bacteria | 2507262055 | 2507507158 | 284 |
| 901 | iso_pu_bacteria | 2508501009 | 2508541208 | 284 |
| 902 | iso_pu_bacteria | 2508501042 | 2508693456 | 284 |
| 903 | iso_pu_bacteria | 2508501050 | 2508729356 | 284 |
| 904 | iso_pu_bacteria | 2508501114 | 2509077833 | 284 |
| 905 | iso_pu_bacteria | 2508501128 | 2509147101 | 284 |
| 906 | iso_pu_bacteria | 2510461069 | 2510840821 | 284 |
| 907 | iso_pu_bacteria | 2510917030 | 2511193497 | 284 |
| 908 | iso_pu_bacteria | 2511231027 | 2511392114 | 284 |
| 909 | iso_pu_bacteria | 2511231028 | 2511397706 | 284 |
| 910 | iso_pu_bacteria | 2513237092 | 2513627116 | 284 |
| 911 | iso_pu_bacteria | 2513237094 | 2513637225 | 284 |
| 912 | iso_pu_bacteria | 2513237095 | 2513651617 | 284 |
| 913 | iso_pu_bacteria | 2513237096 | 2513655804 | 284 |
| 914 | iso_pu_bacteria | 2513237098 | 2513672006 | 284 |
| 915 | iso_pu_bacteria | 2513237101 | 2513696498 | 284 |
| 916 | iso_pu_bacteria | 2513237102 | 2513703035 | 284 |
| 917 | iso_pu_bacteria | 2513237104 | 2513717409 | 284 |
| 918 | iso_pu_bacteria | 2513237137 | 2513856700 | 284 |
| 919 | iso_pu_bacteria | 2513237138 | 2513866075 | 284 |
| 920 | iso_pu_bacteria | 2513237139 | 2513876779 | 284 |
| 921 | iso_pu_bacteria | 2513237141 | 2513887509 | 284 |
| 922 | iso_pu_bacteria | 2513237145 | 2513917283 | 284 |
| 923 | iso_pu_bacteria | 2513237161 | 2514012183 | 284 |
| 924 | iso_pu_bacteria | 2513237351 | 2514589950 | 284 |
| 925 | iso_pu_bacteria | 2515154112 | 2515628815 | 284 |
| 926 | iso_pu_bacteria | 2517093001 | 2517107370 | 284 |
| 927 | iso_pu_bacteria | 2517572143 | 2517895435 | 284 |
| 928 | iso_pu_bacteria | 2524023205 | 2524439545 | 284 |
| 929 | iso_pu_bacteria | 2524023210 | 2524469215 | 284 |
| 930 | iso_pu_bacteria | 2524023228 | 2524539609 | 284 |
| 931 | iso_pu_bacteria | 2528768022 | 2528851012 | 284 |
| 932 | iso_pu_bacteria | 2558860983 | 2561467802 | 284 |
| 933 | iso_pu_bacteria | 2582581298 | 2585226806 | 284 |
| 934 | iso_pu_bacteria | 2582581299 | 2585229825 | 284 |
| 935 | iso_pu_bacteria | 2582581304 | 2585254935 | 284 |
| 936 | iso_pu_bacteria | 2582581867 | 2585404330 | 284 |
| 937 | iso_pu_bacteria | 2585427529 | 2585550221 | 284 |
| 938 | iso_pu_bacteria | 2585427590 | 2585821970 | 284 |
| 939 | iso_pu_bacteria | 2585427594 | 2585843031 | 284 |
| 940 | iso_pu_bacteria | 2597490356 | 2599103784 | 284 |
| 941 | iso_pu_bacteria | 2602042107 | 2603857789 | 284 |
| 942 | iso_pu_bacteria | 2617270735 | 2617348024 | 284 |
| 943 | iso_pu_bacteria | 2617270741 | 2617377743 | 284 |
| 944 | iso_pu_bacteria | 2643221551 | 2643775556 | 284 |
| 945 | iso_pu_bacteria | 2643221555 | 2643794002 | 284 |
| 946 | iso_pu_bacteria | 2643221568 | 2643854370 | 284 |
| 947 | iso_pu_bacteria | 2643221599 | 2644005499 | 284 |
| 948 | iso_pu_bacteria | 2643221634 | 2644192539 | 284 |
| 949 | iso_pu_bacteria | 2643221637 | 2644209368 | 284 |
| 950 | iso_pu_bacteria | 2643221643 | 2644238487 | 284 |
| 951 | iso_pu_bacteria | 2643221651 | 2644291281 | 284 |
| 952 | iso_pu_bacteria | 2643221653 | 2644298161 | 284 |
| 953 | iso_pu_bacteria | 2643221718 | 2644652896 | 284 |
| 954 | iso_pu_bacteria | 2643221719 | 2644656413 | 284 |
| 955 | iso_pu_bacteria | 2643221733 | 2644729811 | 284 |
| 956 | iso_pu_bacteria | 2667528175 | 2671122110 | 284 |
| 957 | iso_pu_bacteria | 2693429784 | 2694634421 | 284 |
| 958 | iso_pu_bacteria | 2721755755 | 2723843007 | 284 |
| 959 | iso_pu_bacteria | 2728368998 | 2728754409 | 284 |
| 960 | iso_pu_bacteria | 2738541293 | 2738804157 | 284 |
| 961 | iso_pu_bacteria | 2744054633 | 2745081818 | 284 |
| 962 | iso_pu_bacteria | 2765235802 | 2765465976 | 284 |
| 963 | iso_pu_bacteria | 2767802442 | 2770196612 | 284 |
| 964 | iso_pu_bacteria | 2773857925 | 2774870133 | 284 |
| 965 | iso_pu_bacteria | 2775506901 | 2776258694 | 284 |
| 966 | iso_pu_bacteria | 2775506902 | 2776267861 | 284 |
| 967 | iso_pu_bacteria | 2775506902 | 2776269278 | 284 |
| 968 | iso_pu_bacteria | 2775506904 | 2776281832 | 284 |
| 969 | iso_pu_bacteria | 2775506904 | 2776283583 | 284 |
| 970 | iso_pu_bacteria | 2775507049 | 2776915833 | 284 |
| 971 | iso_pu_bacteria | 2791355196 | 2793065978 | 284 |
| 972 | iso_pu_bacteria | 2791355197 | 2793069413 | 284 |
| 973 | iso_pu_bacteria | 2791355199 | 2793082439 | 284 |
| 974 | iso_pu_bacteria | 2802429603 | 2805918759 | 284 |
| 975 | iso_pu_bacteria | 2816332527 | 2818243242 | 284 |
| 976 | iso_pu_bacteria | 2818991272 | 2819244245 | 284 |
| 977 | iso_pu_bacteria | 2821123053 | 2821126665 | 284 |
| 978 | iso_pu_bacteria | 2824600985 | 2824605486 | 284 |
| 979 | iso_pu_bacteria | 2824609381 | 2824614824 | 284 |
| 980 | iso_pu_bacteria | 2824617872 | 2824622612 | 284 |
| 981 | iso_pu_bacteria | 2824626560 | 2824631775 | 284 |
| 982 | iso_pu_bacteria | 2824635225 | 2824638943 | 284 |
| 983 | iso_pu_bacteria | 2824644064 | 2824648875 | 284 |
| 984 | iso_pu_bacteria | 2824653114 | 2824658075 | 284 |
| 985 | iso_pu_bacteria | 2824661429 | 2824667920 | 284 |
| 986 | iso_pu_bacteria | 2824671348 | 2824673919 | 284 |
| 987 | iso_pu_bacteria | 2824679649 | 2824681669 | 284 |
| 988 | iso_pu_bacteria | 2824687955 | 2824690633 | 284 |
| 989 | iso_pu_bacteria | 2824696289 | 2824698154 | 284 |
| 990 | iso_pu_bacteria | 2824704595 | 2824707495 | 284 |
| 991 | iso_pu_bacteria | 2824714736 | 2824721310 | 284 |
| 992 | iso_pu_bacteria | 2824723954 | 2824731315 | 284 |
| 993 | iso_pu_bacteria | 2824732956 | 2824736958 | 284 |
| 994 | iso_pu_bacteria | 2824746037 | 2824746429 | 284 |
| 995 | iso_pu_bacteria | 2824753945 | 2824759244 | 284 |
| 996 | iso_pu_bacteria | 2824763712 | 2824769552 | 284 |
| 997 | iso_pu_bacteria | 2824773399 | 2824776135 | 284 |
| 998 | iso_pu_bacteria | 2835312727 | 2835316298 | 284 |
| 999 | iso_pu_bacteria | 2837678835 | 2837683410 | 284 |
| 1000 | iso_pu_bacteria | 2838122688 | 2838127007 | 284 |
| 1001 | iso_pu_bacteria | 2838736955 | 2838740272 | 284 |
| 1002 | iso_pu_bacteria | 2839993093 | 2839993609 | 284 |
| 1003 | iso_pu_bacteria | 2840764183 | 2840766630 | 284 |
| 1004 | iso_pu_bacteria | 2841840854 | 2841843603 | 284 |
| 1005 | iso_pu_bacteria | 2841941048 | 2841945513 | 284 |
| 1006 | iso_pu_bacteria | 2841949485 | 2841954729 | 284 |
| 1007 | iso_pu_bacteria | 2841957949 | 2841965513 | 284 |
| 1008 | iso_pu_bacteria | 2841966195 | 2841974268 | 284 |
| 1009 | iso_pu_bacteria | 2841974524 | 2841980570 | 284 |
| 1010 | iso_pu_bacteria | 2841983080 | 2841988741 | 284 |
| 1011 | iso_pu_bacteria | 2842038055 | 2842045030 | 284 |
| 1012 | iso_pu_bacteria | 2842045827 | 2842052784 | 284 |
| 1013 | iso_pu_bacteria | 2842140634 | 2842143323 | 284 |
| 1014 | iso_pu_bacteria | 2842871566 | 2842874911 | 284 |
| 1015 | iso_pu_bacteria | 2844315083 | 2844320529 | 284 |
| 1016 | iso_pu_bacteria | 2846952575 | 2846957471 | 284 |
| 1017 | iso_pu_bacteria | 2847930680 | 2847938072 | 284 |
| 1018 | iso_pu_bacteria | 2847939898 | 2847939987 | 284 |
| 1019 | iso_pu_bacteria | 2848858292 | 2848863248 | 284 |
| 1020 | iso_pu_bacteria | 2849076700 | 2849077813 | 284 |
| 1021 | iso_pu_bacteria | 2857509624 | 2857510989 | 284 |
| 1022 | iso_pu_bacteria | 2857531043 | 2857536757 | 284 |
| 1023 | iso_pu_bacteria | 2874590934 | 2874596097 | 284 |
| 1024 | iso_pu_bacteria | 2874604998 | 2874606339 | 284 |
| 1025 | iso_pu_bacteria | 2874612657 | 2874616788 | 284 |
| 1026 | iso_pu_bacteria | 2874620515 | 2874625855 | 284 |
| 1027 | iso_pu_bacteria | 2874628541 | 2874633173 | 284 |
| 1028 | iso_pu_bacteria | 2874645413 | 2874650921 | 284 |
| 1029 | iso_pu_bacteria | 2876761206 | 2876769108 | 284 |
| 1030 | iso_pu_bacteria | 2876771140 | 2876776075 | 284 |
| 1031 | iso_pu_bacteria | 2876808645 | 2876810779 | 284 |
| 1032 | iso_pu_bacteria | 2876818435 | 2876820653 | 284 |
| 1033 | iso_pu_bacteria | 2879074833 | 2879080164 | 284 |
| 1034 | iso_pu_bacteria | 2879083081 | 2879084381 | 284 |
| 1035 | iso_pu_bacteria | 2879099564 | 2879100216 | 284 |
| 1036 | iso_pu_bacteria | 2879110137 | 2879118116 | 284 |
| 1037 | iso_pu_bacteria | 2879127579 | 2879129937 | 284 |
| 1038 | iso_pu_bacteria | 2879142872 | 2879147415 | 284 |
| 1039 | iso_pu_bacteria | 2881364244 | 2881367797 | 284 |
| 1040 | iso_pu_bacteria | 2881665667 | 2881672250 | 284 |
| 1041 | iso_pu_bacteria | 2882456835 | 2882461987 | 284 |
| 1042 | iso_pu_bacteria | 2884298095 | 2884299590 | 284 |
| 1043 | iso_pu_bacteria | 2885366525 | 2885368466 | 284 |
| 1044 | iso_pu_bacteria | 2885374607 | 2885382168 | 284 |
| 1045 | iso_pu_bacteria | 2885383462 | 2885383705 | 284 |
| 1046 | iso_pu_bacteria | 2885409591 | 2885410053 | 284 |
| 1047 | iso_pu_bacteria | 2888378607 | 2888386021 | 284 |
| 1048 | iso_pu_bacteria | 2888388044 | 2888392264 | 284 |
| 1049 | iso_pu_bacteria | 2888419890 | 2888426139 | 284 |
| 1050 | iso_pu_bacteria | 2889033259 | 2889033701 | 284 |
| 1051 | iso_pu_bacteria | 2889790730 | 2889793573 | 284 |
| 1052 | iso_pu_bacteria | 2889914905 | 2889918712 | 284 |
| 1053 | iso_pu_bacteria | 2893066018 | 2893068059 | 284 |
| 1054 | iso_pu_bacteria | 2894232714 | 2894241995 | 284 |
| 1055 | iso_pu_bacteria | 2903727486 | 2903732820 | 284 |
| 1056 | iso_pu_bacteria | 2903748898 | 2903750867 | 284 |
| 1057 | iso_pu_bacteria | 2903768456 | 2903770059 | 284 |
| 1058 | iso_pu_bacteria | 2904578770 | 2904579693 | 284 |
| 1059 | iso_pu_bacteria | 2904666416 | 2904673784 | 284 |
| 1060 | iso_pu_bacteria | 2904690495 | 2904698780 | 284 |
| 1061 | iso_pu_bacteria | 2904699407 | 2904710900 | 284 |
| 1062 | iso_pu_bacteria | 2904711408 | 2904717603 | 284 |
| 1063 | iso_pu_bacteria | 2906602504 | 2906605619 | 284 |
| 1064 | iso_pu_bacteria | 2906610324 | 2906615946 | 284 |
| 1065 | iso_pu_bacteria | 2906626472 | 2906627997 | 284 |
| 1066 | iso_pu_bacteria | 2906635258 | 2906639043 | 284 |
| 1067 | iso_pu_bacteria | 2906643746 | 2906644082 | 284 |
| 1068 | iso_pu_bacteria | 2906660503 | 2906662091 | 284 |
| 1069 | iso_pu_bacteria | 2908739725 | 2908740960 | 284 |
| 1070 | iso_pu_bacteria | 2908756301 | 2908759293 | 284 |
| 1071 | iso_pu_bacteria | 2908775508 | 2908782211 | 284 |
| 1072 | iso_pu_bacteria | 2917699015 | 2917700190 | 284 |
| 1073 | iso_pu_bacteria | 2919100787 | 2919102117 | 284 |
| 1074 | iso_pu_bacteria | 2919119836 | 2919120640 | 284 |
| 1075 | iso_pu_bacteria | 2919119836 | 2919124363 | 284 |
| 1076 | iso_pu_bacteria | 2919166419 | 2919168759 | 284 |
| 1077 | iso_pu_bacteria | 2919450847 | 2919455517 | 284 |
| 1078 | iso_pu_bacteria | 2922361189 | 2922367058 | 284 |
| 1079 | iso_pu_bacteria | 2922368715 | 2922376349 | 284 |
| 1080 | iso_pu_bacteria | 2922386360 | 2922390162 | 284 |
| 1081 | iso_pu_bacteria | 2922393267 | 2922399933 | 284 |
| 1082 | iso_pu_bacteria | 2922425934 | 2922432082 | 284 |
| 1083 | iso_pu_bacteria | 2923556063 | 2923558378 | 284 |
| 1084 | iso_pu_bacteria | 2929615660 | 2929624005 | 284 |
| 1085 | iso_pu_bacteria | 2929624759 | 2929633146 | 284 |
| 1086 | iso_pu_bacteria | 2932784394 | 2932792685 | 284 |
| 1087 | iso_pu_bacteria | 2932794094 | 2932797848 | 284 |
| 1088 | iso_pu_bacteria | 2932801729 | 2932806384 | 284 |
| 1089 | iso_pu_bacteria | 2932809354 | 2932815225 | 284 |
| 1090 | iso_pu_bacteria | 2932818245 | 2932824496 | 284 |
| 1091 | iso_pu_bacteria | 2932828146 | 2932832104 | 284 |
| 1092 | iso_pu_bacteria | 2933577622 | 2933585906 | 284 |
| 1093 | iso_pu_bacteria | 2935608549 | 2935610463 | 284 |
| 1094 | iso_pu_bacteria | 2935616580 | 2935622043 | 284 |
| 1095 | iso_pu_bacteria | 2935630451 | 2935631041 | 284 |
| 1096 | iso_pu_bacteria | 2935638405 | 2935643947 | 284 |
| 1097 | iso_pu_bacteria | 2935648319 | 2935654335 | 284 |
| 1098 | iso_pu_bacteria | 2935656913 | 2935663215 | 284 |
| 1099 | iso_pu_bacteria | 2935665750 | 2935669138 | 284 |
| 1100 | iso_pu_bacteria | 2935675223 | 2935683304 | 284 |
| 1101 | iso_pu_bacteria | 2935684952 | 2935692245 | 284 |
| 1102 | iso_pu_bacteria | 2935694250 | 2935700584 | 284 |
| 1103 | iso_pu_bacteria | 2935703347 | 2935708787 | 284 |
| 1104 | iso_pu_bacteria | 2935713505 | 2935720517 | 284 |
| 1105 | iso_pu_bacteria | 2935722832 | 2935729798 | 284 |
| 1106 | iso_pu_bacteria | 2935732158 | 2935739220 | 284 |
| 1107 | iso_pu_bacteria | 2935741537 | 2935748239 | 284 |
| 1108 | iso_pu_bacteria | 2935750917 | 2935758442 | 284 |
| 1109 | iso_pu_bacteria | 2935760218 | 2935766131 | 284 |
| 1110 | iso_pu_bacteria | 2935769743 | 2935771010 | 284 |
| 1111 | iso_pu_bacteria | 2935777560 | 2935781179 | 284 |
| 1112 | iso_pu_bacteria | 2935785616 | 2935786289 | 284 |
| 1113 | iso_pu_bacteria | 2935793552 | 2935793914 | 284 |
| 1114 | iso_pu_bacteria | 2935801545 | 2935805854 | 284 |
| 1115 | iso_pu_bacteria | 2935810662 | 2935815587 | 284 |
| 1116 | iso_pu_bacteria | 2935819856 | 2935823624 | 284 |
| 1117 | iso_pu_bacteria | 2935827899 | 2935833199 | 284 |
| 1118 | iso_pu_bacteria | 2935837841 | 2935843231 | 284 |
| 1119 | iso_pu_bacteria | 2935847175 | 2935849150 | 284 |
| 1120 | iso_pu_bacteria | 2935855204 | 2935860290 | 284 |
| 1121 | iso_pu_bacteria | 2935864058 | 2935867687 | 284 |
| 1122 | iso_pu_bacteria | 2935873716 | 2935878503 | 284 |
| 1123 | iso_pu_bacteria | 2935883170 | 2935888391 | 284 |
| 1124 | iso_pu_bacteria | 2935908558 | 2935912760 | 284 |
| 1125 | iso_pu_bacteria | 2935916978 | 2935922921 | 284 |
| 1126 | iso_pu_bacteria | 2935926038 | 2935930346 | 284 |
| 1127 | iso_pu_bacteria | 2935934488 | 2935939246 | 284 |
| 1128 | iso_pu_bacteria | 2935942939 | 2935946194 | 284 |
| 1129 | iso_pu_bacteria | 2935951376 | 2935955531 | 284 |
| 1130 | iso_pu_bacteria | 2935959822 | 2935966842 | 284 |
| 1131 | iso_pu_bacteria | 2935967501 | 2935972098 | 284 |
| 1132 | iso_pu_bacteria | 2935975950 | 2935976032 | 284 |
| 1133 | iso_pu_bacteria | 2935984226 | 2935986477 | 284 |
| 1134 | iso_pu_bacteria | 2935992306 | 2935998613 | 284 |
| 1135 | iso_pu_bacteria | 2936002035 | 2936006920 | 284 |
| 1136 | iso_pu_bacteria | 2936011229 | 2936017371 | 284 |
| 1137 | iso_pu_bacteria | 2936019824 | 2936025873 | 284 |
| 1138 | iso_pu_bacteria | 2936028420 | 2936034719 | 284 |
| 1139 | iso_pu_bacteria | 2936037263 | 2936040825 | 284 |
| 1140 | iso_pu_bacteria | 2936046547 | 2936052776 | 284 |
| 1141 | iso_pu_bacteria | 2936055302 | 2936059971 | 284 |
| 1142 | iso_pu_bacteria | 2940556831 | 2940564346 | 284 |
| 1143 | iso_pu_bacteria | 2941507105 | 2941507693 | 284 |
| 1144 | iso_pu_bacteria | 2941515067 | 2941516120 | 284 |
| 1145 | iso_pu_bacteria | 2941523033 | 2941523172 | 284 |
| 1146 | iso_pu_bacteria | 2941531003 | 2941531727 | 284 |
| 1147 | iso_pu_bacteria | 2941538514 | 2941544777 | 284 |
| 1148 | iso_pu_bacteria | 2989776772 | 2989776884 | 284 |
| 1149 | iso_pu_bacteria | 2996336353 | 2996337777 | 284 |
| 1150 | iso_pu_bacteria | 3002141150 | 3002141988 | 284 |
| 1151 | iso_pu_bacteria | 3005445848 | 3005450539 | 284 |
| 1152 | iso_pu_bacteria | 3005452660 | 3005457718 | 284 |
| 1153 | iso_pu_bacteria | 3005474847 | 3005476895 | 284 |
| 1154 | iso_pu_bacteria | 3005483717 | 3005489154 | 284 |
| 1155 | iso_pu_bacteria | 3005506211 | 3005511522 | 284 |
| 1156 | iso_pu_bacteria | 3005587118 | 3005594400 | 284 |
| 1157 | iso_pu_bacteria | 3005594810 | 3005600922 | 284 |
| 1158 | iso_pu_bacteria | 3005710791 | 3005716315 | 284 |
| 1159 | iso_pu_bacteria | 3005718088 | 3005723706 | 284 |
| 1160 | iso_pu_bacteria | 641522639 | 641642203 | 284 |
| 1161 | iso_pu_bacteria | 8005246636 | 8005247838 | 284 |
| 1162 | iso_pu_bacteria | 8006926726 | 8006932581 | 284 |
| 1163 | iso_pu_bacteria | 8006933436 | 8006934522 | 284 |
| 1164 | iso_pu_bacteria | 8006964411 | 8006966593 | 284 |
| 1165 | iso_pu_bacteria | 8006973647 | 8006974492 | 284 |
| 1166 | iso_pu_bacteria | 8006984368 | 8006989442 | 284 |
| 1167 | iso_pu_bacteria | 8006994254 | 8006997910 | 284 |
| 1168 | iso_pu_bacteria | 8016511872 | 8016520062 | 284 |
| 1169 | iso_pu_bacteria | 8016522445 | 8016527981 | 284 |
| 1170 | iso_pu_bacteria | 8016530956 | 8016533104 | 284 |
| 1171 | iso_pu_bacteria | 8016539877 | 8016546339 | 284 |
| 1172 | iso_pu_bacteria | 8016548790 | 8016555786 | 284 |
| 1173 | iso_pu_bacteria | 8016557553 | 8016564137 | 284 |
| 1174 | iso_pu_bacteria | 8016575299 | 8016575679 | 284 |
| 1175 | iso_pu_bacteria | 8016595262 | 8016601840 | 284 |
| 1176 | iso_pu_bacteria | 8016603502 | 8016608410 | 284 |
| 1177 | iso_pu_bacteria | 8016613128 | 8016616457 | 284 |
| 1178 | iso_pu_bacteria | 8016622563 | 8016624681 | 284 |
| 1179 | iso_pu_bacteria | 8016630954 | 8016638170 | 284 |
| 1180 | iso_pu_bacteria | 8017057580 | 8017065492 | 284 |
| 1181 | iso_pu_bacteria | 8018150411 | 8018154128 | 284 |
| 1182 | iso_pu_bacteria | 8019538911 | 8019546949 | 284 |
| 1183 | iso_pu_bacteria | 8019547302 | 8019551720 | 284 |
| 1184 | iso_pu_bacteria | 8019555841 | 8019564157 | 284 |
| 1185 | iso_pu_bacteria | 8019565922 | 8019574231 | 284 |
| 1186 | iso_pu_bacteria | 8019576017 | 8019584894 | 284 |
| 1187 | iso_pu_bacteria | 8019608314 | 8019609765 | 284 |
| 1188 | iso_pu_bacteria | 8019619141 | 8019620350 | 284 |
| 1189 | iso_pu_bacteria | 8019629233 | 8019632752 | 284 |
| 1190 | iso_pu_bacteria | 8019638758 | 8019647179 | 284 |
| 1191 | iso_pu_bacteria | 8019648815 | 8019655508 | 284 |
| 1192 | iso_pu_bacteria | 8019678201 | 8019686066 | 284 |
| 1193 | iso_pu_bacteria | 8045864390 | 8045867823 | 284 |
| 1194 | iso_pu_bacteria | 8054460903 | 8054465432 | 284 |
| 1195 | iso_pu_bacteria | 8055742211 | 8055744523 | 284 |
| 1196 | iso_pu_bacteria | 8056673599 | 8056674938 | 284 |
| 1197 | iso_pu_bacteria | 8056681323 | 8056682151 | 284 |
| 1198 | iso_pu_bacteria | 8056689827 | 8056694846 | 284 |
| 1199 | iso_pu_bacteria | 8056875544 | 8056876433 | 284 |
| 1200 | iso_pu_bacteria | 8056967851 | 8056970435 | 284 |
| 1201 | 3300003794 | Ga0055531_10041864 | Ga0055531_100418642 | 285 |
| 1202 | 3300005577 | Ga0068857_100458514 | Ga0068857_1004585141 | 285 |
| 1203 | 3300025304 | Ga0209257_1000239 | Ga0209257_100023927 | 285 |
| 1204 | 3300046810 | Ga0495660_0004735 | Ga0495660_0004735_1814_2680 | 285 |
| 1205 | 3300047469 | Ga0495673_0003388 | Ga0495673_0003388_626_1492 | 285 |
| 1206 | iso_pu_bacteria | 2857524615 | 2857527161 | 285 |
| 1207 | iso_pu_bacteria | 2919073203 | 2919078277 | 285 |
| 1208 | 3300005985 | Ga0081539_10018502 | Ga0081539_100185024 | 286 |
| 1209 | 3300007076 | Ga0075435_100016626 | Ga0075435_1000166264 | 286 |
| 1210 | 3300031995 | Ga0307409_100139382 | Ga0307409_1001393822 | 286 |
| 1211 | 3300032126 | Ga0307415_100023443 | Ga0307415_1000234433 | 286 |
| 1212 | 3300050512 | nmdc:mga0n895_2560_c1 | nmdc:mga0n895_2560_c1_6637_7539 | 286 |
| 1213 | 3300050513 | nmdc:mga0rr50_4914_c1 | nmdc:mga0rr50_4914_c1_4818_5720 | 286 |
| 1214 | 3300053130 | Ga0500642_0064108 | Ga0500642_0064108_346_1230 | 286 |
| 1215 | iso_pu_bacteria | 2883291878 | 2883296292 | 286 |
| 1216 | 3300002705 | JGI25156J39149_1006718 | JGI25156J39149_10067181 | 287 |
| 1217 | 3300002772 | JGI25164J39214_1004164 | JGI25164J39214_10041642 | 287 |
| 1218 | 3300002987 | JGI25159J45721_1004965 | JGI25159J45721_10049654 | 287 |
| 1219 | 3300003187 | JGI25151J46595_10046217 | JGI25151J46595_100462172 | 287 |
| 1220 | 3300003215 | JGI25153J46596_10000024 | JGI25153J46596_10000024139 | 287 |
| 1221 | 3300003756 | Ga0055533_1000011 | Ga0055533_1000011264 | 287 |
| 1222 | 3300003759 | Ga0055525_1000644 | Ga0055525_10006447 | 287 |
| 1223 | 3300003775 | Ga0055524_1000382 | Ga0055524_10003824 | 287 |
| 1224 | 3300003791 | Ga0055530_10003201 | Ga0055530_1000320110 | 287 |
| 1225 | 3300003792 | Ga0055540_1000007 | Ga0055540_1000007169 | 287 |
| 1226 | 3300003794 | Ga0055531_10006835 | Ga0055531_100068354 | 287 |
| 1227 | 3300004625 | Ga0055543_1004514 | Ga0055543_10045144 | 287 |
| 1228 | 3300004625 | Ga0055543_1010096 | Ga0055543_10100962 | 287 |
| 1229 | 3300005262 | Ga0065165_1000086 | Ga0065165_1000086121 | 287 |
| 1230 | 3300005262 | Ga0065165_1000132 | Ga0065165_100013231 | 287 |
| 1231 | 3300005262 | Ga0065165_1000235 | Ga0065165_100023557 | 287 |
| 1232 | 3300005262 | Ga0065165_1003449 | Ga0065165_10034494 | 287 |
| 1233 | 3300005327 | Ga0070658_10023280 | Ga0070658_100232803 | 287 |
| 1234 | 3300005356 | Ga0070674_100142579 | Ga0070674_1001425792 | 287 |
| 1235 | 3300005364 | Ga0070673_100139498 | Ga0070673_1001394982 | 287 |
| 1236 | 3300005543 | Ga0070672_100173029 | Ga0070672_1001730292 | 287 |
| 1237 | 3300005563 | Ga0068855_100159363 | Ga0068855_1001593633 | 287 |
| 1238 | 3300005844 | Ga0068862_100033882 | Ga0068862_1000338822 | 287 |
| 1239 | 3300006175 | Ga0070712_100005932 | Ga0070712_1000059323 | 287 |
| 1240 | 3300006195 | Ga0075366_10052148 | Ga0075366_100521483 | 287 |
| 1241 | 3300006844 | Ga0075428_100321704 | Ga0075428_1003217042 | 287 |
| 1242 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009132 | 287 |
| 1243 | 3300013296 | Ga0157374_10079053 | Ga0157374_100790533 | 287 |
| 1244 | 3300025226 | Ga0209674_100003 | Ga0209674_100003563 | 287 |
| 1245 | 3300025230 | Ga0209563_100010 | Ga0209563_100010293 | 287 |
| 1246 | 3300025231 | Ga0207427_100729 | Ga0207427_1007299 | 287 |
| 1247 | 3300025242 | Ga0209258_100773 | Ga0209258_10077311 | 287 |
| 1248 | 3300025253 | Ga0209677_102733 | Ga0209677_1027334 | 287 |
| 1249 | 3300025256 | Ga0209759_1001305 | Ga0209759_100130512 | 287 |
| 1250 | 3300025263 | Ga0209565_1009765 | Ga0209565_10097652 | 287 |
| 1251 | 3300025273 | Ga0209673_1037216 | Ga0209673_10372162 | 287 |
| 1252 | 3300025284 | Ga0209130_1000208 | Ga0209130_100020840 | 287 |
| 1253 | 3300025294 | Ga0209025_1002291 | Ga0209025_10022919 | 287 |
| 1254 | 3300025294 | Ga0209025_1007137 | Ga0209025_10071372 | 287 |
| 1255 | 3300025298 | Ga0209050_1005060 | Ga0209050_10050607 | 287 |
| 1256 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019188 | 287 |
| 1257 | 3300025302 | Ga0207426_1015005 | Ga0207426_10150054 | 287 |
| 1258 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004222 | 287 |
| 1259 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038356 | 287 |
| 1260 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044203 | 287 |
| 1261 | 3300025904 | Ga0207647_10193410 | Ga0207647_101934102 | 287 |
| 1262 | 3300025909 | Ga0207705_10037246 | Ga0207705_100372463 | 287 |
| 1263 | 3300025915 | Ga0207693_10018506 | Ga0207693_100185066 | 287 |
| 1264 | 3300025925 | Ga0207650_10033574 | Ga0207650_100335744 | 287 |
| 1265 | 3300025937 | Ga0207669_10093092 | Ga0207669_100930922 | 287 |
| 1266 | 3300026089 | Ga0207648_10101244 | Ga0207648_101012442 | 287 |
| 1267 | 3300026116 | Ga0207674_10182305 | Ga0207674_101823052 | 287 |
| 1268 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023255 | 287 |
| 1269 | 3300028794 | Ga0307515_10153679 | Ga0307515_101536792 | 287 |
| 1270 | 3300031456 | Ga0307513_10266951 | Ga0307513_102669512 | 287 |
| 1271 | 3300031456 | Ga0307513_10346460 | Ga0307513_103464602 | 287 |
| 1272 | 3300031507 | Ga0307509_10005567 | Ga0307509_1000556713 | 287 |
| 1273 | 3300031507 | Ga0307509_10098912 | Ga0307509_100989122 | 287 |
| 1274 | 3300031548 | Ga0307408_100155007 | Ga0307408_1001550072 | 287 |
| 1275 | 3300031616 | Ga0307508_10000273 | Ga0307508_1000027320 | 287 |
| 1276 | 3300031852 | Ga0307410_10026075 | Ga0307410_100260752 | 287 |
| 1277 | 3300032004 | Ga0307414_10278168 | Ga0307414_102781682 | 287 |
| 1278 | 3300032004 | Ga0307414_10326757 | Ga0307414_103267572 | 287 |
| 1279 | 3300032005 | Ga0307411_10000039 | Ga0307411_100000394 | 287 |
| 1280 | 3300033180 | Ga0307510_10000088 | Ga0307510_1000008856 | 287 |
| 1281 | 3300037068 | Ga0373925_0174547 | Ga0373925_0174547_232_1116 | 287 |
| 1282 | 3300037312 | Ga0395899_0001797 | Ga0395899_0001797_7074_7943 | 287 |
| 1283 | 3300037418 | Ga0395900_0023837 | Ga0395900_0023837_1716_2585 | 287 |
| 1284 | 3300037466 | Ga0395898_0029740 | Ga0395898_0029740_3443_4312 | 287 |
| 1285 | 3300037466 | Ga0395898_0051921 | Ga0395898_0051921_1144_2028 | 287 |
| 1286 | 3300037471 | Ga0395905_0193507 | Ga0395905_0193507_134_1108 | 287 |
| 1287 | 3300038443 | Ga0395901_0010231 | Ga0395901_0010231_5216_6100 | 287 |
| 1288 | 3300038443 | Ga0395901_0042456 | Ga0395901_0042456_1828_2697 | 287 |
| 1289 | 3300038443 | Ga0395901_0176077 | Ga0395901_0176077_947_1816 | 287 |
| 1290 | 3300038443 | Ga0395901_0303025 | Ga0395901_0303025_306_1208 | 287 |
| 1291 | 3300042531 | Ga0450918_001867 | Ga0450918_001867_2606_3490 | 287 |
| 1292 | 3300044658 | Ga0466972_0009712 | Ga0466972_0009712_2355_3236 | 287 |
| 1293 | 3300044684 | Ga0466966_0007913 | Ga0466966_0007913_1750_2631 | 287 |
| 1294 | 3300044694 | Ga0466963_0004299 | Ga0466963_0004299_983_1957 | 287 |
| 1295 | 3300044694 | Ga0466963_0027077 | Ga0466963_0027077_564_1436 | 287 |
| 1296 | 3300044842 | Ga0466957_0093125 | Ga0466957_0093125_29_1003 | 287 |
| 1297 | 3300045051 | Ga0451576_0019992 | Ga0451576_0019992_1466_2350 | 287 |
| 1298 | 3300046471 | Ga0495650_0006054 | Ga0495650_0006054_6147_7016 | 287 |
| 1299 | 3300046507 | Ga0495606_0000297 | Ga0495606_0000297_16137_17006 | 287 |
| 1300 | 3300047472 | Ga0495686_0016837 | Ga0495686_0016837_641_1510 | 287 |
| 1301 | 3300048905 | Ga0496102_0027736 | Ga0496102_0027736_1318_2187 | 287 |
| 1302 | 3300048910 | Ga0496107_0043614 | Ga0496107_0043614_2315_3199 | 287 |
| 1303 | 3300048911 | Ga0496108_0030667 | Ga0496108_0030667_2950_3819 | 287 |
| 1304 | 3300048912 | Ga0496109_0036488 | Ga0496109_0036488_2378_3247 | 287 |
| 1305 | 3300048914 | Ga0496111_0045011 | Ga0496111_0045011_909_1778 | 287 |
| 1306 | 3300048917 | Ga0496114_0013948 | Ga0496114_0013948_5456_6334 | 287 |
| 1307 | 3300048923 | Ga0496120_0090088 | Ga0496120_0090088_218_1081 | 287 |
| 1308 | 3300048924 | Ga0496121_0023966 | Ga0496121_0023966_3464_4354 | 287 |
| 1309 | 3300048925 | Ga0496122_0055712 | Ga0496122_0055712_1737_2600 | 287 |
| 1310 | 3300048926 | Ga0496123_0046294 | Ga0496123_0046294_352_1215 | 287 |
| 1311 | 3300048927 | Ga0496124_0059142 | Ga0496124_0059142_450_1313 | 287 |
| 1312 | 3300048928 | Ga0496125_0013289 | Ga0496125_0013289_6719_7582 | 287 |
| 1313 | 3300048928 | Ga0496125_0014724 | Ga0496125_0014724_5272_6162 | 287 |
| 1314 | 3300048929 | Ga0496126_0009052 | Ga0496126_0009052_6625_7488 | 287 |
| 1315 | 3300048929 | Ga0496126_0138887 | Ga0496126_0138887_212_1102 | 287 |
| 1316 | 3300049459 | Ga0495678_008167 | Ga0495678_008167_4129_4998 | 287 |
| 1317 | 3300049579 | Ga0501043_0000101 | Ga0501043_0000101_13230_14114 | 287 |
| 1318 | 3300049580 | Ga0501046_0000135 | Ga0501046_0000135_64850_65734 | 287 |
| 1319 | 3300049581 | Ga0501047_0000173 | Ga0501047_0000173_13337_14221 | 287 |
| 1320 | 3300049665 | Ga0501227_036024 | Ga0501227_036024_55_939 | 287 |
| 1321 | 3300049669 | Ga0501235_004940 | Ga0501235_004940_1519_2403 | 287 |
| 1322 | 3300049679 | Ga0501249_010268 | Ga0501249_010268_406_1290 | 287 |
| 1323 | 3300049683 | Ga0501253_004339 | Ga0501253_004339_688_1572 | 287 |
| 1324 | 3300049824 | Ga0501045_0131924 | Ga0501045_0131924_503_1387 | 287 |
| 1325 | 3300050493 | nmdc:mga0k408_6933_c1 | nmdc:mga0k408_6933_c1_1041_1925 | 287 |
| 1326 | 3300050511 | nmdc:mga08y16_713892_c1 | nmdc:mga08y16_713892_c1_18_935 | 287 |
| 1327 | 3300053090 | Ga0500646_0003505 | Ga0500646_0003505_2950_3834 | 287 |
| 1328 | 3300053092 | Ga0500583_0041114 | Ga0500583_0041114_923_1807 | 287 |
| 1329 | 3300053094 | Ga0500566_0002553 | Ga0500566_0002553_1417_2307 | 287 |
| 1330 | 3300053122 | Ga0500608_046152 | Ga0500608_046152_883_1773 | 287 |
| 1331 | 3300053131 | Ga0500652_154497 | Ga0500652_154497_13_906 | 287 |
| 1332 | 3300059477 | Ga0587084_002539 | Ga0587084_002539_437_1306 | 287 |
| 1333 | 3300059493 | Ga0587077_000359 | Ga0587077_000359_2574_3443 | 287 |
| 1334 | 3300059493 | Ga0587077_003655 | Ga0587077_003655_338_1207 | 287 |
| 1335 | 3300059645 | Ga0587076_010795 | Ga0587076_010795_365_1234 | 287 |
| 1336 | iso_pu_bacteria | 2600255292 | 2601667769 | 287 |
| 1337 | iso_pu_bacteria | 2643221628 | 2644162845 | 287 |
| 1338 | iso_pu_bacteria | 2643221683 | 2644469244 | 287 |
| 1339 | iso_pu_bacteria | 2721755523 | 2722886137 | 287 |
| 1340 | iso_pu_bacteria | 2739367655 | 2739613378 | 287 |
| 1341 | iso_pu_bacteria | 2839138175 | 2839144225 | 287 |
| 1342 | iso_pu_bacteria | 2842677519 | 2842680220 | 287 |
| 1343 | iso_pu_bacteria | 2857547612 | 2857550202 | 287 |
| 1344 | iso_pu_bacteria | 2857576091 | 2857577914 | 287 |
| 1345 | iso_pu_bacteria | 2881927736 | 2881927835 | 287 |
| 1346 | iso_pu_bacteria | 2885198086 | 2885199527 | 287 |
| 1347 | iso_pu_bacteria | 2885211737 | 2885213200 | 287 |
| 1348 | iso_pu_bacteria | 2887375801 | 2887378025 | 287 |
| 1349 | iso_pu_bacteria | 2904449895 | 2904454793 | 287 |
| 1350 | iso_pu_bacteria | 2904456579 | 2904462634 | 287 |
| 1351 | iso_pu_bacteria | 2904541872 | 2904546769 | 287 |
| 1352 | iso_pu_bacteria | 2919462493 | 2919464076 | 287 |
| 1353 | iso_pu_bacteria | 2919704043 | 2919708830 | 287 |
| 1354 | iso_pu_bacteria | 2929160207 | 2929164242 | 287 |
| 1355 | iso_pu_bacteria | 2932410948 | 2932411382 | 287 |
| 1356 | iso_pu_bacteria | 2932416698 | 2932419051 | 287 |
| 1357 | iso_pu_bacteria | 2932422444 | 2932423142 | 287 |
| 1358 | iso_pu_bacteria | 2945945610 | 2945946888 | 287 |
| 1359 | iso_pu_bacteria | 2954767861 | 2954771654 | 287 |
| 1360 | 2010549000 | RicEn_C7977 | RicEn_140520 | 288 |
| 1361 | 2162886007 | SwRhRL2b_contig_2985449 | SwRhRL2b_0269.00004670 | 288 |
| 1362 | 3300001989 | JGI24739J22299_10024874 | JGI24739J22299_100248742 | 288 |
| 1363 | 3300002077 | JGI24744J21845_10026991 | JGI24744J21845_100269912 | 288 |
| 1364 | 3300002774 | JGI25150J39212_1000123 | JGI25150J39212_100012323 | 288 |
| 1365 | 3300003187 | JGI25151J46595_10000083 | JGI25151J46595_1000008323 | 288 |
| 1366 | 3300003187 | JGI25151J46595_10005526 | JGI25151J46595_100055263 | 288 |
| 1367 | 3300003187 | JGI25151J46595_10017014 | JGI25151J46595_100170141 | 288 |
| 1368 | 3300003203 | JGI25406J46586_10000042 | JGI25406J46586_1000004252 | 288 |
| 1369 | 3300003203 | JGI25406J46586_10023074 | JGI25406J46586_100230742 | 288 |
| 1370 | 3300003215 | JGI25153J46596_10000210 | JGI25153J46596_1000021041 | 288 |
| 1371 | 3300003215 | JGI25153J46596_10008716 | JGI25153J46596_100087164 | 288 |
| 1372 | 3300003659 | JGI25404J52841_10024437 | JGI25404J52841_100244372 | 288 |
| 1373 | 3300003773 | Ga0055537_1000224 | Ga0055537_100022415 | 288 |
| 1374 | 3300003781 | Ga0055536_1013682 | Ga0055536_10136824 | 288 |
| 1375 | 3300003781 | Ga0055536_1013856 | Ga0055536_10138562 | 288 |
| 1376 | 3300003784 | Ga0055534_1000273 | Ga0055534_100027328 | 288 |
| 1377 | 3300003784 | Ga0055534_1000902 | Ga0055534_100090212 | 288 |
| 1378 | 3300003784 | Ga0055534_1004252 | Ga0055534_10042524 | 288 |
| 1379 | 3300003790 | Ga0055528_1001031 | Ga0055528_10010314 | 288 |
| 1380 | 3300003792 | Ga0055540_1012394 | Ga0055540_10123942 | 288 |
| 1381 | 3300003792 | Ga0055540_1026244 | Ga0055540_10262442 | 288 |
| 1382 | 3300003794 | Ga0055531_10000322 | Ga0055531_1000032244 | 288 |
| 1383 | 3300003794 | Ga0055531_10010330 | Ga0055531_100103303 | 288 |
| 1384 | 3300005262 | Ga0065165_1018020 | Ga0065165_10180202 | 288 |
| 1385 | 3300005262 | Ga0065165_1021516 | Ga0065165_10215162 | 288 |
| 1386 | 3300005289 | Ga0065704_10089375 | Ga0065704_100893753 | 288 |
| 1387 | 3300005289 | Ga0065704_10157222 | Ga0065704_101572222 | 288 |
| 1388 | 3300005289 | Ga0065704_10206522 | Ga0065704_102065222 | 288 |
| 1389 | 3300005327 | Ga0070658_10318478 | Ga0070658_103184781 | 288 |
| 1390 | 3300005329 | Ga0070683_100003964 | Ga0070683_1000039642 | 288 |
| 1391 | 3300005329 | Ga0070683_100017977 | Ga0070683_1000179774 | 288 |
| 1392 | 3300005329 | Ga0070683_100046754 | Ga0070683_1000467543 | 288 |
| 1393 | 3300005329 | Ga0070683_100127041 | Ga0070683_1001270414 | 288 |
| 1394 | 3300005329 | Ga0070683_100179321 | Ga0070683_1001793212 | 288 |
| 1395 | 3300005331 | Ga0070670_100000372 | Ga0070670_1000003727 | 288 |
| 1396 | 3300005336 | Ga0070680_100011764 | Ga0070680_1000117645 | 288 |
| 1397 | 3300005336 | Ga0070680_100209735 | Ga0070680_1002097352 | 288 |
| 1398 | 3300005339 | Ga0070660_100071105 | Ga0070660_1000711053 | 288 |
| 1399 | 3300005339 | Ga0070660_100497834 | Ga0070660_1004978341 | 288 |
| 1400 | 3300005344 | Ga0070661_100106571 | Ga0070661_1001065712 | 288 |
| 1401 | 3300005344 | Ga0070661_100229694 | Ga0070661_1002296942 | 288 |
| 1402 | 3300005344 | Ga0070661_100245311 | Ga0070661_1002453111 | 288 |
| 1403 | 3300005355 | Ga0070671_100044769 | Ga0070671_1000447692 | 288 |
| 1404 | 3300005355 | Ga0070671_100048581 | Ga0070671_1000485814 | 288 |
| 1405 | 3300005355 | Ga0070671_100111737 | Ga0070671_1001117372 | 288 |
| 1406 | 3300005356 | Ga0070674_100026172 | Ga0070674_1000261723 | 288 |
| 1407 | 3300005356 | Ga0070674_100067175 | Ga0070674_1000671753 | 288 |
| 1408 | 3300005367 | Ga0070667_100292277 | Ga0070667_1002922772 | 288 |
| 1409 | 3300005434 | Ga0070709_10042930 | Ga0070709_100429302 | 288 |
| 1410 | 3300005435 | Ga0070714_100072863 | Ga0070714_1000728633 | 288 |
| 1411 | 3300005436 | Ga0070713_100025776 | Ga0070713_1000257764 | 288 |
| 1412 | 3300005436 | Ga0070713_100031324 | Ga0070713_1000313244 | 288 |
| 1413 | 3300005436 | Ga0070713_100107242 | Ga0070713_1001072422 | 288 |
| 1414 | 3300005436 | Ga0070713_100262520 | Ga0070713_1002625202 | 288 |
| 1415 | 3300005439 | Ga0070711_100023898 | Ga0070711_1000238983 | 288 |
| 1416 | 3300005441 | Ga0070700_100031574 | Ga0070700_1000315743 | 288 |
| 1417 | 3300005455 | Ga0070663_100119438 | Ga0070663_1001194382 | 288 |
| 1418 | 3300005455 | Ga0070663_100199811 | Ga0070663_1001998112 | 288 |
| 1419 | 3300005456 | Ga0070678_100055642 | Ga0070678_1000556422 | 288 |
| 1420 | 3300005456 | Ga0070678_100194209 | Ga0070678_1001942092 | 288 |
| 1421 | 3300005458 | Ga0070681_10002996 | Ga0070681_100029965 | 288 |
| 1422 | 3300005458 | Ga0070681_10047095 | Ga0070681_100470953 | 288 |
| 1423 | 3300005458 | Ga0070681_10110577 | Ga0070681_101105774 | 288 |
| 1424 | 3300005458 | Ga0070681_10139649 | Ga0070681_101396492 | 288 |
| 1425 | 3300005458 | Ga0070681_10334927 | Ga0070681_103349272 | 288 |
| 1426 | 3300005459 | Ga0068867_100061387 | Ga0068867_1000613872 | 288 |
| 1427 | 3300005530 | Ga0070679_100006191 | Ga0070679_1000061919 | 288 |
| 1428 | 3300005530 | Ga0070679_100009801 | Ga0070679_1000098015 | 288 |
| 1429 | 3300005530 | Ga0070679_100065635 | Ga0070679_1000656352 | 288 |
| 1430 | 3300005530 | Ga0070679_100222470 | Ga0070679_1002224701 | 288 |
| 1431 | 3300005535 | Ga0070684_100083145 | Ga0070684_1000831452 | 288 |
| 1432 | 3300005535 | Ga0070684_100142382 | Ga0070684_1001423822 | 288 |
| 1433 | 3300005535 | Ga0070684_100174262 | Ga0070684_1001742622 | 288 |
| 1434 | 3300005536 | Ga0070697_100009974 | Ga0070697_1000099742 | 288 |
| 1435 | 3300005536 | Ga0070697_100340685 | Ga0070697_1003406852 | 288 |
| 1436 | 3300005539 | Ga0068853_100143634 | Ga0068853_1001436342 | 288 |
| 1437 | 3300005543 | Ga0070672_100058504 | Ga0070672_1000585042 | 288 |
| 1438 | 3300005544 | Ga0070686_100118488 | Ga0070686_1001184881 | 288 |
| 1439 | 3300005546 | Ga0070696_100162798 | Ga0070696_1001627982 | 288 |
| 1440 | 3300005547 | Ga0070693_100182553 | Ga0070693_1001825531 | 288 |
| 1441 | 3300005547 | Ga0070693_100219439 | Ga0070693_1002194392 | 288 |
| 1442 | 3300005548 | Ga0070665_100029739 | Ga0070665_1000297394 | 288 |
| 1443 | 3300005548 | Ga0070665_100062998 | Ga0070665_1000629982 | 288 |
| 1444 | 3300005548 | Ga0070665_100166107 | Ga0070665_1001661072 | 288 |
| 1445 | 3300005548 | Ga0070665_100501116 | Ga0070665_1005011161 | 288 |
| 1446 | 3300005563 | Ga0068855_100030522 | Ga0068855_1000305224 | 288 |
| 1447 | 3300005563 | Ga0068855_100054492 | Ga0068855_1000544925 | 288 |
| 1448 | 3300005563 | Ga0068855_100287265 | Ga0068855_1002872652 | 288 |
| 1449 | 3300005563 | Ga0068855_100356384 | Ga0068855_1003563842 | 288 |
| 1450 | 3300005563 | Ga0068855_100609552 | Ga0068855_1006095522 | 288 |
| 1451 | 3300005564 | Ga0070664_100042664 | Ga0070664_1000426643 | 288 |
| 1452 | 3300005564 | Ga0070664_100688573 | Ga0070664_1006885731 | 288 |
| 1453 | 3300005577 | Ga0068857_100012293 | Ga0068857_1000122936 | 288 |
| 1454 | 3300005577 | Ga0068857_100206295 | Ga0068857_1002062952 | 288 |
| 1455 | 3300005577 | Ga0068857_100226182 | Ga0068857_1002261822 | 288 |
| 1456 | 3300005577 | Ga0068857_100312291 | Ga0068857_1003122912 | 288 |
| 1457 | 3300005614 | Ga0068856_100000217 | Ga0068856_1000002177 | 288 |
| 1458 | 3300005614 | Ga0068856_100059874 | Ga0068856_1000598743 | 288 |
| 1459 | 3300005614 | Ga0068856_100143863 | Ga0068856_1001438634 | 288 |
| 1460 | 3300005614 | Ga0068856_100180902 | Ga0068856_1001809022 | 288 |
| 1461 | 3300005616 | Ga0068852_100001671 | Ga0068852_10000167111 | 288 |
| 1462 | 3300005616 | Ga0068852_100091688 | Ga0068852_1000916882 | 288 |
| 1463 | 3300005616 | Ga0068852_100136573 | Ga0068852_1001365732 | 288 |
| 1464 | 3300005842 | Ga0068858_100180417 | Ga0068858_1001804172 | 288 |
| 1465 | 3300005842 | Ga0068858_100346459 | Ga0068858_1003464592 | 288 |
| 1466 | 3300005843 | Ga0068860_100000280 | Ga0068860_10000028016 | 288 |
| 1467 | 3300005844 | Ga0068862_100599364 | Ga0068862_1005993641 | 288 |
| 1468 | 3300005937 | Ga0081455_10000751 | Ga0081455_1000075118 | 288 |
| 1469 | 3300005937 | Ga0081455_10007868 | Ga0081455_100078686 | 288 |
| 1470 | 3300005937 | Ga0081455_10013127 | Ga0081455_100131274 | 288 |
| 1471 | 3300005937 | Ga0081455_10015126 | Ga0081455_100151265 | 288 |
| 1472 | 3300005937 | Ga0081455_10057044 | Ga0081455_100570441 | 288 |
| 1473 | 3300005981 | Ga0081538_10045792 | Ga0081538_100457924 | 288 |
| 1474 | 3300005983 | Ga0081540_1002153 | Ga0081540_100215314 | 288 |
| 1475 | 3300005983 | Ga0081540_1002523 | Ga0081540_10025237 | 288 |
| 1476 | 3300005983 | Ga0081540_1005561 | Ga0081540_10055618 | 288 |
| 1477 | 3300005983 | Ga0081540_1008122 | Ga0081540_10081223 | 288 |
| 1478 | 3300005983 | Ga0081540_1008798 | Ga0081540_10087984 | 288 |
| 1479 | 3300005983 | Ga0081540_1028343 | Ga0081540_10283434 | 288 |
| 1480 | 3300005983 | Ga0081540_1089062 | Ga0081540_10890621 | 288 |
| 1481 | 3300005983 | Ga0081540_1111796 | Ga0081540_11117962 | 288 |
| 1482 | 3300005985 | Ga0081539_10000099 | Ga0081539_10000099189 | 288 |
| 1483 | 3300005985 | Ga0081539_10001660 | Ga0081539_100016606 | 288 |
| 1484 | 3300005985 | Ga0081539_10007918 | Ga0081539_100079189 | 288 |
| 1485 | 3300006028 | Ga0070717_10001256 | Ga0070717_1000125617 | 288 |
| 1486 | 3300006028 | Ga0070717_10008632 | Ga0070717_100086322 | 288 |
| 1487 | 3300006038 | Ga0075365_10020604 | Ga0075365_100206044 | 288 |
| 1488 | 3300006038 | Ga0075365_10162934 | Ga0075365_101629342 | 288 |
| 1489 | 3300006038 | Ga0075365_10339516 | Ga0075365_103395162 | 288 |
| 1490 | 3300006042 | Ga0075368_10020284 | Ga0075368_100202844 | 288 |
| 1491 | 3300006042 | Ga0075368_10034251 | Ga0075368_100342512 | 288 |
| 1492 | 3300006051 | Ga0075364_10034399 | Ga0075364_100343992 | 288 |
| 1493 | 3300006051 | Ga0075364_10046426 | Ga0075364_100464263 | 288 |
| 1494 | 3300006051 | Ga0075364_10121122 | Ga0075364_101211222 | 288 |
| 1495 | 3300006058 | Ga0075432_10030334 | Ga0075432_100303342 | 288 |
| 1496 | 3300006173 | Ga0070716_100048945 | Ga0070716_1000489453 | 288 |
| 1497 | 3300006175 | Ga0070712_100008776 | Ga0070712_1000087764 | 288 |
| 1498 | 3300006177 | Ga0075362_10021558 | Ga0075362_100215582 | 288 |
| 1499 | 3300006177 | Ga0075362_10063030 | Ga0075362_100630303 | 288 |
| 1500 | 3300006177 | Ga0075362_10114043 | Ga0075362_101140432 | 288 |
| 1501 | 3300006177 | Ga0075362_10148813 | Ga0075362_101488131 | 288 |
| 1502 | 3300006178 | Ga0075367_10144208 | Ga0075367_101442082 | 288 |
| 1503 | 3300006178 | Ga0075367_10177198 | Ga0075367_101771982 | 288 |
| 1504 | 3300006178 | Ga0075367_10215987 | Ga0075367_102159872 | 288 |
| 1505 | 3300006186 | Ga0075369_10000180 | Ga0075369_1000018013 | 288 |
| 1506 | 3300006186 | Ga0075369_10038880 | Ga0075369_100388802 | 288 |
| 1507 | 3300006186 | Ga0075369_10072627 | Ga0075369_100726272 | 288 |
| 1508 | 3300006186 | Ga0075369_10108966 | Ga0075369_101089661 | 288 |
| 1509 | 3300006195 | Ga0075366_10010769 | Ga0075366_100107694 | 288 |
| 1510 | 3300006195 | Ga0075366_10198852 | Ga0075366_101988521 | 288 |
| 1511 | 3300006353 | Ga0075370_10034259 | Ga0075370_100342592 | 288 |
| 1512 | 3300006353 | Ga0075370_10039025 | Ga0075370_100390253 | 288 |
| 1513 | 3300006353 | Ga0075370_10177243 | Ga0075370_101772432 | 288 |
| 1514 | 3300006852 | Ga0075433_10253205 | Ga0075433_102532052 | 288 |
| 1515 | 3300006871 | Ga0075434_100063130 | Ga0075434_1000631303 | 288 |
| 1516 | 3300006942 | Ga0099824_1002075 | Ga0099824_100207523 | 288 |
| 1517 | 3300006943 | Ga0099822_1008450 | Ga0099822_100845011 | 288 |
| 1518 | 3300006946 | Ga0079104_1000208 | Ga0079104_100020820 | 288 |
| 1519 | 3300006948 | Ga0099826_10000135 | Ga0099826_100001354 | 288 |
| 1520 | 3300006948 | Ga0099826_10072630 | Ga0099826_100726302 | 288 |
| 1521 | 3300007076 | Ga0075435_100108433 | Ga0075435_1001084332 | 288 |
| 1522 | 3300007265 | Ga0099794_10019124 | Ga0099794_100191242 | 288 |
| 1523 | 3300007265 | Ga0099794_10042728 | Ga0099794_100427283 | 288 |
| 1524 | 3300009092 | Ga0105250_10000154 | Ga0105250_1000015432 | 288 |
| 1525 | 3300009093 | Ga0105240_10003939 | Ga0105240_1000393911 | 288 |
| 1526 | 3300009093 | Ga0105240_10009735 | Ga0105240_100097358 | 288 |
| 1527 | 3300009093 | Ga0105240_10208115 | Ga0105240_102081152 | 288 |
| 1528 | 3300009093 | Ga0105240_10405279 | Ga0105240_104052792 | 288 |
| 1529 | 3300009101 | Ga0105247_10045403 | Ga0105247_100454033 | 288 |
| 1530 | 3300009101 | Ga0105247_10083369 | Ga0105247_100833692 | 288 |
| 1531 | 3300009101 | Ga0105247_10093409 | Ga0105247_100934092 | 288 |
| 1532 | 3300009147 | Ga0114129_10030308 | Ga0114129_100303083 | 288 |
| 1533 | 3300009148 | Ga0105243_10003470 | Ga0105243_100034709 | 288 |
| 1534 | 3300009148 | Ga0105243_10181233 | Ga0105243_101812332 | 288 |
| 1535 | 3300009148 | Ga0105243_10437963 | Ga0105243_104379632 | 288 |
| 1536 | 3300009174 | Ga0105241_10041364 | Ga0105241_100413642 | 288 |
| 1537 | 3300009174 | Ga0105241_10100281 | Ga0105241_101002812 | 288 |
| 1538 | 3300009174 | Ga0105241_10200563 | Ga0105241_102005632 | 288 |
| 1539 | 3300009176 | Ga0105242_10314456 | Ga0105242_103144562 | 288 |
| 1540 | 3300009545 | Ga0105237_10000711 | Ga0105237_100007113 | 288 |
| 1541 | 3300009545 | Ga0105237_10116995 | Ga0105237_101169953 | 288 |
| 1542 | 3300009545 | Ga0105237_10140221 | Ga0105237_101402212 | 288 |
| 1543 | 3300009545 | Ga0105237_10221020 | Ga0105237_102210202 | 288 |
| 1544 | 3300009545 | Ga0105237_10240156 | Ga0105237_102401562 | 288 |
| 1545 | 3300009551 | Ga0105238_10013593 | Ga0105238_100135934 | 288 |
| 1546 | 3300009551 | Ga0105238_10015307 | Ga0105238_100153074 | 288 |
| 1547 | 3300009551 | Ga0105238_10207894 | Ga0105238_102078942 | 288 |
| 1548 | 3300009551 | Ga0105238_10248302 | Ga0105238_102483022 | 288 |
| 1549 | 3300009551 | Ga0105238_10342465 | Ga0105238_103424652 | 288 |
| 1550 | 3300009551 | Ga0105238_10411438 | Ga0105238_104114382 | 288 |
| 1551 | 3300009551 | Ga0105238_10459237 | Ga0105238_104592372 | 288 |
| 1552 | 3300010159 | Ga0099796_10071740 | Ga0099796_100717401 | 288 |
| 1553 | 3300010375 | Ga0105239_10002359 | Ga0105239_100023596 | 288 |
| 1554 | 3300010375 | Ga0105239_10047224 | Ga0105239_100472244 | 288 |
| 1555 | 3300010375 | Ga0105239_10086633 | Ga0105239_100866332 | 288 |
| 1556 | 3300010375 | Ga0105239_10221947 | Ga0105239_102219471 | 288 |
| 1557 | 3300010375 | Ga0105239_10473805 | Ga0105239_104738052 | 288 |
| 1558 | 3300011119 | Ga0105246_10171290 | Ga0105246_101712902 | 288 |
| 1559 | 3300011119 | Ga0105246_10195093 | Ga0105246_101950932 | 288 |
| 1560 | 3300013102 | Ga0157371_10007676 | Ga0157371_100076764 | 288 |
| 1561 | 3300013104 | Ga0157370_10324402 | Ga0157370_103244022 | 288 |
| 1562 | 3300013104 | Ga0157370_10485708 | Ga0157370_104857081 | 288 |
| 1563 | 3300013104 | Ga0157370_10508829 | Ga0157370_105088292 | 288 |
| 1564 | 3300013105 | Ga0157369_10007499 | Ga0157369_1000749910 | 288 |
| 1565 | 3300013105 | Ga0157369_10027452 | Ga0157369_100274524 | 288 |
| 1566 | 3300013105 | Ga0157369_10037352 | Ga0157369_100373524 | 288 |
| 1567 | 3300013105 | Ga0157369_10043154 | Ga0157369_100431546 | 288 |
| 1568 | 3300013105 | Ga0157369_10068644 | Ga0157369_100686444 | 288 |
| 1569 | 3300013105 | Ga0157369_10075613 | Ga0157369_100756134 | 288 |
| 1570 | 3300013250 | Ga0171462_1016 | Ga0171462_101624 | 288 |
| 1571 | 3300013307 | Ga0157372_10030764 | Ga0157372_100307641 | 288 |
| 1572 | 3300013307 | Ga0157372_10220737 | Ga0157372_102207372 | 288 |
| 1573 | 3300013308 | Ga0157375_10412970 | Ga0157375_104129702 | 288 |
| 1574 | 3300014325 | Ga0163163_10129728 | Ga0163163_101297283 | 288 |
| 1575 | 3300014325 | Ga0163163_10388765 | Ga0163163_103887652 | 288 |
| 1576 | 3300014969 | Ga0157376_10163548 | Ga0157376_101635482 | 288 |
| 1577 | 3300015261 | Ga0182006_1000002 | Ga0182006_1000002682 | 288 |
| 1578 | 3300015262 | Ga0182007_10000085 | Ga0182007_1000008558 | 288 |
| 1579 | 3300015265 | Ga0182005_1000002 | Ga0182005_1000002414 | 288 |
| 1580 | 3300017792 | Ga0163161_10015229 | Ga0163161_100152294 | 288 |
| 1581 | 3300021320 | Ga0214544_1000136 | Ga0214544_100013618 | 288 |
| 1582 | 3300021321 | Ga0214542_1000127 | Ga0214542_100012718 | 288 |
| 1583 | 3300021324 | Ga0214545_1000063 | Ga0214545_100006380 | 288 |
| 1584 | 3300021327 | Ga0214543_1018162 | Ga0214543_10181624 | 288 |
| 1585 | 3300021361 | Ga0213872_10022991 | Ga0213872_100229912 | 288 |
| 1586 | 3300021388 | Ga0213875_10044085 | Ga0213875_100440852 | 288 |
| 1587 | 3300025245 | Ga0207425_1000024 | Ga0207425_1000024225 | 288 |
| 1588 | 3300025245 | Ga0207425_1005788 | Ga0207425_10057884 | 288 |
| 1589 | 3300025245 | Ga0207425_1032518 | Ga0207425_10325181 | 288 |
| 1590 | 3300025253 | Ga0209677_101929 | Ga0209677_1019296 | 288 |
| 1591 | 3300025253 | Ga0209677_102242 | Ga0209677_1022424 | 288 |
| 1592 | 3300025254 | Ga0209148_1000879 | Ga0209148_10008794 | 288 |
| 1593 | 3300025254 | Ga0209148_1002254 | Ga0209148_10022547 | 288 |
| 1594 | 3300025258 | Ga0209129_1000146 | Ga0209129_100014621 | 288 |
| 1595 | 3300025258 | Ga0209129_1007872 | Ga0209129_10078723 | 288 |
| 1596 | 3300025261 | Ga0209233_1000753 | Ga0209233_10007532 | 288 |
| 1597 | 3300025261 | Ga0209233_1001523 | Ga0209233_10015237 | 288 |
| 1598 | 3300025261 | Ga0209233_1002406 | Ga0209233_10024063 | 288 |
| 1599 | 3300025263 | Ga0209565_1000083 | Ga0209565_1000083126 | 288 |
| 1600 | 3300025272 | Ga0209455_1002084 | Ga0209455_10020846 | 288 |
| 1601 | 3300025272 | Ga0209455_1005287 | Ga0209455_10052873 | 288 |
| 1602 | 3300025273 | Ga0209673_1000534 | Ga0209673_100053421 | 288 |
| 1603 | 3300025273 | Ga0209673_1025459 | Ga0209673_10254592 | 288 |
| 1604 | 3300025284 | Ga0209130_1004260 | Ga0209130_10042604 | 288 |
| 1605 | 3300025291 | Ga0209675_1000081 | Ga0209675_1000081126 | 288 |
| 1606 | 3300025291 | Ga0209675_1004057 | Ga0209675_10040573 | 288 |
| 1607 | 3300025292 | Ga0209676_1000065 | Ga0209676_100006519 | 288 |
| 1608 | 3300025292 | Ga0209676_1001087 | Ga0209676_100108711 | 288 |
| 1609 | 3300025292 | Ga0209676_1006060 | Ga0209676_10060604 | 288 |
| 1610 | 3300025294 | Ga0209025_1000050 | Ga0209025_1000050102 | 288 |
| 1611 | 3300025294 | Ga0209025_1000925 | Ga0209025_10009254 | 288 |
| 1612 | 3300025294 | Ga0209025_1001886 | Ga0209025_100188622 | 288 |
| 1613 | 3300025294 | Ga0209025_1082996 | Ga0209025_10829961 | 288 |
| 1614 | 3300025295 | Ga0209564_1000366 | Ga0209564_100036683 | 288 |
| 1615 | 3300025295 | Ga0209564_1000602 | Ga0209564_10006026 | 288 |
| 1616 | 3300025295 | Ga0209564_1009126 | Ga0209564_10091263 | 288 |
| 1617 | 3300025295 | Ga0209564_1011345 | Ga0209564_10113451 | 288 |
| 1618 | 3300025295 | Ga0209564_1027094 | Ga0209564_10270942 | 288 |
| 1619 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011884 | 288 |
| 1620 | 3300025297 | Ga0209758_1000083 | Ga0209758_1000083155 | 288 |
| 1621 | 3300025297 | Ga0209758_1000455 | Ga0209758_100045517 | 288 |
| 1622 | 3300025297 | Ga0209758_1000792 | Ga0209758_100079224 | 288 |
| 1623 | 3300025297 | Ga0209758_1001083 | Ga0209758_100108331 | 288 |
| 1624 | 3300025297 | Ga0209758_1011163 | Ga0209758_10111634 | 288 |
| 1625 | 3300025297 | Ga0209758_1012836 | Ga0209758_10128364 | 288 |
| 1626 | 3300025297 | Ga0209758_1013115 | Ga0209758_10131154 | 288 |
| 1627 | 3300025297 | Ga0209758_1027818 | Ga0209758_10278181 | 288 |
| 1628 | 3300025298 | Ga0209050_1006629 | Ga0209050_10066292 | 288 |
| 1629 | 3300025298 | Ga0209050_1018568 | Ga0209050_10185683 | 288 |
| 1630 | 3300025299 | Ga0209256_1000934 | Ga0209256_10009344 | 288 |
| 1631 | 3300025299 | Ga0209256_1018955 | Ga0209256_10189552 | 288 |
| 1632 | 3300025302 | Ga0207426_1007923 | Ga0207426_10079233 | 288 |
| 1633 | 3300025303 | Ga0209051_1000244 | Ga0209051_100024449 | 288 |
| 1634 | 3300025303 | Ga0209051_1006304 | Ga0209051_10063044 | 288 |
| 1635 | 3300025303 | Ga0209051_1008812 | Ga0209051_10088126 | 288 |
| 1636 | 3300025304 | Ga0209257_1000144 | Ga0209257_1000144130 | 288 |
| 1637 | 3300025304 | Ga0209257_1003906 | Ga0209257_10039064 | 288 |
| 1638 | 3300025304 | Ga0209257_1008157 | Ga0209257_10081574 | 288 |
| 1639 | 3300025304 | Ga0209257_1046541 | Ga0209257_10465412 | 288 |
| 1640 | 3300025711 | Ga0207696_1000388 | Ga0207696_100038829 | 288 |
| 1641 | 3300025893 | Ga0207682_10006388 | Ga0207682_100063884 | 288 |
| 1642 | 3300025899 | Ga0207642_10018244 | Ga0207642_100182442 | 288 |
| 1643 | 3300025901 | Ga0207688_10010905 | Ga0207688_100109055 | 288 |
| 1644 | 3300025901 | Ga0207688_10016380 | Ga0207688_100163804 | 288 |
| 1645 | 3300025901 | Ga0207688_10077308 | Ga0207688_100773082 | 288 |
| 1646 | 3300025904 | Ga0207647_10021071 | Ga0207647_100210712 | 288 |
| 1647 | 3300025904 | Ga0207647_10103671 | Ga0207647_101036712 | 288 |
| 1648 | 3300025906 | Ga0207699_10037385 | Ga0207699_100373852 | 288 |
| 1649 | 3300025906 | Ga0207699_10094522 | Ga0207699_100945222 | 288 |
| 1650 | 3300025906 | Ga0207699_10245439 | Ga0207699_102454392 | 288 |
| 1651 | 3300025907 | Ga0207645_10023628 | Ga0207645_100236284 | 288 |
| 1652 | 3300025909 | Ga0207705_10125185 | Ga0207705_101251852 | 288 |
| 1653 | 3300025910 | Ga0207684_10230764 | Ga0207684_102307642 | 288 |
| 1654 | 3300025911 | Ga0207654_10110007 | Ga0207654_101100072 | 288 |
| 1655 | 3300025912 | Ga0207707_10000183 | Ga0207707_1000018329 | 288 |
| 1656 | 3300025912 | Ga0207707_10005958 | Ga0207707_100059582 | 288 |
| 1657 | 3300025912 | Ga0207707_10010268 | Ga0207707_1001026810 | 288 |
| 1658 | 3300025912 | Ga0207707_10272681 | Ga0207707_102726812 | 288 |
| 1659 | 3300025913 | Ga0207695_10000157 | Ga0207695_10000157110 | 288 |
| 1660 | 3300025913 | Ga0207695_10012974 | Ga0207695_100129744 | 288 |
| 1661 | 3300025913 | Ga0207695_10024944 | Ga0207695_100249444 | 288 |
| 1662 | 3300025913 | Ga0207695_10175139 | Ga0207695_101751392 | 288 |
| 1663 | 3300025913 | Ga0207695_10455151 | Ga0207695_104551511 | 288 |
| 1664 | 3300025914 | Ga0207671_10007248 | Ga0207671_100072484 | 288 |
| 1665 | 3300025914 | Ga0207671_10024412 | Ga0207671_100244124 | 288 |
| 1666 | 3300025914 | Ga0207671_10099213 | Ga0207671_100992132 | 288 |
| 1667 | 3300025914 | Ga0207671_10101625 | Ga0207671_101016252 | 288 |
| 1668 | 3300025914 | Ga0207671_10135615 | Ga0207671_101356152 | 288 |
| 1669 | 3300025914 | Ga0207671_10341359 | Ga0207671_103413592 | 288 |
| 1670 | 3300025915 | Ga0207693_10007368 | Ga0207693_100073686 | 288 |
| 1671 | 3300025915 | Ga0207693_10199453 | Ga0207693_101994532 | 288 |
| 1672 | 3300025915 | Ga0207693_10230843 | Ga0207693_102308432 | 288 |
| 1673 | 3300025916 | Ga0207663_10041718 | Ga0207663_100417183 | 288 |
| 1674 | 3300025919 | Ga0207657_10001840 | Ga0207657_1000184013 | 288 |
| 1675 | 3300025919 | Ga0207657_10146645 | Ga0207657_101466452 | 288 |
| 1676 | 3300025920 | Ga0207649_10028131 | Ga0207649_100281312 | 288 |
| 1677 | 3300025920 | Ga0207649_10064178 | Ga0207649_100641783 | 288 |
| 1678 | 3300025921 | Ga0207652_10023004 | Ga0207652_100230042 | 288 |
| 1679 | 3300025921 | Ga0207652_10131156 | Ga0207652_101311562 | 288 |
| 1680 | 3300025921 | Ga0207652_10261848 | Ga0207652_102618482 | 288 |
| 1681 | 3300025923 | Ga0207681_10029523 | Ga0207681_100295232 | 288 |
| 1682 | 3300025923 | Ga0207681_10509215 | Ga0207681_105092151 | 288 |
| 1683 | 3300025924 | Ga0207694_10022641 | Ga0207694_100226413 | 288 |
| 1684 | 3300025924 | Ga0207694_10036365 | Ga0207694_100363652 | 288 |
| 1685 | 3300025924 | Ga0207694_10078687 | Ga0207694_100786872 | 288 |
| 1686 | 3300025924 | Ga0207694_10290708 | Ga0207694_102907082 | 288 |
| 1687 | 3300025925 | Ga0207650_10000955 | Ga0207650_100009557 | 288 |
| 1688 | 3300025926 | Ga0207659_10037749 | Ga0207659_100377492 | 288 |
| 1689 | 3300025927 | Ga0207687_10184232 | Ga0207687_101842322 | 288 |
| 1690 | 3300025928 | Ga0207700_10026499 | Ga0207700_100264992 | 288 |
| 1691 | 3300025928 | Ga0207700_10111812 | Ga0207700_101118122 | 288 |
| 1692 | 3300025928 | Ga0207700_10202496 | Ga0207700_102024962 | 288 |
| 1693 | 3300025928 | Ga0207700_10229719 | Ga0207700_102297192 | 288 |
| 1694 | 3300025929 | Ga0207664_10041985 | Ga0207664_100419852 | 288 |
| 1695 | 3300025929 | Ga0207664_10283126 | Ga0207664_102831262 | 288 |
| 1696 | 3300025931 | Ga0207644_10143631 | Ga0207644_101436311 | 288 |
| 1697 | 3300025933 | Ga0207706_10093287 | Ga0207706_100932873 | 288 |
| 1698 | 3300025934 | Ga0207686_10128424 | Ga0207686_101284242 | 288 |
| 1699 | 3300025935 | Ga0207709_10000745 | Ga0207709_1000074521 | 288 |
| 1700 | 3300025935 | Ga0207709_10000862 | Ga0207709_100008625 | 288 |
| 1701 | 3300025935 | Ga0207709_10152522 | Ga0207709_101525222 | 288 |
| 1702 | 3300025936 | Ga0207670_10247359 | Ga0207670_102473591 | 288 |
| 1703 | 3300025937 | Ga0207669_10062805 | Ga0207669_100628052 | 288 |
| 1704 | 3300025939 | Ga0207665_10034568 | Ga0207665_100345683 | 288 |
| 1705 | 3300025941 | Ga0207711_10532840 | Ga0207711_105328402 | 288 |
| 1706 | 3300025944 | Ga0207661_10005577 | Ga0207661_100055774 | 288 |
| 1707 | 3300025944 | Ga0207661_10009220 | Ga0207661_100092202 | 288 |
| 1708 | 3300025944 | Ga0207661_10248092 | Ga0207661_102480922 | 288 |
| 1709 | 3300025945 | Ga0207679_10400716 | Ga0207679_104007162 | 288 |
| 1710 | 3300025949 | Ga0207667_10025206 | Ga0207667_100252066 | 288 |
| 1711 | 3300025949 | Ga0207667_10042544 | Ga0207667_100425442 | 288 |
| 1712 | 3300025949 | Ga0207667_10370428 | Ga0207667_103704282 | 288 |
| 1713 | 3300025961 | Ga0207712_10353700 | Ga0207712_103537002 | 288 |
| 1714 | 3300025981 | Ga0207640_10164788 | Ga0207640_101647882 | 288 |
| 1715 | 3300025986 | Ga0207658_10108932 | Ga0207658_101089322 | 288 |
| 1716 | 3300025986 | Ga0207658_10143977 | Ga0207658_101439772 | 288 |
| 1717 | 3300026023 | Ga0207677_10156526 | Ga0207677_101565262 | 288 |
| 1718 | 3300026035 | Ga0207703_10207747 | Ga0207703_102077472 | 288 |
| 1719 | 3300026041 | Ga0207639_10057826 | Ga0207639_100578262 | 288 |
| 1720 | 3300026041 | Ga0207639_10267734 | Ga0207639_102677342 | 288 |
| 1721 | 3300026067 | Ga0207678_10028237 | Ga0207678_100282372 | 288 |
| 1722 | 3300026067 | Ga0207678_10056271 | Ga0207678_100562714 | 288 |
| 1723 | 3300026078 | Ga0207702_10001581 | Ga0207702_1000158119 | 288 |
| 1724 | 3300026078 | Ga0207702_10037097 | Ga0207702_100370974 | 288 |
| 1725 | 3300026078 | Ga0207702_10411970 | Ga0207702_104119702 | 288 |
| 1726 | 3300026088 | Ga0207641_10033406 | Ga0207641_100334064 | 288 |
| 1727 | 3300026089 | Ga0207648_10013832 | Ga0207648_100138327 | 288 |
| 1728 | 3300026116 | Ga0207674_10036358 | Ga0207674_100363583 | 288 |
| 1729 | 3300026116 | Ga0207674_10100560 | Ga0207674_101005603 | 288 |
| 1730 | 3300026116 | Ga0207674_10205855 | Ga0207674_102058552 | 288 |
| 1731 | 3300026116 | Ga0207674_10220597 | Ga0207674_102205972 | 288 |
| 1732 | 3300026121 | Ga0207683_10045311 | Ga0207683_100453114 | 288 |
| 1733 | 3300026121 | Ga0207683_10205221 | Ga0207683_102052212 | 288 |
| 1734 | 3300026142 | Ga0207698_10006676 | Ga0207698_100066763 | 288 |
| 1735 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002390 | 288 |
| 1736 | 3300027111 | Ga0209281_1000061 | Ga0209281_1000061196 | 288 |
| 1737 | 3300027296 | Ga0209389_1034967 | Ga0209389_10349671 | 288 |
| 1738 | 3300027357 | Ga0209589_1000002 | Ga0209589_100000235 | 288 |
| 1739 | 3300027357 | Ga0209589_1004535 | Ga0209589_100453518 | 288 |
| 1740 | 3300027361 | Ga0209489_100002 | Ga0209489_10000235 | 288 |
| 1741 | 3300027361 | Ga0209489_100050 | Ga0209489_100050130 | 288 |
| 1742 | 3300027361 | Ga0209489_104795 | Ga0209489_1047954 | 288 |
| 1743 | 3300027363 | Ga0209700_100002 | Ga0209700_10000235 | 288 |
| 1744 | 3300027363 | Ga0209700_100016 | Ga0209700_100016238 | 288 |
| 1745 | 3300027512 | Ga0209179_1003151 | Ga0209179_10031513 | 288 |
| 1746 | 3300027614 | Ga0209970_1000107 | Ga0209970_10001076 | 288 |
| 1747 | 3300027617 | Ga0210002_1016632 | Ga0210002_10166321 | 288 |
| 1748 | 3300027666 | Ga0209282_1001739 | Ga0209282_10017399 | 288 |
| 1749 | 3300027671 | Ga0209588_1020699 | Ga0209588_10206992 | 288 |
| 1750 | 3300027682 | Ga0209971_1001548 | Ga0209971_10015484 | 288 |
| 1751 | 3300027866 | Ga0209813_10003068 | Ga0209813_100030684 | 288 |
| 1752 | 3300027866 | Ga0209813_10048661 | Ga0209813_100486612 | 288 |
| 1753 | 3300027876 | Ga0209974_10007739 | Ga0209974_100077393 | 288 |
| 1754 | 3300027907 | Ga0207428_10255836 | Ga0207428_102558362 | 288 |
| 1755 | 3300028379 | Ga0268266_10003203 | Ga0268266_1000320313 | 288 |
| 1756 | 3300028379 | Ga0268266_10012481 | Ga0268266_100124818 | 288 |
| 1757 | 3300028379 | Ga0268266_10039076 | Ga0268266_100390764 | 288 |
| 1758 | 3300028379 | Ga0268266_10078930 | Ga0268266_100789303 | 288 |
| 1759 | 3300028379 | Ga0268266_10085845 | Ga0268266_100858454 | 288 |
| 1760 | 3300028381 | Ga0268264_10000038 | Ga0268264_10000038271 | 288 |
| 1761 | 3300028556 | Ga0265337_1005916 | Ga0265337_10059162 | 288 |
| 1762 | 3300028558 | Ga0265326_10003140 | Ga0265326_100031403 | 288 |
| 1763 | 3300028563 | Ga0265319_1002854 | Ga0265319_10028547 | 288 |
| 1764 | 3300028573 | Ga0265334_10001590 | Ga0265334_100015905 | 288 |
| 1765 | 3300028577 | Ga0265318_10005470 | Ga0265318_100054705 | 288 |
| 1766 | 3300028653 | Ga0265323_10000744 | Ga0265323_1000074411 | 288 |
| 1767 | 3300028654 | Ga0265322_10026828 | Ga0265322_100268282 | 288 |
| 1768 | 3300028666 | Ga0265336_10000228 | Ga0265336_1000022811 | 288 |
| 1769 | 3300028786 | Ga0307517_10000512 | Ga0307517_1000051252 | 288 |
| 1770 | 3300028794 | Ga0307515_10007488 | Ga0307515_100074887 | 288 |
| 1771 | 3300028800 | Ga0265338_10000116 | Ga0265338_1000011641 | 288 |
| 1772 | 3300029957 | Ga0265324_10003977 | Ga0265324_100039775 | 288 |
| 1773 | 3300030521 | Ga0307511_10109527 | Ga0307511_101095272 | 288 |
| 1774 | 3300030732 | Ga0316176_1097126 | Ga0316176_10971261 | 288 |
| 1775 | 3300031235 | Ga0265330_10020866 | Ga0265330_100208664 | 288 |
| 1776 | 3300031235 | Ga0265330_10039637 | Ga0265330_100396372 | 288 |
| 1777 | 3300031238 | Ga0265332_10117983 | Ga0265332_101179832 | 288 |
| 1778 | 3300031241 | Ga0265325_10020132 | Ga0265325_100201322 | 288 |
| 1779 | 3300031247 | Ga0265340_10002528 | Ga0265340_100025287 | 288 |
| 1780 | 3300031249 | Ga0265339_10001476 | Ga0265339_100014767 | 288 |
| 1781 | 3300031249 | Ga0265339_10059648 | Ga0265339_100596482 | 288 |
| 1782 | 3300031250 | Ga0265331_10023285 | Ga0265331_100232852 | 288 |
| 1783 | 3300031251 | Ga0265327_10025625 | Ga0265327_100256253 | 288 |
| 1784 | 3300031456 | Ga0307513_10000028 | Ga0307513_10000028185 | 288 |
| 1785 | 3300031456 | Ga0307513_10000206 | Ga0307513_1000020678 | 288 |
| 1786 | 3300031507 | Ga0307509_10084915 | Ga0307509_100849154 | 288 |
| 1787 | 3300031507 | Ga0307509_10120213 | Ga0307509_101202131 | 288 |
| 1788 | 3300031507 | Ga0307509_10379167 | Ga0307509_103791672 | 288 |
| 1789 | 3300031548 | Ga0307408_100027214 | Ga0307408_1000272141 | 288 |
| 1790 | 3300031548 | Ga0307408_100096358 | Ga0307408_1000963581 | 288 |
| 1791 | 3300031548 | Ga0307408_100195868 | Ga0307408_1001958681 | 288 |
| 1792 | 3300031616 | Ga0307508_10000008 | Ga0307508_1000000864 | 288 |
| 1793 | 3300031616 | Ga0307508_10040908 | Ga0307508_100409084 | 288 |
| 1794 | 3300031616 | Ga0307508_10055166 | Ga0307508_100551663 | 288 |
| 1795 | 3300031649 | Ga0307514_10000722 | Ga0307514_100007224 | 288 |
| 1796 | 3300031711 | Ga0265314_10006545 | Ga0265314_1000654511 | 288 |
| 1797 | 3300031711 | Ga0265314_10015462 | Ga0265314_100154625 | 288 |
| 1798 | 3300031711 | Ga0265314_10024921 | Ga0265314_100249213 | 288 |
| 1799 | 3300031727 | Ga0316576_10017056 | Ga0316576_100170561 | 288 |
| 1800 | 3300031730 | Ga0307516_10024119 | Ga0307516_100241194 | 288 |
| 1801 | 3300031731 | Ga0307405_10010736 | Ga0307405_100107364 | 288 |
| 1802 | 3300031824 | Ga0307413_10232830 | Ga0307413_102328302 | 288 |
| 1803 | 3300031901 | Ga0307406_10018898 | Ga0307406_100188982 | 288 |
| 1804 | 3300031911 | Ga0307412_10002786 | Ga0307412_100027866 | 288 |
| 1805 | 3300031911 | Ga0307412_10026597 | Ga0307412_100265972 | 288 |
| 1806 | 3300031911 | Ga0307412_10097399 | Ga0307412_100973992 | 288 |
| 1807 | 3300032002 | Ga0307416_100234891 | Ga0307416_1002348911 | 288 |
| 1808 | 3300032002 | Ga0307416_100279148 | Ga0307416_1002791482 | 288 |
| 1809 | 3300032004 | Ga0307414_10057596 | Ga0307414_100575961 | 288 |
| 1810 | 3300032004 | Ga0307414_10132567 | Ga0307414_101325672 | 288 |
| 1811 | 3300032004 | Ga0307414_10193040 | Ga0307414_101930402 | 288 |
| 1812 | 3300032004 | Ga0307414_10335077 | Ga0307414_103350772 | 288 |
| 1813 | 3300032004 | Ga0307414_10428999 | Ga0307414_104289992 | 288 |
| 1814 | 3300032005 | Ga0307411_10016890 | Ga0307411_100168902 | 288 |
| 1815 | 3300032005 | Ga0307411_10256903 | Ga0307411_102569032 | 288 |
| 1816 | 3300032005 | Ga0307411_10418826 | Ga0307411_104188262 | 288 |
| 1817 | 3300033179 | Ga0307507_10071426 | Ga0307507_100714262 | 288 |
| 1818 | 3300033180 | Ga0307510_10002929 | Ga0307510_100029293 | 288 |
| 1819 | 3300033180 | Ga0307510_10021544 | Ga0307510_100215444 | 288 |
| 1820 | 3300033180 | Ga0307510_10068402 | Ga0307510_100684023 | 288 |
| 1821 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004330 | 288 |
| 1822 | 3300035083 | Ga0373926_0011772 | Ga0373926_0011772_1640_2542 | 288 |
| 1823 | 3300035085 | Ga0373929_0011017 | Ga0373929_0011017_196_1098 | 288 |
| 1824 | 3300035086 | Ga0373934_0001948 | Ga0373934_0001948_6333_7235 | 288 |
| 1825 | 3300035086 | Ga0373934_0012326 | Ga0373934_0012326_477_1379 | 288 |
| 1826 | 3300035112 | Ga0373932_0035200 | Ga0373932_0035200_393_1295 | 288 |
| 1827 | 3300035113 | Ga0373936_0007174 | Ga0373936_0007174_2001_2903 | 288 |
| 1828 | 3300035116 | Ga0373945_0008905 | Ga0373945_0008905_2253_3155 | 288 |
| 1829 | 3300035116 | Ga0373945_0020462 | Ga0373945_0020462_841_1743 | 288 |
| 1830 | 3300035117 | Ga0373953_0094460 | Ga0373953_0094460_139_1041 | 288 |
| 1831 | 3300035118 | Ga0373954_0001852 | Ga0373954_0001852_6961_7863 | 288 |
| 1832 | 3300035118 | Ga0373954_0010696 | Ga0373954_0010696_1345_2247 | 288 |
| 1833 | 3300035119 | Ga0373956_0003558 | Ga0373956_0003558_4086_4988 | 288 |
| 1834 | 3300035119 | Ga0373956_0137522 | Ga0373956_0137522_216_1118 | 288 |
| 1835 | 3300035120 | Ga0373957_0010697 | Ga0373957_0010697_1711_2613 | 288 |
| 1836 | 3300035170 | Ga0373943_0010932 | Ga0373943_0010932_1993_2895 | 288 |
| 1837 | 3300035170 | Ga0373943_0215764 | Ga0373943_0215764_138_1040 | 288 |
| 1838 | 3300035171 | Ga0373946_0013875 | Ga0373946_0013875_2109_3011 | 288 |
| 1839 | 3300035172 | Ga0373955_0039970 | Ga0373955_0039970_899_1801 | 288 |
| 1840 | 3300035172 | Ga0373955_0051885 | Ga0373955_0051885_1029_1931 | 288 |
| 1841 | 3300035242 | Ga0373962_0060997 | Ga0373962_0060997_103_1005 | 288 |
| 1842 | 3300035410 | Ga0373924_0003246 | Ga0373924_0003246_3528_4430 | 288 |
| 1843 | 3300035691 | Ga0373931_0001380 | Ga0373931_0001380_5971_6873 | 288 |
| 1844 | 3300035692 | Ga0373935_0000493 | Ga0373935_0000493_1715_2617 | 288 |
| 1845 | 3300035692 | Ga0373935_0058231 | Ga0373935_0058231_297_1199 | 288 |
| 1846 | 3300035695 | Ga0373927_0000331 | Ga0373927_0000331_22299_23201 | 288 |
| 1847 | 3300035695 | Ga0373927_0007766 | Ga0373927_0007766_4385_5287 | 288 |
| 1848 | 3300035695 | Ga0373927_0012238 | Ga0373927_0012238_554_1456 | 288 |
| 1849 | 3300035695 | Ga0373927_0075732 | Ga0373927_0075732_1248_2150 | 288 |
| 1850 | 3300035695 | Ga0373927_0205124 | Ga0373927_0205124_161_1063 | 288 |
| 1851 | 3300035724 | Ga0373933_0004248 | Ga0373933_0004248_1829_2731 | 288 |
| 1852 | 3300035724 | Ga0373933_0047155 | Ga0373933_0047155_855_1757 | 288 |
| 1853 | 3300035725 | Ga0373947_0004776 | Ga0373947_0004776_5332_6234 | 288 |
| 1854 | 3300035725 | Ga0373947_0014044 | Ga0373947_0014044_1513_2415 | 288 |
| 1855 | 3300035725 | Ga0373947_0055623 | Ga0373947_0055623_1454_2353 | 288 |
| 1856 | 3300035725 | Ga0373947_0143620 | Ga0373947_0143620_211_1113 | 288 |
| 1857 | 3300036401 | Ga0373937_0009958 | Ga0373937_0009958_7131_8033 | 288 |
| 1858 | 3300036401 | Ga0373937_0136963 | Ga0373937_0136963_814_1716 | 288 |
| 1859 | 3300036712 | Ga0316584_0161063 | Ga0316584_0161063_361_1233 | 288 |
| 1860 | 3300037068 | Ga0373925_0029402 | Ga0373925_0029402_1351_2253 | 288 |
| 1861 | 3300037068 | Ga0373925_0053723 | Ga0373925_0053723_1695_2603 | 288 |
| 1862 | 3300037068 | Ga0373925_0094066 | Ga0373925_0094066_1015_1917 | 288 |
| 1863 | 3300037312 | Ga0395899_0027157 | Ga0395899_0027157_2689_3591 | 288 |
| 1864 | 3300037418 | Ga0395900_0000134 | Ga0395900_0000134_122647_123549 | 288 |
| 1865 | 3300037466 | Ga0395898_0411805 | Ga0395898_0411805_328_1218 | 288 |
| 1866 | 3300037471 | Ga0395905_0155934 | Ga0395905_0155934_321_1214 | 288 |
| 1867 | 3300037471 | Ga0395905_0193383 | Ga0395905_0193383_180_1082 | 288 |
| 1868 | 3300038443 | Ga0395901_0011149 | Ga0395901_0011149_3585_4487 | 288 |
| 1869 | 3300038443 | Ga0395901_0084013 | Ga0395901_0084013_1821_2708 | 288 |
| 1870 | 3300038443 | Ga0395901_0091348 | Ga0395901_0091348_1501_2403 | 288 |
| 1871 | 3300039437 | Ga0436365_0851563 | Ga0436365_0851563_436_1338 | 288 |
| 1872 | 3300039438 | Ga0436360_0042397 | Ga0436360_0042397_8896_9798 | 288 |
| 1873 | 3300039438 | Ga0436360_0742143 | Ga0436360_0742143_374_1276 | 288 |
| 1874 | 3300039438 | Ga0436360_0766994 | Ga0436360_0766994_531_1433 | 288 |
| 1875 | 3300039438 | Ga0436360_0975226 | Ga0436360_0975226_654_1556 | 288 |
| 1876 | 3300039447 | Ga0436361_0054229 | Ga0436361_0054229_1256_2158 | 288 |
| 1877 | 3300039450 | Ga0436363_0016840 | Ga0436363_0016840_50_952 | 288 |
| 1878 | 3300039450 | Ga0436363_1029339 | Ga0436363_1029339_729_1631 | 288 |
| 1879 | 3300041406 | Ga0439439_0029169 | Ga0439439_0029169_217_1113 | 288 |
| 1880 | 3300041411 | Ga0439466_0044835 | Ga0439466_0044835_552_1442 | 288 |
| 1881 | 3300041486 | Ga0451807_0979801 | Ga0451807_0979801_286_1188 | 288 |
| 1882 | 3300042006 | Ga0439432_015833 | Ga0439432_015833_525_1415 | 288 |
| 1883 | 3300042007 | Ga0439449_0004936 | Ga0439449_0004936_441_1328 | 288 |
| 1884 | 3300042007 | Ga0439449_0041706 | Ga0439449_0041706_160_1050 | 288 |
| 1885 | 3300042122 | Ga0450920_033559 | Ga0450920_033559_73_963 | 288 |
| 1886 | 3300042145 | Ga0450906_010567 | Ga0450906_010567_504_1394 | 288 |
| 1887 | 3300042184 | Ga0450908_018115 | Ga0450908_018115_83_973 | 288 |
| 1888 | 3300042531 | Ga0450918_004434 | Ga0450918_004434_1454_2344 | 288 |
| 1889 | 3300044673 | Ga0453683_0003423 | Ga0453683_0003423_6187_7080 | 288 |
| 1890 | 3300044683 | Ga0466965_0030147 | Ga0466965_0030147_165_1052 | 288 |
| 1891 | 3300044684 | Ga0466966_0001490 | Ga0466966_0001490_12639_13541 | 288 |
| 1892 | 3300044684 | Ga0466966_0049842 | Ga0466966_0049842_624_1511 | 288 |
| 1893 | 3300044693 | Ga0466961_0000122 | Ga0466961_0000122_37574_38476 | 288 |
| 1894 | 3300044712 | Ga0453684_0000590 | Ga0453684_0000590_40998_41894 | 288 |
| 1895 | 3300044719 | Ga0466971_0017005 | Ga0466971_0017005_1952_2839 | 288 |
| 1896 | 3300044735 | Ga0466968_0010019 | Ga0466968_0010019_1853_2827 | 288 |
| 1897 | 3300044735 | Ga0466968_0030833 | Ga0466968_0030833_93_995 | 288 |
| 1898 | 3300044842 | Ga0466957_0039832 | Ga0466957_0039832_1391_2278 | 288 |
| 1899 | 3300045049 | Ga0466959_0077781 | Ga0466959_0077781_665_1567 | 288 |
| 1900 | 3300045049 | Ga0466959_0149223 | Ga0466959_0149223_167_1087 | 288 |
| 1901 | 3300045051 | Ga0451576_0004219 | Ga0451576_0004219_2827_3723 | 288 |
| 1902 | 3300045051 | Ga0451576_0029404 | Ga0451576_0029404_3202_4104 | 288 |
| 1903 | 3300045051 | Ga0451576_0141235 | Ga0451576_0141235_712_1608 | 288 |
| 1904 | 3300045836 | Ga0466958_0036023 | Ga0466958_0036023_1917_2804 | 288 |
| 1905 | 3300045976 | Ga0466967_0080214 | Ga0466967_0080214_720_1622 | 288 |
| 1906 | 3300045976 | Ga0466967_0081717 | Ga0466967_0081717_1984_2892 | 288 |
| 1907 | 3300046454 | Ga0495592_0014473 | Ga0495592_0014473_2434_3336 | 288 |
| 1908 | 3300046454 | Ga0495592_0017918 | Ga0495592_0017918_3386_4288 | 288 |
| 1909 | 3300046454 | Ga0495592_0023531 | Ga0495592_0023531_3558_4460 | 288 |
| 1910 | 3300046454 | Ga0495592_0034500 | Ga0495592_0034500_1860_2762 | 288 |
| 1911 | 3300046455 | Ga0495603_0003417 | Ga0495603_0003417_2622_3524 | 288 |
| 1912 | 3300046455 | Ga0495603_0031407 | Ga0495603_0031407_529_1431 | 288 |
| 1913 | 3300046455 | Ga0495603_0043613 | Ga0495603_0043613_904_1806 | 288 |
| 1914 | 3300046457 | Ga0495590_0011066 | Ga0495590_0011066_286_1188 | 288 |
| 1915 | 3300046459 | Ga0495629_0001243 | Ga0495629_0001243_18616_19518 | 288 |
| 1916 | 3300046459 | Ga0495629_0002500 | Ga0495629_0002500_6960_7862 | 288 |
| 1917 | 3300046459 | Ga0495629_0046459 | Ga0495629_0046459_202_1104 | 288 |
| 1918 | 3300046459 | Ga0495629_0190955 | Ga0495629_0190955_382_1284 | 288 |
| 1919 | 3300046460 | Ga0495638_0017604 | Ga0495638_0017604_2144_3118 | 288 |
| 1920 | 3300046460 | Ga0495638_0036612 | Ga0495638_0036612_1586_2488 | 288 |
| 1921 | 3300046460 | Ga0495638_0071985 | Ga0495638_0071985_329_1234 | 288 |
| 1922 | 3300046460 | Ga0495638_0148590 | Ga0495638_0148590_231_1133 | 288 |
| 1923 | 3300046461 | Ga0495641_0006961 | Ga0495641_0006961_4320_5222 | 288 |
| 1924 | 3300046462 | Ga0495651_0036982 | Ga0495651_0036982_2731_3633 | 288 |
| 1925 | 3300046462 | Ga0495651_0058034 | Ga0495651_0058034_834_1736 | 288 |
| 1926 | 3300046463 | Ga0495653_0000821 | Ga0495653_0000821_8622_9524 | 288 |
| 1927 | 3300046463 | Ga0495653_0128814 | Ga0495653_0128814_549_1451 | 288 |
| 1928 | 3300046472 | Ga0495580_0001284 | Ga0495580_0001284_18401_19303 | 288 |
| 1929 | 3300046472 | Ga0495580_0006315 | Ga0495580_0006315_44_946 | 288 |
| 1930 | 3300046472 | Ga0495580_0148851 | Ga0495580_0148851_325_1227 | 288 |
| 1931 | 3300046473 | Ga0495582_0000166 | Ga0495582_0000166_18477_19379 | 288 |
| 1932 | 3300046473 | Ga0495582_0003905 | Ga0495582_0003905_1907_2809 | 288 |
| 1933 | 3300046475 | Ga0495639_0001515 | Ga0495639_0001515_6834_7736 | 288 |
| 1934 | 3300046475 | Ga0495639_0004799 | Ga0495639_0004799_3218_4120 | 288 |
| 1935 | 3300046475 | Ga0495639_0082730 | Ga0495639_0082730_325_1227 | 288 |
| 1936 | 3300046476 | Ga0495662_0090495 | Ga0495662_0090495_377_1279 | 288 |
| 1937 | 3300046477 | Ga0495664_0002707 | Ga0495664_0002707_7591_8505 | 288 |
| 1938 | 3300046477 | Ga0495664_0002890 | Ga0495664_0002890_4219_5121 | 288 |
| 1939 | 3300046477 | Ga0495664_0134418 | Ga0495664_0134418_519_1421 | 288 |
| 1940 | 3300046499 | Ga0495594_0004296 | Ga0495594_0004296_1059_1961 | 288 |
| 1941 | 3300046499 | Ga0495594_0086106 | Ga0495594_0086106_385_1287 | 288 |
| 1942 | 3300046501 | Ga0495607_0142386 | Ga0495607_0142386_274_1179 | 288 |
| 1943 | 3300046506 | Ga0495583_0037575 | Ga0495583_0037575_812_1678 | 288 |
| 1944 | 3300046507 | Ga0495606_0001165 | Ga0495606_0001165_35006_35905 | 288 |
| 1945 | 3300046507 | Ga0495606_0058668 | Ga0495606_0058668_1214_2116 | 288 |
| 1946 | 3300046507 | Ga0495606_0080355 | Ga0495606_0080355_348_1253 | 288 |
| 1947 | 3300046511 | Ga0495608_0002366 | Ga0495608_0002366_3176_4078 | 288 |
| 1948 | 3300046511 | Ga0495608_0170921 | Ga0495608_0170921_402_1304 | 288 |
| 1949 | 3300046512 | Ga0495610_0018339 | Ga0495610_0018339_2506_3372 | 288 |
| 1950 | 3300046512 | Ga0495610_0037307 | Ga0495610_0037307_223_1122 | 288 |
| 1951 | 3300046515 | Ga0495620_0062506 | Ga0495620_0062506_142_1044 | 288 |
| 1952 | 3300046516 | Ga0495628_0020530 | Ga0495628_0020530_236_1138 | 288 |
| 1953 | 3300046516 | Ga0495628_0033373 | Ga0495628_0033373_3002_3904 | 288 |
| 1954 | 3300046516 | Ga0495628_0083981 | Ga0495628_0083981_475_1377 | 288 |
| 1955 | 3300046517 | Ga0495630_0006088 | Ga0495630_0006088_1499_2401 | 288 |
| 1956 | 3300046517 | Ga0495630_0017695 | Ga0495630_0017695_2023_2925 | 288 |
| 1957 | 3300046517 | Ga0495630_0167346 | Ga0495630_0167346_233_1135 | 288 |
| 1958 | 3300046517 | Ga0495630_0321663 | Ga0495630_0321663_47_949 | 288 |
| 1959 | 3300046519 | Ga0495632_0068709 | Ga0495632_0068709_291_1157 | 288 |
| 1960 | 3300046522 | Ga0495643_0018119 | Ga0495643_0018119_3115_4089 | 288 |
| 1961 | 3300046524 | Ga0495648_0000832 | Ga0495648_0000832_2827_3729 | 288 |
| 1962 | 3300046524 | Ga0495648_0001607 | Ga0495648_0001607_13115_14017 | 288 |
| 1963 | 3300046524 | Ga0495648_0039513 | Ga0495648_0039513_843_1745 | 288 |
| 1964 | 3300046529 | Ga0495652_0026794 | Ga0495652_0026794_226_1128 | 288 |
| 1965 | 3300046529 | Ga0495652_0032433 | Ga0495652_0032433_492_1394 | 288 |
| 1966 | 3300046529 | Ga0495652_0088960 | Ga0495652_0088960_788_1690 | 288 |
| 1967 | 3300046529 | Ga0495652_0113108 | Ga0495652_0113108_1258_2160 | 288 |
| 1968 | 3300046530 | Ga0495654_0000207 | Ga0495654_0000207_31145_32014 | 288 |
| 1969 | 3300046531 | Ga0495665_0000104 | Ga0495665_0000104_24327_25229 | 288 |
| 1970 | 3300046533 | Ga0495640_0004822 | Ga0495640_0004822_6656_7558 | 288 |
| 1971 | 3300046533 | Ga0495640_0009631 | Ga0495640_0009631_5472_6374 | 288 |
| 1972 | 3300046533 | Ga0495640_0018706 | Ga0495640_0018706_528_1430 | 288 |
| 1973 | 3300046533 | Ga0495640_0039260 | Ga0495640_0039260_2026_2928 | 288 |
| 1974 | 3300046535 | Ga0495586_0022737 | Ga0495586_0022737_324_1226 | 288 |
| 1975 | 3300046536 | Ga0495587_0066179 | Ga0495587_0066179_177_1079 | 288 |
| 1976 | 3300046542 | Ga0495597_0016953 | Ga0495597_0016953_1517_2419 | 288 |
| 1977 | 3300046543 | Ga0495645_0003878 | Ga0495645_0003878_5783_6685 | 288 |
| 1978 | 3300046543 | Ga0495645_0007622 | Ga0495645_0007622_1556_2458 | 288 |
| 1979 | 3300046543 | Ga0495645_0024803 | Ga0495645_0024803_865_1779 | 288 |
| 1980 | 3300046543 | Ga0495645_0049530 | Ga0495645_0049530_1012_1914 | 288 |
| 1981 | 3300046557 | Ga0495622_0035224 | Ga0495622_0035224_251_1156 | 288 |
| 1982 | 3300046557 | Ga0495622_0123527 | Ga0495622_0123527_110_1084 | 288 |
| 1983 | 3300046558 | Ga0495633_0004906 | Ga0495633_0004906_5618_6502 | 288 |
| 1984 | 3300046559 | Ga0495667_0032161 | Ga0495667_0032161_110_1012 | 288 |
| 1985 | 3300046559 | Ga0495667_0297173 | Ga0495667_0297173_30_932 | 288 |
| 1986 | 3300046615 | Ga0495656_0054834 | Ga0495656_0054834_247_1149 | 288 |
| 1987 | 3300046616 | Ga0495668_0179737 | Ga0495668_0179737_211_1101 | 288 |
| 1988 | 3300046642 | Ga0495634_0017597 | Ga0495634_0017597_2068_2970 | 288 |
| 1989 | 3300046642 | Ga0495634_0032726 | Ga0495634_0032726_1167_2069 | 288 |
| 1990 | 3300046642 | Ga0495634_0041737 | Ga0495634_0041737_1214_2116 | 288 |
| 1991 | 3300046648 | Ga0495611_0060183 | Ga0495611_0060183_364_1266 | 288 |
| 1992 | 3300046660 | Ga0495625_0000637 | Ga0495625_0000637_1793_2683 | 288 |
| 1993 | 3300046660 | Ga0495625_0063090 | Ga0495625_0063090_1182_2084 | 288 |
| 1994 | 3300046660 | Ga0495625_0183625 | Ga0495625_0183625_14_880 | 288 |
| 1995 | 3300046663 | Ga0495635_0000965 | Ga0495635_0000965_9494_10396 | 288 |
| 1996 | 3300046663 | Ga0495635_0022910 | Ga0495635_0022910_2521_3423 | 288 |
| 1997 | 3300046664 | Ga0495659_0033826 | Ga0495659_0033826_638_1540 | 288 |
| 1998 | 3300046665 | Ga0495661_0078549 | Ga0495661_0078549_47_949 | 288 |
| 1999 | 3300046665 | Ga0495661_0135855 | Ga0495661_0135855_157_1062 | 288 |
| 2000 | 3300046675 | Ga0495657_0003762 | Ga0495657_0003762_4330_5232 | 288 |
| 2001 | 3300046675 | Ga0495657_0009942 | Ga0495657_0009942_2650_3552 | 288 |
| 2002 | 3300046675 | Ga0495657_0033182 | Ga0495657_0033182_893_1795 | 288 |
| 2003 | 3300046675 | Ga0495657_0056668 | Ga0495657_0056668_1374_2276 | 288 |
| 2004 | 3300046678 | Ga0495599_0000673 | Ga0495599_0000673_13894_14796 | 288 |
| 2005 | 3300046678 | Ga0495599_0054348 | Ga0495599_0054348_1394_2296 | 288 |
| 2006 | 3300046680 | Ga0495646_0001365 | Ga0495646_0001365_10360_11262 | 288 |
| 2007 | 3300046680 | Ga0495646_0011555 | Ga0495646_0011555_85_987 | 288 |
| 2008 | 3300046680 | Ga0495646_0030382 | Ga0495646_0030382_1308_2210 | 288 |
| 2009 | 3300046681 | Ga0495647_0034877 | Ga0495647_0034877_98_1000 | 288 |
| 2010 | 3300046683 | Ga0495658_0005346 | Ga0495658_0005346_656_1558 | 288 |
| 2011 | 3300046683 | Ga0495658_0044779 | Ga0495658_0044779_1278_2180 | 288 |
| 2012 | 3300046683 | Ga0495658_0072881 | Ga0495658_0072881_866_1768 | 288 |
| 2013 | 3300046689 | Ga0495613_0012606 | Ga0495613_0012606_4228_5130 | 288 |
| 2014 | 3300046689 | Ga0495613_0156210 | Ga0495613_0156210_125_1027 | 288 |
| 2015 | 3300046690 | Ga0495624_0003391 | Ga0495624_0003391_9174_10076 | 288 |
| 2016 | 3300046690 | Ga0495624_0039559 | Ga0495624_0039559_1825_2727 | 288 |
| 2017 | 3300046690 | Ga0495624_0052583 | Ga0495624_0052583_255_1157 | 288 |
| 2018 | 3300046691 | Ga0495670_0010648 | Ga0495670_0010648_492_1397 | 288 |
| 2019 | 3300046694 | Ga0495649_0099289 | Ga0495649_0099289_310_1212 | 288 |
| 2020 | 3300046809 | Ga0495600_0002097 | Ga0495600_0002097_9494_10396 | 288 |
| 2021 | 3300046809 | Ga0495600_0017523 | Ga0495600_0017523_130_1032 | 288 |
| 2022 | 3300046809 | Ga0495600_0118175 | Ga0495600_0118175_353_1255 | 288 |
| 2023 | 3300047315 | Ga0495581_0000391 | Ga0495581_0000391_18476_19378 | 288 |
| 2024 | 3300047315 | Ga0495581_0066443 | Ga0495581_0066443_1165_2067 | 288 |
| 2025 | 3300047317 | Ga0495604_0016096 | Ga0495604_0016096_2097_2999 | 288 |
| 2026 | 3300047317 | Ga0495604_0021599 | Ga0495604_0021599_1374_2276 | 288 |
| 2027 | 3300047319 | Ga0495674_0001108 | Ga0495674_0001108_24331_25233 | 288 |
| 2028 | 3300047319 | Ga0495674_0012073 | Ga0495674_0012073_3499_4401 | 288 |
| 2029 | 3300047319 | Ga0495674_0033082 | Ga0495674_0033082_3485_4387 | 288 |
| 2030 | 3300047319 | Ga0495674_0137732 | Ga0495674_0137732_294_1196 | 288 |
| 2031 | 3300047319 | Ga0495674_0274794 | Ga0495674_0274794_32_934 | 288 |
| 2032 | 3300047320 | Ga0495672_0058151 | Ga0495672_0058151_929_1831 | 288 |
| 2033 | 3300047321 | Ga0495676_0105399 | Ga0495676_0105399_378_1280 | 288 |
| 2034 | 3300047321 | Ga0495676_0238373 | Ga0495676_0238373_73_975 | 288 |
| 2035 | 3300047322 | Ga0495680_0006581 | Ga0495680_0006581_4330_5232 | 288 |
| 2036 | 3300047443 | Ga0495687_052157 | Ga0495687_052157_91_1065 | 288 |
| 2037 | 3300047444 | Ga0495675_0001627 | Ga0495675_0001627_7315_8217 | 288 |
| 2038 | 3300047444 | Ga0495675_0031987 | Ga0495675_0031987_131_1033 | 288 |
| 2039 | 3300047469 | Ga0495673_0032426 | Ga0495673_0032426_1435_2337 | 288 |
| 2040 | 3300047471 | Ga0495684_0001891 | Ga0495684_0001891_139_1041 | 288 |
| 2041 | 3300047471 | Ga0495684_0006492 | Ga0495684_0006492_2673_3575 | 288 |
| 2042 | 3300047471 | Ga0495684_0020313 | Ga0495684_0020313_3622_4524 | 288 |
| 2043 | 3300047472 | Ga0495686_0096606 | Ga0495686_0096606_681_1547 | 288 |
| 2044 | 3300047472 | Ga0495686_0131884 | Ga0495686_0131884_561_1463 | 288 |
| 2045 | 3300047673 | Ga0495593_0000180 | Ga0495593_0000180_18472_19374 | 288 |
| 2046 | 3300048088 | Ga0495602_0029325 | Ga0495602_0029325_3726_4628 | 288 |
| 2047 | 3300048088 | Ga0495602_0061892 | Ga0495602_0061892_1197_2099 | 288 |
| 2048 | 3300048088 | Ga0495602_0266693 | Ga0495602_0266693_140_1042 | 288 |
| 2049 | 3300048089 | Ga0495614_0009204 | Ga0495614_0009204_537_1439 | 288 |
| 2050 | 3300048091 | Ga0495626_0047188 | Ga0495626_0047188_116_1018 | 288 |
| 2051 | 3300048903 | Ga0496100_0343340 | Ga0496100_0343340_94_984 | 288 |
| 2052 | 3300048904 | Ga0496101_0054418 | Ga0496101_0054418_67_969 | 288 |
| 2053 | 3300048905 | Ga0496102_0035155 | Ga0496102_0035155_1059_1961 | 288 |
| 2054 | 3300048905 | Ga0496102_0149984 | Ga0496102_0149984_95_997 | 288 |
| 2055 | 3300048905 | Ga0496102_0268468 | Ga0496102_0268468_246_1220 | 288 |
| 2056 | 3300048906 | Ga0496103_0004910 | Ga0496103_0004910_471_1445 | 288 |
| 2057 | 3300048907 | Ga0496104_0152143 | Ga0496104_0152143_43_1017 | 288 |
| 2058 | 3300048907 | Ga0496104_0157091 | Ga0496104_0157091_404_1306 | 288 |
| 2059 | 3300048907 | Ga0496104_0173710 | Ga0496104_0173710_633_1523 | 288 |
| 2060 | 3300048907 | Ga0496104_0274899 | Ga0496104_0274899_57_1031 | 288 |
| 2061 | 3300048907 | Ga0496104_0505852 | Ga0496104_0505852_189_1091 | 288 |
| 2062 | 3300048908 | Ga0496105_0008027 | Ga0496105_0008027_538_1440 | 288 |
| 2063 | 3300048908 | Ga0496105_0068092 | Ga0496105_0068092_1227_2129 | 288 |
| 2064 | 3300048908 | Ga0496105_0068327 | Ga0496105_0068327_1860_2762 | 288 |
| 2065 | 3300048908 | Ga0496105_0090420 | Ga0496105_0090420_774_1748 | 288 |
| 2066 | 3300048908 | Ga0496105_0313031 | Ga0496105_0313031_333_1235 | 288 |
| 2067 | 3300048909 | Ga0496106_0000201 | Ga0496106_0000201_38724_39590 | 288 |
| 2068 | 3300048909 | Ga0496106_0013233 | Ga0496106_0013233_4339_5241 | 288 |
| 2069 | 3300048910 | Ga0496107_0133265 | Ga0496107_0133265_597_1487 | 288 |
| 2070 | 3300048911 | Ga0496108_0074813 | Ga0496108_0074813_1895_2797 | 288 |
| 2071 | 3300048911 | Ga0496108_0106391 | Ga0496108_0106391_769_1671 | 288 |
| 2072 | 3300048911 | Ga0496108_0210665 | Ga0496108_0210665_181_1086 | 288 |
| 2073 | 3300048911 | Ga0496108_0288637 | Ga0496108_0288637_332_1306 | 288 |
| 2074 | 3300048912 | Ga0496109_0024725 | Ga0496109_0024725_3286_4188 | 288 |
| 2075 | 3300048912 | Ga0496109_0252270 | Ga0496109_0252270_583_1473 | 288 |
| 2076 | 3300048912 | Ga0496109_0291169 | Ga0496109_0291169_427_1401 | 288 |
| 2077 | 3300048913 | Ga0496110_0035946 | Ga0496110_0035946_2132_3034 | 288 |
| 2078 | 3300048913 | Ga0496110_0088041 | Ga0496110_0088041_824_1798 | 288 |
| 2079 | 3300048914 | Ga0496111_0024140 | Ga0496111_0024140_2948_3832 | 288 |
| 2080 | 3300048914 | Ga0496111_0038246 | Ga0496111_0038246_1878_2780 | 288 |
| 2081 | 3300048914 | Ga0496111_0104793 | Ga0496111_0104793_94_996 | 288 |
| 2082 | 3300048915 | Ga0496112_0000092 | Ga0496112_0000092_44686_45585 | 288 |
| 2083 | 3300048915 | Ga0496112_0022945 | Ga0496112_0022945_567_1469 | 288 |
| 2084 | 3300048915 | Ga0496112_0179532 | Ga0496112_0179532_333_1235 | 288 |
| 2085 | 3300048915 | Ga0496112_0181055 | Ga0496112_0181055_928_1830 | 288 |
| 2086 | 3300048915 | Ga0496112_0566202 | Ga0496112_0566202_129_1031 | 288 |
| 2087 | 3300048916 | Ga0496113_0049855 | Ga0496113_0049855_806_1708 | 288 |
| 2088 | 3300048916 | Ga0496113_0274579 | Ga0496113_0274579_140_1114 | 288 |
| 2089 | 3300048917 | Ga0496114_0041941 | Ga0496114_0041941_1388_2290 | 288 |
| 2090 | 3300048917 | Ga0496114_0156892 | Ga0496114_0156892_429_1331 | 288 |
| 2091 | 3300048917 | Ga0496114_0162639 | Ga0496114_0162639_944_1846 | 288 |
| 2092 | 3300048918 | Ga0496115_0002825 | Ga0496115_0002825_9703_10605 | 288 |
| 2093 | 3300048918 | Ga0496115_0022795 | Ga0496115_0022795_446_1336 | 288 |
| 2094 | 3300048919 | Ga0496116_0000061 | Ga0496116_0000061_119308_120174 | 288 |
| 2095 | 3300048919 | Ga0496116_0002679 | Ga0496116_0002679_16268_17134 | 288 |
| 2096 | 3300048919 | Ga0496116_0004501 | Ga0496116_0004501_1123_1989 | 288 |
| 2097 | 3300048919 | Ga0496116_0004648 | Ga0496116_0004648_10813_11679 | 288 |
| 2098 | 3300048919 | Ga0496116_0032753 | Ga0496116_0032753_1772_2674 | 288 |
| 2099 | 3300048919 | Ga0496116_0089587 | Ga0496116_0089587_508_1482 | 288 |
| 2100 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_1322488_1323372 | 288 |
| 2101 | 3300048920 | Ga0496117_0044016 | Ga0496117_0044016_627_1529 | 288 |
| 2102 | 3300048920 | Ga0496117_0108516 | Ga0496117_0108516_691_1611 | 288 |
| 2103 | 3300048920 | Ga0496117_0166454 | Ga0496117_0166454_78_1052 | 288 |
| 2104 | 3300048921 | Ga0496118_0000002 | Ga0496118_0000002_1322488_1323372 | 288 |
| 2105 | 3300048921 | Ga0496118_0009532 | Ga0496118_0009532_6982_7884 | 288 |
| 2106 | 3300048921 | Ga0496118_0057074 | Ga0496118_0057074_652_1572 | 288 |
| 2107 | 3300048921 | Ga0496118_0061408 | Ga0496118_0061408_1215_2117 | 288 |
| 2108 | 3300048922 | Ga0496119_0001636 | Ga0496119_0001636_1717_2622 | 288 |
| 2109 | 3300048922 | Ga0496119_0033824 | Ga0496119_0033824_2150_3052 | 288 |
| 2110 | 3300048922 | Ga0496119_0190741 | Ga0496119_0190741_85_990 | 288 |
| 2111 | 3300048924 | Ga0496121_0000099 | Ga0496121_0000099_197375_198277 | 288 |
| 2112 | 3300048924 | Ga0496121_0000684 | Ga0496121_0000684_1578_2462 | 288 |
| 2113 | 3300048924 | Ga0496121_0002376 | Ga0496121_0002376_25465_26370 | 288 |
| 2114 | 3300048924 | Ga0496121_0002933 | Ga0496121_0002933_20668_21537 | 288 |
| 2115 | 3300048924 | Ga0496121_0006287 | Ga0496121_0006287_10827_11711 | 288 |
| 2116 | 3300048924 | Ga0496121_0012784 | Ga0496121_0012784_861_1766 | 288 |
| 2117 | 3300048924 | Ga0496121_0028225 | Ga0496121_0028225_545_1447 | 288 |
| 2118 | 3300048924 | Ga0496121_0032833 | Ga0496121_0032833_2866_3840 | 288 |
| 2119 | 3300048924 | Ga0496121_0053578 | Ga0496121_0053578_2324_3244 | 288 |
| 2120 | 3300048924 | Ga0496121_0063399 | Ga0496121_0063399_43_972 | 288 |
| 2121 | 3300048924 | Ga0496121_0067626 | Ga0496121_0067626_1311_2177 | 288 |
| 2122 | 3300048924 | Ga0496121_0087453 | Ga0496121_0087453_996_1898 | 288 |
| 2123 | 3300048924 | Ga0496121_0168484 | Ga0496121_0168484_311_1210 | 288 |
| 2124 | 3300048924 | Ga0496121_0197206 | Ga0496121_0197206_38_940 | 288 |
| 2125 | 3300048924 | Ga0496121_0231043 | Ga0496121_0231043_169_1071 | 288 |
| 2126 | 3300048925 | Ga0496122_0005417 | Ga0496122_0005417_117_1001 | 288 |
| 2127 | 3300048925 | Ga0496122_0093078 | Ga0496122_0093078_33_935 | 288 |
| 2128 | 3300048925 | Ga0496122_0099831 | Ga0496122_0099831_100_966 | 288 |
| 2129 | 3300048925 | Ga0496122_0101137 | Ga0496122_0101137_517_1419 | 288 |
| 2130 | 3300048926 | Ga0496123_0018674 | Ga0496123_0018674_2389_3255 | 288 |
| 2131 | 3300048926 | Ga0496123_0051185 | Ga0496123_0051185_900_1805 | 288 |
| 2132 | 3300048926 | Ga0496123_0093223 | Ga0496123_0093223_753_1658 | 288 |
| 2133 | 3300048926 | Ga0496123_0108089 | Ga0496123_0108089_649_1515 | 288 |
| 2134 | 3300048927 | Ga0496124_0000788 | Ga0496124_0000788_982_1884 | 288 |
| 2135 | 3300048927 | Ga0496124_0026389 | Ga0496124_0026389_4076_4978 | 288 |
| 2136 | 3300048927 | Ga0496124_0055451 | Ga0496124_0055451_2400_3266 | 288 |
| 2137 | 3300048927 | Ga0496124_0058194 | Ga0496124_0058194_877_1779 | 288 |
| 2138 | 3300048928 | Ga0496125_0000715 | Ga0496125_0000715_45753_46655 | 288 |
| 2139 | 3300048928 | Ga0496125_0003799 | Ga0496125_0003799_3750_4655 | 288 |
| 2140 | 3300048928 | Ga0496125_0023769 | Ga0496125_0023769_1489_2391 | 288 |
| 2141 | 3300048928 | Ga0496125_0040985 | Ga0496125_0040985_1614_2516 | 288 |
| 2142 | 3300048928 | Ga0496125_0045842 | Ga0496125_0045842_2424_3326 | 288 |
| 2143 | 3300048928 | Ga0496125_0056254 | Ga0496125_0056254_1693_2559 | 288 |
| 2144 | 3300048928 | Ga0496125_0140249 | Ga0496125_0140249_527_1501 | 288 |
| 2145 | 3300048928 | Ga0496125_0207685 | Ga0496125_0207685_153_1055 | 288 |
| 2146 | 3300048929 | Ga0496126_0000397 | Ga0496126_0000397_78788_79654 | 288 |
| 2147 | 3300048929 | Ga0496126_0006480 | Ga0496126_0006480_385_1275 | 288 |
| 2148 | 3300048929 | Ga0496126_0014179 | Ga0496126_0014179_6107_7009 | 288 |
| 2149 | 3300048929 | Ga0496126_0016190 | Ga0496126_0016190_3253_4155 | 288 |
| 2150 | 3300048929 | Ga0496126_0037699 | Ga0496126_0037699_918_1820 | 288 |
| 2151 | 3300048929 | Ga0496126_0041380 | Ga0496126_0041380_3008_3910 | 288 |
| 2152 | 3300048929 | Ga0496126_0048610 | Ga0496126_0048610_716_1621 | 288 |
| 2153 | 3300048929 | Ga0496126_0062027 | Ga0496126_0062027_1449_2351 | 288 |
| 2154 | 3300048929 | Ga0496126_0065008 | Ga0496126_0065008_1378_2280 | 288 |
| 2155 | 3300048929 | Ga0496126_0081582 | Ga0496126_0081582_223_1119 | 288 |
| 2156 | 3300048929 | Ga0496126_0091239 | Ga0496126_0091239_1139_2041 | 288 |
| 2157 | 3300048929 | Ga0496126_0112527 | Ga0496126_0112527_807_1709 | 288 |
| 2158 | 3300048929 | Ga0496126_0121887 | Ga0496126_0121887_912_1817 | 288 |
| 2159 | 3300048929 | Ga0496126_0188274 | Ga0496126_0188274_758_1732 | 288 |
| 2160 | 3300048929 | Ga0496126_0197132 | Ga0496126_0197132_657_1559 | 288 |
| 2161 | 3300048929 | Ga0496126_0218447 | Ga0496126_0218447_462_1364 | 288 |
| 2162 | 3300048929 | Ga0496126_0333399 | Ga0496126_0333399_219_1121 | 288 |
| 2163 | 3300048929 | Ga0496126_0421289 | Ga0496126_0421289_109_1011 | 288 |
| 2164 | 3300049460 | Ga0495682_0010828 | Ga0495682_0010828_2160_3044 | 288 |
| 2165 | 3300049568 | Ga0501031_0006330 | Ga0501031_0006330_2074_2976 | 288 |
| 2166 | 3300049568 | Ga0501031_0029630 | Ga0501031_0029630_547_1437 | 288 |
| 2167 | 3300049568 | Ga0501031_0051048 | Ga0501031_0051048_1235_2101 | 288 |
| 2168 | 3300049569 | Ga0501032_0000088 | Ga0501032_0000088_14605_15507 | 288 |
| 2169 | 3300049569 | Ga0501032_0004273 | Ga0501032_0004273_9228_10094 | 288 |
| 2170 | 3300049569 | Ga0501032_0023586 | Ga0501032_0023586_1978_2883 | 288 |
| 2171 | 3300049569 | Ga0501032_0048350 | Ga0501032_0048350_670_1563 | 288 |
| 2172 | 3300049569 | Ga0501032_0049366 | Ga0501032_0049366_1571_2437 | 288 |
| 2173 | 3300049570 | Ga0501033_0000724 | Ga0501033_0000724_28156_29058 | 288 |
| 2174 | 3300049570 | Ga0501033_0004494 | Ga0501033_0004494_1788_2681 | 288 |
| 2175 | 3300049570 | Ga0501033_0004740 | Ga0501033_0004740_9348_10214 | 288 |
| 2176 | 3300049570 | Ga0501033_0038006 | Ga0501033_0038006_49_951 | 288 |
| 2177 | 3300049570 | Ga0501033_0090768 | Ga0501033_0090768_778_1671 | 288 |
| 2178 | 3300049570 | Ga0501033_0091683 | Ga0501033_0091683_669_1535 | 288 |
| 2179 | 3300049570 | Ga0501033_0259434 | Ga0501033_0259434_220_1086 | 288 |
| 2180 | 3300049570 | Ga0501033_0265378 | Ga0501033_0265378_152_1054 | 288 |
| 2181 | 3300049571 | Ga0501034_0000332 | Ga0501034_0000332_64784_65686 | 288 |
| 2182 | 3300049571 | Ga0501034_0000413 | Ga0501034_0000413_66015_66887 | 288 |
| 2183 | 3300049571 | Ga0501034_0046250 | Ga0501034_0046250_518_1384 | 288 |
| 2184 | 3300049571 | Ga0501034_0087844 | Ga0501034_0087844_419_1321 | 288 |
| 2185 | 3300049571 | Ga0501034_0133323 | Ga0501034_0133323_686_1552 | 288 |
| 2186 | 3300049571 | Ga0501034_0163752 | Ga0501034_0163752_1029_1931 | 288 |
| 2187 | 3300049571 | Ga0501034_0184492 | Ga0501034_0184492_263_1156 | 288 |
| 2188 | 3300049571 | Ga0501034_0291310 | Ga0501034_0291310_693_1559 | 288 |
| 2189 | 3300049571 | Ga0501034_0294452 | Ga0501034_0294452_403_1308 | 288 |
| 2190 | 3300049571 | Ga0501034_0409243 | Ga0501034_0409243_383_1249 | 288 |
| 2191 | 3300049572 | Ga0501036_0000233 | Ga0501036_0000233_28156_29058 | 288 |
| 2192 | 3300049572 | Ga0501036_0019618 | Ga0501036_0019618_1837_2730 | 288 |
| 2193 | 3300049572 | Ga0501036_0056239 | Ga0501036_0056239_944_1846 | 288 |
| 2194 | 3300049573 | Ga0501037_0000242 | Ga0501037_0000242_32867_33733 | 288 |
| 2195 | 3300049573 | Ga0501037_0000421 | Ga0501037_0000421_5717_6619 | 288 |
| 2196 | 3300049573 | Ga0501037_0001825 | Ga0501037_0001825_1914_2807 | 288 |
| 2197 | 3300049573 | Ga0501037_0144712 | Ga0501037_0144712_499_1401 | 288 |
| 2198 | 3300049573 | Ga0501037_0180980 | Ga0501037_0180980_263_1129 | 288 |
| 2199 | 3300049574 | Ga0501038_0000049 | Ga0501038_0000049_25456_26358 | 288 |
| 2200 | 3300049574 | Ga0501038_0006856 | Ga0501038_0006856_8373_9266 | 288 |
| 2201 | 3300049574 | Ga0501038_0097772 | Ga0501038_0097772_748_1614 | 288 |
| 2202 | 3300049574 | Ga0501038_0152963 | Ga0501038_0152963_867_1733 | 288 |
| 2203 | 3300049575 | Ga0501039_0002402 | Ga0501039_0002402_7995_8897 | 288 |
| 2204 | 3300049575 | Ga0501039_0142671 | Ga0501039_0142671_648_1514 | 288 |
| 2205 | 3300049579 | Ga0501043_0000440 | Ga0501043_0000440_3390_4256 | 288 |
| 2206 | 3300049579 | Ga0501043_0000740 | Ga0501043_0000740_19952_20854 | 288 |
| 2207 | 3300049579 | Ga0501043_0013981 | Ga0501043_0013981_5165_6058 | 288 |
| 2208 | 3300049579 | Ga0501043_0115632 | Ga0501043_0115632_639_1541 | 288 |
| 2209 | 3300049579 | Ga0501043_0186067 | Ga0501043_0186067_103_969 | 288 |
| 2210 | 3300049579 | Ga0501043_0227759 | Ga0501043_0227759_338_1240 | 288 |
| 2211 | 3300049580 | Ga0501046_0006266 | Ga0501046_0006266_3271_4164 | 288 |
| 2212 | 3300049580 | Ga0501046_0008083 | Ga0501046_0008083_5020_5922 | 288 |
| 2213 | 3300049580 | Ga0501046_0022355 | Ga0501046_0022355_649_1515 | 288 |
| 2214 | 3300049581 | Ga0501047_0000875 | Ga0501047_0000875_5028_5930 | 288 |
| 2215 | 3300049581 | Ga0501047_0005968 | Ga0501047_0005968_9289_10182 | 288 |
| 2216 | 3300049581 | Ga0501047_0009133 | Ga0501047_0009133_7952_8857 | 288 |
| 2217 | 3300049581 | Ga0501047_0031398 | Ga0501047_0031398_3920_4786 | 288 |
| 2218 | 3300049581 | Ga0501047_0160289 | Ga0501047_0160289_276_1178 | 288 |
| 2219 | 3300049581 | Ga0501047_0431125 | Ga0501047_0431125_56_943 | 288 |
| 2220 | 3300049581 | Ga0501047_0491545 | Ga0501047_0491545_61_927 | 288 |
| 2221 | 3300049582 | Ga0501048_0005053 | Ga0501048_0005053_5107_6009 | 288 |
| 2222 | 3300049582 | Ga0501048_0020879 | Ga0501048_0020879_2160_3026 | 288 |
| 2223 | 3300049582 | Ga0501048_0208119 | Ga0501048_0208119_332_1234 | 288 |
| 2224 | 3300049584 | Ga0501068_0029721 | Ga0501068_0029721_1772_2638 | 288 |
| 2225 | 3300049585 | Ga0501069_0000017 | Ga0501069_0000017_22021_22887 | 288 |
| 2226 | 3300049585 | Ga0501069_0021804 | Ga0501069_0021804_869_1771 | 288 |
| 2227 | 3300049585 | Ga0501069_0086231 | Ga0501069_0086231_227_1093 | 288 |
| 2228 | 3300049586 | Ga0501070_0007767 | Ga0501070_0007767_6172_7038 | 288 |
| 2229 | 3300049586 | Ga0501070_0010286 | Ga0501070_0010286_3177_4043 | 288 |
| 2230 | 3300049586 | Ga0501070_0025357 | Ga0501070_0025357_2417_3283 | 288 |
| 2231 | 3300049586 | Ga0501070_0027733 | Ga0501070_0027733_3666_4553 | 288 |
| 2232 | 3300049586 | Ga0501070_0127996 | Ga0501070_0127996_1023_1889 | 288 |
| 2233 | 3300049586 | Ga0501070_0235240 | Ga0501070_0235240_169_1035 | 288 |
| 2234 | 3300049587 | Ga0501071_0031427 | Ga0501071_0031427_44_910 | 288 |
| 2235 | 3300049588 | Ga0501072_0054390 | Ga0501072_0054390_2152_3054 | 288 |
| 2236 | 3300049588 | Ga0501072_0197180 | Ga0501072_0197180_183_1085 | 288 |
| 2237 | 3300049589 | Ga0501073_0000112 | Ga0501073_0000112_48816_49718 | 288 |
| 2238 | 3300049589 | Ga0501073_0117617 | Ga0501073_0117617_592_1458 | 288 |
| 2239 | 3300049590 | Ga0501074_0000610 | Ga0501074_0000610_8267_9133 | 288 |
| 2240 | 3300049590 | Ga0501074_0006273 | Ga0501074_0006273_1889_2791 | 288 |
| 2241 | 3300049590 | Ga0501074_0120179 | Ga0501074_0120179_576_1442 | 288 |
| 2242 | 3300049705 | Ga0501225_0017431 | Ga0501225_0017431_724_1614 | 288 |
| 2243 | 3300049741 | Ga0501079_0003748 | Ga0501079_0003748_9933_10835 | 288 |
| 2244 | 3300049742 | Ga0501080_0000343 | Ga0501080_0000343_31772_32674 | 288 |
| 2245 | 3300049742 | Ga0501080_0006075 | Ga0501080_0006075_9519_10385 | 288 |
| 2246 | 3300049742 | Ga0501080_0177732 | Ga0501080_0177732_193_1059 | 288 |
| 2247 | 3300049744 | Ga0501083_0000724 | Ga0501083_0000724_8940_9842 | 288 |
| 2248 | 3300049744 | Ga0501083_0003168 | Ga0501083_0003168_4604_5470 | 288 |
| 2249 | 3300049759 | Ga0501262_000189 | Ga0501262_000189_1871_2761 | 288 |
| 2250 | 3300049776 | Ga0501280_000460 | Ga0501280_000460_728_1597 | 288 |
| 2251 | 3300049822 | Ga0501035_0000101 | Ga0501035_0000101_33209_34075 | 288 |
| 2252 | 3300049822 | Ga0501035_0001854 | Ga0501035_0001854_2879_3781 | 288 |
| 2253 | 3300049822 | Ga0501035_0003169 | Ga0501035_0003169_14218_15084 | 288 |
| 2254 | 3300049822 | Ga0501035_0018035 | Ga0501035_0018035_4324_5190 | 288 |
| 2255 | 3300049822 | Ga0501035_0296486 | Ga0501035_0296486_78_944 | 288 |
| 2256 | 3300049822 | Ga0501035_0343325 | Ga0501035_0343325_215_1081 | 288 |
| 2257 | 3300049823 | Ga0501044_0000010 | Ga0501044_0000010_166803_167669 | 288 |
| 2258 | 3300049823 | Ga0501044_0000182 | Ga0501044_0000182_15348_16250 | 288 |
| 2259 | 3300049823 | Ga0501044_0000916 | Ga0501044_0000916_4620_5513 | 288 |
| 2260 | 3300049823 | Ga0501044_0025590 | Ga0501044_0025590_5046_5948 | 288 |
| 2261 | 3300049823 | Ga0501044_0063871 | Ga0501044_0063871_175_1041 | 288 |
| 2262 | 3300049823 | Ga0501044_0096823 | Ga0501044_0096823_1383_2249 | 288 |
| 2263 | 3300049823 | Ga0501044_0115924 | Ga0501044_0115924_683_1549 | 288 |
| 2264 | 3300049823 | Ga0501044_0133026 | Ga0501044_0133026_197_1084 | 288 |
| 2265 | 3300049823 | Ga0501044_0321189 | Ga0501044_0321189_19_921 | 288 |
| 2266 | 3300049824 | Ga0501045_0086916 | Ga0501045_0086916_1258_2160 | 288 |
| 2267 | 3300049824 | Ga0501045_0230577 | Ga0501045_0230577_368_1234 | 288 |
| 2268 | 3300050489 | nmdc:mga03683_33107_c1 | nmdc:mga03683_33107_c1_64_966 | 288 |
| 2269 | 3300050491 | nmdc:mga00v17_104836_c1 | nmdc:mga00v17_104836_c1_590_1564 | 288 |
| 2270 | 3300050491 | nmdc:mga00v17_115762_c1 | nmdc:mga00v17_115762_c1_607_1497 | 288 |
| 2271 | 3300050491 | nmdc:mga00v17_50950_c1 | nmdc:mga00v17_50950_c1_448_1350 | 288 |
| 2272 | 3300050492 | nmdc:mga0yw44_3131_c1 | nmdc:mga0yw44_3131_c1_5815_6717 | 288 |
| 2273 | 3300050492 | nmdc:mga0yw44_34788_c1 | nmdc:mga0yw44_34788_c1_903_1877 | 288 |
| 2274 | 3300050492 | nmdc:mga0yw44_4219_c1 | nmdc:mga0yw44_4219_c1_2289_3191 | 288 |
| 2275 | 3300050492 | nmdc:mga0yw44_43205_c1 | nmdc:mga0yw44_43205_c1_249_1151 | 288 |
| 2276 | 3300050493 | nmdc:mga0k408_13536_c2 | nmdc:mga0k408_13536_c2_821_1711 | 288 |
| 2277 | 3300050493 | nmdc:mga0k408_214466_c1 | nmdc:mga0k408_214466_c1_105_992 | 288 |
| 2278 | 3300050493 | nmdc:mga0k408_223182_c1 | nmdc:mga0k408_223182_c1_153_1043 | 288 |
| 2279 | 3300050493 | nmdc:mga0k408_61822_c1 | nmdc:mga0k408_61822_c1_1018_1992 | 288 |
| 2280 | 3300050494 | nmdc:mga06z11_77649_c1 | nmdc:mga06z11_77649_c1_344_1246 | 288 |
| 2281 | 3300050495 | nmdc:mga04h51_2456_c1 | nmdc:mga04h51_2456_c1_3253_4122 | 288 |
| 2282 | 3300050495 | nmdc:mga04h51_26269_c1 | nmdc:mga04h51_26269_c1_544_1518 | 288 |
| 2283 | 3300050496 | nmdc:mga07m45_127312_c1 | nmdc:mga07m45_127312_c1_134_1036 | 288 |
| 2284 | 3300050496 | nmdc:mga07m45_2857_c1 | nmdc:mga07m45_2857_c1_5530_6420 | 288 |
| 2285 | 3300050496 | nmdc:mga07m45_32439_c1 | nmdc:mga07m45_32439_c1_775_1665 | 288 |
| 2286 | 3300050496 | nmdc:mga07m45_700_c1 | nmdc:mga07m45_700_c1_11657_12547 | 288 |
| 2287 | 3300050507 | nmdc:mga05p37_510010_c1 | nmdc:mga05p37_510010_c1_173_1075 | 288 |
| 2288 | 3300050515 | nmdc:mga0a205_269570_c1 | nmdc:mga0a205_269570_c1_101_1003 | 288 |
| 2289 | 3300050516 | nmdc:mga0sz30_13236_c1 | nmdc:mga0sz30_13236_c1_2014_2916 | 288 |
| 2290 | 3300050516 | nmdc:mga0sz30_1854_c1 | nmdc:mga0sz30_1854_c1_2752_3654 | 288 |
| 2291 | 3300050516 | nmdc:mga0sz30_20265_c1 | nmdc:mga0sz30_20265_c1_1304_2278 | 288 |
| 2292 | 3300053077 | Ga0495601_0100329 | Ga0495601_0100329_699_1601 | 288 |
| 2293 | 3300053077 | Ga0495601_0137133 | Ga0495601_0137133_409_1311 | 288 |
| 2294 | 3300053077 | Ga0495601_0225575 | Ga0495601_0225575_260_1162 | 288 |
| 2295 | 3300053080 | Ga0500635_0005930 | Ga0500635_0005930_2259_3161 | 288 |
| 2296 | 3300053084 | Ga0495595_0000394 | Ga0495595_0000394_8622_9524 | 288 |
| 2297 | 3300053084 | Ga0495595_0043698 | Ga0495595_0043698_396_1298 | 288 |
| 2298 | 3300053085 | Ga0495619_0001260 | Ga0495619_0001260_6211_7113 | 288 |
| 2299 | 3300053085 | Ga0495619_0075414 | Ga0495619_0075414_1259_2161 | 288 |
| 2300 | 3300053086 | Ga0500578_0077167 | Ga0500578_0077167_1165_2067 | 288 |
| 2301 | 3300053086 | Ga0500578_0088708 | Ga0500578_0088708_437_1411 | 288 |
| 2302 | 3300053087 | Ga0500643_000042 | Ga0500643_000042_117720_118622 | 288 |
| 2303 | 3300053089 | Ga0500581_016873 | Ga0500581_016873_2715_3620 | 288 |
| 2304 | 3300053093 | Ga0500651_0000751 | Ga0500651_0000751_7036_7938 | 288 |
| 2305 | 3300053093 | Ga0500651_0030895 | Ga0500651_0030895_2044_2949 | 288 |
| 2306 | 3300053093 | Ga0500651_0039450 | Ga0500651_0039450_208_1110 | 288 |
| 2307 | 3300053094 | Ga0500566_0000621 | Ga0500566_0000621_4075_4977 | 288 |
| 2308 | 3300053094 | Ga0500566_0005911 | Ga0500566_0005911_4686_5591 | 288 |
| 2309 | 3300053094 | Ga0500566_0005990 | Ga0500566_0005990_920_1822 | 288 |
| 2310 | 3300053094 | Ga0500566_0007233 | Ga0500566_0007233_885_1787 | 288 |
| 2311 | 3300053102 | Ga0500554_024840 | Ga0500554_024840_598_1500 | 288 |
| 2312 | 3300053103 | Ga0500555_007469 | Ga0500555_007469_2101_3003 | 288 |
| 2313 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_127547_128452 | 288 |
| 2314 | 3300053104 | Ga0500556_0001028 | Ga0500556_0001028_1271_2176 | 288 |
| 2315 | 3300053105 | Ga0500557_000006 | Ga0500557_000006_36261_37163 | 288 |
| 2316 | 3300053108 | Ga0500562_010400 | Ga0500562_010400_311_1213 | 288 |
| 2317 | 3300053108 | Ga0500562_015423 | Ga0500562_015423_663_1568 | 288 |
| 2318 | 3300053109 | Ga0500569_016776 | Ga0500569_016776_16_921 | 288 |
| 2319 | 3300053109 | Ga0500569_064462 | Ga0500569_064462_32_1006 | 288 |
| 2320 | 3300053111 | Ga0500572_000226 | Ga0500572_000226_105_1007 | 288 |
| 2321 | 3300053111 | Ga0500572_006955 | Ga0500572_006955_736_1602 | 288 |
| 2322 | 3300053116 | Ga0500592_000296 | Ga0500592_000296_2268_3173 | 288 |
| 2323 | 3300053119 | Ga0500595_009264 | Ga0500595_009264_729_1631 | 288 |
| 2324 | 3300053119 | Ga0500595_013051 | Ga0500595_013051_900_1805 | 288 |
| 2325 | 3300053119 | Ga0500595_026070 | Ga0500595_026070_1001_1903 | 288 |
| 2326 | 3300053122 | Ga0500608_003307 | Ga0500608_003307_2336_3241 | 288 |
| 2327 | 3300053122 | Ga0500608_048783 | Ga0500608_048783_735_1601 | 288 |
| 2328 | 3300053125 | Ga0500618_000025 | Ga0500618_000025_64618_65487 | 288 |
| 2329 | 3300053125 | Ga0500618_007682 | Ga0500618_007682_1129_2034 | 288 |
| 2330 | 3300053130 | Ga0500642_0000110 | Ga0500642_0000110_8301_9206 | 288 |
| 2331 | 3300053130 | Ga0500642_0000686 | Ga0500642_0000686_6948_7850 | 288 |
| 2332 | 3300053130 | Ga0500642_0003964 | Ga0500642_0003964_2695_3579 | 288 |
| 2333 | 3300053131 | Ga0500652_013163 | Ga0500652_013163_603_1508 | 288 |
| 2334 | 3300053131 | Ga0500652_136860 | Ga0500652_136860_105_974 | 288 |
| 2335 | 3300053134 | Ga0500658_0036906 | Ga0500658_0036906_480_1382 | 288 |
| 2336 | 3300053136 | Ga0500559_0000198 | Ga0500559_0000198_22312_23217 | 288 |
| 2337 | 3300053136 | Ga0500559_0005770 | Ga0500559_0005770_507_1409 | 288 |
| 2338 | 3300053136 | Ga0500559_0009515 | Ga0500559_0009515_1148_2050 | 288 |
| 2339 | 3300053136 | Ga0500559_0052706 | Ga0500559_0052706_48_950 | 288 |
| 2340 | 3300053136 | Ga0500559_0068411 | Ga0500559_0068411_225_1127 | 288 |
| 2341 | 3300053136 | Ga0500559_0073163 | Ga0500559_0073163_541_1443 | 288 |
| 2342 | 3300053139 | Ga0500568_0000262 | Ga0500568_0000262_22835_23701 | 288 |
| 2343 | 3300053139 | Ga0500568_0001410 | Ga0500568_0001410_2613_3518 | 288 |
| 2344 | 3300053139 | Ga0500568_0009265 | Ga0500568_0009265_3585_4490 | 288 |
| 2345 | 3300053139 | Ga0500568_0090095 | Ga0500568_0090095_227_1129 | 288 |
| 2346 | 3300053139 | Ga0500568_0104083 | Ga0500568_0104083_11_913 | 288 |
| 2347 | 3300053145 | Ga0500586_001269 | Ga0500586_001269_3267_4169 | 288 |
| 2348 | 3300053148 | Ga0500590_054917 | Ga0500590_054917_353_1255 | 288 |
| 2349 | 3300053150 | Ga0500603_001570 | Ga0500603_001570_591_1493 | 288 |
| 2350 | 3300053151 | Ga0500604_0009060 | Ga0500604_0009060_1155_2060 | 288 |
| 2351 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_261295_262200 | 288 |
| 2352 | 3300053156 | Ga0500622_0000647 | Ga0500622_0000647_29486_30352 | 288 |
| 2353 | 3300053156 | Ga0500622_0001402 | Ga0500622_0001402_6826_7692 | 288 |
| 2354 | 3300053156 | Ga0500622_0006944 | Ga0500622_0006944_19_993 | 288 |
| 2355 | 3300053156 | Ga0500622_0011016 | Ga0500622_0011016_2931_3836 | 288 |
| 2356 | 3300053156 | Ga0500622_0020165 | Ga0500622_0020165_2498_3400 | 288 |
| 2357 | 3300053159 | Ga0500630_002647 | Ga0500630_002647_559_1461 | 288 |
| 2358 | 3300053161 | Ga0500634_0103553 | Ga0500634_0103553_194_1096 | 288 |
| 2359 | 3300053162 | Ga0500638_046459 | Ga0500638_046459_313_1215 | 288 |
| 2360 | 3300053163 | Ga0500639_000029 | Ga0500639_000029_55300_56202 | 288 |
| 2361 | 3300053177 | Ga0500636_0000009 | Ga0500636_0000009_135426_136292 | 288 |
| 2362 | 3300053177 | Ga0500636_0000711 | Ga0500636_0000711_16716_17621 | 288 |
| 2363 | 3300053177 | Ga0500636_0100958 | Ga0500636_0100958_731_1597 | 288 |
| 2364 | 3300053177 | Ga0500636_0130136 | Ga0500636_0130136_164_1066 | 288 |
| 2365 | 3300053178 | Ga0500637_0000707 | Ga0500637_0000707_2383_3285 | 288 |
| 2366 | 3300053178 | Ga0500637_0078591 | Ga0500637_0078591_395_1297 | 288 |
| 2367 | 3300053178 | Ga0500637_0084706 | Ga0500637_0084706_763_1668 | 288 |
| 2368 | 3300053178 | Ga0500637_0129457 | Ga0500637_0129457_203_1105 | 288 |
| 2369 | 3300053729 | Ga0500625_000351 | Ga0500625_000351_10195_11097 | 288 |
| 2370 | 3300053730 | Ga0500645_012656 | Ga0500645_012656_598_1500 | 288 |
| 2371 | 3300053730 | Ga0500645_039130 | Ga0500645_039130_453_1358 | 288 |
| 2372 | 3300053731 | Ga0500609_002203 | Ga0500609_002203_1259_2233 | 288 |
| 2373 | 3300053731 | Ga0500609_006122 | Ga0500609_006122_522_1424 | 288 |
| 2374 | 3300053735 | Ga0500596_005177 | Ga0500596_005177_429_1331 | 288 |
| 2375 | 3300053737 | Ga0500601_001469 | Ga0500601_001469_124_1026 | 288 |
| 2376 | 3300054114 | Ga0501084_0041419 | Ga0501084_0041419_975_1877 | 288 |
| 2377 | 3300055283 | Ga0500661_009777 | Ga0500661_009777_267_1169 | 288 |
| 2378 | 3300059423 | Ga0590074_025951 | Ga0590074_025951_28_915 | 288 |
| 2379 | 3300059426 | Ga0590077_031064 | Ga0590077_031064_259_1146 | 288 |
| 2380 | 3300060353 | Ga0501082_0002561 | Ga0501082_0002561_12007_12909 | 288 |
| 2381 | 3300060353 | Ga0501082_0233918 | Ga0501082_0233918_658_1524 | 288 |
| 2382 | 3300060353 | Ga0501082_0253642 | Ga0501082_0253642_198_1100 | 288 |
| 2383 | 3300060353 | Ga0501082_0477300 | Ga0501082_0477300_54_956 | 288 |
| 2384 | 3300061719 | Ga0466962_0005798 | Ga0466962_0005798_3758_4645 | 288 |
| 2385 | 3300061719 | Ga0466962_0027799 | Ga0466962_0027799_161_1063 | 288 |
| 2386 | iso_pu_bacteria | 2885080285 | 2885082572 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
85
289
0.92
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8756 | 49 | 277 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.8462 | 49 | 274 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8312 | 52 | 277 |
| 3pv0-assembly1.cif.gz_F | crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide | 0.8291 | 51 | 276 |
| 2r6g-assembly1.cif.gz_F | the crystal structure of the e. coli maltose transporter | 0.8228 | 49 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9169 | 46 | 283 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9066 | 46 | 285 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9024 | 46 | 283 | 1.10.3720.10 |
| af_P10905_52_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8959 | 46 | 283 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8919 | 46 | 279 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529SKP8-F1-model_v4 | Sugar ABC transporter permease | 0.9842 | 62 | 224 |
GO:0005886
GO:0055085 |
| AF-A0A529SKP8-F1-model_v4 | Sugar ABC transporter permease | 0.9724 | 62 | 224 |
GO:0005886
GO:0055085 |
| AF-A0A434FWY4-F1-model_v4 | Sugar ABC transporter permease | 0.9453 | 68 | 288 |
GO:0005886
GO:0055085 |
| AF-A0A434FWY4-F1-model_v4 | Sugar ABC transporter permease | 0.9412 | 68 | 288 |
GO:0005886
GO:0055085 |
| AF-A0A4Q6F296-F1-model_v4 | deleted | 0.9393 | 88 | 288 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar